1U54B

Crystal structures of the phosphorylated and unphosphorylated kinase domains of the cdc42-associated tyrosine kinase ack1 bound to amp-pcp
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
272
structure length
261
Chain Sequence
LTCLIGEKDLRLLEKLGDGVVRRGEWDAPSGKTVSVAVKCLEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of the Phosphorylated and Unphosphorylated Kinase Domains of the Cdc42-associated Tyrosine Kinase ACK1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Activated CDC42 kinase 1
total genus 77
structure length 261
sequence length 272
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2004-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1u54B02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1u54B01
4ITJA 3SV0A 1WBNA 5EYMA 4CYIA 3EN5A 3TEIA 4EK6A 3MY0A 1H0VA 5AP4A 4WRGA 1PRYA 4XG4A 1G8SA 3OVVA 2HZ4A 2Q0NA 3DB8A 5HLWA 4F0FA 4RIYB 5CXZA 2PMNX 3V5PA 4NL0A 4FYOA 1W82A 4QMUA 3MVJA 4DH7A 4ZMFA 4FT5A 2IJMA 4WT6A 2P2IA 3GU6A 5JRQA 2VX1A 3OWPA 3VIDA 2J90A 3CS9A 4FKLA 4FKPA 4XG2A 2QKWB 3VQUA 3BWFA 2AC3A 5HCYA 3ZFYA 4XP3A 2VO7A 3MIYA 5AUTA 2RGPA 5BVNA 1RQQA 5JGBA 2RL5A 4F7LA 2WHBA 1B38A 3QHWA 4IDTA 4OTWA 4IVCA 4I22A 5DR6A 3ODZX 4QO9A 4F7NA 5DGZA 2Z7RA 1Q97A 2WTCA 5KBQA 4GT3A 4ARKA 2X6EA 2JAVA 2JDVA 4PUZA 2P3GX 4O83A 3QCSA 4BICA 5C27A 5CF5A 3SXSA 4DTAA 2F2CB 4FUXA 1H08A 4U97A 2CKOA 3FQEA 2X7FA 2YISA 3VVHA 3RM6A 3A7FA 4YO6A 3SX9A 4O7LA 1SM2A 4HZRA 4FUYA 3FQSA 4U42A 2VTQA 3DKFA 3R2YA 3AGLA 3R1QA 2CJMA 4OTFA 4FTOA 5GJGA 3DLZA 4IFGA 4UWCA 1UNHA 4JBVA 4QMZA 2SRCA 3KXNA 5HG7A 4YLKA 4FTTA 5M53A 5BUIA 2WD1A 2UW8A 1KOBA 4QTDA 5CENA 3G9LX 4L3LA 4DGGA 1YOJA 5L2SA 4N4SA 1CTPE 1ZOGA 5DLSA 3AT3A 4Y83A 4BHNA 4F65A 4I4EA 2PPQA 3QWJA 1GNGA 4KB8A 4U79A 3TWJA 4C02A 2BFYA 2QCSA 3EFJA 3QYWA 2JDSA 2Z7SA 4B7TA 1K3AA 4Q2AA 4BGQA 4CZYB 3L9NA 4GG7A 3TI1A 5EYCA 2VWIA 4CSVA 1M7QA 2OW3A 4FEQA 3PLSA 2V0DA 4CKIA 5KZ0A 1M52A 4BKZA 4R7HA 4DGOA 3C50A 3NR9A 4HVSA 3EZRA 2HENA 4U8ZA 3D0EA 4FKJA 3UVQA 3BQCA 4MBLA 3D2KA 4I3ZA 4P4CA 4MXZA 3KXXA 3HVCA 3SG9A 3NYVA 1PHKA 3GXLA 3PP0A 4I94A 1VR2A 3KULA 3UNZA 2BPMA 3UZTA 4RZWA 3HDMA 3I6WA 4YPSA 5K0XA 3F5XA 3KREA 3WF8A 3QYZA 3LCSA 2Q83A 4F99A 2EXMA 5C8MA 3C4CA 5KMLA 2ZV8A 5EYDA 5HO7A 2X9FA 4FODA 4F70A 4ENXA 1UVRA 2HWOA 2BAQA 3MFSA 4FKVA 4GJ3A 2NPQA 4HOKA 4ANSA 4DC2A 4QQTA 5AIKA 2FB8A 1JVPP 3EJ1A 4D4RA 2WMUA 5IUGA 1H25A 5JN2A 4MX9A 4O21A 4BTJA 3CPCA 3F5PA 5J8IA 4H1MA 2J0IA 3GFWA 2R4BA 3OWJA 3QTWA 2UVZA 4RJ5A 4YTHA 3ROCA 1H1PA 2WQBA 4HCUA 3NAXA 4QRCA 2ZB0A 1GAGA 1MP8A 3W2CA 1K2PA 2RSVA 2RFNA 4X6RA 2QODA 3TCPA 2YCRA 3I81A 3MH0A 3V51A 4BCQA 2A19B 5CSPA 5HD7A 4G1WA 4I6QA 3R9OA 4BWPA 3IPHA 4GVJA 2VTNA 2YHVA 3EMGA 2OH4A 1OI9A 3KGAA 2E9PA 3NZ0A 5D12A 5TO8A 4FL3A 3SQQA 4YO4A 1PYEA 2PUIA 4QMNA 2JD5A 2V62A 5KMNA 2C6EA 2W7XA 2J0KA 3EFLA 3MBLA 3A7HA 4NM5A 5B2LA 2XNMA 3DAKA 4JDIA 3TKUA 3BQRA 1BL7A 3TNWA 3H30A 2EB3A 3A60A 1KWPA 2JIVA 4ZS4A 3OT8A 4C8BA 5EG3A 5A54A 4YGAA 2OF4A 3DBQA 3ENMA 3SW4A 1M2QA 2I0YA 4OGRA 4RVMA 4F08A 3OD6X 5KX8A 4FV3A 1J91A 2C68A 4JAJA 4EL9A 3II5A 3C4FA 1O6LA 1UV5A 5DG5A 4M3QA 1BI7A 3A4PA 5AA9A 4NW6A 4CZTA 3H4JA 4FKSA 4ZY6A 4BRXA 2XJ2A 2CNUA 3CBLA 2PWLA 3ORTA 3AMYA 4FV2A 4J71A 1MRVA 4EEVA 5KBRA 4CCUA 5JQ5A 3S1HA 3FZSA 1OECA 2VO3A 4QP2A 1ERKA 1H24A 3KXZA 2BZKB 2J2IB 2PVRA 3HA6A 4C34A 4ZLZA 2ITUA 4QPAA 3GC0A 4EWQA 3PFQA 4DH5A 4GRBA 4JQ8A 2H96A 3ANQA 4NCTC 2VWBA 4DGMA 4FNZA 2J4ZA 4LRMA 4IM2A 5EOLA 3SOCA 3VBXA 2R3LA 4NJDA 3WF9A 5GJFA 2IPXA 4OTQA 3AC3A 5FD2A 4F1TA 1H00A 1PXOA 3LPBA 3FMEA 3MFRA 3NAYA 3O51A 3V04A 1KE6A 4CQGA 3AC4A 3P78A 4TWCA 3QCYA 5CVFA 2C0IA 2ITWA 4FIFA 2HZNA 2XYUA 3E62A 5L2WA 4ITHA 3DTWA 4MNEB 2WTVA 4L00A 3MWUA 3Q5ZA 3Q9XA 2WOUA 4A4XA 4EH7A 5CF8A 3RK9A 3TV4A 3W2RA 3FMJA 1UWHA 2GQGA 4BCOA 3EQDA 3HEGA 3U4UA 3QL8A 5LCJA 4U81A 4IB5A 5AV4A 2E9NA 3OXTA 3Q04A 4F6UA 2B7AA 3D5WA 3NWWA 2JDTA 3PSCA 5EDQA 1IRKA 3I6UA 2BKKA 5H9BA 4FTKA 4DG2E 3Q2MA 4EK5A 2EWAA 3GB2A 4BDJA 4YSJA 2ZB1A 3E7OA 2WMQA 3OMVA 4V04A 4B6LA 2CGVA 3D7ZA 4O0VA 4W4WA 4YMJA 4USEA 1Y6BA 2Y4PA 3H0ZA 4AW1A 5M44A 1UU9A 4DITA 3MN3A 5LJJA 4BKYA 4BR3A 3L8VA 3ZOSA 1YWRA 4WRSA 4F64A 2XNBA 4IAIA 4EK8A 2H34A 4CTCA 3GUBA 3ORMA 4OTGA 5EOBA 5B0XA 3WF7A 4EQUA 4FOBA 4XLVA 1PJKA 4PL5A 3UVRA 2C3LA 3GVUA 1YHWA 5FXRA 4EH9A 1W83A 2ITZA 5HIEA 4J95A 3OT3A 1LUFA 2YDJA 3BGZA 3OXZA 4ZTRA 5CEMA 4C4JA 1W8CA 4PPAA 3UBDA 2B53A 2OFVA 3FSFA 4IANA 3VUDA 2F7XE 4FMQA 3R9DA 5IPJA 3JPVA 4J97A 3ZSHA 2OZOA 3BPRA 3C9WA 3NLBA 4KIOA 4QYFA 4BC6A 4U41A 4KBKA 4DFLA 3NYOA 3MFTA 4DEBA 5I3RA 3MVHA 4OTHA 3ZSIA 4GJ2A 1J1CA 2R3RA 1YXVA 3RCDA 5F9EA 2VWXA 4UWBA 4WBOA 4AA0A 1GJOA 3PDTA 2QLQA 4AZWA 1H27A 4BDAA 4DFYA 5K5NA 3GI3A 2RG6A 1IAHA 4ACGA 1OIQA 3FWQA 2HY81 3DZOA 4HGEA 4Q5HA 3DXQA 5J9YA 2JC6A 3BLRA 3VS7A 3GC7A 2NRUA 3FKLA 1FINA 4WSYA 4DFUA 4JI9A 3NNWA 5ANGA 4F0IA 3E92A 5IQAA 3AD4A 3ZO1A 4K2RA 4DGNA 3R1YA 1BLXA 1OPLA 1WZYA 3DS6A 3F3VA 4K0YA 4UYAA 4KNBA 1L3RE 2PMLX 5GNKA 3W16A 4DLIA 3DJ7A 4EUUA 5JGAA 3F66A 3ACJA 3HRCA 4QMXA 5AR7A 5FLFA 4KKEA 4IAAA 3DKOA 5A4EA 4QP1A 3PPJA 5L3AA 1SMHA 4FV5A 5AX9A 