1U5AA

Plasmodium falciparum lactate dehydrogenase complexed with 3,5-dihydroxy-2-naphthoic acid
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
316
structure length
306
Chain Sequence
b'APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase
molecule tags Oxidoreductase
source organism Plasmodium falciparum
publication title Mapping the binding site for gossypol-like inhibitors of Plasmodium falciparum lactate dehydrogenase.
pubmed doi rcsb
total genus 114
structure length 306
sequence length 316
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2004-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1u5aA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1u5aA02
2B69A 3WGYA 2IZZA 3ANLA 3AY7A 1BXGA 4ID9A 1IY8A 3QJ5A 3TOZA 1V9LA 5TX7A 3C1TA 5A9RA 4XWYA 2POQX 4KUHA 4H3VA 1RM4A 4BNFA 1NHGA 4CM4B 1HDCA 2Y93A 5HBRA 2J6IA 3I9MA 4JCOA 4Q3AA 5GZ3A 3NYWA 2NU6A 3K8ZA 2RAFA 4I8XA 6ADHA 3D3WB 4PRKA 1LRJA 5A9TA 4PLHA 2JCXA 1ISIA 1ZJYA 3QVTA 1PGQA 2ZB8A 3TPCA 2GPTA 1GUFA 4RPKA 1ID1A 1ONNA 4E5MA 2B36A 4MP6A 4OKIA 5JC8A 2GN8A 1U8XX 3ICPA 2ZB4A 4CM9D 3ROQA 4LISA 2Q2QA 2Y99A 1JVSA 1RJWA 4OMUA 5FI5A 5DDIP 2OP0A 3VVBA 3S2IA 1PL8A 3A9WA 1BG6A 5JYEA 4PLYA 3X2FA 3PZRA 1ONOA 2A35A 4KWIA 5EPOA 2Y1FA 1Z75A 1XQ1A 3Q2KA 1E7WA 3LF2A 3V5NA 3K2BA 2QYTA 2GDZA 3I4CA 1KEVA 2EERA 4GLOA 3W8EA 4EW6A 1EVYA 1H6DA 3I9OA 2VHWA 4ROSA 4Z9YA 1B14A 1TEHA 3LK7A 1BXZA 1E5LA 5GY7A 3F1LA 3H4VA 4ESOA 5KJ6A 4PLGA 3PHGA 1D3AA 1UDCA 4FGSA 1U5AA 4DBZA 1XLTA 3JQAB 2VHXA 4GGPA 1TT5A 2C7VA 3KHUA 3H9UA 3PI7A 4PVDA 1PJLA 5F5NA 4D3DA 2GNAA 2UUOA 3SVTA 4R1UA 4BNTA 2OZPA 4A10A 1M67A 1EVJA 1XYGA 4GVXA 3EZYA 2W8ZA 3OEYA 2EW8A 4XA8A 4O1MA 4JBGA 3NAQA 1QR6A 1Y5MA 2CMDA 2DLDA 1JLLA 4R3WA 3G1TA 3H3JA 4I08A 1PS9A 1LDBA 1SPXA 2VRBA 4OQZA 1E3WA 4ND3A 4BO6A 3JQEA 1H93A 4WPGA 2P9EA 2R2GA 3PQEA 1HLDA 1D1TA 3TZ6A 5JW6A 2HJRA 4CLXA 2X0RA 1HF3A 1A4UA 4MDHA 4OAQA 4P4LA 5DZSA 3KOUA 3GFGA 2JHGA 1P1IA 1XGKA 4C4OA 1MC4A 2C7GA 2DQ4A 2OOSA 1LSSA 1A27A 4J43A 4ALNA 1J0XO 3ITDA 3DBLB 3NV9A 1BVUA 3C1OA 4PZCA 3EVTA 3GG2A 3KB6A 1BXGB 1E7MA 1SOWA 5JDCA 5JC1A 2CVQA 3PJGA 1NQOA 4L74A 4OHUA 3SC4A 3HDHA 4RVUA 3NJ8A 5TF4A 2W98A 4BNMA 3Q9NA 1PJ2A 1U3UA 3FNGA 3C7CB 3ASVA 5JAIA 4ZU3A 2P4HX 1M6HA 2HU2A 3IUPA 5DCUA 3O4RA 4Q3NA 2X8LA 3QRWA 4FW8A 4OOEA 3BMNA 3E9MA 2CVOA 3Q3CA 3ZWAA 4CR6A 2ZQYA 4BMNA 3V2HA 3MJSA 4RV9A 3DAPA 5CP8A 4BNIA 5IDQA 4YRAA 4DIBA 3PIDA 4ITUA 1EUCA 4IMRA 2IXAA 2B5WA 4PVCA 4YVFA 1ULSA 1H2HA 3C1AA 3V2UA 4XGIA 4EEZA 4YJGA 4IDDA 1GFSA 3FNEA 7ADHA 2OUIA 2Y1EA 2EW2A 5B12A 4E5NA 4JLWA 3L6OO 3PGXA 2PZLA 3FWNA 5JAMA 4D3FA 1NFRA 4WGGA 4IXWA 2GLXA 1EEHA 1P1JA 5HRUA 2IDZA 1BHSA 1F8GA 4DMLA 2DUUA 3GMDA 5KJFA 3Q9UA 4OYRA 3VH4A 4CUJA 3MWDB 4S3MA 3QHAA 3WICA 4CMHA 2CY0A 4ALLA 2BD0A 3JYQA 3VKVA 4YJHA 4QTZA 2VNAA 2NVUB 5AOVA 3DZKA 2I9PA 5COQA 4DMMA 1EDZA 5ICMA 4BGEA 5THQA 3ZDFA 1VE9A 3M1LA 4N5LA 4ND2A 5IDYA 2VWQA 3X2EA 3I9JA 1PZEA 2J8ZA 4W9NC 4NDNE 4JJFA 4XQEA 4CPDA 5KVCA 3JD1A 1DC6A 1XU7A 2P9CA 1EVZA 2CD9A 2QHXA 1L7EA 4J7XA 4PLTA 1XKQA 3I83A 3OP4A 4HUJA 1BGVA 1E3JA 2PZMA 5JSFA 1S7CA 4RVGA 4E31A 4IDFA 3JD0A 2GSDA 3WS7A 5I7VA 3PJFA 1H9BA 3RQSA 4BB6A 4NJOA 1IHYA 2PH3A 1JDJA 3QP9A 1GL3A 4H15A 4MVJI 1TLTA 1DXYA 2H9IA 4AFNA 3ONDA 4DYVA 5IN4A 2DPGA 1ADBA 2DBVO 4IDGA 2FSVA 5DCYA 1NR7A 1ISJA 4RGBA 2JHFA 1I3LA 4WKGA 4RORA 3TZQA 4E30A 5DP2A 2P68A 4J2HA 3RFTA 3PTZA 1IHXA 1VM6A 3IJRA 2EEZA 5FI3A 3WWZA 1T2AA 3ZNOA 4IGEA 3LT0A 1IOLA 4BNZA 4U5QA 2NVUA 5MGBA 4BVAA 3BMQA 4MIOA 1GYPA 1E7RA 2C2XA 4GLLA 4L4XA 1WLYA 3RUHA 4FS3A 1QV6A 2AW5A 4CM5A 2VRCA 4NH4A 2ZJ0A 2I65A 3WMWA 3OJOA 4B7UA 3VZPA 1PU2A 2O4CA 2RHRA 2FPPA 2Y66A 4TRJA 4MP3A 2BMAA 1DOHA 4MOWA 4PLZA 1X0VA 3V2GA 2W2LD 4J49A 4WOJA 1H0KA 3ZWCA 2D5CA 2QRKA 2DKNA 4XDZA 4Z9FA 2BELA 3PWKA 4JP2A 5TC4A 5JDIC 2O3QA 2EKLA 2VYND 3DOCA 5F1KA 4F3YA 3WR5A 1R4NB 3FR7A 3LVFO 3RBZA 4CV3A 4JJIA 1YS4A 2HK8A 3ZGYA 2DBZA 3FPCA 3O8QA 2O3UA 5FYDA 4OXNA 1TVEA 2OO5A 4FD3A 3TDKA 4RQTA 2IODA 1BW9B 3ZU5A 1ORRA 3OIDA 4O5OA 4DC1A 1LUAA 1U7HA 3GRPA 1SB9A 3W1VA 2Q3EA 4OM8A 4XGKA 4J7UA 3PHHA 3BHMA 2YHUA 2H5LA 1ZSVA 2ZTMA 4YACA 3MTGA 1X1EA 3HQ4O 4CL3A 3PFFA 4BO1A 3AFNA 2EJVA 4X54A 1DPGA 2YZ7A 5ILGA 5U1PA 5G4KB 3E5RA 3INRA 4YJHB 3BIOA 2Y05A 1QYCA 2WYVA 4BO4A 1IZ9A 4WLEA 1P0FA 2GGSA 3A28A 4ND1A 4RO0A 1LQTA 2ZTVA 1R12A 3ITKA 4FGWA 4RVFA 1EE2A 1B3BA 1KEWA 3IDSA 2J5KA 3LT2A 4AJIA 1ENPA 4Y9DA 3WNVA 3OBBA 1AE1A 1PGNA 2JFFA 4OJNA 4RVDA 2C59A 3ZWNA 3B1FA 4BKPA 3WNQA 3GZ4A 4O6VA 3L0DA 3W6ZA 1MFZA 2JFGA 4JBIA 3P19A 4MKXA 2GD1O 1KETA 2P9GA 4L4RA 3BHIA 3ZHBA 2NQ8A 1HETA 2DTEA 3GLQA 1DAOA 3H7AA 4WUVA 5BNTA 2NACA 2DM6A 1UR5A 2OBNA 1H9AA 2JAPA 5A04A 3M2PA 5C37A 2BFOA 2XPCA 3BTOA 2W2KB 4RPGA 1HDRA 1SZJG 3PVZA 3GEGA 3WFJA 3WQQA 3KZVA 3GGPA 2I66A 1VJ1A 2E6UX 1IULA 2HSDA 1YE3A 2O3SA 1X13A 1HZZA 3AW9A 3IOYA 3NUGA 4PLCA 3RKRA 2HQ1A 4BNUA 3RUIA 4R1TA 2QG4A 1GEGA 3MTJA 5CFZA 3D1LA 4AJHA 4RF4A 5EIOA 2YW9A 3AJRA 4G65A 1FDUA 2Q4EA 2YUTA 5BSEA 3IP1A 1GV1A 2VT2A 3U4HA 4E4YA 1I3MA 3WGIA 4CR8A 3EW7A 4OH1A 2XXBA 2PGJA 3FSRA 4U6QA 1DC5A 2E82A 2FZEA 