1U5AA

Plasmodium falciparum lactate dehydrogenase complexed with 3,5-dihydroxy-2-naphthoic acid
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
316
structure length
306
Chain Sequence
b'APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase
publication title Mapping the binding site for gossypol-like inhibitors of Plasmodium falciparum lactate dehydrogenase.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 114
structure length 306
sequence length 316
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2004-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1u5aA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1u5aA02
5CHEA 3CE6A 3AUAA 1R66A 2W90A 4IJKA 4NU5A 3GDFA 3EMKA 3IAHA 1UZNA 1K6IA 1H0KA 3WNVA 2YZ7A 1WAMA 4AVYA 1PJSA 1HDYA 4MKZA 4Z9XA 2EJWA 3GHHA 5F3RA 2ZATA 4WECA 3PHHA 4JQCA 3HDJA 4F6LA 1J0XO 4BUCA 1XHLA 2HU2A 3GZNA 1ONNA 3PPIA 3DC2A 5JFOA 2NQ8A 4BKQA 4XQEA 2VNAA 4YYZA 2E49A 5ICSA 5EMHA 1TVEA 1C14A 1ZJYA 2EJVA 2A9FA 2FPPA 4BQRA 2DPGA 2XAAA 2RHRA 3WGQA 3ZW8A 3ROQA 4E2XA 1AHHA 1E6EA 1B2LA 1X0VA 1XR3A 1WMAA 3O03A 3OEWA 4OQYA 5H81A 3AI1A 3OECA 4ZVVA 2P9GA 1GU7A 3HDQA 3JYNA 4NJOA 4CMGA 1QLHA 1QV6A 1TT5A 3UUWA 1FDTA 4CLRA 2BFPA 2B5VA 5EJ2A 2YY7A 4MP3A 3K8ZA 4YQZA 3O38A 4CM9D 1PGNA 1BXGB 3VHRA 1V35A 2Q49A 4F46A 3H9QA 4XJTA 2V6MA 8LDHA 1E7WA 4BGEA 4MIEA 4GI2A 5GY7A 1J49A 4ALLA 1IY8A 5T8KC 3W6UA 2X86A 1VE9A 3EZLA 1E7YA 4Y6SA 3GRKA 3P7MA 1GUZA 1W0CA 4IXWA 4U5QA 1Z75A 4YACA 3ZN2A 3NGXA 3A1NA 2ILTA 2YHUA 3ASUA 1NAHA 2VT3A 3PLNA 2EKPA 5CG1A 4EJ6A 3PK0A 1UUFA 1ZXLA 1ZCJA 3DHYA 5A04A 5BT9A 2WMDA 3H65A 5DDIP 3TSCA 4L75A 3F46A 3LT2A 4DREA 1W8DA 2YHIB 4OL9A 5G0UA 1H6DA 2Y0DA 2IXBA 4K1LA 