3AGMA 1UU7A 3QWKA 3T9IA 3ZEWA 3TUDA 3LKMA 4FE2A 2J0MB 4KS8A 3UYSA 2WZJA 4FEUA 1UNGA 3HP5A 5AP3A 4IACA 4UMTA 1GIHA 5HI2A 3KRRA 4H39A 2UV2A 3KB7A 2DYLA 2WTKC 1GZOA 3PRIA 4LGDA 3W2SA 4N57A 3EFWA 4B9DA 3ZRLA 2W1CA 5E8SA 3MSSA 4MD9E 2HZIA 1XO2B 1PMEA 4L43A 3CPBA 4EH2A 3QQJA 4EH3A 2WQMA 2QOOA 5IG1A 5EHYA 5HVYA 2X2LA 5KCVA 2XRWA 3NUXA 4O7SA 2OWBA 2QU5A 3BYOA 4V01A 4FKRA 2CKQA 3UTOA 5IQGA 5ETAA 3T3UA 4KSPA 4IWOA 4Y5QA 3KXMA 3MB6A 4GCJA 1J7LA 3O96A 3GP0A 3OY3A 5HLPA 2UZVA 4R3PA 3ZEPA 1E1VA 5HE0A 2Y4IB 4O7TA 4AFEA 2EU9A 3HV3A 4AN3A 2IVVA 2OJFE 3MDYA 3HRFA 3MB7A 4DINA 4E7WA 3FXXA 5EM8A 3BE2A 4V0GA 5I9ZA 4EOLA 4MBIA 2WO6A 3H3CA 4AP7A 3A8WA 3WBLA 3DPKA 2HY0A 3NW5A 3N4TA 4QTAA 3V8SA 3D5UA 1A48A 2XIKA 4ZY4A 4R5SA 3ZDUA 2E9VA 3H9OA 4FKOA 4JDHA 1Q8WA 4AAAA 3NRMA 4BZOA 4D2PA 4H58A 1YDRE 2RG5A 3SOAA 5HTBA 4HVHA 3DGKA 3CJFA 4JBPA 3ZLWA 4FKGA 4XEYA 3RINA 5HVKA 5LOHA 4GL9A 4HW7A 3ZDIA 3W1FA 1WFCA 3HV4A 3VRYA 3GCVA 5J87A 3TV7A 5KNJA 4WKQA 5F94A 3RHXA 3UC3A 4KSQA 4YTIA 2BRNA 3COKA 3TUBA 3BYVA 5ICPA 1ZZLA 3KF7A 3BYUA 5K9IA 4ZTNA 2OXYA 5EW3A 5IEXA 1CSNA 3L9MA 4C33A 3O7LB 4GFMA 2GU8A 1R39A 1PW2A 2NP8A 2WMRA 2XNGA 5EH0A 4D1XA 4OUCA 4ZSEA 3VBYA 4PP9A 2B54A 3C5IA 2BMCA 5M06A 3KMMA 3E8EA 2IVTA 4HNFA 3ERKA 4XG8A 5HNBA 4XRJA 3UZRA 3A7GA 3R7VA 4CLJA 4QP3A 5BQ0A 2JEDA 4WBBB 4PMSA 4EZ7A 5DVRA 4HYHA 3E8CA 3Q4UA 5EM7A 1H26A 5K5XA 4I5MA 3AT2A 5LWNA 5K3YA 2ITPA 3AC8A 1DAYA 5AIRA 3QRIA 4AT5A 4JDJA 4DFBA 1IR3A 2YM3A 3BU3A 4BZDA 4L6QA 3VBTA 3WF5A 3FLWA 5HNGA 3D4QA 3KK8A 4DH8A 4RX9A 4BIEA 3EYGA 3DAEA 1B39A 2JIIA 2W5BA 4O0TA 2WTDA 4NW5A 1XH5A 3TKHA 3KMWA 3PXZA 2PSQA 4JG8A 4LM5A 3FXWA 5I5ZA 1R0EA 3HDNA 2YIQA 4D4SA 2AUHA 4LI5A 4ASZA 4P5ZA 5KMIA 3EQBA 2IW6A 4FV8A 3ZO2A 3FJQE 2XNNA 4Q9SA 3NS9A 5CLPA 4ACMA 4OBPA 2ZJWA 4MYGA 4QMOA 3UIBA 1SVHA 4PNKA 5LVMA 2GFSA 2VAGA 2WTIA 2P0CA 4GUEA 4GT5A 3FY2A 4I6HA 5AP7A 5BVOA 4YZDA 3LOKA 1Q8UA 4UN0C 2X9EA 4X3FB 5AR2A 2Z60A 5BPYA 4O7VA 3LM5A 1OBGA 3ZS5A 2IWIA 4GKHA 3UNKA 2B9IA 4E5WA 3LXPA 4M66A 5DE2A 1KV2A 2WMVA 3KXHA 2XK8A 3OUNB 3PE1A 4RX7A 3ZCLA 4AG8A 4E6DA 2GQSA 5A4LA 4F6SA 5CEOA 4CG9A 2CGWA 3FL4A 1APME 2GFCA 3COMA 3PG1A 4YPDA 4ZTMA 5CALA 1WVWA 5IEVA 3MTLA 3PPKA 4H3PA 4FZ6A 4LUDA 3L8PA 1Q99A 4QMWA 4XRLA 2QR8A 3W2QA 4TYGA 4CKJA 4F0GA 4OAUC 4ACDA 3UNJA 1XQZA 4IB1A 1OKWA 1PYXA 1RE8A 3UG2A 4W8EA 1J7UA 1XR1A 3OCBA 2WB8A 3LFCA 4IFCA 4G9CA 4RLLA 3BBWA 4CCBA 4X2JA 3LXNA 4XV1A 1QCFA 3A99A 1E1XA 5AAEA 2VTHA 4J96A 1V0OA 4APPA 4EORA 2C0TA 1Q5KA 5IA4A 5KMKA 1YI3A 5CWZA 2W99B 1ATPE 1BX6A 3OXIA 1R1WA 3QCQA 2E9OA 4CFXA 5IA1A 5I9WA 2OJJA 2PZ5A 1DM2A 3DJ5A 3MA6A 4BBEA 1E9HA 3VS5A 3CGFA 5EM5A 4DCEA 3MFUA 4NIFB 4C7TA 4TL0A 2NNWB 3WZKA 1KE5A 1UU8A 1W84A 1MQ4A 2JDOA 3PY0A 1JSVA 1X8BA 4NUSA 3QRTA 4RJ3A 1TQPA 4PL3A 5E90A 2UZEA 5AV3A 4C3RA 3DDQA 2WTJA 4XG6A 3GQLA 3CQWA 4K11A 4PQNA 4BDFA 3TIYA 3CC6A 3IG7A 3HZTA 4U43A 2ETKA 2WGJA 5H8BA 2PULA 3TDVA 3DDPA 3GC8A 4I23A 4YJNA 3JUHA 4ERKA 4WO5A 3D5VA 4BCKA 3FLZA 5JFSA 2WOTA 3E64A 1REJA 5H8EA 2PVHA 4FK6A 2E9UA 3VWAA 1WBWA 2RIOA 4RZVA 3UVPA 3PPZA 2PE0A 4Q9ZA 4AZVA 4O0RA 5JK3A 2A1AB 3RGFA 3UDBA 3Q60A 1ZYDA 3ZSGA 2WAJA 4FA2A 2WMBA 2OJ9A 4MXCA 5M09A 3TNHA 5CAQA 3R22A 4ZSJA 2J0LA 5CX9A 3UO5A 4UALA 1VEBA 1PMVA 4Y72A 5A4QA 5EQPA 3EKNA 1H28A 2B55A 4JOAA 2ZMDA 4WNOA 3LXLA 2WMTA 2X7OA 4B8MA 3TJDA 4PNIA 3OC1A 4LRJA 4O27B 2C3KA 3GU7A 5AV1A 3V6RA 2IW8A 3FHRA 4O84A 4XG3A 3A4OX 5C01A 3WF6A 1DI9A 5E1EA 2BDWA 2VGOA 3QZFA 3AC1A 4U80A 3B8QA 4XH6A 5CU3A 5FBNC 3RCJA 1ZYCA 2G15A 5JZJA 2F49A 4MH7A 4NM7A 1PXPA 2WTKB 3LFQA 4FSZA 4JLCA 1OL2A 4QP4A 2VO0A 1XH7A 4S34A 4LV5A 5CY3A 4G6OA 2XK6A 4JIAA 3KQ7A 3OF0A 3PWDA 4U40A 3R8PA 4QMYA 3QKKA 3G2FA 3VW6A 3TJCA 2R3FA 2O64A 1BUHA 4GVAA 3D9VA 4LMNA 4UMQA 5DT3A 3BCEA 4P2KA 2W4KA 3F3WA 2WIHA 3DA6A 3VS2A 3E93A 3P9JA 2X2MA 2WXVA 5M56A 3GCSA 4MNEA 3WZUA 4CV9A 3TZMA 4C35A 3RAHA 3QLGA 4BWKA 1BL6A 3NEWA 4OTIA 3FQHA 1NY3A 2EXCX 2FH9A 3RAKA 5HKMA 4YJVA 1V0BA 3KL8A 3S3IA 4UMRA 1YOLA 1TVOA 2UW4A 2R2PA 3FMLA 3V3VA 5C03A 3BZ3A 4AN9A 3UOHA 3UODA 4EHVA 5CAOA 4YU2A 1Z57A 4U0IA 3RBWA 2GNLA 5I9UA 3TIZA 3W2PA 4BCIA 1OGUA 4GK2A 1ZARA 4EI4A 4TNBA 2X39A 1GY3A 2XRUA 2X1NA 4GH2A 2ZM3A 4I24A 2P4IA 1I44A 5I4NA 2W05A 1OL5A 4Y8DA 4HVIA 3FKNA 2R3NA 4HYSA 2XKDA 4MF1A 3RALA 3OROA 2QONA 3PP1A 4DCAA 2REIA 2BALA 1KSWA 1YDTE 2C69A 2C6DA 4D2RA 1BYGA 2YITA 3MY1A 4DT8A 4C4EA 5AADA 4IX5A 1XWSA 5CF6A 4AT3A 3QUDA 2R7IA 4X2GA 4A4LA 4M68A 5AMNA 3RJCA 4JBOA 1H07A 3K5UA 5ACBC 1FBNA 1G8AA 2OLCA 4AOTA 3Q96A 4GK3A 4NKAA 3R7OA 5AP1A 2VUWA 3O8UA 4HGLA 4RC2A 4IB0A 5EDPA 2PK9A 4N6YA 4BN1A 4IZ5A 3WIKA 2BRBA 2P2HA 5BUEA 4IMYA 3TNPC 4D4VA 4YZ9A 3R9HA 1Q8ZA 3TZ9A 4YUQA 3P4KA 5HD4A 5D41A 2C6MA 4AGUA 2QI8A 4CNHA 4L44A 4M69A 2OBJA 3OG7A 4G6LA 4AACA 5K4JA 4APCA 4R1YA 3GNIB 4DG0E 4ALWA 4NWMA 1YRPA 4KKGA 1FPUA 3NSZA 3QQKA 2C6KA 5IQBA 1Q41A 5IH4A 3SAYA 3G6HA 4TPTA 3MESA 4C59A 2YACA 2B9FA 2ZYBA 5IKWA 3N51A 3OCGA 4B0GA 2YIYA 3HL7A 2C5OA 4M13A 2BTRA 4QQ5A 2UW5A 2XIXA 3DQXA 3Q4TA 2UZDA 2ITTA 3ZC5A 4U9AA 1Y8GA 5DOSA 3FSKA 4ZTLA 4RIXA 4E4LA 3RAIA 3THBA 4MVFA 2YDKA 3H9RA 1ZAOA 3PXYA 3D94A 4G3FA 2ZV7A 