3S1LA 1WDMA 3VKUA 4CLHA 2ZTUA 1PX0A 4A03A 1GU7A 4K9DA 4KUGA 4MJLA 4WECA 1GUYA 1FJHA 4WLNA 3PYLA 1Z73A 1C0LA 1NHWA 3NKLA 5CPBA 3CMMA 3GOHA 4CM8A 1UDBA 4G5HA 1V3UA 4WEQA 1DC3A 1U4OA 4GQAA 1R16A 3IJPA 3WQSB 3SC6A 1HE2A 1SMKA 3OA2A 4KTTE 2B5VA 4WASA 4B8ZA 3E5MA 1IL0A 2O3RA 3A4VA 2DTXA 3H9QA 4UVEA 2Q99A 4EJ0A 1LQUA 5TT0A 3R3JA 4QO7A 5LCXA 1PWZA 3ONFA 1GCUA 1G6KA 4L4SA 3G3EA 5COBA 3F1KA 4MVJH 1PZGA 1MA0A 5IZCC 4YWJA 2Y1DA 3K30A 3WTCA 3OJLA 3UKOA 1CERA 1GPJA 2PGLA 1KBZA 2DFVA 4PRLA 1ENOA 1UXJA 3QWHA 1NWCA 3DC2A 4YYZA 5ADHA 1EBFA 4ZQFA 3HADA 1XR3A 3U4DA 4MVJA 1IB6A 4E13A 4E32A 5FF9A 3FNFA 5AYVA 4CLRB 5HS4A 1DIAA 3GGGA 3IIEA 5HWSA 4R16A 1P44A 1I2ZA 3LDHA 5L4LA 2RH4A 4FC6A 4BGVA 4W82A 2PZJA 1NM5A 3TWOA 1PR3A 5DT9A 2GYYA 3CINA 1FDTA 3PQDA 4CLOA 3ANMA 1E3SA 1OZAA 4UUOA 4YDRA 3DDNA 3GG9A 3KYDA 3C7DB 4MINA 3V1UA 4TRRA 1OC4A 3NTOA 4FFLA 5I9MA 3IAHA 3ZV6A 1MP0A 2NU8A 4NR0A 4ALKA 3I5MA 3TL2A 1A72A 4XB1A 2BGLA 4UVGA 1I30A 2OFPA 1P3DA 4H16A 1B26A 1SAYA 1P31A 1GZ6A 1QYWA 1KIFA 3DAGA 3GRKA 4RF5A 4R41A 5JMPA 1RM5A 3GK3A 1UP4A 3JQ8B 1EUZA 3WBBA 3G1UA 4YTEA 5A9SB 5L7YA 4J1NA 2UVDA 8ADHA 5JMWA 1NWHA 3LT4A 2G82A 5JBIA 2DBRA 1PWXA 2JD2A 2YFQA 4DQUA 1R4MB 1F17A 3BYZA 1YQXA 1Y1PA 3AK4A 4BNJA 1E1LA 5G0UA 1Q2XA 1C0PA 1V35A 3ZN2A 1I2CA 3OFSA 3LQFA 4TKMA 1UZNA 1CIVA 2BI7A 2VYVD 3MJTA 3ZWYA 2AMFA 3PRJA 1KC3A 4XYLA 5KVVA 1ZEJA 5L40A 1G1AA 3L4BC 4IIUA 4IUYA 4NJMB 3RFXA 3UH1A 3V1TC 4BNHA 3GUCA 4RQUA 1W6UA 4XRGA 5TJHA 4RDHA 1J5PA 4RPLA 4R54A 3DR3A 4RVHA 2HMVA 1WXDA 4QEDA 4WNIA 3K6JA 3L6DA 4EI2A 3WFIA 3QVSA 3OQBA 2LDBA 4I5GA 4DPMA 4Y6SA 3K96A 4CM9A 2HDHA 5BSFA 1VSVA 2HMSA 3B20A 5HM8A 2PD6A 5ITVA 1U3WA 1Y8QB 3B1KA 1X1TA 4N5NA 4Q9NA 3JCZA 3S55A 3L07A 1KYQA 4NK4A 4BNKA 1YB1A 3LC7O 4WLOA 3UCEA 4J6FA 4GI2A 4AJJA 3AM4A 3WOHA 5A4DA 2Y68A 2B4RO 4Q3CA 5L53A 1T2EA 4B79A 2ZYGA 2NV6A 5H83A 3UCXA 1NFFA 4W7HA 5LC1A 4WCFA 4FFOA 3HWRA 2I3GA 4BNLA 3W4JA 1NPYA 1Z82A 4GSKA 1LNQA 3INGA 2CF6A 3OIFA 3RIHA 3BXXA 1SB8A 2FY8A 4KQWA 2NSDA 2V6BA 3MJVA 1OI7A 3BHJA 4HADA 4PG8A 3GNQA 5L4SA 2AG8A 4XX0A 3D5TA 3FI9A 4M55A 1ZMTA 4NG5A 5TJ9A 5JY1A 4J1TA 1U4SA 3T7CA 2NU9A 3L4BA 3GAZA 4DYDA 1XU9A 5CEFA 1E6EA 5COAA 4BO2A 1YQDA 4Z6KA 2Z95A 2Y1CA 5T64A 1DIGA 1XG5A 1T4DA 4QUKA 2Q2VA 3UFXA 3S8MA 4CMBA 2VTEA 3RC7A 1B8PA 3K31A 4D0RA 5CDTA 4EJMA 3WIEA 1UP7A 2EWMA 3G0OA 2WE8A 4NFYA 4YAJA 3ENNA 3OH8A 1VKNA 4N54A 3JD3A 1ZXLA 3DMTC 4D45A 4YQYA 3ZWMA 3ADPA 4DTIA 2C20A 4CLRA 3LC2O 4D46A 1VC2A 4NZ9A 1DLJA 4YT2A 4TROA 1ADCA 3DO5A 4DLLA 3ETGA 1YVEI 1VL6A 3T7EA 1E6UA 2YV2A 3DOOA 4LSMA 1UXIA 3EHEA 1HSOA 1GDHA 2I5PO 1DO8A 4GX2A 1IYZA 2JCVA 3OEWA 5T67A 9LDBA 3HFGA 1SEPA 2HO5A 4S1VA 1P1RA 2H1SA 1B8UA 4B3IA 3PDUA 2XF8A 1KC1A 4M8SA 4EITA 1ADFA 1O0SA 3HFSA 2BGMA 8LDHA 1NX6A 3I9NA 5G0VA 2NADA 3CMCO 1B8VA 3ZV3A 3QV1A 4ND5A 1YOVB 4XEHA 3KETA 2EGHA 3KYDB 5L51A 5BSGA 4CODB 1M66A 5DOZA 3JQ7B 3HSKA 4FBGA 1H6CA 3MJ4A 3NJ4A 1Q1NA 3TNLA 2FRDA 1E7YA 3EUWA 1VJTA 1N9GB 4J3FA 4BKOA 5T5QA 3BMOB 2RH8A 3HJAA 3I9LA 4U7WA 4INAA 3GH3A 1EVIA 1XQ6A 1I10A 5T8KC 4B7CA 3PYXA 3NT5A 5KKAA 1F8FA 2D2IA 1HTBA 1YL7A 5KTKA 1ZNQO 1HEUA 2VHYA 3H5NA 1YDEA 1ZMOA 2C82A 5G0WA 4K26A 1Q7GA 1JU9A 2YQ4A 4KDFA 1BXKA 3O26A 1DFIA 3VOSA 2ZK7A 2G17A 3VTZA 4NPCA 4AL4A 3ZI0A 3H6KA 4B8WA 1SNYA 2C07A 3EK2A 1K2WA 4M89A 3GDFA 1FK8A 2C2YA 2VUTA 1YOVA 1YJ8A 4GH5A 1E7QA 5I7EA 3F6YA 1PJ4A 2OP1A 3KXDA 3QVWA 1RM3A 1N5DA 4FIZA 3PFWO 3WJ7A 4RDIA 4NMHA 2QIOA 3MJCA 4P22A 2HLPA 3CKYA 1CJCA 4UUPA 2DTDA 1N9GA 4F6CA 3ZHYA 4D44A 1A7KA 3RU7A 3I6QA 4EEXA 3PLRA 2PV7A 1GYQA 5JAQA 3VZSA 4W6ZA 3WDSA 2R00A 2NNLD 4TQGA 5CDSA 3D4OA 4JGBA 1HDYA 2B35A 4D0SA 1U1IA 3CE6A 4Z0TA 4J0EA 5IG2A 2PD4A 3C7AA 3AUTA 4IQGA 4ONEA 2I99A 4RVSA 3GNSA 4LMRA 3H8VA 3EVNA 1UDAA 1E3LA 3D7LA 3KUXA 4KUEA 4NI5A 4O0LA 4CMEC 4QX6A 1QYDA 4I9NA 4WLUA 3S2FA 3OM9A 4O63O 5B4VA 3DB2A 3ULKA 4GAEA 1Q0QA 1HE3A 3FBTA 3KSZO 4BO8A 5AXCA 3ZWXA 1Z45A 1ZW1A 4NBWA 3U49A 1I36A 1QG6A 2VWPA 4URFA 4L9RA 5T8KA 2CF5A 4PZDA 4LCEA 1M6WA 2VOEA 1UXKA 3JQDA 5C7LO 2Y1GA 2NTNA 2O7QA 1FDSA 4AJPA 4IGFA 1IPEA 3DTTA 4JBHA 4Y8VA 3HDQA 4FDAA 4YAKA 4OSOA 1UXHA 1LLCA 4P8RA 3KV3O 3K9QO 4XQCA 1Y7TA 2AG5A 1IE3A 4IBOA 1R6DA 3IQDB 2Z1MA 5A3JA 1RM0A 1HSZA 2B83A 3DL2A 3INTA 1P33A 3FTPA 1Q0LA 2FZWA 3ANNA 4J0FA 4JNKA 4YJGB 5I9LA 1OC2A 1CYDA 1PJTA 1CF2O 1YB5A 2ZYAA 3WSWA 4GMFA 3WIDA 5TS3A 4ZRNA 5LDGA 4BGUA 5JNLA 1ZO8A 1PJSA 1Y9AA 2O4UX 4BKQA 4GKBA 4TKLA 1EQUA 2GF2A 1N1EA 3AM5A 2V6MA 4AJ2A 4E2WA 5K9ZA 3SJ7A 1CRWG 4PFJA 4R3NA 3DZFA 4DUPA 1ZK2A 1ZK4A 3ETDA 2BFMA 1R0SA 5TT1A 1Y9EA 5EL0A 3DMTA 5U9CA 5B37A 4FOSA 2VZ9A 3SLGA 3BTUA 2Q50A 4FSHA 2Y0EA 4M54A 4B4UA 2CFCA 3I23A 3U0BA 3VPSA 4WNCA 5F5LA 4CLOB 1U28A 3DZBA 1J4AA 3WLEA 3BA1A 3AY6A 3DHEA 2HK7A 3BMCB 1AUPA 5KJCA 3ZW9A 1MV8A 3KSDO 5A05A 4Z3KA 3TZHA 4UREA 2PK3A 4BMSA 3FF4A 1PIWA 3GPDG 3PIIA 4J90A 1YBVA 2Q1WA 4PG6A 3TFOA 4PG7A 3AI2A 1GPDG 2OHXA 3JQGA 4CM1A 4JROA 3B70A 4LK3A 4CMAA 3RAJA 4YJFA 1PQUA 2W2LA 4YT5A 2VZ8A 3DBVO 1MX3A 3PLNA 4IQ8A 1G0NA 1ADGA 4U6SA 4A5OA 3F4BA 4BO7A 1WMAA 2O3TA 1D7OA 3D4PA 1DB3A 3DBRA 3ROMA 2O2YA 1RWBA 2BF7A 3QWAA 4J4HA 1KVUA 