2FRDA 3JQBC 2ZTMA 3ASVA 2Y1GA 3PJDA 3DBLB 2AEMA 4J1QA 1XA0A 3WS7A 7ADHA 3KSDO 4IMRA 3PHJA 2GRAA 5JLAA 3JQAD 4O59O 4XQ9A 3Q0EA 3EYWA 4M8SA 4E2WA 4RVHA 1I8TA 2HSDA 3LLSA 3WMWA 2QHXA 3OMLA 1GD1O 1NQAO 5TS3A 5TIIA 2GNAA 2X5KO 4CLOB 1Y5RA 5A3VA 1E5QA 1PJLA 4W9NC 3DFZA 4P22A 3H7AA 1EUZA 1J4AA 1DB3A 2O7SA 3VZQA 3W8DA 4XYMA 5JW6A 1XCBA 4UEJA 4CMJA 1ZSNA 5EL0A 1DRVA 1YL7A 4FCCA 1A72A 1QKIA 1P45A 2CDBA 3ZV6A 1KVQA 2YYYA 4RPGA 3JTMA 4RF2A 5LCXA 3I83A 2F1KA 4F3YA 2TMGA 2Y99A 1MB4A 1N5DA 1OBFO 3T4EA 4OO3A 4BV8A 2WEKA 2GPTA 5TLSA 2DLDA 1VSUA 1DIAA 3KYBA 4D0RA 4PCVA 1RWBA 2DTXA 1U1IA 3GLQA 1DJNA 3U9LA 3KLMX 4G81A 4PLHA 5DCUA 1Q0QA 3GEDA 3UF0A 1B8UA 1LNQA 4IPTA 1V3UA 3JD2A 3LQFA 3CEAA 5HWSA 2IZ1A 1FK8A 2HMSA 3QW2A 6LDHA 4W7HA 5I7SA 3BMNA 5IAAA 3EVNA 2O3SA 2VTEA 2O3RA 3AM3A 2OFPA 3PYLA 4D45A 4A0SA 5JMPA 1FF9A 1NQOA 4WNIA 1F12A 1LSUA 2ET6A 3EHEA 3DQPA 3PTZA 4DRYA 3GK3A 3H9JA 1C1DB 4IJWA 1KC1A 3CUKA 1R4NB 2Y05A 2G82A 3TPCA 3WFIA 2HMTA 3K92A 3Q2KA 1KETA 5F5NA 3PQFA 4FFPA 4J3FA 1YB4A 1JLLA 1XKQA 4GSKA 4N5LA 4LGVA 4YR9A 4YQYA 2CVQA 4J1NA 1C3VA 1LEHA 1HEUA 1E5LA 3RUIA 3S2FA 1XQ6A 3PGXA 3P5SA 3ZU3A 5TGDA 3FNHA 1R6DA 4P4GA 3DL2A 3ONEA 1VJTA 2BFOA 1E0DA 4LN1A 3A28A 3D4PA 4IDGA 4K28A 1PL6A 3ZNQA 2VYVD 2Q4BA 2X58A 3GZNB 3S8MA 5IXYA 4Q3BA 5C7LO 5BNTA 3U0BA 4MVJP 1HE2A 2JCYA 4GX1A 4WOKA 1SAYA 1DC3A 4GX5A 2Z1MA 1SPXA 2IXAA 1M6HA 2GDZA 1GY8A 3KM0A 2WWRA 4J7UA 1OI7A 3WQSB 2JFGA 4CQMB 2JD1A 2X9GA 5AXDA 1OMOA 1YBVA 3UFXA 5C5IA 3ROKA 1ML3A 2OL4A 2J6IA 4J4HA 2NUAA 5CFZA 5U1PA 1E7RA 4YT2A 4FOSA 3V2UA 3DZKA 5JCJA 4IGFA 4CLRB 2IRWA 3WGZA 1LDBA 3WJ7A 1I33A 3U3XA 1LXCA 2NADA 3OETA 2P4QA 1DO8A 1JKJA 4E30A 1NFRA 1C0PA 3U5TA 4HP8A 3ON5A 