4IAFA 3ZFXA 2XJ0A 3WE4A 2JKMA 1ZYSA 3QZHA 3QGWA 2PVJA 1PXMA 3FV8A 2Z7LA 5CI6A 1J3HA 4LRKA 4MAOA 4MXAA 5AR3A 5A14A 5TF9A 2PY3A 1GZKA 3ITZA 2ITYA 3P79A 3SDJA 4DEDA 5A4CA 3HV7A 5AP2A 5HE2A 3R83A 4TYJA 5F20A 3G51A 3PRFA 3F2AA 4FTIA 4Y95A 3G0FA 5A4TA 3K54A 3W8QA 2BIYA 2C5NA 3KXGA 4KBCA 2XK9A 3UC4A 2IG7A 5JFVA 1OIUA 4OT5A 3U8WA 1JKKA 5IA2A 3R9RA 4KABA 4PMPA 3R7IA 3LMGA 3FC1X 2V22A 3H10A 1PXNA 3QQGA 2X7GA 2BKZA 4F4PA 4Y85A 3LMHA 2HELA 2WU6A 3QC9A 4FC0A 3ALOA 5CANA 1R78A 2R7BA 3C13A 3ETAA 3V8TA 4TTHB 1CDKA 3FKOA 4FGBA 4E8AA 4S2ZA 3ZBXA 3IGOA 4EJNA 5AV2A 4G9RA 4CZUA 3HV6A 4QMVA 4O7ZA 5AUWA 4M14A 4D1ZA 2IZRA 4PDPA 3TTJA 2ETMA 4J52A 4QMLA 1OIYA 2JLDA 3O2MA 3FMNA 2X4FA 3QQLA 4FVRA 3QQHA 4IWPA 2NO3A 1NVQA 4FIGA 4E6AA 4QMQA 4DBXA 4BY9E 4NH1A 2KTYA 2QO9A 1R3CA 3ZLXA 3NUNA 4Y46A 4GMYA 4P90A 4AOJA 5GZ8A 5LMKA 4JS8A 3MA3A 4FNWA 3RPOA 3MTFA 1OL7A 3P7AA 3Q53A 3RI1A 4TWOA 2O0UA 4KBAA 5AUVA 4HVGA 4WIHA 4DTBA 4JG6A 4D0WA 4DN5A 5J7BA 4I6FA 4XV9A 4ZXTA 3TXOA 4XBUA 2C5VA 5AP5A 5HQ0A 3DU8A 2JKQA 3MVLA 5HO8A 3LLTA 3E3PA 2JBPA 5AUYA 3G90X 5M51A 3I5NA 3L9LA 1J7IA 3ZZWA 5FRIA 3BBTB 2PZPA 3ODYX 2QOKA 2B52A 1ZY5A 3FY0A 3ET7A 4TY1A 3LFAA 2CHLA 2J5EA 2XM8A 1BMKA 3LJ2A 3R00A 3HX4A 2W1GA 4AT4A 1PY5A 3A61A 4WG3A 5C26A 2XS0A 4QMPA 4YLLA 3ZLSA 3LVPA 2CN8A 4TYHA 4M12A 4EYJA 4YTCA 2YZLA 1Y91A 3P1AA 2BAJA 4ZP5A 3ZONA 2VNYA 3W18A 2YERA 2XEYA 3ZRMA 4IDVA 4HGSA 1U4DA 2XKFA 2ZAZA 4NJ3A 5IA5A 5IUHA 4FYNA 3F69A 5CYIA 5J95A 3CKWA 2P33A 3IW5A 4OTRA 5LVLA 5AEPA 3Q3BA 2I0HA 4GS6A 5D11A 1AGWA 4M69B 4H05A 3QRKA 1LEZA 1MRUA 1ZY4A 4FL2A 4MD8E 3FUPA 5L8LA 4OTDA 3I4BA 4LL0A 2J50A 4HCVA 3R73A 4L01A 3U87A 2CMWA 4YC3A 5LQFA 4CMOA 3QTRA 4R7IA 4G3CA 1PXIA 4MHAA 3LCDA 5CT7A 3FPQA 4RRVA 4A7CA 2R3KA 3P7CA 4BDCA 5J7HA 4DGLC 3F61A 4F9BA 3QD4A 5BVKA 1IAJA 2C6TA 2XVDA 3W2OA 2R3JA 3NNXA 4EOIA 4RFZA 4G6NA 4PPBA 4BGGA 3EYHA 2X8DA 3ATSA 1EH4A 3BU6A 2GS2A 3R04A 4K33A 3UQFA 4JDKA 4QPMA 4YSMA 3VAPA 1PMNA 1OPKA 3CR0A 3KA0A 2IW9A 2YEXA 3C4XA 4PX6A 3PY3A 3VW8A 1YHVA 2VWUA 2ZMCA 4G34A 4JAIA 5A9UA 4RQVA 4U45A 1AD5A 4ZY5A 3UPZA 2O8YA 3SGCA 2YAAA 3KEXA 5DR9A 2W4OA 2VZ6A 3VUGA 3FI8A 5LVPA 2JFMA 4AWIA 1P4FA 2DWBA 2P55A 4UWYA 4ASEA 4D2TA 3BGQA 4O2ZA 1DI8A 4ZEGA 2XZSA 2J9MA 1CMKE 4QTBA 4ORKA 4IADA 4RJ8A 5C4KA 4L45A 4FTLA 4F1MA 1Y57A 5GHVA 3HRBA 4AX8A 2GCDA 1NVRA 4FSQA 4YBJA 4C57A 4CT1A 1JKSA 4W4VA 5FBOA 4EBVA 2G2IA 5IQDA 3MIAA 4M67A 4OBQA 4S31A 2UZNA 3WYYA 4J53A 1ZMWA 2VTSA 4R8QA 5FWKK 1KV1A 5AJQA 5M55A 3LMIA 2W1EA 5BYZA 5AX3A 3SRVA 2VNWA 2JBOA 3MV5A 5BVWA 5K4IA 1LR4A 2OIDA 4ALUA 1HOWA 2QOQA 4C38A 5LWMA 2YABA 3IW6A 3Q6UA 5I3OA 3T9TA 4LFIA 1M2RA 3DFCB 4XG7A 5GIPE 4GYIA 3BX5A 2C3IB 4FOCA 2JITA 1LEWA 3FL5A 1NXKA 3BE9A 3VNTA 2WQNA 5IMEA 5FEQA 4EHZA 1UKHA 2VWZA 4TT7A 5C8NA 2OFUA 5L2IA 1JSUA 2C30A 4ALVA 2XKEA 1PF8A 4J7BA 4AZTA 4L9IA 5F4NA 2QLUA 4PY1A 5ETCA 4OBOA 3WYXA 2B1PA 3V5LA 3JVSA 4AN2A 3UIUA 4YJQA 5E8WA 4CD0A 1LP4A 2BIKB 2AYPA 4HPTE 3AD6A 3E8DA 1V1KA 2ACXA 3I7BA 3QKLA 3U6JA 2BILB 1BI8A 4YZBA 2EB2A 2RFDA 5HTIA 4C2WA 3VS4A 5C8KA 2VO6A 4PTCA 4CFNA 5CTPA 4ZTHA 3C7QA 1U5RA 1DS5A 4OLIA 4UV0A 3FC2A 2XF0A 3R8MA 2PVKA 3LM0A 3OBJA 4D1SA 1YDSE 4ID7A 4O1PA 4IAYA 4JT3A 4W4XA 3DBEA 1RJBA 2XMYA 2Y4IC 4G17A 4C58A 4D2VA 3SC1A 2PHKA 5L4QA 2CPKE 3F7ZA 3BGPA 2BZIB 2ZOQA 2XNPA 2ZV9A 4BIDA 4EOSA 4O7WA 4O7YA 2VTAA 2W1FA 5JT2A 5IQCA 1WMKA 3Q32A 1UKIA 3PIYA 4O7NA 2C6IA 3RZBA 1SNXA 2IVSA 2C5YA 3PWYA 5FM2A 4RX5A 3FAAA 5EQYA 3SHEA 2CNVA 3QU0A 3A62A 4DH1A 3CP9A 5D9HA 5JRSA 3DZQA 2C6OA 4UEUA 3OOGA 4XHKB 4R77A 4RWJA 4YNEA 4O6EA 3OZ6A 3FI3A 4ZZOA 1KE8A 4DTKA 2Z7QA 3EL8A 1FQ1B 5GJDA 4V05A 3DV3A 3QF9A 3BEGA 5CU4A 4XOYA 2R3IA 1G5SA 2CLQA 4Z3VA 3MY5A 4IVBA 4KIPA 4R1VA 4MF0A 4BBFA 4PF4A 2V7AA 1TQIA 4ZLOA 5KMMA 2YCSA 4FBXA 2I40A 3EN7A 3POZA 4CKRA 3OTVA 3N4VA 2WQOA 3HKOA 4EHEA 3LHJA 4B99A 5IQFA 2X6DA 3ZZEA 3BV3A 4IAZA 2W96B 1WBVA 3I7CA 4C62A 4QYGA 5DIAA 4AUAA 2G01A 5HHWA 5JH6A 4ONAA 3QXOA 4P7EA 2YCQA 5IH6A 1WVYA 3LIJA 4J99A 4CT2A 2R0IA 2UZBA 2CDZA 2VTRA 3EWHA 2J5FA 4NEUA 3GU8A 4O38A 5AR8A 2F9GA 3E7VA 4FKQA 2A4LA 2DUVA 3ZUTA 2W1ZA 2UW3A 2XA4A 3ORXA 3WE8A 3Q52A 4E4MA 5HNIX 1WAKA 3BHHA 2Y7JA 4A07A 2ONLC 2PMOX 5L8JA 2YIRA 3V01A 4UX9A 4UXLA 2F7EE 4CEGA 3C0IA 5I9VA 5I9XA 2R3GA 3TUCA 5CEKA 3QBNA 4RMZA 4WUAA 3OOMA 3DJ6A 1WCCA 4BDEA 3VBQA 4W4YA 2R3QA 4EH8A 5JQ8A 4R6VA 4AXAA 4BI1A 4DEGA 3IONA 4NM3A 2OKRA 3FYKX 4NTTA 3ZHPC 4ANBA 5HX6A 2DQ7X 4QYYA 2ONLA 4WUNA 4IM3A 1FGKA 4IM0A 4Y5HA 4G5PA 4YJOA 2FYSA 4MXXA 1VJYA 1UA2A 3P0MA 3TNIA 5M4FA 2HXQA 2ITVA 5HG8A 4GFGA 4AFJA 4ANLA 3WZJA 2XK4A 3FHIA 4V0GB 5CT0A 4QQJA 2ZM4A 4MEDA 3HAVA 4JQ7A 5L2QA 2R3HA 4JX7A 3R7EA 3DCVA 4FKTA 1STCE 3PLAE 2W4JA 1ZMVA 3IDBA 3LCKA 2XK3A 3VHKA 4DAWA 3IOPA 4J1RA 3LFFA 3DKGA 4IH8A 4L42A 3UE4A 3FMDA 2CKPA 1ZMUA 2VTMA 2WMAA 4WHZA 4Z55A 5ACKA 1W98A 4IX6A 4I5PA 3UO6A 4BKJA 4DFNA 4QMTA 3UPXA 5CVGA 3LW0A 1VYZA 5D7VA 4IJPA 4QNAA 4ZS0A 2FA2A 3NCGA 1Q3WA 2XCKA 3COIA 4FICA 4FT0A 5E91A 1I09A 3HMNA 3O17A 4FSUA 3DB6A 3QD0A 2CCIA 2QURA 1OPJA 4FT9A 2UZUE 3JS2A 2OK1A 3BHVA 4FSRA 5DI1A 3ZTXA 2GQRA 4EJ7A 2UZTA 3K3JA 3CKXA 4LGHA 5L6OA 