1LSJA 5JYDA 3DZIA 4MVJF 5ER6A 1X7DA 2QRJA 3U09A 4YT4A 3G17A 4GKVA 1MG0A 1CQIA 1EZ4A 1T26A 4XQ9A 5JO9A 3CH6A 3SXPA 2GRAA 5KIAA 2QZ9A 4R9RA 5ICSA 2YQ5A 2X6TA 4CMIB 1WPQA 1Y8RA 2O50A 3RKUA 4IXTA 4ZICA 4BNVA 2A9FA 4II2A 4NJMA 4AJOA 4HP8A 3NT4A 3HB4X 1LA2A 3GVCA 3UUWA 4KZPA 3QIVA 3QW2A 4XKJA 1Z6ZA 1F06A 2V7PA 1YBAA 3L9XA 4YJFB 2JKVA 3QLJA 4CJXA 2WYWA 4E6PA 4PLWA 3DWFA 5G4LA 3CTMA 2VUUA 3UN1A 3M2TA 5AXBA 4XJTA 3RWBA 3P2YA 3TZKA 2PWZA 4CM3A 4QECA 4W7IA 3NT2A 4E5YA 3FRJA 1UZLA 3DXFA 4OOFA 4UUMA 4BO9A 4CV0A 2EF1A 1PTJA 5CAEA 4CQMA 1ZBQA 1PGJA 5AXAA 1PGPA 5F3RA 2YFHA 4CM6A 1U8FO 1Y8RB 1GZ3A 1NQ5A 3OQ6A 1VPDA 1LC0A 4AJKA 1UH5A 4YRBA 4K1LA 1C1DA 1PQWA 2TMGA 3GA0A 1YDWA 3RBXA 1ZCJA 2GO1A 3HZZA 3WTBA 3ZWBA 1KOLA 1N1GA 1T2CA 4KDEA 4KQXA 3AY3A 5JLAA 3I6IA 5MDHA 3OA0A 1B3RA 4R69A 5I8ZA 1SO8A 5G4KA 2DFDA 3IMFA 2WDZA 3QY9A 3CXRA 4M1QA 3RFVA 3EZLA 2FWMX 2X58A 2VT3A 1NAHA 3ZWWA 3Q2IA 3D4NA 4HV4A 1J6UA 1VSUA 3KBOA 1LDMA 4E21A 1C0KA 3JYLA 3KEOA 2HMWA 4D42A 4ZQEA 1E1KA 1CETA 4UAGA 3GZNB 4PZEA 1DRWA 3ZU3A 4HFMA 1FDWA 3KRTA 1WZEA 3QWFA 4R1NA 3C24A 3MJEA 2AE2A 1C1DB 5JCJD 3W4IA 2UDPA 3WGGA 3ZHZA 4EBFA 2Z1NA 4EUEA 1C1XB 1WNTA 1XCBA 1MLDA 1TT5B 1AHHA 2HRBA 4JN6B 2WMDA 3GUYA 3VPXA 3EMKA 3QWIA 3F46A 4NBRA 1E6WA 3GC6A 1GTMA 2ZB3A 4ZQBA 5BNFA 3ZV5A 2V65A 3L77A 4TVOA 2C54A 5F1OA 4J2OA 1PJCA 3KVOA 4YQZA 2Q45A 5IF3A 1HYGA 5C5IA 4L76A 5A3VA 1GY8A 4I5DA 3HG7A 2B37A 3VAZA 3QA9A 2B0JA 3U4CA 3NTRA 4G2NA 2V6GA 5BT9A 4N18A 3G79A 2FR0A 2ZATA 3K2EA 2X0NA 4BNXA 5JAZA 1TI7A 4FCCA 1KERA 3EYWA 3ZV4A 5EN4A 3RUDA 5ILOA 2I67A 4HKTA 1H6BA 4DWVA 5EMHA 3UF0A 1M75A 2XXJA 4JP3A 3PJDA 3MOGA 2E48A 3KYCA 3D3WA 5GMOA 1I5RA 1GV0A 2X1HA 5KVQA 1LDNA 3WB9A 4CL8A 4BQRA 4FFNA 1BDMA 1QSGA 3PHJA 4TRNA 4ZQGA 3WG9A 4J4BA 2J3JA 5GZ6A 1NNUA 4F45A 3Q11A 3C3XA 2VTDA 6LDHA 4ZJUA 1PR9A 2FN7A 5B1YA 1ISGA 1JKIA 5G0TA 4CMCA 3GHHA 2BLLA 4B3JA 2P5YA 1UUFA 2ET6A 3KTDA 3DZJA 3NGXA 4HBGA 5THKA 1U2GA 2X0JA 4E33A 3TZCA 1ULUA 1NQTA 2ZIZA 3ASUA 1LTHR 3DMYA 3ZU2A 3O03A 1I3KA 3ZNPA 4P4GA 1NQAO 4L73A 1AXEA 2D0IA 1XDWA 5DNAA 1BVRA 1E1MA 3NX4A 3EC7A 4Z0HO 3FWZA 2JL1A 5B4UA 5I7SA 5DOVA 2DU8A 5C7IO 2VOJA 3OJFA 3KO8A 4ZN6A 4TVBA 7MDHA 4IPTA 5KCZA 3OECA 2Y1OA 2NWQA 1JKJA 3A1NA 4DGSA 1LJ8A 2OMEA 4LMPA 3IL2A 1T2DA 1ML3A 3JTMA 3M1AA 4D3SA 1I8TA 1K6JA 4CM4A 3UVEA 1P1FA 2HKIA 1LXCA 1BW9A 2EV9A 2P4QA 3M6IA 4TZKA 1P45A 4CQMD 2VHVA 1N8KA 3JQ9A 2RCYA 3WX0A 2YY7A 1GYRA 3O9ZA 4FR5A 3AFMA 2O2SA 4J16A 3VPFA 4ZD6A 1DDOA 1TA4A 2P2SA 3SBOA 2WD8A 3VHRA 2CDAA 2V6FA 4DPKA 3AOEA 4JQCA 2YV1A 3EDMA 3R6DA 3GVXA 3IKVA 1GQYA 3H65A 3I3OA 3LLSA 4OQYA 3AWDA 1GCOA 4E3ZA 2O48X 2Q1TA 2WD7B 3QWBA 1UXGA 1DFHA 1EK5A 4CMEA 3O8QB 3CZRA 1L7DA 2GR9A 4F6LA 2AA3A 5DP1A 1C14A 2VWGA 1ZH8A 4Y6RA 3A06A 2OBYA 1X15A 2QZZA 4OXYA 4UVDA 3U4IA 2IZ1A 1WVGA 2Q1SA 1PZHA 1K3TA 1TB4A 1OFGA 4GGOA 3TJRA 1YGYA 4ALIA 3HHPA 2O7SA 1HDOA 1W73A 2P5UA 3E82A 3H2SA 3JQBC 3LC1O 2QW8A 2ZJ1A 5IDXA 3ZWVA 2GERA 2YDXA 1QP8A 1B16A 2IZ0A 1D8AA 1YQGA 1U9JA 3BZUA 4WLFA 2NLOA 3RUCA 2PNFA 4I9UA 1U5CA 4MVJG 3EY4A 4OO3A 2W2KA 3JQBA 1B15A 4DPLA 1GQQA 3ZHXA 3H5RA 1ZVMA 1CDOA 5IZ4A 3CIFA 5KWEA 4XCVA 3ZWPA 1V6AA 2AQIA 1ZEMA 1ZK3A 1DBVO 2FMUA 1ZXBA 2RBEA 2ZQZA 3EAGA 4M49A 3H9EO 3C8MA 3LT1A 1H2BA 4XYMA 3DOJA 1J49A 1IZ0A 1PS0A 1OBFO 4MKRA 1P9LA 2C5AA 3NRCA 3SLKA 4E5KA 1AN9A 5AQ1A 5BR7A 3GGOA 4R01A 5FEUA 5AVOA 1T1SA 5L7WA 2D59A 3I9KA 3ZCXA 4FFPA 1YO6A 1T4BA 3HDYA 2Q1UA 4MKZA 2Z5LA 3QE3A 4CM8B 2BGKA 2D4AA 4ILKA 4PLVA 3E8XA 4IJUA 4YAIA 1JN0A 5KJEA 5KKCA 3ROPA 3DFUA 5L9AA 3WGHA 3KEQA 1N7HA 4DLBA 3D64A 1R0KA 1RYDA 2BFAA 5F21A 3JQCA 1XSEA 2FPGA 4PLPA 3TRIA 4XR9A 1DFGA 1HWYA 1U7TA 2VUSA 5EQFA 3WJAA 3VTFA 3JYNA 3WXBA 1JTVA 3UCFA 3WMXA 2F00A 4IMPA 4YEDA 4R5HA 5TLSA 1K0UA 1Z74A 4GWGA 3E9QA 3K5PA 4IINA 1PS8A 1GR0A 1Z7EA 1JA9A 1E5QA 4QSMA 2IRWA 2JD1A 1GQ2A 3OHSX 1V3TA 2PGDA 2RIRA 2EHDA 2HMTA 1I2BA 3FR8A 4HNHA 1I0ZA 1W0CA 1ENYA 3FCOA 4AICA 1UAYA 2X86A 1YKFA 1EQ2A 1LLQA 1V3VA 1Y6JA 3JD2A 4N5MA 1L1FA 4XRRA 3AI3A 3F5SA 4N7RA 4E0BA 4K6FA 3CPSA 4EZBA 4IDAA 2DBQA 4XDYA 1Q7BA 3DQPA 4P38A 1O8CA 3AOGA 5JDIA 4PG5A 2AHRA 2X5JO 4I1IA 3BMQB 5HTOA 3RC1A 1NVGA 3LSYA 1HL3A 2R6JA 3PHLA 1WMBA 1HE5A 4NU5A 2YJZA 3W8FA 5A03A 1NR1A 1RYEA 4ALMA 4RZHA 3H9JA 3WGZA 3E18A 1ISFA 1MUUA 3PYMA 2OORA 5L45A 2PZKA 1T24A 4WCFC 4BMVA 1XEAA 1U2DA 2R00C 3AU9A 5HS6A 3RASA 3U3XA 3S2GA 3R3SA 2W4QA 3TN7A 3TQHA 4Q3BA 4BGIA 3KLPX 4LN1A 4E2ZA 1DC4A 3N58A 5L4NA 4NK5A 2J5QA 2SCUA 4DREA 1ZIDA 4RCVA 2D3TA 1R4MA 2JFHA 3RJ5A 5GZ1A 2PA3A 1HDXA 2DT5A 3HNPA 2IEBA 4L75A 3Q1LA 3KM0A 3B1JA 3HB5X 3T4EA 4NBTA 2HUNA 4IJWA 2ZB7A 4A7PA 4YR9A 3QSGA 4OXKA 4DRYA 5JXWA 2VNSA 4DLAA 4CM7A 2YV3A 1A4IA 1K6XA 2W90A 3H5AA 2ZCVA 3TFQA 3F3SA 3SEFA 4B4VA 1LX6A 1UJMA 1N7GA 4WLVA 4LRSB 4CV1A 1U3VA 1BSVA 1R0LA 1CQJA 1BTOA 2WTBA 4KTVE 3RD5A 1HDZA 3DTYA 2ZKLA 5FWNA 3GHYA 3GY0A 3N7UA 5KJ1A 3OETA 4W9NA 3JYOA 1MGOA 1WDLA 4GVLA 3GPIA 4BOYA 5EINA 2EKPA 4JJGA 5JCJA 3HN7A 1PJBA 4HNGA 1C3VA 1SCUA 4LGVA 5JE8A 3RSHA 1QLJA 4YA6A 1JQBA 3NTQA 3GVHA 2J3IA 5I8WA 1QKIA 3GQVA 2HRZA 4R9SA 4UEOA 5H82A 2UV8A 1JWBB 4AVYA 3PGJA 2VWHA 