2ZK7A 4CMKA 3FD8A 3NDJA 2HJRA 1B3RA 3AW9A 4XR4A 3GGOA 1TT7A 3VTFA 4O1MA 2ZYGA 3TF5A 2W2KA 2XOXA 4DL9A 1MX3A 1MG5A 2GZ2A 3U4CA 3TL2A 2Q1WA 3QE3A 1LX6A 3DZHA 3G17A 1LTHR 1PZHA 1KEWA 2YV1A 1JDJA 3PWZA 3R1IA 5HS6A 4Z0TA 1YBMA 1MXFA 4GVLA 3UCXA 3VOSA 2ZQZA 1DFGA 4OKIA 1UR5A 3Q9NA 2X7HA 4DLLA 4KUHA 4ZD6A 4R5HA 1P1IA 1CRWG 1E3JA 2D4AA 3P19A 2CY0A 4OJNA 5A05A 1XEAA 1CF2O 3DR3A 1O6ZA 2X0RA 4BO6A 1G1AA 3LVFO 4BNWA 3B6ZA 3JQFC 5EN4A 3MOIA 2PZKA 4E12A 4B7XA 4N5NA 3OF2A 2BMAA 4MVJM 3ZNOA 1ZFNA 3IOYA 5DBIA 5C7OO 1H6CA 5AYVA 3OJFA 1X15A 2CDAA 4IDCA 4R41A 4R01A 5JAQA 3ABIA 3OJOA 5I7EA 1Q7BA 1TEHA 3K2BA 4A2CA 1KEPA 5L51A 4PZDA 2JD2A 3WG9A 1KVRA 5L4SA 3WLFA 3OSUA 3VZSA 1A71A 1TB4A 3FI9A 3GH3A 4S1VA 4NHEA 1KOLA 4UREA 3NGLA 4AJKA 5MGBA 5F1OA 3OA0A 4DLBA 1ZJZA 3NUGA 4ZQBA 4BOYA 3VDRA 2C0CA 1UDAA 2AA3A 1DC5A 2RH8A 4IDAA 4RVUA 1H93A 1ZSYA 1DIGA 2VHZA 3HE3A 2YFQA 2POQX 5GZ1A 4I5GA 3DBRB 2NVWA 1V9LA 4PG5A 1S6YA 2EEZA 1HZZA 3OQ1A 4YA6A 1H9AA 3DMTA 4AICA 3BMNB 3TDKA 1ZK1A 2IEBA 4ND5A 1ISGA 4L76A 4TMFA 4AFNA 4ZICA 1O8CA 4XQCA 3ZI0A 1BDBA 1D7OA 4Q3NA 1GQQA 2ZB7A 3L77A 1HDGO 3LC1O 3VH1A 3BAZA 4U0KA 2DM6A 3SC6A 2W2LD 1PJBA 2WD7A 3EC7A 3OJLA 1WWKA 2EIHA 1AHIA 3GUCA 1EMDA 4NZ9A 5I7FA 4NK5A 4E5MA 3PQEA 2PZMA 2W8ZA 4XB2A 3WR5A 1HETA 3V1UA 1ADGA 4HNGA 1OOEA 3JQ9C 3MJSA 3Q11A 4HNHA 1SBYA 3VPHA 1M6WA 1LLQA 1LQTA 4J16A 1YL5A 4FGSA 3H2SA 2QRJA 1T26A 4J49A 1UXHA 4FGWA 3OBBA 3LC2O 4RO0A 1WZIA 3DO5A 2TMDA 2I3AA 4UVDA 3VH3A 1K6XA 3KYDB 2JHFA 2XXBA 2BI8A 3KSUA 1LLCA 4CM9A 3C7CB 4PLYA 1BW9B 1J5PA 4MINA 3A06A 4KQWA 3WSVA 3T7CA 4FC6A 3H3FA 4U6SA 4EUFA 5L4LA 2IE0A 4XGIA 4HY3A 5DT9A 3NT2A 1RYDA 3PHLA 5ER9A 4YRBA 1X7HA 3RI3A 1DDOA 2DBZA 3ONFA 