4P5QA 3EN9A 3V5QA 2ESMA 4I20A 3DOGA 4BFMA 2CSNA 2VU3A 3PY1A 3MPMA 3JR1A 3Q9WA 1VZOA 4CLIA 3PJ3A 5E8ZA 4DLJA 5CAUA 2LGCA 3LJ0A 1T46A 3DBFA 4IX3A 3VO3A 2ITNA 3VQHA 3NNUA 1OIRA 5AUXA 3NMUF 4FV4A 1PKDA 5JFXA 4KKHA 1UU3A 3WZDA 5FTGA 4IVAA 2W1DA 4R78A 1JNKA 3NUYA 5BNJA 1FVRA 3EOCA 3S00A 5HE1A 3ZH8A 3HMIA 3MGYA 1QPEA 2HIWA 3D7TA 1ND4A 5AV0A 3VBVA 2XM9A 5FEEA 2QHNA 5DHJA 4IC8A 4WOVA 3PYYA 4GFOA 4MWIA 1WVXA 3CTHA 5CU2A 3BV2A 2J0JA 5IQIA 4RJ4A 4DF3A 4QNYA 3VF9A 3PSBA 3HYHA 4O1OA 2PVFA 3HMOA 3KRXA 4BCPA 3DBCA 3O0GA 2PUPA 4XG9A 4IJ9A 2RKUA 1OB3A 3HA8A 3Q9ZA 2X8IA 4L53A 3RK7A 5KZIA 2VTTA 4WG5A 4F9CA 5FEDA 5EW8A 1H1RA 2W17A 4R3CA 2WMXA 2J51A 4FVPA 5EM6A 2HAKA 3LAUA 1QL6A 2YJRA 3ORPA 4CTBA 5L2TA 3REPA 2HW7A 3MS9A 4B8LA 1G3NA 4QD6A 5IMXA 4HNIA 2WFYA 4XCUA 4YURA 3QTIA 4CRSA 4DEAA 3G15A 3OFMA 5HVJA 4CFWA 3E88A 4F9AA 3KVXA 3EIDA 3CGOA 5DBXA 4X0MA 4EKLA 3V5JA 4BDGA 3O7LD 5HOAA 2PUUA 5KKRB 2I7QA 5IZFA 3ALNA 5B2KA 1SNUA 3DAJA 2QOLA 4U7ZA 4IZAA 5J79A 3B2WA 4GIIA 5ETFA 1LPUA 3CE3A 3KRLA 3KRWA 4RIOA 5KHXA 2C6LA 4DYMA 4TYEA 5AAFA 4IE9A 3NGAA 5C1QB 4C36A 4A06A 3DTCA 1IG1A 4D5HA 4EZ3A 5FUTA 3F5GA 1MUOA 3WOWA 4D9TA 4WD5A 2W1HA 3FZOA 3Q9YA 4NSTA 4O6LA 4QP9A 2HW6A 4RJ7A 3OWKA 1IASA 5DT0A 4USFA 5HX8A 4XS2A 2DS1A 3MJ1A 5DR2A 5A3XA 5ITAA 2QO7A 1M7NA 2YM6A 3AC5A 4RVLA 5KHWA 5J9LA 2BRMA 2X4ZA 4J98A 3C5UA 3QXPA 4L8MA 4OT6A 4WG4A 3E5AA 2Z02A 3HAMA 2OH0E 4TYHB 5LMKC 4CGAA 4O0SA 5ETIA 5CEQA 5AFVA 2ZV2A 2IVUA 4RFMA 4AGDA 4F9YA 3SD0A 4AS0A 3AOXA 3HV5A 3NYNA 3TTIA 4EH4A 4X2KA 4DE4A 3DNEA 3GQIA 2ITXA 4W8DA 4AW5A 3R21A 4D0XA 4BYJA 1NT2A 1XH6A 4O0XA 2ZDUA 3OP5A 4HPUE 4IEBA 2OZAB 3CY2A 2JFLA 4F1OA 4EH6A 1H8FA 3QZGA 4BF2A 3CY3A 3KKVA 4FV6A 4TNDA 4MBJA 1O9UA 4X3FC 3P23A 1YKRA 2B4SB 3L8SA 5FTQA 3ZXTA 4GSBA 4S33A 2OG8A 3JYAA 3IGGA 3R1NA 4HYUA 4LOQA 5T68A 5CEPA 5M57A 3I1AA 3R71A 3RVGA 1Q8YA 4BGHA 3SLSA 1OM1A 3R28A 1XJDA 3FZPA 2X2KA 3HMMA 3V6SA 4XLIA 4RLKA 3W32A 3ZO4A 4K8AA 2QG7A 5E4HA 4RA4A 4FV1A 2VTIA 3QQUA 4KRCA 2OU7A 3D2IA 1QPDA 1K9AA 3A2CA 4PMMA 3F5UA 4UY9A 4EOPA 4MD7E 4I0RA 1R0PA 4RGJA 2R0UA 4AA5A 2WNTA 4C3FA 2C47A 4FTRA 4HJOA 1ZWSA 4I4FA 4NKSA 4YJTA 4A9SA 4F7JA 1JBPE 3HMPA 3COHA 4K77A 4RC4A 4RG0A 5BVDA 4Z16A 4FKUA 1JLUE 1KE7A 1F3MC 1OUYA 4IWDA 4UZHA 4RQKA 4AZEA 2G2HA 4RIWA 2F7ZE 3EFKA 4O91A 2AC5A 5G1XA 4ITIA 3UIXA 5FQDC 3CXWA 4DEIA 3DK7A 5EKNA 2UVYA 3GEQA 4N6ZA 1Q62A 3IW7A 5M4IA 4TWPA 3SW7A 5BVFA 1XBCA 3E3BX 5EFQA 2YM7A 4XP2A 5D7AA 2GNJA 3V5TA 5C4LA 5DH3A 5IA0A 2UW9A 1XHAA 2XUUA 3FZ1A 1UNLA 5ANIA 5CASA 1QMZA 4FG8A 4XV3A 5HEZA 5HIBA 3OBGA 4LMUA 3VS6A 2EUFB 4S32A 5EW9A 2YWPA 2GNIA 3QA0A 3UP7A 5EYKA 4X6QC 4CMUA 5J5TA 2VTPA 2E2BA 2YM4A 2YJSA 2UZWE 3CCNA 3LQ8A 4FNXA 4ASXA 5JGDA 2YCFA 4QP6A 1U5QA 4IXPA 3TN8A 4FV9A 3MPTA 3UQGA 2R3MA 4ASDA 4U3ZA 3HLLA 3N4UA 4C4FA 3H9FA 4FF8A 4FZAB 1S9JA 3QHRA 2OJGA 1ZZ2A 2B9HA 3O50A 3Q4ZA 4KS7A 3CD3A 4L7FA 5AUUA 5JZNA 3E87A 4RX8A 5I0BA 2OIBA 3GOKA 3QFVA 2R3OA 4X21A 3RK5A 1IEPA 2VV9A 3QQFA 4A9TA 2XB7A 4MKCA 5AR5A 4QMMA 4AZFA 4FSMA 3ORLA 4ZSGA 5BYLA 3PG3A 5HU9A 2ZDTA 4I92A 4IVDA 3U4WA 2OGVA 3R30A 3CSVA 1TQMA 3QTZA 4JIKA 4RVKA 3PIXA 3R6XA 2A2AA 3PXQA 3OW4A 4BI2A 1FMOE 1XBAA 3FMHA 2VD5A 4JQEA 3FI4A 3GOPA 1JKLA 2PE2A 3F3TA 4NM0A 4XUFA 4EONA 2QOBA 2GNGA 1WBOA 1OL1A 3UZPA 4U44A 1TKIA 4BTFA 2Z8CA 1JAMA 3VUTA 4G16A 3EZVA 2XK7A 3UGCA 4PMTA 4L7SA 3M2WA 3OEZA 3BI6A 3C1XA 5EI6A 2O5KA 3VJOA 5KUPA 3F88A 2W9ZB 1W7HA 4TN6A 2Z2WA 2YWVA 3LQ3A 2HOGA 4GKIA 1YWNA 4EOQA 3B2TA 4ZK5A 4OAVB 3PA3A 2PU8A 5E9EA 4DHFA 3U54A 3W55A 1H0WA 4QP7A 3KRJA 5JEBA 4AU8A 1PKGA 3RNYA 4YJUA 3ZFMA 5CF4A 3VRZA 1JWHA 3K2LA 4A9RA 4RIXB 5CI7A 2IZTA 5ANJA 3SG8A 1NVSA 4LGGA 4X7QA 3R02A 2Y9QA 3K5VA 4FNYA 4RWLA 4YZMA 2PUNA 2PE1A 2PVLA 4XYFA 3VF8A 2RFEA 3AG9A 4OTPA 4F09A 5IDPA 5DYJA 2CLXA 2XIRA 4ZJVA 4TKSA 3QRUA 4YLJA 4KWPA 5M07A 2V55A 3GENA 3FZRA 3IO7A 3QLFA 3R9NA 2VTLA 3UOKA 4E6QA 4FSTA 2H6DA 2BAKA 3UOLA 3BYMA 5CU6A 1YI6A 5ANEA 3GGFA 4GV1A 3D14A 3NYXA 3OW3A 1KOAA 4G3GA 3LFDA 4F9WA 2PVMA 3ZO3A 3PTGA 5A46A 3ZM4A 3TG1A 4RWKA 3GFEA 3E8NA 5BUJA 4ZZMA 3QCXA 4FKWA 5IA3A 4F7SA 1ZOEA 1WBPA 3TACA 4AA4A 5AUZA 1CM8A 4YJPA 4NU1A 3BLQA 3QD3A 2PMIA 3UYTA 3RTPA 5BMSA 4YBKA 4QMSA 1YW2A 4EZ5A 4DG3E 4X3FA 5DNRA 4BTMA 4D2WA 5CSWA 5DRDA 1JQHA 4ACCA 1OL6A 2XKCA 3OCSA 5FDPA 1OBDA 4O7RA 4KRDA 3I79A 4KINA 1NW1A 1CKJA 3KK9A 4EBWA 4MQ1A 4U3YA 2BDJA 2NRYA 5TKDA 5HTCA 2XH5A 4JVGA 4XOZA 3LLAA 3DY7A 5HICA 4UXQA 4E26A 2VGPA 3BU5A 5GIOE 3EQCA 3FI2A 3IOKA 1SVGA 5J1WA 2XYNA 5K0KA 3C4ZA 1F0QA 4AGCA 4KIKB 5IQHA 3EHAA 3PZHA 2OICA 2H8HA 3QUEA 4RC3A 3FLNC 5T3QA 4QQCA 3S2PA 4JRVA 4RVTA 1Z5MA 1ZYLA 3R0TA 4FVQA 4IIRA 3PXFA 5E8UA 1Q8TA 4E5AX 3QD2B 5IEYA 1BKXA 4NCTA 3IQ7A 4HZSA 1XH8A 1REKA 4IX4A 3IKAA 3UG1A 3L9PA 4BDDA 5B2MA 1KUTA 1MQBA 4EWHA 4K18A 3G6GA 4RWIA 2XNOA 3GCQA 4PTEA 4YNOA 2R9SA 3Q6WA 3R8UA 3KF4A 1B6CB 4BCNA 5AWMA 1OUKA 4FTUA 3G33A 3MH2A 2C5XA 4JX3A 4EOMA 4D9UA 4E6CA 2OO8X 3KCFA 4A9UA 3SKCA 4O96A 5M4UA 2OXXA 3QTXA 3KN6A 3UO4A 1XKKA 3L8XA 1OITA 1PXJA 2RFSA 5AM7A 3BYSA 3TT0A 1YI4A 4GT4A 4M0ZA 1H1QA 3UP2A 4LV8A 3IECA 3PXKA 4EQCA 2XIYA 2PZRA 2R3PA 4HYIA 3R8LA 