1LU9A 3GNTA 3VPGA 3LYLA 1BWSA 3PXXA 4D79A 3DFZA 3SJUA 1VJ0A 5ITWA 1KVSA 4AJEA 3VZRA 3ON5A 1X7HA 5LDHA 5IXSA 3JQAA 4FFMA 3NGLA 3SX2A 1R4NA 3RI3A 1A7AA 3TOXA 1EE9A 4J91A 1ZZEA 2VZ0A 3RROA 4BL5A 4YXFA 3K92A 3FN4A 2YDYA 5IAAA 4J1SA 4HWKA 4B4OA 3RC2A 1S6YA 5CDGA 3KLMX 3PK0A 2GN6A 3ADOA 3GMSA 4FB5A 4RZIA 2NQTA 1WWKA 4FN4A 5DBGA 1Z7BA 2IYPA 4MPDA 4ZRMA 5JPIA 1E3WB 5BNIA 5FFFA 1F0YA 3Q0EA 4LSWA 2QX7A 4TWRA 1OOEA 4KP7A 1ZK0A 2X0IA 4W99A 1YL5A 4XR4A 2GCGA 5TQVA 2QRLA 1F12A 4MVJE 1DIBA 5TRTA 1F14A 4GX1A 4ND4A 1YRLA 1GZ4A 5A9SA 3VC7A 1LEHA 1DLIA 4Z9XA 3ZNQA 3RC9A 1ZK1A 2BRUA 1PQPA 2G0TA 5J23A 2OGUA 1ONPA 2Q4BA 3OF2A 3P7MA 2FP4A 3WGOA 2GZ3A 3ZW8A 1QLHA 3F9IA 4FFRA 4R68A 1E3EA 1BRMA 1DRVA 4RLSA 4BNYA 5HA5A 1LSUA 4ZGWA 2X5KO 1LC3A 3DZGA 5G0SA 5JS6A 5TGDA 2P91A 3FPLA 1D4FA 3RVDA 4ZA2A 2UUPA 1FF9A 1KEPA 5CG2A 1DIHA 1SBYA 3OJEA 3PZBA 4M87A 4PCVA 1HYHA 5K6AC 3QVXA 1ZFNA 5DCWA 4B4WA 3JQGB 4CUKA 4Q39A 4PG4A 1W4ZA 4DIFA 4YT8A 5A02A 1H94A 4GSLA 2XAAA 1SEVA 3UHAA 3DEYX 2FHSA 3ZZNA 4RJTA 1WP4A 4AJNA 2C29D 2NTVA 3GDOA 3DBRB 4XD2A 1O94A 3NDIA 1UZMA 4BV8A 3BTSA 4H7PA 4MIYA 5K6AA 2VHZA 2WJPA 1BDBA 2O3JA 2WD7A 2X9GA 4NIMA 1PJ3A 1CEQA 2IEDA 4R5MA 4UEKA 5H81A 3AU8A 3GDGA 2G5CA 2HK9A 2CDCA 5L95A 3OICA 4IDEA 1DHRA 4XZ3A 3WQRA 1JVBA 2X9VA 1KVTA 3GFBA 5A5EA 4R51A 4BO5A 4FPXA 1NXQA 4TZTA 4U0KA 2FR1A 3CEAA 3ETEA 5ENDA 4CMKA 9LDTA 3CUKA 3MEQA 1MB4A 1XHLA 3D3EA 4BKRA 5KVSA 4KMSA 3E1KA 4FJ0A 1OMOA 5DBFA 4GX0A 1T1RA 3IC5A 1OAAA 4NHEA 3E9NA 4YCAA 4AG3A 4HFJA 1P74A 1V8BA 4CV2A 3H3FA 3I1JA 3ABIA 1GEEA 1TXGA 3E03A 4HY3A 1I24A 4M86A 4R1SA 5ES3A 1LLDA 3MOIA 5IDWA 4K6CA 1R37A 1JKFA 1VL0A 1DRUA 4LVUA 2EG9A 4FJ2A 2GUGA 2QQ5A 1H5QA 1PL7A 4QFDA 5IJZA 3OIGA 5I7FA 4KOAA 2PY6A 2AQHA 2DUWA 3DAFA 2AEFA 3EGOA 4TSKA 4YB8A 1LLUA 3LU1A 3ONEA 2X5OA 3CZMA 3WYEA 2NU7A 1GAEO 4DBVO 1NFQA 3FHLA 2HCTA 3RUFA 4J7CA 1LBEA 1Q7CA 2TMDA 1E0DA 1HKUA 1QRRA 2BH9A 5F1PA 2CZCA 2VYNA 4PN3A 2BI8A 1A9YA 3I4FA 1QMGA 3AUUA 1KY5A 3NDJA 3A14A 1EUDA 3JQ7A 5TNXA 1R66A 2PKRA 2D1YA 1HE4A 4Q3EA 4PLFA 3H9GA 4NQZA 4J4TA 1LI4A 4KWHA 3OSUA 3Q6IA 3NDRA 4UEJA 4BO0A 4JX8A 1FDVA 2PTGA 1I01A 1QXSA 2E49A 1NASA 2CDBA 4BNGA 4MVJD 1NTOA 1EBUA 4AJLA 4F46A 3E6AA 3DBHB 5JY6A 1XIVA 2GN4A 2PFGA 2X22A 4UVHA 2HAEA 5TIIA 4JK3A 2OXIA 4MIEA 1EFKA 1HRDA 3COSA 1QORA 4XYBA 3UAGA 1MFPA 1NAIA 4NU6A 4D43A 4BIIA 4JXKA 4IY1A 1Y5RA 5JDCC 3VDQA 2J3HA 2ZYDA 3UW3A 4C7JA 4IM7A 1NVMB 3VH2A 3RUEA 3V1YA 1NVTA 1HXHA 4L8VA 4LVCA 1C1XA 5CDYA 1TT7A 4CLDA 4BB5A 4RLHA 1MXFA 3DZHA 2GN9A 3FTNA 4XJSA 4IDBA 4BKUA 2WM3A 3DHYA 4CR7A 4BNWA 4FOOA 1GUZA 4JIGA 4WK6A 4WOKA 2NUAA 2ZCUA 4OL9A 4GX5A 2VQ3A 4YAEA 1E77A 3QVOA 4OIMA 5DBIA 1ARZA 5KOIA 4I5FA 2OL4A 2PD3A 5DF1A 2I6TA 2AQKA 3UXYA 5ER9A 4A73A 3WBFA 1YONA 2VYVA 2VCYA 2F1KA 1YL6A 4DA9A 1K89A 2PLAA 1WDKA 3PEFA 4NFHA 1T25A 3AOEC 1YXMA 1XWFA 1ENZA 4MVJM 1LRLA 3WLFA 1E1NA 2AEJA 3MCVA 5EERA 3PQFA 3LF1A 3R0IA 2J3KA 1X0XA 4PGFA 4II3A 1XELA 1FXSA 4YRDA 5EJ2A 3LLVA 4HXYA 1BMDA 3PPIA 3JQ9C 2VRCD 2E4AA 4NFSA 1DJNA 3GEDA 4J9UE 1B0AA 1YB4A 1A9ZA 4EUFA 1EK6A 2NTJA 4WCFB 3PJEA 2EP5A 3BMCA 3VZQA 4HFRA 1P1HA 2AXQA 4GBJA 3LZ6A 4NNJA 3AUSA 3WGQA 4B7XA 1DEHA 1NPTO 3L9WA 1DJQA 3JYPA 3DONA 1D1SA 3TSCA 1HZJA 1X14A 4DVJA 4EUHA 1PSDA 2AQ8A 4IDCA 2CVZA 1ZKMA 2E37A 4XYEA 1ZSNA 3HN2A 4U0JA 3GEMA 1G0OA 1XA0A 3GAFA 1ZUD1 3QQPA 3ZWOA 1HDGO 1Y8QA 3VVCA 1AHIA 2Q49A 3P5SA 4J1QA 3OMLA 4O59O 1RPNA 3VH1A 2EXXA 1GADO 4LW8A 5A06A 3PP8A 3ZH2A 4I5EA 3JQ6A 1Y81A 4HFNA 5K0ZA 5CG1A 5EQDA 3UICA 1MC5A 4A27A 1N2SA 4RPJA 4XYGA 1B2LA 2PH5A 3DBLA 5DULA 2B4QA 1VI2A 3I52A 3TF5A 4CMIA 3W4KA 1DHTA 4UULA 2Q46A 1JAXA 1M2WA 5I9NA 1C0IA 3HUDA 3R1IA 4RF3A 2RHCA 1U3TA 5AXDA 2HJSA 2AEMA 2UYYA 4UVIA 4P4NA 4TMFA 3S2EA 4E12A 1JAYA 5U4QA 3AI1A 2FOIA 5IFLA 2AE1A 3JSAA 3JQFC 3PHIA 4BNNA 4DC0A 3IUSA 5IXYA 1I32A 1HT0A 2JJYA 1O89A 2X23A 3RUAA 3WYBA 5JCXA 3WGTA 4BHTA 2FPIA 1YH3A 4XGNA 2X9NA 5CDUA 4FJ1A 2JAHA 2GASA 4K28A 1WZIA 4YBZA 4DIOA 4DXHA 5L7TA 3RCBA 2J5RA 5BQFA 4PIVA 3KSUA 2CSUA 2X7HA 1AXGA 1NBOA 3DBHA 1EDOA 3H2ZA 2NVWA 1W8DA 3E48A 5DN9A 2DVMA 4I9HA 5T57A 2B4TO 1T2FA 4UUNA 1Q0HA 2I3AA 4L0QA 4A26A 4RF2A 4RPHA 1E92A 2GZ2A 3UOGA 2JD0A 4EDFA 4IQ0A 3GVIA 1PZFA 5KNLA 1M76A 5C3MA 2CNBA 3BMOA 4Y98A 2I76A 4GWKA 2WSBA 3RJ9A 4ALJA 5JFOA 3GR6A 1I33A 3GVPA 3N74A 2EKQA 1ZJZA 4GMGA 3ZU4A 3GN2A 2LDXA 2WE7A 5A5FA 2BHLA 2FSSA 1E3IA 1O9BA 1NP3A 3ENKA 4FC7A 4C7KA 1O6ZA 4BUCA 1LDGA 3K73O 2NVBA 1FMCA 3BTVA 2ILTA 3JV7A 4XQGA 2XOXA 4D7AA 1SOVA 1LDYA 3ROKA 1SC6A 3TL3A 1IPFA 3ORFA 1AGNA 5B4TA 1LSOA 3JQFA 4E2YA 5BSHA 2WYUA 3WYCA 3OQ1A 4YAGA 4GL4A 4DL9A 1GD1O 3C85A 1VKOA 2O23A 4Q3DA 2QYSA 4MP8A 2UAGA 1PEDA 3O38A 3F47A 5A1TA 1PGOA 1VLLA 1KEUA 4FQ8A 4G81A 4LRTB 3U9LA 2Q2WA 4CMGA 2WEKA 2GZ1A 4QQRA 4IIVA 2Y0CA 4WEOA 3IP3A 5CEJA 2A94A 1O95A 4AJ1A 4Z3DA 2A4KA 3GF4A 1R15A 3L6EA 4OSPA 3WWYA 4CLEA 4CQLA 4R4JA 1JW9B 3PWZA 1H6AA 2IYOA 3B6ZA 3G49A 3GT0A 5T6BA 3U5TA 3GN1A 3VPHA 1QV7A 2IE0A 1LDEA 1LRKA 3BAZA 1KS9A 2PKQO 3AM3A 3DHNA 4XIJA 3ST7A 1EFLA 3HE3A 4ZVVA 4A2CA 4IZHA 3JQ8A 2DAPA 5IN5A 1DSSG 1HYEA 4J9VA 4TRMA 2D5AA 3PDJA 3IKTA 4XIYA 