2WD8A 3WFJA 1ULSA 2QYSA 2NU7A 3RUFA 3GVXA 4CM5A 4BKOA 2X22A 3AJRA 4PGFA 1Z7BA 3H8VA 2OOSA 3GC6A 2RAFA 3C1AA 1EFKA 2A35A 4CV0A 5T6BA 2FR1A 2PFGA 3F47A 3AM4A 2EXXA 1VL8A 5G0SA 5EIOA 2X5OA 4A5OA 1ZZEA 4JP3A 5KTKA 3ZWYA 5J23A 1P9LA 2OORA 1MC5A 5ILGA 1HSOA 2UVDA 1BVRA 1P3DA 2FMUA 4IBOA 2ZIZA 1HYEA 1JAXA 4R5MA 1Q7GA 4CMHA 3TRIA 2J3IA 3JQAA 3ZWXA 3OIGA 5DCYA 3V8BA 1B7GO 4RZHA 2IYPA 4Q39A 3QV1A 3JQ7A 3VPFA 1N2SA 2DTDA 2FPIA 1K0UA 1U9JA 4BNKA 1E3EA 3BMCA 5L3ZA 3FTPA 3JQ6A 2H5LA 1ZO8A 5IZCC 1CYDA 4XIYA 5K6AA 3E6AA 4P4LA 5G4KB 3I3OA 1GCOA 1NPTO 1P1FA 2FPGA 4R1UA 5HRUA 1EE9A 1HE4A 3JYPA 4M86A 4J4BA 4DPKA 2J5QA 3AUSA 3PVZA 4QTZA 4RCVA 4BNZA 2JAHA 4XZ3A 3ZH2A 4RGBA 1HF3A 3OQ6A 1UXKA 3INTA 5G4LA 5A5FA 3ANLA 3G1TA 3I9JA 4GVXA 3ZU4A 1U4SA 1YB1A 4E5KA 5KNLA 4ND3A 4ZA2A 1LDNA 1UP6A 2IZ0A 5AXCA 4DLAA 1HLPA 5G0WA 4WCFA 1LC0A 4JX8A 3GR6A 3INRA 2CF5A 3ZHZA 4YJHA 2FY8A 3W8FA 4L0QA 4A73A 4WK6A 3H4VA 2AQHA 4YJGB 4E13A 3DBHA 4CM6A 4NFYA 5JCXA 1LRLA 3G0OA 4URFA 3E82A 4X54A 4XYGA 1GCUA 1ISFA 1E77A 3A14A 5ENDA 1P0CA 4J2HA 1N7GA 3NJ8A 2NTJA 4JP2A 3RIHA 3SC4A 1BDMA 3IP3A 3K96A 3WGHA 1VC2A 2HKIA 4L4XA 1DHRA 1XGKA 2YFHA 3WTBA 2BFAA 2J3KA 3PHGA 1T24A 2Y1DA 2O7QA 4KP7A 4QFDA 1U5CA 4XYEA 3VKVA 1T2CA 3ZW9A 4R51A 4Y98A 5I8WA 1KVUA 4JGBA 3CH6A 5U9CA 4CODB 4CJXA 5THQA 3DHNA 4HFNA 4JJIA 4PIVA 1Y7TA 1E1MA 4MOWA 4R54A 5T67A 1BSVA 1UZLA 3FR8A 4RZIA 3WIEA 3KVOA 4RV9A 4DMMA 1YL6A 4IDDA 2WD7B 3JQGB 2Y0EA 3FBGA 3WB9A 4DVJA 1QRRA 4FFLA 5BNIA 3RJ9A 1YOVA 4TRJA 5BR7A 1GFSA 4CV2A 1CWUA 3IJPA 3P2OA 1HDCA 1W6UA 1NX6A 1I3KA 4LW8A 1GR0A 1PJTA 4N5MA 1NFFA 2D5CA 2G17A 1ZKMA 4EEZA 1ZUD1 1LLUA 2PGJA 3EGOA 3GMDA 3IJRA 3PFWO 4BB5A 2WJPA 2DFDA 3CKYA 1LC3A 3KEOA 