4LL5A 5I9YA 3DNDA 4O2PA 3F3UA 4ANQA 3DFAA 3RPYA 5JFWA 5M4CA 3NW6A 2G9XA 3JY9A 2UVXA 3ACKA 4FTJA 3RKBA 1HCLA 4FX3A 4FR4A 4IBMA 3RWQA 5C9CA 2VN9A 1SZMA 2YIXA 3OHTA 3POOA 3KFAA 5CZIA 4FEWA 3BELA 4D55A 4ACHA 4G5JA 2F57A 5KO1A 3F7WA 4M84A 5LVNA 2CKEA 4LUEA 3VS1A 4GEOA 5M08A 3FPMA 5TE0A 4Z7GA 4J8NA 4S30A 2BRHA 2FGIA 5DA3A 3S95A 4QP8A 2I1MA 1GZ8A 3O8PA 4GIHA 4E4XA 5A6OA 2WMSA 2WEIA 5IU2A 2GTMA 3GBZA 4GU6A 5J5SA 3RNIA 5CSVA 3AD5A 1OMWA 1GIJA 3OUKA 2PZYA 4YJSA 4QTEA 4G3DA 5DPVA 3U55A 3OTUA 5EHLA 3A7JA 4FV7A 3C4WA 4LOOA 3AC2A 4PTGA 5FG8A 5HG9A 4PP7A 3TM0A 2JDRA 4YJRA 4O86A 3F6XA 2QNJA 3MPAA 4II5A 4ZTQA 4E3CA 1V0PA 3TL8A 4K9YA 1JPAA 5CQWA 3U51A 5J1VA 4CXAA 2YM8A 2WQEA 5FTOA 1FVTA 3F82A 3FLYA 4ZSLA 3OWLA 4FIEA 4FZDB 1A9UA 3LZBA 4GUBA 3R7UA 5JSMA 4PL4A 2C3JA 4H36A 1P5EA 2GHGA 2JKOA 1P2AA 5FP5A 1IA8A 2ZVAA 5TR6A 4QT1A 3ZBFA 2W06A 3S4QA 3FXZA 1M17A 4FG9A 3LFEA 5FXQA 3DLSA 2YN8A 3EQRA 4I5HA 4J8MA 2UW6A 2I0VA 2QVSE 2JAMA 3AQVA 4FT3A 4IHPA 2FSMX 1Y8YA 4LG4A 5IDNA 3M1SA 3DKCA 3IDPA 4IQ6A 2QG5A 5EK7A 3FYJX 3TNQB 5KKRC 1SVEA 4WNMA 4ZMEA 4PRJA 5H2UA 3BHUA 3VJNA 2YM5A 3CLYA 3SXFA 5HORA 4EC8A 4YC6A 4PDOA 3M11A 3U9CA 4BTKA 4E93A 3ANRA 4YHJA 4AGWA 5IF1A 2XIZA 4QYEA 3QZIA 3ORKA 4FTCA 2QU6A 5J9ZA 1XH4A 4I21A 1CKPA 3WARA 4BIBA 3ORIA 1CKIA 4FZ7A 3LQ5A 4HCTA 1WBSA 4ZIMA 1KE9A 5TOZA 5IISA 3QGYA 3R63A 4DEEA 4CRLA 5BMMA 5HCZA 1XBBA 2FVDA 4TRLA 2HWPA 3SRVB 3PSDA 1Q24A 1L8TA 2GS7A 3ENHA 3T3VA 1IA9A 5D1JA 1ZYJA 2IO6A 2HXLA 5H8GA 3BKBA 4RIWB 4GG5A 3CEKA 4KD1A 4NT4A 1M14A 3A7IA 4MCVA 5E8YA 4FGRA 2XCHA 4C4IA 2YA9A 5HCXA 5KE0A 4M15A 1RW8A 2FUMA 2GPHA 4JL9A 3C0GA 2X81A 4JXFA 1URWA 3R01A 4W9WA 3D5XA 3GU4A 3ZU7A 1S9IA 5F95A 4ZJIA 2EXEA 3DT1A 3HNGA 3VUHA 4ANNA 2CCHA 1Q61A 3EKKA 4I1ZA 3CQUA 2X0GA 3NIZA 5AM6A 3V8WA 3ZC6A 5BX0A 5AP0A 4BHZA 3FLSA 3TKIA 1GOLA 3GT8A 3LFSA 4LQMA 3RZFA 4EK4A 4ENYA 3ATTA 3RPSA 2HK5A 5D10A 1OZ1A 4YP8A 5CEIA 5FGKA 2XEZA 4AZSA 2OSCA 4C37A 4XJ0A 3RMFA 4FL1A 4WSQA 3PJ1A 3IW8A 4MWHA 3AMAA 4R3RA 3LE6A 4WNPA 5LMBA 2BZJA 3L1SA 4G3EA 1WBTA 4OW8A 4GYGA 4D28A 3NVKI 2W9FB 2BTSA 1ZXEA 3ELJA 5HBHA 5HGIA 3R8VA 4CFUA 2X8EA 1GIIA 5E8TA 3IS5A 4BWXA 4N70A 4JBQA 4ANMA 5CNNA 2YZAA 3LJ1A 2GHMA 5FDXA 3B8RA 2J7TA 3EL7A 2LAVA 1YOMA 1ZOHA 3TZ8A 4H1JA 4Y73A 5LMAA 4NFMA 5DRBA 1OKVA 3NPCA 3BWJA 3PE2A 3LXKA 3FLQA 2EVAA 2OI4X 3NUUA 4I6BA 4AW0A 4ZTSA 5HO6A 3DXPA 2KULA 3DK3A 4U5JA 4ZLYA 3UMWA 4TW9A 4IB3A 3PVUA 2PL0A 2BZHB 5HBEA 3C4EA 2VWYA 2FSTX 4BL1A 3QUPA 4F63A 4UMUA 3JVRA 3RP9A 2IZUA 5A6NA 5ANKA 5EKOA 3KVWA 3I5ZA 3DK6A 5KMJA 5LARA 1JKTA 2Y0AA 3QALE 4BB4A 5LXMA 3SA0A 3PJ8A 3OS3A 4EHGA 4EUTA 3UOJA 3G0EA 3N9XA 3S0OA 1YXXA 3ORNA 3VUKA 4I41A 4O0YA 3JY0A 4DA5A 4R5YA 2H9VA 2QOHA 2BDFA 4MXOA 4IZ7A 3NNVA 4M7IA 4AF3A 3JXWA 4YC8A 2A27A 3LCOA 2C1BA 1PXLA 1QPJA 4FSNA 3ROYA 2BHEA 2C4GA 2W5AA 3HECA 3PA4A 2F4JA 4O0WA 4XX9A 2R64A 5DWRA 5FP6A 1U54B 4DFZE 3PVWA 1XH9A 1Q4LA 2PZIA 3NX8A 3ORZA 3ZUUA 3U6IA 2JIUA 5B7VA 3P7BA 1MRYA 4TWNA 4LOPA 4U6RA 4JRNA 4HGTA 4CV8A 4WA9A 5HG5A 2OF2A 3PA5A 3NIEA 3BLHA 2IN6A 2W0JA 4KA3A 5AA8A 3FMKA 3EQFA 2VX3A 2YAKA 3U9NA 2YFXA 3R1SA 4MQ2A 5ANDA 5HZNA 5CAVA 4CFMA 3D15A 2Y6MA 2Y8OA 3CIKA 3EN4A 4IZYA 5JKGA 3C0HA 2WTWA 2UUEA 2V7OA 3R8ZA 4ZSAA 1OKYA 3F2NA 4CVAA 3PJ2A 3CTQA 4KIKA 3VS3A 3ZM9A 5DEWA 1W0XC 5LVOA 5IH5A 4E73A 3QKMA 3P86A 4I93A 5L8KA 3EQHA 3W8LA 4BBMA 2GSFA 2ERZE 3ULIA 3VHEA 3ZLYA 1PMUA 3LCTA 3RPVA 2QOCA 3F9NA 4O22A 4AE9A 3R7YA 4UMPA 4O81A 2B9JA 2JGZA 4MNFA 3KY2A 3PXRA 4GK4A 3ZYAA 2UW0A 5E92A 5GZAA 1O6YA 4ZOGA 1VYWA 3FBVA 5E7RA 2YDIA 4KUJA 3PVBA 4FTMA 4BCMA 1FVVA 1Y6AA 4I5CA 4XMOA 5HLNA 4NIFA 1P4OA 4X2FA 5JMSA 2FO0A 3BEAA 4BDBA 3RHKA 3ZUVA 2BROA 5CSXA 4TYIA 2VX0A 5EHOA 5EI8A 3Q4CA 3AT4A 4IW0A 3G5DA 5E1SA 2A0CX 4NZWB 2WMWA 4EOJA 3PJCA 5AP6A 2VRXA 4FSWA 4EKKA 3KN5A 1T45A 5EQEA 5HESA 3H0YA 2UZOA 4DEHA 4C2VA 3NUSA 2ITQA 5LCKA 2G2FA 3FZTA 3CJGA 4H3QA 3NVMB 3E63A 4K1BA 4FT7A 4D4YA 1O6KA 2B0QA 1YXTA 2FSLX 3I0OA 3PVGA 4C4HA 5E8XA 4YZCA 5HBJA 4L52A 3MJ2A 4TZRA 2YLEA 3P08A 3DQWA 4YHFA 2BHHA 3G9NA 3Q5IA 4XV2A 2QKRA 3QRJA 4FK3A 4RPVA 2XBAA 3HGKA 4XBRA 3WZEA 4R7BA 3CTJA 4UB7A 3WI6A 5EI2A 3QTQA 4RBLA 1YWVA 4E5BA 5CS6A 3NUPA 5GZ9A 5FM3A 4TXCA 4I0SA 3RWPA 3GU5A 4FEVA 3MYGA 4KAOA 3UQCA 1URCA 2OIQA 4H3BA 3A8XA 5CQUA 4NYEA 4O82A 4B4LA 2C1AA 5DMZA 2VWWA 2O3PA 5DFPA 1JSTA 2BVAA 2GDOA 1OKZA 1FOTA 2ETRA 3IW4A 3NCZA 4C61A 4FIJA 2BCJA 4D5KA 3OY1A 4Z7HA 3LFBA 4PPCA 4F6WA 4E20A 4FZFB 4Z9LA 2QR7A 5ANOA 4EYMA 2J6MA 2GNHA 2OXDA 5CZHA 2W5HA 4BDIA 4YTFA 1J1BA 2IZSA 4M8TA 3VUMA 4L46A 3W33A 4G2FA 3PUPA 5TT7A 3EQGA 4QOXA 4K6ZA 3QX2A 1ZLTA 2GMXA 5HU3A 4NFNA 3WILA 3EQIA 2GNFA 4FKIA 4A9YA 3O71A 1UWJA 3O23A 4FIIA 4MK0A 4BCGA 3AXWA 4BDKA 3ZRKA 3KULB 4RA5A 3FEGA 4RIYA 3NDMA 3TV6A 3UJGA 1U59A 2Q0BA 2ZM1A 2BRGA 3GCPA 4FSYA 4L3PA 4QPSA 1P14A 3EH9A 4USDA 4CYJA 3EQPA 5CVHA 3MW1A 4XNEA 4X3JA 5BVEA 3KCKA 4E4NA 3EN6A 3V5WA 4JG7A 1A06A 5KMOA 4FI1A 1H1SA 3EB0A 2QQ7A 4FV0A 5CAPA 2WEVA 4I0TA 3BHTA 3CD8A 3BIZA 4CFFA 3KMUA 1SYKA 2RF9A 4L67A 3TZ7A 3HUBA 5HIDA 4BCJA 3M42A 4ZJJA 4LYNA 2HYYA 4DBNA 3FMMA 3KU2A 3Q2JA 1Q3DA 2BUJA 3D7TB 3T8OA 5GINE 