3MWEB 4EGFA 3W8DA 1ZSYA 2PKQP 4LCJA 4YJDA 3KYCB 2YYYA 2YHIB 1KVRA 1NPDA 1K5HA 4IJVA 5ENVA 3L4SO 3FD8A 4CQMB 5CPFA 1CWUA 1DIRA 3MZ0A 3VDRA 1YWGO 2G76A 1P77A 4AJ4A 4CMJA 4ZQHA 1V0JA 2EJWA 3VH3A 4EJ6A 3P2OA 1VRWA 1JWAB 4YPOA 4WE3A 5C7OO 3D5QA 4E5PA 4NBVA 1KVQA 1IUKA 3JQAD 1K6IA 1E7SA 1MXHA 2VN8A 4E2XA 2WWRA 2Y67A 1N92A 4QXMA 4MO2A 1NYTA 1WW8A 4WCDA 2BFPA 2H6EA 1VL8A 1MG5A 2PR2A 1EMDA 5CEEA 4IS2A 4OGWA 2C0CA 4CQLB 3RBVA 2FR8A 3NEPX 1PJQA 3OJ0A 1B7GO 4EYEA 2EGGA 4HX5A 4BS9A 5CHEA 1UAGA 3STHA 4A0SA 1ISMA 3CSDA 1PL6A 2X4GA 2C5EA 4MVJP 1ISHA 2EP7A 3T4XA 5JO0A 5L3ZA 4Z0PA 1O5IA 2ZTLA 1QYXA 2BKAA 3RU9A 1X7GA 1KY4A 4IS3A 2YHIA 4QT0A 3AUAA 3GZNA 2JCYA 3KYBA 3ZNNA 4DQVA 4QFCA 3ICCA 4BO3A 4U8GA 4RL6A 1A5ZA 4IJKA 3D0OA 2CUKA 3F5QA 4DQXA 4WJZA 3V8BA 2H63A 5IZCA 4B3HA 2DPHA 3F4LA 2NM0A 3HDJA 3WSVA 5EESA 1A71A 1P0CA 3IS3A 3FBGA 4W4TA 4Y67A 5G2OA 1YBMA 4ZHSA 2Y0DA 1QYVA 1P1KA 1WAMA 1HLPA 2D8AA 3JD4A 4Y6PA 2G1UA 1UP6A 4GPD1 1I3NA 4IZIA 4CUZA 3BMNB 3FNHA 3U62A 2EIHA 3PWSA 1YJQA 2DC1A 4NBUA 2A92A 2HMUA 3UGKA 4QO8A 1RKXA 4BQPA 5TSDA 4XB2A 3W6UA 1DAPA 4D41A 2IXBA 4BV9A 4OKNA
chains in the Genus database with same CATH superfamily
6ABPA 4QSHA 2DERA 1GGEA 3OEED 3MD9A 4W8HA 2OESA 4NMXB 1W581 4ID9A 5H1YA 1J2UA 1RQPA 3EDRA 1CCWA 2KSQA 4H4EA 3RYIB 4F5DA 4LFAB 2C4KA 3ZLJA 4P7BA 2POQX 2J7KA 3IMCA 4QL3A 3MUNA 1RM4A 2QSUA 3ICOA 3VVMA 4AZ0B 4BNFA 4JQYA 1V11B 3FOWA 1SHZA 3NYWA 1WY5A 2VUIB 1G8YA 6ADHA 3D3WB 1KNXA 1LRJA 1ZVQA 1R7RA 1YS2X 2WILA 4PRKA 5ALTA 1XXHB 4PLHA 1VJGA 2FZLA 3FMGA 1Z6GA 3PFBA 1ISIA 2X8AA 1ZJYA 3QVTA 4IKOA 3U2QA 2PGNA 1GN8A 1NRXA 1Z16A 2WU0A 3FSJX 1Q84A 3MA0A 1QFYA 3O93A 4WKCA 1ORDA 4Z9BA 4AUKA 1ONNA 3UOAB 5IT5A 1CJMA 5JC8A 2GN8A 1JF8A 5KBYA 1CQIB 3F49S 5C5CA 1QVWA 4N6NA 2GAOA 3AR6A 2D6FA 2Q2QA 4BRUA 5H8WA 3K9CA 3K4QA 4U7PB 2JZCA 1UBUS 3T3IA 2OP0A 4RPCA 1X1CA 3S2IA 3J81k 3N76A 1S1MA 1MENA 1U8EA 3T5BA 1VBNA 4ZDWA 4PLYA 2CT8A 2IYTA 2ORWA 3X2FA 1QQBA 2ACEA 1UMDA 2UYOA 4KWIA 1RXYA 2Z2KA 4Q03A 1Z0DA 2Y77A 1L9XA 1WCWA 1XYYA 1XQ1A 2FOLA 2XTJA 3CKKA 3LF2A 2AOUA 3K2BA 3Q2KA 2A5LA 2UU9B 1MC8A 1WU8A 2QYTA 1KEVA 2Z5VA 3PTLA 2IOQA 1TJYA 2V96A 4IZ6A 3IDFA 4ML3A 4ZI2A 1R0XA 1UANA 4M83A 1FSSA 4LC1A 4ROSA 1TEHA 3LK7A 4XCXA 4DCUA 4C7BA 4PX5A 1C2TA 3K1AA 1RD4A 1BXZA 5GY7A 2EFEB 1FRVA 1JG7A 1CB7A 3MWDA 2HEIA 4PLGA 3BGDA 2QPLA 1RJEA 4YV1A 3VR5A 2ZE8A 1JE0A 1T9DA 3HXTA 4OBEA 3RIYA 2E3JA 1JG2A 4X7BA 4L5JA 2UZAA 2VHXA 2A6PA 3AW8A 1TT5A 3PUJA 4OXRA 3WRYC 5IAGA 3O95A 4KWEA 3H9UA 4D3DA 5JRJA 3HYRA 1NN5A 4LI3X 4JQZA 3T9AA 3WYGA 5C8VA 4OHVA 1WVIA 1Z0FA 4NCJA 2A9JA 4M4SA 2GM4A 2Q3FA 3HXPA 3OTQA 1QANA 3GB9A 2EW8A 2NUTB 4Q0MA 4O1MA 4MEJA 1WABA 3ZG6A 5CCXA 1E79D 1KJJA 2IKSA 4OTZA 4F56A 4GOLD 4KFCA 1CZKA 1Y5MA 2DLDA 2WF6A 2EFGA 3H3JA 1EFPB 3OI7A 2PZGA 4ZDJA 1YA4A 1SPXA 4L3VA 1E3WA 4JLOA 2IX3A 1D6NA 4RV4A 2MSWA 5EXTA 4N8EA 4BO6A 4DWWA 1UEXC 1KYWA 3JQEA 3T1YB 1H93A 1PF7E 2H9YA 1W48A 2NX2A 3QUAA 4IRXA 4OHCA 4WPGA 4KAXA 2QRPA 2P9EA 4ISCA 3PQEA 1JR3D 5JD4A 4I66A 3ERCA 4NP6A 4Z51A 1RQGA 2HF9A 1EZZA 1XZBA 5JW6A 2X0RA 1HF3A 5BUSA 1OYWA 1U9IA 1A4UA 4JBYA 4OAQA 4UBNA 4V3BA 3SQWA 1VA4A 2EYUA 3IULA 4UPDA 3KOUA 2ZT7A 1IJEA 3E05A 5IJAA 2FV8A 1ETHA 2PUFA 4C3UA 2C92A 2L0XA 3OG9A 3QUBA 2C7GA 1RWMA 1UOEA 2OOSA 3UW1A 3H87A 4JUBA 3FZEA 2A58A 2WWXA 2NO7A 4MGYR 2AEEA 1CSEE 1RMQA 4DLNA 2PS0A 1WETA 2FQXA 3ITDA 5KYXA 4OQFA 1YI8A 4ZMRA 1UBNA 1LBIA 4PZCA 2C83A 3A2LA 3BB4A 5KC8A 1UAAA 1K88A 2R6HA 1SOWA 3AXTA 5HHTA 4QTYA 1TM2A 2YBDA 1UIRA 4JOBA 5DCLA 1AH2A 3VC2A 1MABB 3PJGA 1NQOA 4L74A 4DR5B 3O3MB 3O8OA 3R7WB 3NJ8A 1EAYA 1QC5A 3FNGA 1KK1A 1T15A 1Y9ZA 3C7CB 3P26A 1C8VB 4RS4A 1ZD3A 1W87A 5FWXB 1C2YA 3TE6A 3VR6D 4GZLA 2UVPB 3O4RA 4Q3NA 3I6YA 3UBTA 3Q3CA 2W2OA 3KB2A 1TW3A 3ZY3A 3PRHA 3ZLTA 1Y1QA 4CDMA 1LPBB 5ADWA 2ZQYA 2JCSA 2AI2A 2Q3CA 1ZCAA 3MJSA 4BMNA 4DZRA 4RV9A 4BNIA 5JAOA 4CG0A 1EGAA 5GONB 5CLIA 3AR7A 3ORQA 2IXAA 4IMRA 4LDZA 1VLZA 3Q7SA 1IY1A 3EMDA 3NZEA 1LPSA 1H2HA 4RHTA 1WSDA 4XVHA 1QH1A 3H5VA 4A9AA 2J0QA 4HEHA 4MV0A 4XGIA 5FIUA 1B23P 1SWVA 2VA9A 4KU4A 4YJGA 1GFSA 1L7AA 2VDMB 2BCJQ 5CB0A 4GR5A 7ADHA 3OD5A 1MQ8B 5FLXA 1LS1A 2OUIA 2FRVA 3LZCA 3MG9A 1GDTA 2QMEA 4BAGA 1DUSA 4E5NA 3PGXA 2BJWA 1EWRA 1GAWA 1UOQA 1DT3A 3E5HA 2DH5A 3OM8A 1SULA 2BC9A 4ME6A 1NFRA 4WGGA 5B53A 2EL7A 2VTVA 2X0KA 2XEDA 4IXWA 1EEHA 1JIXA 1JIJA 1P1JA 2GILA 1F8GA 3FYUA 1LZLA 1SUSA 2FWPA 1FUKA 4GPIB 1XTJA 1T1EA 4PNZA 4BX0A 2XKKA 1JWLA 4W9MC 4TLBA 4QOIA 2J4CA 4WZBE 1X2EA 4U2KA 2QQEA 3QU5A 3VU0A 3WICA 1B43A 1UFKA 3U3DA 2CKDA 2GXUA 5JFGA 1YD7A 3VKVA 2F3UA 2VDJA 4UE6A 4KJZA 1RHMA 4JSTA 5AOVA 4DMMA 2AS0A 2SHKA 3VBCA 4O4LA 3OBIA 1MQ9A 4M0EA 5J3JA 1R4ZA 3ZDFA 1Z4OA 3C43A 1LK5A 4ND2A 1FXWF 4RY9A 2VWQA 3HJRA 5IDYA 3ORYA 5FPSA 1D6MA 1PZEA 3I9JA 1H0RA 1MJNA 1T8YA 3PUHA 4KYIB 4W9NC 5E4FA 2VDRB 3SLRA 3L6UA 4NV3A 1YZLA 2VP9A 3PQ7A 3Q15C 4XQEA 3MERA 3ML1A 1MO6A 2CNKA 3C6MA 3RRNA 4Z1OA 4PXYA 5F1YA 2NO4A 3TLAA 1XKQA 2PT5A 4V0NA 3UXEA 3SHOA 1ICEA 1R8YA 2VHCA 4IGIA 1MDBA 4MV1A 3RJTA 1E3JA 4DV6B 3RG2A 4RVGA 2A59A 1WP9A 3FLMA 3K0HA 4EJSA 4MCHA 3PJFA 3RQSA 3HU3A 3KNZA 3NYIA 