1SNYA 5HS4A 1LSOA 4Z6KA 1IOLA 1IB6A 3OP4A 1ISJA 1YQGA 3HADA 5KVCA 3LT0A 3PIDA 4MKRA 2CNBA 2C82A 4BNGA 1NPYA 3RWBA 2OO5A 1HSZA 5TRTA 4FFOA 2QG4A 4D42A 4CPDA 3MJVA 4PRKA 4L74A 1B8PA 3L4BA 4PG4A 4PLPA 4EUEA 2DKNA 2XPCA 1YQDA 3M2TA 2DTEA 2JJYA 4FW8A 4NFHA 5JDCA 3MJ4A 3R0IA 3GEGA 4CLXA 1GADO 1VRWA 4O63O 5THKA 4NBUA 4CMEA 1GEEA 5JAZA 3STHA 5A9SB 2NQTA 1D3AA 2O3JA 4J0FA 1N1GA 1ZNQO 4XDZA 4YEDA 1UXGA 4LSWA 2AQ8A 1B3BA 4IMPA 4XJSA 4BQPA 1OZAA 3I1JA 4E5YA 1NBOA 3FHLA 5BQFA 2GYYA 4FJ1A 3F1KA 4TVOA 5DBFA 2E82A 3U4HA 4ESOA 3DEYX 3JD4A 4YVFA 4GPD1 2CVZA 3VH4A 2UYYA 3ANNA 3AM5A 4B7CA 3WOHA 4J4TA 4U8GA 3RBXA 3S2EA 4BO3A 4WEOA 2OP0A 4K6CA 5TC4A 4DC1A 1X1TA 3EK2A 1N9GA 4R4JA 2PKRA 1R4MA 4H7PA 3OJ0A 4WNCA 2I65A 3Q2IA 1A4IA 2DPHA 4IJUA 4MP6A 1HDRA 2NVBA 1KEVA 2EW2A 3JQ7B 2E48A 2EF1A 2JHGA 5JYDA 4AJOA 1T1SA 1EVIA 1XLTA 4RPHA 5HM8A 4D7AA 3D3WA 2NNLD 1U3WA 2BD0A 4NMHA 2D1YA 4DBZA 3JYOA 3PIIA 4O5OA 4QT0A 2VUSA 4XX0A 3AI3A 3ETGA 2DBVO 2FZWA 5K9ZA 4BMSA 2JFFA 3KTDA 2NSDA 1QXSA 1N1EA 4B4WA 3RUDA 3GRPA 4YDRA 3KHUA 3AFNA 4M49A 1HDXA 2Y1FA 2J8ZA 5K0ZA 3OICA 2D8AA 4NQZA 4UVHA 4B3IA 5L53A 3E9MA 6ADHA 3HNPA 3QVSA 3QY9A 4NK4A 4WCFB 2VYND 1EUDA 3QVTA 4GL4A 2DBRA 3PGJA 4QQRA 2YQ4A 1L1FA 3C1OA 3NTOA 4D0SA 3RAJA 4F45A 3DBHB 4UAGA 1Z45A 1EEHA 3L07A 5EQDA 1BXZA 2DBQA 3I9KA 4HBGA 4IIVA 1M76A 5L7YA 4B3JA 2OBNA 3LDHA 4R1NA 1YWGO 3JQDA 5JDIC 2QQ5A 4WPGA 3PFFA 1P44A 2W2LA 5C7IO 1JWAB 1HL3A 2B37A 1K2WA 1Z7EA 4L4RA 3HFSA 1T2DA 4ITUA 2C20A 4PZCA 2OP1A 3GFGA 1VKOA 1HDZA 2C2XA 4J2OA 5EESA 4XGNA 1NHGA 1GZ3A 2C2YA 3S2IA 3Q9UA 4CMIA 2VHWA 1DAPA 4CV3A 2GD1O 4BGVA 4OAQA 5B4VA 5CEJA 4ZN6A 4WASA 3OIDA 3BHMA 5JAMA 3H9GA 3PQDA 1PR3A 4XYBA 1EVJA 1XQ1A 