4GW8A 2PTKA 2FSOX 2YIWA 4EOOA 3ZMMA 1M2PA 1OVEA 3C51A 5DN3A 5AAGA 1GZNA 2O63A 4PWNA 4FEXA 4GU9A 3HUCA 4UBAA 2XP2A 3CQEA 4FTAA 4D58A 3NW7A 4EC9A 2BR1A 2OZAA 5E8VA 1PXKA 4M97A 4W9XA 3P5KA 3BRBA 5CSHA 2PVYA 3LFNA 1FMKA 4RT7A 1JOWB 3DBDA 4XP0A 4ERWA 4MTAA 4NTSA 4C3PA 4YZNA 4YR8A 1ZRZA 3ULZA 2GS6A 1YXSA 2WIPA 5CXHA 4N0SA 4UZDA 2O65A 4PDSA 4HVDA 1HCKA 4MXYA 1DAWA 4RFYA 3MH1A 3VN9A 3W10A 2VTJA 4C4GA 3HP2A 2JKKA 3OEFX 4CMTA 3MI9A 2XNEA 4EQMA 4IWQA 4ZZNA 1QPCA 1H01A 2BFXA 4IC7A 3IK3A 2HCKA 4QTCA 4CQEA 3PZEA 2QHMA 3RAWA 2GTNA 2GHLA 3VULA 4JR3A 3K3IA 3FE3A 2W1IA 4JR7A 2CNQA 3KC3A 2VWVA 2I6LA 2ITOA 4EOKA 4C0TA 5G6VA 1U54A 3FDNA 5H3QA 2QO2A 2WELA 3DXNA 4JJRA 2ERKA 2UW7A 4BCHA 4G31A 2WU7A 2XJ1A 4KIQA 4AE6A 4BI0A 2CGXA 3MH3A 2XBJA 4EK3A 2OJIA 5L6WL 2Y6OA 4BYIA 4RJ6A 5DT4A 2I0EA 4BZNA 3OCTA 5IQEA 4CG8A 4M0YA 4FIHA 5DEYA 1Z9XA 3QA8A 3QX4A 3F2RA 4L3JA 2QD9A 1YQJA 3PIZA 1FGIA 2CGUA 2CN5A 4BCFA 3GCUA 1NA7A 3NUAA 5CU0A 3O8TA 4BVUA 4L68A 1F5QA 3VS0A 2O2UA 3GC9A 3I60A 3QTSA 2WKMA 3MVMA 4DFXE 1RDQE 2PYWA 4AW2A 2PVNA 4JNWA 2QOIA 3VBWA 5CNOA 3VC4A 4EH5A 5AR4A 4ZAUA 1H1WA 5L6PA 4RSSA 1H4LA 5EDRA 4ANOA 3R7GA 3QC4A 3BHYA 4AQCA 4Q5EA 3UMXA 1YVJA 4YHTA 4O0UA 4PDYA 4PV0A 1U46A 1YXUA 3RM7A 4BDHA 3R2BA 3F3ZA 2F2UA 4NK9A 3UIMA 3QTUA 3WIGA 4DT9A 4WNKA 4OR5A 3I0QA 5FXSA 3VUIA 2YLFA 4DH3A 2HZ0A 5IUIA 4UYNA 1YHSA 4D2SA 2C0OA 2QC6A 2V5QA 4FG7A 4AOIA 3SVVA 2VTOA 2QOFA 4X2NA 4FTNA 1AQ1A 3ZXZA 2G1TA 3ID6C 3QAME 5HE3A 5F1ZA 3AMBA 3U6HA 3TDWA 4FTQA 4E1ZA 3RPRA 2UZLA 4IAKA 4QYHA 3SXRA 4A4OA 4CFVA 3IDCA 2R5TA 2WPAA 5T6KA 5BYYA 3D83A
chains in the Genus database with same CATH superfamily
4ITJA 3SV0A 1WBNA 5EYMA 4CYIA 3EN5A 3TEIA 4EK6A 3MY0A 1H0VA 5AP4A 4WRGA 1PRYA 4XG4A 1G8SA 3OVVA 2HZ4A 2Q0NA 3DB8A 5HLWA 4F0FA 4RIYB 5CXZA 2PMNX 3V5PA 4NL0A 4FYOA 1W82A 4QMUA 3MVJA 4DH7A 4ZMFA 4FT5A 2IJMA 4WT6A 2P2IA 3GU6A 5JRQA 2VX1A 3OWPA 3VIDA 2J90A 3CS9A 4FKLA 4FKPA 4XG2A 2QKWB 3VQUA 3BWFA 2AC3A 5HCYA 3ZFYA 4XP3A 2VO7A 3MIYA 5AUTA 2RGPA 5BVNA 1RQQA 5JGBA 2RL5A 4F7LA 2WHBA 1B38A 3QHWA 4IDTA 4OTWA 4IVCA 4I22A 5DR6A 3ODZX 4QO9A 4F7NA 5DGZA 2Z7RA 4JMQA 3AKJA 1Q97A 2WTCA 5KBQA 4GT3A 4ARKA 2X6EA 2JAVA 2JDVA 4PUZA 2P3GX 4O83A 3QCSA 4BICA 5C27A 5CF5A 3SXSA 4DTAA 2F2CB 4FUXA 1H08A 4U97A 2CKOA 3FQEA 2X7FA 2YISA 3VVHA 3RM6A 3A7FA 4YO6A 3SX9A 4O7LA 1SM2A 4HZRA 4FUYA 3FQSA 4U42A 2VTQA 3DKFA 4AQKA 3R2YA 3AGLA 3R1QA 2CJMA 4AXCA 4OTFA 4FTOA 5GJGA 3DLZA 4IFGA 4UWCA 1UNHA 4JBVA 4QMZA 2SRCA 3KXNA 5HG7A 4YLKA 4FTTA 5M53A 5BUIA 2WD1A 2UW8A 1KOBA 4QTDA 5CENA 3G9LX 4L3LA 4DGGA 1YOJA 5L2SA 4N4SA 1CTPE 3PUFC 1ZOGA 5DLSA 3AT3A 4Y83A 4BHNA 4F65A 4I4EA 2PPQA 3QWJA 1GNGA 4KB8A 4U79A 3TWJA 4C02A 2BFYA 2QCSA 3EFJA 3QYWA 2JDSA 2Z7SA 4B7TA 1K3AA 4Q2AA 4BGQA 4CZYB 3L9NA 4GG7A 3TI1A 5EYCA 2VWIA 4CSVA 1M7QA 2OW3A 4FEQA 3PLSA 2V0DA 4CKIA 5KZ0A 1M52A 4BKZA 4R7HA 4DGOA 3C50A 3NR9A 4HVSA 3EZRA 2HENA 4U8ZA 3D0EA 4FKJA 3UVQA 3BQCA 3AKLA 4MBLA 3D2KA 4I3ZA 4P4CA 4MXZA 3KXXA 3HVCA 3SG9A 3NYVA 1PHKA 3GXLA 1ST0A 3PP0A 4I94A 1VR2A 3KULA 3UNZA 2BPMA 3UZTA 4RZWA 3HDMA 3I6WA 4YPSA 5K0XA 3F5XA 3KREA 3WF8A 3QYZA 3LCSA 2Q83A 4F99A 2EXMA 5C8MA 3C4CA 5KMLA 2ZV8A 5EYDA 5HO7A 2X9FA 4FODA 4F70A 4ENXA 1UVRA 2HWOA 2BAQA 3MFSA 4FKVA 4GJ3A 2NPQA 4HOKA 4ANSA 4DC2A 4QQTA 5AIKA 2FB8A 1JVPP 3EJ1A 4D4RA 2WMUA 5IUGA 1H25A 5JN2A 4MX9A 4O21A 4BTJA 3CPCA 3F5PA 5J8IA 4H1MA 2J0IA 3GFWA 1G8JA 2R4BA 3OWJA 3QTWA 2UVZA 4RJ5A 4YTHA 3ROCA 1H1PA 2WQBA 4HCUA 3NAXA 4QRCA 2ZB0A 1GAGA 1MP8A 3W2CA 1K2PA 2RSVA 2RFNA 4X6RA 2QODA 3TCPA 2YCRA 3I81A 3MH0A 3V51A 4BCQA 2A19B 5CSPA 5HD7A 4G1WA 4I6QA 3R9OA 4BWPA 3IPHA 4GVJA 2VTNA 2YHVA 3EMGA 2OH4A 1OI9A 3KGAA 2E9PA 3NZ0A 5D12A 5TO8A 4FL3A 3SQQA 4YO4A 1PYEA 2PUIA 4QMNA 2JD5A 2V62A 5KMNA 2C6EA 2W7XA 2J0KA 3EFLA 3MBLA 3A7HA 4NM5A 5B2LA 2XNMA 3DAKA 4JDIA 3TKUA 3BQRA 1BL7A 3TNWA 3H30A 2EB3A 3A60A 1KWPA 4O4DA 2JIVA 4ZS4A 3OT8A 4C8BA 5EG3A 5A54A 4YGAA 2OF4A 3DBQA 3ENMA 3SW4A 1M2QA 2I0YA 4OGRA 4RVMA 4F08A 3OD6X 5KX8A 4FV3A 1J91A 2C68A 4JAJA 4EL9A 3II5A 3C4FA 1O6LA 1UV5A 5DG5A 4M3QA 1BI7A 3A4PA 5AA9A 4NW6A 4CZTA 3H4JA 4FKSA 4ZY6A 4BRXA 2XJ2A 2CNUA 3CBLA 2PWLA 3ORTA 3AMYA 4FV2A 4J71A 1MRVA 4EEVA 5KBRA 4CCUA 5JQ5A 3S1HA 3FZSA 1OECA 2VO3A 4QP2A 1ERKA 1H24A 3KXZA 2BZKB 2J2IB 2PVRA 3HA6A 4C34A 4ZLZA 2ITUA 4QPAA 3GC0A 4EWQA 3PFQA 4DH5A 4GRBA 4JQ8A 2H96A 3ANQA 4NCTC 2VWBA 4DGMA 4FNZA 2J4ZA 4LRMA 4IM2A 5EOLA 3SOCA 3VBXA 2R3LA 4NJDA 3WF9A 5GJFA 2IPXA 4OTQA 3AC3A 5FD2A 4F1TA 1H00A 1PXOA 3LPBA 3FMEA 3MFRA 3NAYA 3O51A 3V04A 1KE6A 4CQGA 3AC4A 3P78A 4TWCA 3QCYA 5CVFA 2C0IA 2ITWA 4FIFA 2HZNA 2XYUA 3E62A 5L2WA 4ITHA 3DTWA 4MNEB 2WTVA 4L00A 3MWUA 3Q5ZA 3Q9XA 2WOUA 4A4XA 4EH7A 5CF8A 3RK9A 3TV4A 3W2RA 3FMJA 1UWHA 2GQGA 4BCOA 3EQDA 3HEGA 3U4UA 3QL8A 5LCJA 3ML1A 4U81A 4IB5A 5AV4A 2E9NA 3OXTA 3Q04A 4F6UA 2B7AA 3D5WA 3NWWA 2JDTA 3PSCA 5EDQA 1IRKA 3I6UA 2BKKA 5H9BA 4FTKA 4DG2E 3Q2MA 4EK5A 2EWAA 3GB2A 4BDJA 4YSJA 2ZB1A 3E7OA 2WMQA 3OMVA 4V04A 4B6LA 2CGVA 3D7ZA 4O0VA 4W4WA 4YMJA 4O4CA 4USEA 1Y6BA 2Y4PA 3H0ZA 4AW1A 5M44A 1UU9A 4DITA 3MN3A 5LJJA 4BKYA 4BR3A 3L8VA 3ZOSA 1YWRA 4WRSA 4F64A 2XNBA 