3CA8A 3II6X 3PSHA 3GPCA 4JY7A 2GEUA 2I0FA 1TMOA 1TLTA 3FMVA 4X84A 1D0SA 4AFNA 3ONDA 1C7QA 2PBZA 3RFCA 4CNBA 5CFNA 3HVIA 3L7LA 4M9CA 2DBVO 4AT1A 1E98A 1XX6A 2FSVA 4Y2JA 3ANTA 4A3SA 1T9CA 1ISJA 2C5LA 1SCQA 2Q6OA 1QYIA 2KBFA 4TQUS 2JI8A 1I3LA 1SBCA 4K81B 4RORA 3CG0A 3TZQA 4I4IA 2P68A 3NTUA 3O1IC 4J2HA 3RFTA 2F1RA 2YW2A 4GS5A 3AZQA 4ZYUA 5HNKA 1PD0A 3TRDA 5KTSA 2YWBA 1IOLA 3LT0A 4QFBA 3W2IA 2WVJA 4U5QA 3P0JA 1P0IA 2B21A 3L7OA 3BMQA 3PICA 2GA9A 2JBAB 1V8PA 1DELA 4KQ2A 1E7RA 4FDMA 4LHWA 1GRCA 4GLLA 5EVJA 4L4XA 3ZCTA 5ELLA 5K8CA 5LQJA 1QV6A 3AVTA 3CRRA 1L4YA 1GN9A 2AYXA 4KCGA 4NH4A 1A82A 1MIOA 2P6OA 3LBNA 2AIRA 2O4CA 3PGLA 2F3SA 2PYDA 4ARCA 2VI5A 5LQDA 3REQB 1HRKA 4AYTA 1FZTA 4Q47A 3E70C 3IJEB 5KNBD 4PLZA 5DW0A 3T5PA 2P11A 4TL7A 1TF2A 1XCMA 3ER6A 4J49A 4WOJA 3RT9A 3SZ3A 5BW5A 3CW8X 3VNRA 2W42A 3ICQB 4M99A 3O1JC 1KWKA 2OHGA 1T0PA 2QMZA 3QK7A 5M2QA 4XDZA 3STXA 1IN6A 4I1UA 3FVRA 1RIIA 1V45E 3I6BA 5BRNA 4NABA 3WQBA 3A3PA 2WJGA 5FO0A 5JDIC 3D8HA 2A3RA 5F1KA 1AMUA 4ZFNA 1HZZC 4RZXA 4IVNA 1T9KA 4K6GA 2YHAA 3B9RA 1ECPA 1QK3A 1YS4A 3QLVC 1DQNA 5AI9A 2XCIA 3ZGYA 1FFYA 3B6MA 4IIDA 2XQJA 1GL9B 2R25B 5JASA 4PTZA 3W05A 1TVEA 5JEDA 1BDIA 2QTWB 4LAFA 1F1BA 3K3PA 5LMCA 1UEIA 5KINB 4RQTA 1YHYA 2VDQB 3LPNA 4KQIA 1ORRA 2KLBA 3OIDA 4JVMA 1QIIA 4Q00A 3SJAA 2C7QA 1QPZA 1XE3A 4DS3A 3C3DA 1FRQA 4IDHA 4BMDA 1BGWA 1HO3A 2RHGB 1PDOA 3DCNA 4MW7A 4OM8A 2IP4A 1TM5E 4JSYA 4DABA 4L08A 1XNGA 2ZTMA 1G2IA 1ZSVA 4XB6B 2QSJA 4YACA 2WAOA 1X1EA 5BN4A 2G9UA 1C3LA 3HUEA 2WAMA 4UUBA 2JDID 3AFNA 4HLCA 2G0NA 3EMBA 4X54A 4HDMA 4F1JA 1E9EA 5ILGA 4P36A 5U1PA 1GNRA 5FHQA 1Q7TA 1GNTA 1J8DA 2LR0A 3GZTB 4GSYA 4UOZA 3MTAA 2EX4A 3HP1A 1QYCA 4BO4A 4WLEA 3F0TA 4Z0NA 1P0FA 4YO8A 5K6TA 1IBSA 2P5SA 3IO3A 3KT8A 5B7QA 3C87A 5JZBA 2Z3WA 2RK4A 1R12A 1S2MA 4LMBA 1ZH4A 1EE2A 1EM6A 1NT2A 4KRYA 4B81A 1KEWA 3IDSA 4AJIA 1D2AA 1ENPA 1FTQA 2P2DA 4PSVA 5CT5A 3SDSA 2Q6VA 3WNVA 4EQZA 1AE1A 1RQRA 2JFFA 4OJNA 2BGUA 2VG8A 2YIVX 2IYVA 2WJIA 4RVDA 4TN1A 4Y1RA 5DLYA 2IFTA 3ZWNA 5BQXA 1SA0B 3ZK7A 1DINA 4MQFA 2JFGA 1F2TA 4MKXA 1QE3A 1WZNA 2GD1O 3BWCA 1F9AA 4KXQA 4TXJA 4JR2A 5LXTF 2ATEA 4L4RA 3LT5A 2B1RA 5EQTA 5JJKA 1NOJA 2XNDD 1HETA 1BJTA 1QHGA 3QHQA 4M9SA 2OD7A 4IIHA 5BNTA 3TXAA 1E9DA 4D9KA 2BP7B 1N8TA 1ULZA 2JFUA 2NACA 4OXQA 4ZAWA 1GITA 3ND6A 2WBLC 3E9YA 5A04A 2OE2A 3DOIA 4BVJA 4UTVA 2XPCA 5E2BA 4Z53A 2XBMA 4MVWA 1GA1A 3DE5X 5BN1A 2BZ0A 1OIXA 2W2KB 5BV8A 2PZBA 5KOJB 1KDTA 3WQQA 2FCAA 3CB4A 1M9NA 3EAQA 3GGPA 3IEKA 1YACA 1YE3A 4PLCA 1X13A 3QLTA 3PE6A 5AOCA 4DR3B 1Q5PA 1Z8FA 4BLVA 3RUIA 2FYTA 4R1TA 3VZQA 3QX3A 4PW0A 3LUCA 3JWPA 4UCFA 3D1LA 4RHYA 5LD2B 1CRLA 4BTEA 2GYUA 1F1JA 4FR2A 2EFHB 4K3UA 4G65A 1FDUA 5E0KB 3TPFA 4FS8A 2YUTA 5EYPB 2IOFK 5ALYA 3EWSA 1JECA 1TJNA 3AHEA 3M4XA 1Z3CA 1ZX1A 3GT3A 4GBMA 5EJ9A 4YP0A 1FS5A 2XEXA 2XXBA 4OH1A 5HUJA 1U2QA 3WL5A 2PT7A 3VKUA 4DJJA 2ZTUA 3EEQA 2AVNA 4LCBA 1T36A 2AJLI 2QX4A 3KKLA 4MJLA 4QOEA 1FJHA 4UM7A 3V34A 1YAJA 4D9CA 3RSCA 5AUOB 1EX6A 3KB1A 5HKLA 4J8PA 4Q24A 4FQ7A 1XA4A 5GM1A 3RAEC 1JH8A 3GLSA 1P2TA 3CH5A 4AO7A 4MUHA 1EHCA 4CM8A 1A76A 1WXEA 4G5HA 5DNCA 1V3UA 1AKNA 1DC3A 3J80A 2BYTA 3CH7A 3DT8A 3RVNA 3WQSB 1IDN1 4FUQA 1SK9A 3N75A 3HU1A 3QF4A 3ZDYB 2GRUA 5F9MA 4B8ZA 5AI0A 5BQ3A 1YVDA 3H9QA 4UVEA 4S0XA 4J29A 5TT0A 1KNQA 1OFIA 3OPYA 1RAHA 5TDHA 3RGGA 1PWZA 3ONFA 2E5FA 2ESRA 4R1QA 2NVOA 2Y4NA 1E2FA 1MA0A 4NOLA 3V9AA 3DP7A 1AKVA 3K30A 2Y1KA 1LKZA 4QE3A 3EZ6A 5CTAA 1SXHA 4Q12A 3R41A 1OE0A 3CJRA 4FI3C 4MB0A 2B92A 1CERA 3IGFA 4OHWA 4WCVA 4CZ2A 1KBZA 2DFVA 2QTAA 3D9QX 1ENOA 3G5TA 2FPXA 1QO0D 3DOUA 5JXJA 3VR5H 1NWCA 1EBFA 4NE2A 2QMUA 4QARA 1XJ5A 4ZQFA 5FEUA 4RZQA 3N8NA 2P7HA 5JSKA 2WWGA 4J0GA 3CV3A 4EIWA 3FNFA 2WLTA 4BVHA 5B2FA 1GOTA 1LBTA 4RTSA 2C77A 2O5CA 2J9RA 4TV9B 1I9CA 4R16A 3ZGXA 3VHLB 3RC3A 1U02A 3O8DA 2H17A 1I2ZA 4N8SA 4G5XA 2XR1A 3I6MA 1J8QA 2RH4A 2WHQA 4HDCA 4KHZA 4OL0A 1YHZA 2G3YA 2Q29A 2R68A 5CX1B 1PR3A 3U6KA 3QF4B 1ACJA 4D0GA 2ZUUA 3L6CA 4RTLA 1F0NA 5IKPA 5HRAA 4NAVA 4QYIA 1BX0A 5LP6C 4R1OA 1BROA 5C3UA 1H0HA 1W29A 4LNAA 4G0XA 1IQUA 1E3SA 1NUPA 1OZAA 1A3CA 1WXGA 1W52X 3KYDA 4G2TA 3NM6B 2AB0A 1GPLA 3E81A 3L8FA 1K92A 3R24A 4MINA 3RGWS 1X8LA 2ZI9A 4DJEC 2ZPTX 5TVGA 2IXGA 4LHEA 4XM0A 2A7QA 5EY5B 5LNK1 3NS7A 3VR6A 2C04A 3JVUA 1W94A 1A72A 3E9EA 1T8RA 1TQ2A 2BGLA 3U1BA 2QAJA 3L1VA 5A2QA 5JVDB 1YHNA 1CUJA 2OFPA 1P3DA 3DO8A 4RETA 1B26A 1DEAA 4UVGA 3EF1A 1SAYA 2HU8A 3DAGA 4ILEA 5M5BA 1T1GA 2IEIA 5LM3A 3G1UA 4MGKR 3S29A 3QBEA 4YTEA 3VJRA 2Z4RA 8ADHA 1OH7A 4B47A 4IYJA 5HYVA 1NWHA 3IAAA 3LT4A 1T5SA 2IHVA 2SCUB 2DBRA 3KPYA 2J09A 2P77A 3I6ZA 4U4AA 4XM2A 3KOYA 4XXHA 1YQXA 3LY8A 4O2AB 3DEFA 2FW1A 4UTXA 4BNJA 3IAUA 2EP8A 4HPWA 2NAPA 1QZ3A 2V4MA 1DEOA 2AK2A 1PT5A 3OFSA 4X6XA 2XMCA 3VNBA 1CIVA 2WWIA 3DG9A 5C4GB 4ZJYA 5HK9A 2UYCA 1WJGA 4S24A 4NDAA 3TLKA 4F2PA 1JILA 1KC3A 3BFXA 1ZEJA 5L40A 4DG9A 3V1TC 3WB2A 1A8UA 2QT0A 4BNHA 3GUCA 3QLUC 4RQUA 4XRGA 3K9FC 4P53A 3KSBC 3D1JA 2WI8A 1E8NA 4YMLA 4QM7A 5IBPA 1SZPA 3DR3A 3EVDA 4FGJA 3O7WA 1E9BA 4GR4A 3VSAA 4EI2A 5I3CA 2QBYA 4ZGGA 2KPOA 2RGEA 4Q66C 4O2BF 3OFNA 3OQBA 