4IAIA 4EK8A 2H34A 4CTCA 3GUBA 3ORMA 4OTGA 5EOBA 5B0XA 3WF7A 4EQUA 4FOBA 4XLVA 2XARA 1PJKA 4PL5A 3UVRA 2C3LA 3GVUA 1YHWA 5FXRA 4EH9A 1W83A 2ITZA 5HIEA 4J95A 3OT3A 1LUFA 2YDJA 3BGZA 3OXZA 4ZTRA 5CEMA 4C4JA 1W8CA 4PPAA 2X0OA 3UBDA 2B53A 2OFVA 3FSFA 4IANA 3VUDA 2F7XE 4FMQA 3R9DA 5IPJA 3JPVA 4J97A 3ZSHA 2OZOA 3BPRA 3C9WA 3NLBA 4KIOA 4QYFA 4BC6A 4U41A 4KBKA 4DFLA 3NYOA 3MFTA 4DEBA 5I3RA 3MVHA 4OTHA 3ZSIA 4GJ2A 1J1CA 2R3RA 1YXVA 3RCDA 5F9EA 2VWXA 4UWBA 4WBOA 3W0PA 4AA0A 1GJOA 3PDTA 3BLAA 2QLQA 4AZWA 1H27A 4BDAA 4DFYA 5K5NA 3GI3A 2RG6A 1IAHA 4ACGA 1OIQA 3FWQA 2HY81 3DZOA 4HGEA 4Q5HA 3DXQA 5J9YA 2JC6A 3BLRA 3VS7A 3GC7A 2NRUA 3FKLA 1FINA 4WSYA 4DFUA 4JI9A 3NNWA 5ANGA 4F0IA 3E92A 5IQAA 3AD4A 3ZO1A 4K2RA 4DGNA 3R1YA 1BLXA 1OPLA 1WZYA 3DS6A 3F3VA 4K0YA 4UYAA 4KNBA 1L3RE 2PMLX 5GNKA 3W16A 4DLIA 3DJ7A 4EUUA 5JGAA 3F66A 3ACJA 3HRCA 4QMXA 5AR7A 5FLFA 4KKEA 4IAAA 3DKOA 5A4EA 4QP1A 3PPJA 5L3AA 1SMHA 4FV5A 5AX9A 3AGMA 1UU7A 3QWKA 3T9IA 3ZEWA 3TUDA 3LKMA 4FE2A 2J0MB 4KS8A 3UYSA 2WZJA 4FEUA 1UNGA 3HP5A 5AP3A 4IACA 4UMTA 1GIHA 5HI2A 3KRRA 4H39A 2UV2A 3KB7A 2DYLA 2WTKC 1GZOA 3PRIA 4LGDA 3W2SA 4N57A 3EFWA 4B9DA 3ZRLA 2W1CA 5E8SA 1TZDA 3MSSA 4MD9E 2HZIA 1XO2B 1PMEA 4L43A 3CPBA 4EH2A 3QQJA 4EH3A 2WQMA 2QOOA 5IG1A 5EHYA 5HVYA 2X2LA 5KCVA 2XRWA 3NUXA 4O7SA 4BJJB 2OWBA 2QU5A 3BYOA 4V01A 4FKRA 2CKQA 3UTOA 5IQGA 5ETAA 3T3UA 4KSPA 4IWOA 4Y5QA 3KXMA 3MB6A 4GCJA 1J7LA 3O96A 3GP0A 3OY3A 5HLPA 2UZVA 4R3PA 3ZEPA 1E1VA 5HE0A 2Y4IB 4O7TA 4AFEA 2EU9A 3HV3A 4AN3A 2IVVA 2OJFE 3MDYA 3HRFA 3MB7A 4DINA 4E7WA 3FXXA 5EM8A 3BE2A 4V0GA 5I9ZA 4EOLA 4MBIA 2WO6A 3H3CA 4AP7A 3A8WA 3WBLA 3DPKA 2HY0A 3NW5A 3N4TA 4QTAA 3V8SA 3D5UA 1A48A 2XIKA 4ZY4A 4R5SA 3ZDUA 2E9VA 3H9OA 4FKOA 4JDHA 1Q8WA 4AAAA 3NRMA 4BZOA 4D2PA 4H58A 1YDRE 2RG5A 3SOAA 5HTBA 4HVHA 3DGKA 3CJFA 4JBPA 3ZLWA 4FKGA 4XEYA 3RINA 5HVKA 5LOHA 4GL9A 3W0OA 4HW7A 3ZDIA 3W1FA 1WFCA 3HV4A 3VRYA 3GCVA 5J87A 3TV7A 5KNJA 4WKQA 5F94A 3RHXA 3UC3A 4KSQA 4YTIA 2BRNA 3COKA 3TUBA 3BYVA 5ICPA 1ZZLA 3KF7A 3BYUA 5K9IA 4ZTNA 2OXYA 5EW3A 5IEXA 1CSNA 3L9MA 4C33A 3O7LB 4GFMA 2GU8A 1R39A 1PW2A 2NP8A 2WMRA 2XNGA 5EH0A 4D1XA 4OUCA 4ZSEA 3VBYA 4PP9A 2B54A 3C5IA 2BMCA 5M06A 3KMMA 3E8EA 2IVTA 4HNFA 3ERKA 4XG8A 5HNBA 4XRJA 3UZRA 3A7GA 3R7VA 4CLJA 4QP3A 5BQ0A 2JEDA 4WBBB 4PMSA 4EZ7A 5DVRA 4HYHA 3E8CA 3Q4UA 5EM7A 1H26A 5K5XA 4I5MA 3AT2A 5LWNA 5K3YA 2ITPA 3AC8A 1DAYA 5AIRA 3QRIA 4AT5A 4JDJA 4DFBA 1IR3A 2YM3A 3BU3A 4BZDA 4L6QA 3VBTA 3WF5A 3FLWA 5HNGA 3D4QA 3KK8A 4DH8A 4RX9A 4BIEA 3EYGA 3DAEA 1B39A 2JIIA 2W5BA 4O0TA 2WTDA 4NW5A 1XH5A 3TKHA 3KMWA 3PXZA 2PSQA 4JG8A 4LM5A 3FXWA 5I5ZA 1R0EA 4I6LA 3HDNA 2YIQA 4D4SA 2AUHA 3TYKA 4LI5A 4ASZA 4P5ZA 5KMIA 3EQBA 2IW6A 4FV8A 3ZO2A 3FJQE 2XNNA 4Q9SA 3NS9A 5CLPA 4ACMA 4OBPA 2ZJWA 4MYGA 4QMOA 3UIBA 1SVHA 4PNKA 5LVMA 2GFSA 2VAGA 2WTIA 2P0CA 4GUEA 4GT5A 3UDTA 3FY2A 4I6HA 5AP7A 5BVOA 4YZDA 3LOKA 1Q8UA 4UN0C 2X9EA 4X3FB 5AR2A 2Z60A 5BPYA 4O7VA 3LM5A 1OBGA 3ZS5A 2IWIA 4GKHA 3UNKA 2B9IA 4E5WA 3LXPA 4M66A 5DE2A 1KV2A 2WMVA 3KXHA 2XK8A 3OUNB 3PE1A 4RX7A 3ZCLA 4AG8A 4E6DA 2GQSA 5A4LA 4F6SA 5CEOA 4CG9A 2CGWA 3FL4A 1APME 2GFCA 3COMA 3PG1A 4YPDA 4ZTMA 5CALA 1WVWA 5IEVA 3MTLA 3PPKA 4H3PA 4FZ6A 4LUDA 3L8PA 1Q99A 4QMWA 4XRLA 2QR8A 3W2QA 4TYGA 4CKJA 4F0GA 4OAUC 4ACDA 3UNJA 1XQZA 3W0QA 4IB1A 1OKWA 1PYXA 1RE8A 3UG2A 4W8EA 1J7UA 1XR1A 4QDEA 3OCBA 2WB8A 3LFCA 4IFCA 4G9CA 4RLLA 3BBWA 4CCBA 4X2JA 3LXNA 4XV1A 1QCFA 3A99A 1E1XA 5AAEA 2VTHA 4J96A 1V0OA 4APPA 4EORA 2C0TA 1Q5KA 5IA4A 5KMKA 1YI3A 5CWZA 2W99B 1ATPE 1BX6A 3OXIA 1R1WA 3QCQA 2E9OA 4CFXA 5IA1A 5I9WA 2OJJA 2PZ5A 1DM2A 3DJ5A 3MA6A 4BBEA 1E9HA 4O4EA 3VS5A 3CGFA 5EM5A 4DCEA 3MFUA 4NIFB 4C7TA 4TL0A 2NNWB 3VONA 3WZKA 1KE5A 1UU8A 1W84A 1MQ4A 2JDOA 3PY0A 1JSVA 1X8BA 4NUSA 3QRTA 4RJ3A 1TQPA 4PL3A 5E90A 2UZEA 5AV3A 4C3RA 3DDQA 2WTJA 4XG6A 3GQLA 3CQWA 4K11A 4PQNA 4BDFA 3TIYA 3CC6A 3IG7A 3HZTA 4U43A 2ETKA 2WGJA 5H8BA 2PULA 3TDVA 3DDPA 3GC8A 4I23A 4YJNA 3JUHA 4ERKA 4WO5A 3D5VA 4BCKA 3FLZA 5JFSA 2WOTA 3E64A 1REJA 5H8EA 2PVHA 4FK6A 2E9UA 3VWAA 1WBWA 2RIOA 4RZVA 3UVPA 3PPZA 2PE0A 4Q9ZA 4AZVA 4O0RA 5JK3A 4MUQA 2A1AB 3RGFA 3UDBA 3Q60A 1ZYDA 3ZSGA 2WAJA 4FA2A 2WMBA 2OJ9A 1ST4A 4MXCA 5M09A 3TNHA 5CAQA 1XMMA 3R22A 4ZSJA 2J0LA 5CX9A 3UO5A 4UALA 1VEBA 1PMVA 4Y72A 5A4QA 5EQPA 3EKNA 1H28A 2B55A 4JOAA 2ZMDA 4WNOA 3LXLA 2WMTA 2X7OA 4B8MA 3TJDA 4PNIA 3OC1A 4LRJA 4O27B 2C3KA 3GU7A 5AV1A 3V6RA 2IW8A 3FHRA 4O84A 4XG3A 3A4OX 5C01A 3WF6A 1DI9A 5E1EA 2BDWA 2VGOA 3QZFA 3AC1A 4U80A 3B8QA 4XH6A 5CU3A 5FBNC 3RCJA 1ZYCA 2G15A 5JZJA 2F49A 4MH7A 4NM7A 1PXPA 2WTKB 3LFQA 4FSZA 4JLCA 1OL2A 4QP4A 2VO0A 1XH7A 4S34A 4LV5A 5CY3A 4G6OA 2XK6A 4JIAA 3KQ7A 3OF0A 3PWDA 4U40A 3R8PA 4QMYA 3QKKA 3G2FA 3VW6A 3TJCA 2R3FA 2O64A 1BUHA 4GVAA 3D9VA 4LMNA 4UMQA 5DT3A 3BCEA 4P2KA 2W4KA 3F3WA 2WIHA 3DA6A 3VS2A 3E93A 3P9JA 2X2MA 2WXVA 5M56A 3GCSA 4MNEA 3WZUA 4CV9A 3TZMA 4C35A 3RAHA 3QLGA 4BWKA 1BL6A 3NEWA 4OTIA 3FQHA 1NY3A 2EXCX 2FH9A 3RAKA 5HKMA 4YJVA 4DHIB 1V0BA 3KL8A 3S3IA 4UMRA 1YOLA 1TVOA 2UW4A 2R2PA 3FMLA 3V3VA 5C03A 3BZ3A 4AN9A 3UOHA 3UODA 4EHVA 5CAOA 4FRFA 1Z57A 