2HWWA 1WX1A 5E6UB 1SG6A 1N25A 2JZOA 5FFMA 1Z07A 4CM9A 5KYTA 5BSFA 1P18A 2GCEA 2I1VB 3T7KA 1E2NA 2PD6A 1VJCA 3I2YX 4B4DA 1OQAA 2FSIA 2ZDHA 3B1KA 1OASA 4NOKA 1L4HA 4Q9NA 5CVEA 3NUZA 4R8MA 3KJZA 1SELA 1JEEA 4NK4A 3UCEA 2V7XA 4J6FA 4N40A 5CYPA 3AM4A 4BQFA 4FINA 2D1TA 3WOHA 4RA9A 5A5VA 4FHGA 2BMWA 2GTIA 1Z4QA 2GDJA 2QL6A 1TJ4A 3R44A 3R74A 4NU8X 1QG0A 2NV6A 3BZWA 1NFFA 2G67A 2QF7A 1S2GA 4BLWA 1KY2A 2ZANA 3AP2A 4FFOA 2RJ3A 3DPUA 4B09A 2ZUBA 2CF6A 1NR5A 2P62A 1UDRA 3BCRA 4G9GA 2G08A 4NLLA 2TYSB 2FY8A 3LQKA 1D0IA 2XADA 1ZN7A 4Y2PA 4PG8A 4HADA 5FUVA 1PLKA 3PDCA 5L4SA 3EBOA 2E9SA 3C8HA 5KDDA 1RYFA 5GAJA 5KTKA 1T6XA 5L8VA 2X14A 3B2EA 1RLTA 2C99A 1TAQA 4M0PA 1AB5A 4MWEA 1FNDA 1KR2A 5AOBA 5INTA 1WBDA 1JDZA 2W0MA 4PR3A 4BDTA 1Z5PA 1ZQ1A 4HNAB 4IXDA 4J1TA 2QTCA 3CZ5A 3EIUA 4KN6A 3U3ZA 3V1MA 2QJOA 2PJZA 3GAZA 3O4HA 1XU9A 1M2VA 2YICA 5CEFA 3SZUA 4A2QA 4LRQA 4HEA6 4TTVA 1AGRA 2Y1CA 2H1HA 1DTEA 4UBJA 5T64A 4BWYA 4EVQA 4G0OA 1M1NA 2DULA 2HDOA 3FYDA 2Q2VA 1XRNA 3W1WA 4E09A 3S8MA 4CMBA 2VTEA 1U7PA 3PVSA 1B8PA 2VP6A 4KGVA 1WPGA 2OBFA 4MUBA 4RLFA 4ARVA 4LZOA 1YQEA 3A37A 3UHPA 2A5YB 2WMNB 4COKA 1UBGA 2GAIA 1UP7A 1LK0A 2EWMA 4OUDA 4YAJA 1FLVA 3OFJA 3JD3A 1ZXLA 1AN0A 4YQYA 4GMHA 3VXKA 1D2MA 4C22A 1IXSB 1VC2A 4NZ9A 4C3ZA 4YT2A 4Y18A 1T35A 1TZCA 4GECA 3DO5A 4MSUA 4HQFA 3DOOA 4O4HA 3U4QB 1HSOA 2I5PO 4GX2A 3I37X 1FMTA 2RHMA 2IV2X 5HPYB 4B40A 3H1BA 4PC2A 2FSUA 2GHRA 4FWTA 2H1SA 3NRJA 4DGQA 3AONB 3FCUB 3TZBA 2F1OA 5JCPA 3EFOA 3W5DA 2JI6A 4BY9E 1EGVB 1N0IA 1SQSA 1O0SA 2XKJE 3T38A 4BLRA 1O8BA 3LJKA 3VSCA 2PDAA 3M9WA 5JI2E 4J0HA 1XVIA 3VYSB 3CMCO 3ZV3A 3QV1A 4ND5A 1YOVB 3BRCA 4XEHA 2HZ7A 3O3NB 1MKYA 4N82A 1QTIA 1TUBB 3T3NA 3QIAA 5DOZA 2ODWA 1UM9B 3JQ7B 4FBGA 1H6CA 1KOFA 1LX7A 3FAZA 1JALA 4OQMA 2HIGA 4LYAA 1Q1NA 1C4OA 2O7NA 2YYAA 4KQ9A 3TNLA 3VO9A 4AB1A 3D8SA 3I5XA 4NBNA 3ZVNA 1SQ0A 2NUBA 3E3MA 2PKWA 3LY5A 1JPNA 2DJIA 4INAA 5BUZA 1HEIA 1PR6A 2OO3A 1EVIA 1YZUA 4B3XA 3VR2D 5T8KC 4RMGA 5EG5A 5HFAA 4LTNA 1FFAA 4H35A 2D2IA 4F2GA 1AOXA 1YL7A 3CZPA 3GQBB 4XPZA 2R8RA 4KN9S 2VHYA 4LC0A 4CG3A 5K4HA 1ZMOA 3LM8A 1GG5A 1T2VA 1KYYA 4OX9Y 1XZDA 4FE7A 4C7OA 3E2IA 4OHYA 3ZGVA 3YASA 1FQOA 1DQYA 4H7EA 3SJCA 3LHFA 3MQFA 4JJ7A 4WZAB 3VOSA 5HSGA 3PJRA 2F3QA 3VTZA 2C7PA 3TIIA 4CWAA 1B00A 1K2WA 5JAPA 4M89A 3GDFA 2C2YA 3MCWA 4GZMA 2R751 1YOVA 2CNOA 5REQB 1E7QA 3D4IA 3N6VA 3A1WA 4FR0A 1MT3A 4GRAA 1N4AA 2HHAA 2UYQA 4JB3A 1RM3A 1ZHOA 3H0EA 3MINA 5HM6A 2IHTA 4NDZA 5AW1A 1WOYA 4EHKA 4P22A 3BD6A 2HLPA 4DV7B 1XDUA 2GS9A 1JSZA 1LNSA 3T1NA 2FW7A 3E22B 4QYTA 3ZHYA 3R5SA 5H9VA 5D00A 4TVSA 1Q17A 3LO8A 4F9GA 1GYQA 2P7IA 4W6ZA 4ABTA 1F6DA 2R00A 3U31A 4ICIA 1PFVA 5CDSA 3N2GA 1KGSA 4Z1MA 2GRJA 3D4OA 4RKQA 5FBHA 3PE3A 5JNRA 4DCSA 3PUKA 1HDYA 3W79A 2B35A 3CE6A 4ZODA 4V24A 4RVSA 4FK8A 2ETXA 1TDJA 2I99A 4ONEA 1NJ2A 3HV2A 1DAKA 2FWNA 1M6YA 3K53A 3H8VA 3LQYA 5D3QA 3D7LA 1E3LA 1S1CA 2XTAA 4KUEA 4BPRA 1RAEA 2ASVA 2C8KA 4TXHA 1K63A 2VS1A 1Y4UA 4IHQA 4LKOA 3VUFA 4BP1A 2JAUA 2XF2A 4G1BA 3VYVA 1QYDA 1OYOA 1YRWA 4OLHA 2AOXA 3OM9A 4JLJA 3S2FA 1A4XA 2O59A 4UNNA 4RPGA 3T7IA 3DB2A 3ULKA 5T3YA 2FAXA 2VUHB 2BRUC 2GZSA 5J1SB 4H3HB 5JT1A 4Q18A 5AXCA 3ZWXA 3U80A 1Z45A 1TVKB 1TTPB 1ZW1A 2EVWX 2RGWA 2I2AA 3CU5A 3IV9A 3LCCA 4G8DA 5L3RA 3R7WA 3HEMA 4OU4A 1MF7A 1FPMA 3WY9A 3F67A 4JL8A 4URFA 1UJBA 3N2KA 1TGVA 4W8OA 3ZHSA 2CF5A 4WIAA 5AM5A 2OGSA 4LCEA 3HGTA 1QFXA 4AWXA 3JQDA 3RYHB 2NTNA 4F38A 2ZJ7A 4GE0A 2XA2A 1IPEA 2L82A 3DTTA 3NDPA 4GNRA 4ZCSA 5LQKA 4FDAA 3UFXB 2WUDA 4NC9A 1LLCA 4GM1A 3KV3O 5F5XA 3QTLA 3L0PA 2XLCA 4XQCA 4DANA 5BR8B 1W6RA 3ZBTA 2Z1MA 1RM0A 2MJLA 1HSZA 1KU0A 4MV6A 4REMA 2P4SA 4WDQA 5AI6A 1O57A 3UMSA 3V48A 1XTUA 4E22A 3HVUA 3FTPA 4C4PA 1WUTA 1CUWA 3UK6A 4YJGB 2P27A 4M46A 3SQMA 3GJ0A 1CYDA 3H4MA 3P20A 1YB5A 4I55F 2ID9A 2XE4A 2V7GA 2QRVA 4ZRNA 2XGOA 4LBVA 3BOSA 3F73A 3EQ8A 4RK4A 4QXAA 3IKMB 2JCGA 3PR2B 4XWWA 1DKRA 1FFDA 1N0VC 2XHZA 2PUJA 3A9RA 3IILA 4FMCF 4BKQA 1EQUA 5LMNB 2W48A 4NEGA 2XH8A 2PNJA 4F3TA 3ZOKA 1N1EA 3TTTA 4PZYA 5ADVA 1W25A 3HKEA 3OOWA 4QUGA 4E2WA 3K6SB 1WEHA 2GJ9A 1VBKA 3DZFA 4PFJA 1V5FA 2HT6A 1AQIA 1EP3B 4ZEXA 3K9WA 3ETDA 3B6JA 2RHJA 2C5HA 3KJEA 5TT1A 1R6AA 2PWYA 1JHMA 4FOSA 4EG3A 3MCZA 3BTUA 4F8YA 4LF7B 4L85A 3M3DA 3ZC3A 1ECLA 5I7RA 3QJGA 2YWJA 1ULHA 4FSHA 3EVEA 2FVYA 1RRFA 2XB4A 4D2IA 2A86A 1IN7A 4WNCA 5F5LA 2JGRA 3O94A 3L7MA 1GTSA 1IU9A 2GARA 3ECCA 3SZLA 4CHGA 3MGKA 4BQEA 2XUHA 5AVQA 3V7YA 4BWVA 1AUPA 5AVVA 4Q4JB 3UK0A 3WVNA 2WSMA 3TZHA 2W2PA 4P3NA 4X0EA 4LUCA 3GPDG 3PIIA 3PC8C 1IATA 2YKGA 1S7GA 2HREA 3NGMA 5HMMA 5CA0A 1MO2A 3BH7A 3FPSA 2K5UA 3F6BX 2Q28A 3LUBA 4AQDA 1QU3A 1XNHA 4MV4A 3RAJA 4YJFA 3SXJA 5C53B 1O87A 4D3ZA 1NLFA 2RHHA 2VZ8A 5C9ZA 1MX3A 3E3OA 3PLNA 4IQ8A 4Q4LA 4MV3A 1QH9A 3F4BA 2XYPA 1WMAA 3D4PA 1DB3A 1N0UA 1OHHD 1WDTA 3DBRA 2O2YA 1RWBA 3H9CA 2BF7A 3MM4A 3OC0A 1DAEA 3UANA 1BEUB 3UC9A 3E27A 5HFJA 3KG2A 4DDKA 4DLWA 4HLDA 2WVGA 2NYRA 4P33A 2I33A 4MVJF 2ZRFA 1X7DA 5HTKA 3ZDEA 2IUEA 3G17A 4WZZA 2OPHA 4BBAA 2O8FB 1I3CA 1OXKB 4XQ9A 3K72B 4U8HA 3TR5A 5KIAA 2YRWA 4YK7A 3R9IA 2P6UA 4R8VA 4R9RA 5ICSA 2JLUA 4BLTA 2YQ5A 3NWJA 3A36A 4DIMA 1CJSA 5AKYA 2WHXA 3KD3A 1V8OA 1GT6A 2ZROA 4BNVA 3ZBQA 5CT4A 4NJMA 4A0FA 1XJ0A 3IURA 1AGPA 2CXPA 3LWZA 2G80A 4AJOA 1CF9A 3L04A 2CL5A 3GVCA 3M9XA 1P9RA 2J7PD 4KZPA 1NG9A 2RKWA 4G4GA 1L5WA 2MYUA 4YJFB 5TV2A 5TMEA 2IPNA 2GN0A 4PLWA 3MD0A 3N07A 4DFDA 1NU6A 2VUUA 3A26A 3Q3VA 2BE7A 2CCJA 2FTKE 2OYSA 4XJTA 1ZKDA 1LTKA 5I7WA 4MZDA 3GUZA 1HK7A 3RWBA 3IPRA 4BFXA 1NVUQ 3KOMA 4IIGA 3T3OA 1JKMA 1L5QA 2PWZA 2V5UA 4W7IA 5CT9A 3NT2A 4CLEA 7REQA 2Y6VA 3DFMA 3HK2A 1H2ZA 1WSBA 4HGPA 4J0JA 4N1AA 3HWSA 1UZLA 3LX8A 3K1ZA 4FT2A 4OOFA 2I6GA 4JYAB 2YN2A 3FVWA 5CAEA 2A5FA 5HDBB 1ZI9A 4CQMA 2V5VA 1IQRA 4IEEA 1QTNA 2OYCA 4A0QA 5C32A 3KQNA 4L9WA 4RULA 2GD6A 1XFAA 3DO6A 5FP0A 1ELOA 2EKDA 4DR1B 1UH5A 1GG9A 1NVWQ 2SKEA 5LQAA 4K1LA 5ED4A 1C1DA 4W8GA 2JATA 3GLUA 4C0LA 1OGJA 1YDWA 4GI3A 4ZZ0A 5LKAA 1JQJC 3CSSA 1DUIA 2I7DA 1C50A 2XBLA 4P31A 4KDEA 1SXJE 5BN4B 5ES4B 4DCOA 5KNDD 5MDHA 1HMYA 1O95D 3UJPA 4AAYA 1QK4A 4TL6A 1D8TA 4EHNA 3WL4A 2ZWPA 1QYRA 3AIOA 1A9XB 1Z12A 4LIPD 4ZVLA 2VJDA 1HI9A 3G5MA 4REOA 3KQKA 2OB2A 3WI7A 4TYNA 3KCQA 5FTLA 1D4AA 4QBKA 3OLXA 4M1QA 1EVEA 1R5JA 2IP1A 1P7CA 4OI1A 4PO9A 1T5TA 10MHA 2FWMX 1XVUA 2I7TA 1QTRA 2X58A 5F2KA 3Q2IA 3OWOA 2CLKB 1MNQA 4HV4A 1CZUA 4XIGS 4OLFA 4AW9A 1FP6A 3TTXA 3GJ4A 5M7EA 3G7UA 2NZYA 3OQVA 3MTBA 1YDHA 4Y1RB 3U61B 2C3OA 4ZQEA 4NZPA 3ANSA 4GPEA 1VG1A 5K03A 3SNHA 1T5OA 2AD1A 2VF2A 1C81A 3KRTA 1WHSB 4YMWA 3R7NA 4D3XA 3QWFA 2CCGA 3CRNA 3HCAA 2VJAA 3MWGA 4LZZA 4R1NA 5E1BA 4AYXA 1C1DB 3P32A 1HLGA 3JR7A 1YR2A 2CL6X 4P4SA 2HRBA 2J4DA 4RVNA 3N70A 3FTFA 3F46A 3JYHA 3CEMA 1CQJB 1SIBE 2AH5A 5B1SA 1DVRA 5LB2A 2VEDA 3JX9A 1Z8DA 2V65A 2QRUA 4AZWA 1EDBA 4TVOA 1XRSB 3D6HA 2X2EA 5ENZA 4BVFA 4BN0A 4G63A 4DNQA 5G40A 3KVOA 1A9XA 2Q45A 1YFZA 1D2NA 4US2R 4WWHA 1DL5A 1EZ1A 3HPRA 3P2EA 4G3XA 4I5DA 5IJ9B 4E4RA 4M21A 2WV9A 4CVNA 2ZS8A 4HEJA 3MWJA 4DV4B 3NJRA 1CC1S 1N3LA 3U4CA 3B1VA 4P3PA 1E3MA 3QPWA 2V6GA 4LJ6A 3EGXA 4N18A 2NPIA 5LLTA 2C7RA 2O8DA 4M8KA 2DT8A 3ESBA 1DWUA 4POAA 4BNXA 3PGKA 1YC5A 3IDAA 1BU5A 3EYWA 2R8XA 1T36B 3CZ4A 2YBEA 3K2QA 4JJEA 3RUDA 1DUVG 3TRKA 1QVRA 5FBRB 4OMCA 3W78A 5EMHA 4MW1A 3UF0A 4WBNA 4ZEWA 5A7FA 2PCJA 3NIDB 1M75A 4XSVA 4JP3A 3KYCA 5BWBA 2I4IA 3FCCA 1MPTA 2W11A 3CX8A 3IH5A 4OQEA 1I5RA 4XVUA 5KVQA 3ZD8A 2PJDA 2VHUA 3CZCA 3WB9A 1YMVA 2BFDA 3OP1A 1U5BA 3NP9A 1QSGA 1SR8A 4GI5A 4ZQGA 3SQLA 3WG9A 3TSZA 2VSQA 4UU7A 4Y2QA 4KR3A 2QPOA 2HIMA 2VJQA 1JEOA 1WULS 6LDHA 3HU5A 1O54A 4QVKA 2E89A 4ZZ1A 3EWIA 2FN7A 3P9RA 1ISGA 1JKIA 2F3RA 4QUHA 1MH9A 1W5TA 5BQOA 3I2HA 4HN9A 4L5BA 4CMCA 1XZKA 4LDJA 1F2UA 2JGNA 2BLLA 4X63A 4PWYA 4UBLA 2HA6A 3KTDA 1KI2A 1R9JA 3NOVA 3OEHA 1GFZA 1XDGA 3R2JA 5CA1A 4Q7JB 3TZCA 4C4YA 4K9RA 1AF4A 1T0UA 1V39A 1IQPA 2FJPA 2ZIZA 3B8EA 5AW0A 1LTHR 2F64A 3ZU2A 3O03A 1X7YA 1DRJA 1YSCA 3JPWA 4MQMA 4QLBA 2X7JA 2IIQA 1I3KA 3MHPA 1J20A 4P7KA 5CNKA 5LZ5A 4CEIB 1AXEA 2IA5A 5E2IA 1BVRA 1P4AA 4TSFA 4GNKA 5FOTA 4CDNA 4FGKA 2IUTA 3GYGA 1CLEA 3FWZA 3LUFA 3LXRA 4HHEA 3Q7RA 4QRIA 3EPKA 5I7SA 1JDBC 4MKFA 3B3QA 3UJ6A 2HSWA 2IBSA 4HTFA 4L8WB 4DSNA 4E15A 4BMPB 3OJFA 3Q6NA 4YWHA 1E2UA 1QFZA 4IPTA 4MR7A 5K0LA 3HCCA 3OECA 1GQFA 5MF6A 5K3BA 5DYGA 4DRXB 1TCAA 2GNOA 2Z5GA 4G1CA 1LJ8A 1KYVA 3HZHA 1VTKA 1S3FA 2NXWA 2FPGB 4JQOA 1K6JA 4EVSA 4AZ0A 4MQLA 3BXHA 1LXCA 4KPYA 4I6GA 3OCCA 3OJWA 1JLLB 3L1HA 4BTVA 4CQMD 3O84A 3CF4A 3EGEA 5A2GA 1XKXA 2J45A 2RC5A 2YY7A 1EP2B 2BONA 1QIEA 2Y27A 4G25A 3AFMA 3B60A 3QY0A 1O77A 4J16A 1DDOA 4NONA 3R5KA 1OPRA 5EXEA 5G1NA 2P2SA 1G6OA 1H65A 1L7BA 1CJBA 4RD0A 3SBOA 3ZUPA 1TU0A 2RGNC 2HA0A 1ZISA 4ZOAA 4KXXA 3A1DA 5ALMA 1OREA 1XZIA 1KKMA 2OCXA 2YV1A 2QUIA 3EDMA 3GXOA 3R6DA 2NO9A 1DV1A 2Z2XA 3I3OA 3QELB 1DO2A 3AWDA 1GCOA 4JBXA 4OQYA 2Q1TA 2Q3DA 1X1QA 2WD7B 3QWBA 1JGTA 3BX1A 1LI5A 3F3YA 3R0XA 1EK5A 3GFVA 1CY6A 3O8QB 3Q6MA 5AJXA 1L7DA 2GR9A 4CMEA 2JA2A 5T3UA 2NQ2C 3TM5A 2WKRA 2ZAGA 2QYHA 3OCUA 1L8LA 3R5JA 3ZDCA 2WZCA 4IXNA 1XZLA 4JI6B 4GG1A 1XAJA 5H68A 1WXWA 1XXHA 3H2KA 1JR3A 4WBSA 1OFGA 2J46A 2GEFA 2X2OA 4U39A 3B6IA 3X1XA 4LX8A 1PN3A 4V0QA 3B38A 1HDOA 2O8VA 4R3UC 1FDOA 3QEMB 4MGZR 4XVRA 5CFLA 1JH9A 3JU3A 3G82C 4LXGA 1OZHA 3O1HB 1R6TA 3ZWVA 1QP8A 1B16A 5E6UA 4CTNA 2OFXA 2JIZD 4RADA 1VIYA 2ONKA 3GIDA 4WLFA 4ZI7F 4I9UA 5P21A 2QD3A 3GD5A 4MUAA 3RV3A 4DY6A 3ZY5A 4MUXA 1CYEA 1U7ZA 1BAPA 1CY4A 3IMEA 3M70A 4KFSA 3H5RA 1ZCBA 1Z2EA 3WKAA 4JA0A 3U9SA 1AKTA 4AG5A 3PLAE 3PD0A 4LRUA 3AP3A 5BSMA 1ECJA 2JASA 5E7MA 3UK7A 4DNXA 3KOXA 1ZK3A 1DBVO 2RGUA 2HF8A 2C9YA 1YAHA 4M49A 3C8MA 2X0DA 4RJKA 3H8WA 3PS9A 5KNCA 2V59A 3Q0IA 5EXDA 2JFOA 3THOA 1IZ0A 2AOTA 2FDRA 2P6MA 3G7NA 3I1IA 4Q15A 2G5GX 1V1RB 2P69A 3OO0A 1IHOA 3PR3A 2BMFA 5EUBA 4DMGA 4PC1A 3QI2A 2R6R1 3NRCA 4NG4A 3WISA 2XUOA 4JMPA 4QXQA 4YH1A 4OHMA 1TUEA 1ZH2A 2YNMC 3ISTA 2LRHA 2WKPA 5AVOA 3COJA 5L7WA 2WC1A 4PQEA 2VDKB 2D59A 4MR8A 1KJ8A 1K7CA 4LZLA 5DKFA 3SYLA 1TRHA 5H4GA 1YO6A 2PQ2A 5KEIA 1M2OB 4G4IA 5DT2A 5MN4A 1Z13A 2Q1UA 1BQ3A 2Z5LA 4BZPA 3UWPA 2BGKA 1USWA 3FROA 1PNQA 4JDUA 4IJUA 1S2LA 4YAIA 1MTZA 1RQXA 1W2HA 2BISA 3G9XA 5FUWA 3ILHA 3D43A 1HOTA 5E8RA 5K01A 4TM7A 5LZ7A 3CX6A 3QX7A<