4YU2A 4U0IA 3RBWA 2GNLA 5I9UA 3TIZA 3W2PA 4BCIA 1OGUA 4GK2A 1ZARA 2AQXA 4EI4A 4TNBA 2X39A 1GY3A 4O4FA 2XRUA 2X1NA 4GH2A 2ZM3A 4I24A 2P4IA 1I44A 5I4NA 2W05A 1OL5A 4Y8DA 4HVIA 3FKNA 2R3NA 4HYSA 2XKDA 4MF1A 3RALA 3OROA 2QONA 3PP1A 4DCAA 2REIA 2BALA 1KSWA 1YDTE 2C69A 2C6DA 4D2RA 1BYGA 2YITA 3MY1A 4DT8A 4C4EA 5AADA 4IX5A 1XWSA 5CF6A 4AT3A 4QEBA 3QUDA 2R7IA 4X2GA 4A4LA 4M68A 5AMNA 3RJCA 4JBOA 1H07A 3K5UA 5ACBC 1FBNA 1G8AA 2OLCA 4AOTA 3Q96A 4GK3A 4NKAA 3R7OA 5AP1A 2VUWA 3O8UA 4HGLA 4RC2A 4IB0A 5EDPA 2PK9A 4N6YA 4BN1A 4IZ5A 3WIKA 2BRBA 2P2HA 5BUEA 4IMYA 3TNPC 4D4VA 4YZ9A 3R9HA 1Q8ZA 3TZ9A 4YUQA 3P4KA 5HD4A 5D41A 2C6MA 4AGUA 2QI8A 4CNHA 4L44A 4M69A 2OBJA 3OG7A 4G6LA 4AACA 5K4JA 4APCA 4R1YA 3GNIB 4DG0E 4ALWA 4NWMA 1YRPA 4KKGA 1FPUA 3NSZA 3QQKA 2C6KA 5IQBA 1Q41A 5IH4A 3SAYA 3G6HA 4TPTA 3MESA 4C59A 2YACA 2B9FA 2ZYBA 5IKWA 3N51A 3OCGA 4B0GA 2YIYA 3HL7A 2C5OA 4M13A 2BTRA 4QQ5A 2UW5A 2XIXA 3DQXA 3Q4TA 2UZDA 2ITTA 3ZC5A 4U9AA 1Y8GA 5DOSA 3FSKA 4ZTLA 4RIXA 4E4LA 3RAIA 3THBA 4MVFA 2YDKA 3H9RA 1ZAOA 3PXYA 3D94A 4G3FA 2ZV7A 4IAFA 3ZFXA 2XJ0A 3WE4A 2JKMA 1ZYSA 3QZHA 3QGWA 2PVJA 1PXMA 3FV8A 2Z7LA 5CI6A 1J3HA 4LRKA 4MAOA 4MXAA 5AR3A 5A14A 5TF9A 2PY3A 1GZKA 3ITZA 2ITYA 3P79A 3SDJA 4DEDA 5A4CA 3HV7A 5AP2A 5HE2A 3R83A 3DXPA 4TYJA 5F20A 3G51A 3PRFA 3F2AA 4FTIA 4Y95A 3G0FA 5A4TA 3K54A 3W8QA 2BIYA 2C5NA 3KXGA 4KBCA 2XK9A 3UC4A 2IG7A 5JFVA 1OIUA 4OT5A 3U8WA 1JKKA 5IA2A 3R9RA 4KABA 3BL7A 4PMPA 3R7IA 3LMGA 3FC1X 2V22A 3H10A 1PXNA 3QQGA 2X7GA 2BKZA 4F4PA 4Y85A 3LMHA 2HELA 2WU6A 3QC9A 4FC0A 3ALOA 5CANA 1R78A 2R7BA 3C13A 3ETAA 3V8TA 4TTHB 1CDKA 3FKOA 4FGBA 4E8AA 4S2ZA 3ZBXA 3IGOA 4EJNA 5AV2A 4G9RA 4CZUA 3HV6A 4QMVA 4O7ZA 5AUWA 4M14A 4D1ZA 2IZRA 4PDPA 3TTJA 2ETMA 4J52A 4QMLA 1OIYA 2JLDA 3O2MA 3FMNA 2X4FA 3QQLA 4FVRA 3QQHA 4IWPA 2NO3A 1NVQA 4FIGA 4E6AA 4QMQA 4DBXA 4BY9E 4NH1A 2KTYA 2QO9A 1R3CA 3ZLXA 3NUNA 4Y46A 4GMYA 4P90A 4AOJA 5GZ8A 5LMKA 4JS8A 3MA3A 4FNWA 4LV7A 3RPOA 3MTFA 1OL7A 3P7AA 3Q53A 3RI1A 4TWOA 2O0UA 4KBAA 5AUVA 4HVGA 4WIHA 4DTBA 4JG6A 4D0WA 4DN5A 5J7BA 4I6FA 2XAMA 4XV9A 4ZXTA 3TXOA 4XBUA 2XALA 2C5VA 5AP5A 5HQ0A 3DU8A 2JKQA 3MVLA 5HO8A 3LLTA 3E3PA 2JBPA 5AUYA 3G90X 5M51A 3I5NA 3L9LA 1J7IA 3ZZWA 5FRIA 4DDIA 3BBTB 2PZPA 3ODYX 2QOKA 2B52A 1ZY5A 3FY0A 3ET7A 4TY1A 3LFAA 2CHLA 2J5EA 2XM8A 1BMKA 3LJ2A 3R00A 3HX4A 2W1GA 4AT4A 1PY5A 4DDGA 3A61A 4WG3A 2AEGA 5C26A 2XS0A 4QMPA 4YLLA 3ZLSA 3LVPA 2CN8A 4TYHA 4M12A 4EYJA 4YTCA 2YZLA 1Y91A 3P1AA 2BAJA 4ZP5A 3ZONA 2VNYA 3W18A 2YERA 2XEYA 3ZRMA 4IDVA 4HGSA 1U4DA 2XKFA 2ZAZA 4NJ3A 5IA5A 5IUHA 4FYNA 3F69A 5CYIA 5J95A 3CKWA 2P33A 3IW5A 4OTRA 5LVLA 5AEPA 3Q3BA 5BV3A 2I0HA 4GS6A 5D11A 1AGWA 4M69B 4H05A 3QRKA 1LEZA 1MRUA 1ZY4A 4FL2A 4MD8E 3FUPA 5L8LA 4OTDA 3I4BA 4LL0A 2J50A 4HCVA 3R73A 4L01A 3U87A 2CMWA 4YC3A 5LQFA 4CMOA 3QTRA 4R7IA 4G3CA 1PXIA 4MHAA 3LCDA 5CT7A 3FPQA 4AAYA 4RRVA 4A7CA 2R3KA 3P7CA 4BDCA 5J7HA 4DGLC 3F61A 4F9BA 3QD4A 5BVKA 1IAJA 2C6TA 2XVDA 3W2OA 2R3JA 3NNXA 4EOIA 4RFZA 4G6NA 4PPBA 4BGGA 3EYHA 2X8DA 3ATSA 1EH4A 3BU6A 2GS2A 3R04A 4K33A 3UQFA 4JDKA 4QPMA 4YSMA 3VAPA 1PMNA 1OPKA 3CR0A 3KA0A 2IW9A 2YEXA 3C4XA 4PX6A 3PY3A 3VW8A 1YHVA 2VWUA 2ZMCA 4G34A 4JAIA 5A9UA 4RQVA 4U45A 1AD5A 4ZY5A 3UPZA 2O8YA 3SGCA 2YAAA 3KEXA 5DR9A 2W4OA 2VZ6A 3VUGA 3FI8A 5LVPA 2JFMA 4AWIA 1P4FA 2DWBA 2P55A 4UWYA 4ASEA 4D2TA 3BGQA 4O2ZA 1DI8A 4ZEGA 2XZSA 2J9MA 1CMKE 4QTBA 4ORKA 4IADA 4RJ8A 5C4KA 4L45A 4FTLA 4F1MA 1Y57A 5GHVA 3HRBA 4AX8A 2GCDA 1NVRA 4FSQA 4YBJA 4C57A 4CT1A 1JKSA 4W4VA 5FBOA 4EBVA 2G2IA 5IQDA 3MIAA 4M67A 4OBQA 4S31A 2UZNA 3WYYA 4J53A 1ZMWA 2VTSA 4R8QA 5FWKK 1KV1A 5AJQA 5M55A 3LMIA 2W1EA 5BYZA 5AX3A 3SRVA 2VNWA 2JBOA 3MV5A 5BVWA 5K4IA 1LR4A 2OIDA 4ALUA 1HOWA 2QOQA 4C38A 5LWMA 2YABA 3IW6A 3Q6UA 5I3OA 3T9TA 4LFIA 1M2RA 3DFCB 4XG7A 5GIPE 4GYIA 3BX5A 2C3IB 4FOCA 2JITA 1LEWA 3FL5A 1NXKA 3BE9A 3VNTA 4FJVA 2WQNA 5IMEA 5FEQA 4EHZA 1UKHA 2VWZA 4TT7A 5C8NA 2OFUA 5L2IA 1JSUA 2C30A 4ALVA 2XKEA 1PF8A 4J7BA 4AZTA 4L9IA 5F4NA 2QLUA 4PY1A 5ETCA 4AXFA 4OBOA 3WYXA 2B1PA 3V5LA 3JVSA 4AN2A 3UIUA 4YJQA 5E8WA 4CD0A 1LP4A 2BIKB 2AYPA 4HPTE 3AD6A 3E8DA 1V1KA 2ACXA 3I7BA 3QKLA 3U6JA 2BILB 1BI8A 4YZBA 2EB2A 2RFDA 5HTIA 4C2WA 3VS4A 5C8KA 2VO6A 4PTCA 4CFNA 5CTPA 4ZTHA 3C7QA 1U5RA 1DS5A 4OLIA 4UV0A 3FC2A 2XF0A 3R8MA 2PVKA 3LM0A 3OBJA 4D1SA 1YDSE 4ID7A 4O1PA 4IAYA 4JT3A 4W4XA 3DBEA 1RJBA 2XMYA 2Y4IC 4G17A 4C58A 4D2VA 3SC1A 2PHKA 5L4QA 2CPKE 3F7ZA 3BGPA 2BZIB 2ZOQA 2XNPA 2ZV9A 4BIDA 4EOSA 4O7WA 4O7YA 2VTAA 2W1FA 5JT2A 5IQCA 1WMKA 3Q32A 1UKIA 3PIYA 4O7NA 2C6IA 3RZBA 1SNXA 2IVSA 3BL9A 2C5YA 3PWYA 5FM2A 4RX5A 3FAAA 5EQYA 2IF8A 3SHEA 2CNVA 3QU0A 3A62A 4DH1A 3CP9A 5D9HA 5JRSA 3DZQA 2C6OA 4UEUA 3OOGA 4XHKB 4R77A 4RWJA 4YNEA 4O6EA 3OZ6A 3FI3A 4ZZOA 1KE8A 4DTKA 2Z7QA 3EL8A 1FQ1B 5GJDA 4V05A 3DV3A 3QF9A 3BEGA 5CU4A 4XOYA 2R3IA 1G5SA 2CLQA 4Z3VA 3MY5A 4IVBA 4KIPA 4R1VA 4MF0A 4BBFA 4PF4A 2V7AA 1TQIA 4ZLOA 5KMMA 2YCSA 4FBXA 2I40A 3EN7A 3POZA 4CKRA 3OTVA 3N4VA 2WQOA 3HKOA 4EHEA 3LHJA 4B99A 5IQFA 2X6DA 3ZZEA 3BV3A 4IAZA 2W96B 1WBVA 3I7CA 4C62A 4QYGA 5DIAA 4AUAA 2G01A 5HHWA 5JH6A 4AXEA 4ONAA 3QXOA <