1ULUA 3AOEC 5TF4A 4BNXA 3B1FA 1LSSA 1YOVB 2X0JA 4GWKA 4R3WA 1PZFA 3PWKA 4JIGA 4KTTE 4XCVA 1X0XA 4HWKA 1A9ZA 1CDOA 3DZJA 3D5QA 1C1XA 3BTUA 1E3WB 4IJVA 2CD9A 1GUFA 5GZ6A 2OBYA 1DC6A 4ALIA 1T4DA 3MOGA 1PJ3A 3F1LA 3ZHXA 1KEUA 2ZKLA 3GG2A 4KQXA 3DZFA 5DP1A 1ZEMA 4NG5A 4CUJA 5T57A 4DQUA 4TRRA 2HCTA 3IUPA 3WQQA 2Q1TA 4BNLA 2HUNA 2NACA 4AJPA 1B14A 1U8XX 3FBTA 4NJMB 4WJZA 4XDYA 5KVQA 4HFMA 4YJFB 1T2EA 4HFJA 1NHWA 1HTBA 1G6KA 2BELA 3ITDA 1SOVA 5JE8A 5TQVA 5KVSA 1MXHA 2GN9A 4W4TA 1JAYA 1Z73A 4IS2A 4WLUA 1N7HA 2FSVA 2CDCA 3UKOA 3VDQA 1CQJA 5KKCA 3ICPA 3UN1A 3R3JA 2PD4A 4PVDA 4FJ0A 4TZKA 4Z9YA 2BGMA 1V8BA 2C59A 1T25A 2X6TA 3ZWOA 1NQ5A 5JY1A 2FHSA 2EW8A 3DB2A 2LDBA 1YB5A 5T8KA 4DYVA 5DP2A 1V0JA 3SEFA 5I7VA 3RC2A 4BO0A 4FIZA 5I9NA 1I2BA 1RM3A 1N9GB 3H9UA 4DQXA 1BWSA 4IZHA 3FSRA 4IY1A 3N7UA 1NNUA 1CERA 3NJ4A 5TX7A 3WGTA 4CQLB 3I9OA 3OHSX 4I5DA 4A03A 3OEYA 5AVOA 4TRNA 3H3JA 3JD3A 5DNAA 2OXIA 2GASA 3D3WB 3E8XA 4L4SA 4CMBA 1I10A 4NDNE 4PLFA 3ZWPA 3JQBA 2Q99A 3KYCA 4Q3EA 4L9RA 4Y6PA 3BMQA 3E5MA 3F3SA 3ETEA 4YT5A 1E1LA 3QRWA 1M2WA 4QEDA 4PG6A 3AUUA 4PLGA 4RQUA 4IGEA 4R68A 3B1JA 5TJ9A 3EW7A 4EITA 5A06A 2GUGA 3QSGA 4W9NA 1BG6A 3OA2A 4OMUA 3QVOA 4NR0A 1EBFA 2YV3A 3SVTA 4TVBA 2V6BA 1NR1A 1FDVA 2PY6A 4DPLA 4K26A 1DJQA 2DUWA 1A7KA 3LF2A 4YB8A 3V2HA 5KWEA 1HWYA 2HMVA 2Z5LA 1EQ2A 3AY7A 4KMSA 1DFHA 3M2PA 5IXSA 4CLDA 2X5JO 3FWZA 4W99A 4DMLA 1JVBA 1ZSVA 1H2HA 2X9NA 2JKVA 4OYRA 5L40A 4ILKA 5EINA 4WGGA 1TT5B 5TJHA 1YH3A 3I5MA 3VPGA 1SB8A 1X7GA 1E92A 3ST7A 1ZK0A 1Y9EA 2O2YA 3O8QA 4P8RA 4UUOA 1G0NA 4CM8A 1SEVA 4ZRMA 4DBVO 1TXGA 2X0NA 4WLFA 1YO6A 3CZRA 2B36A 3ENKA 2ZTUA 4RVDA 5B1YA 4CMIB 4HKTA 4P38A 3LLVA 4OOFA 1R15A 1X13A 5G0VA 4JBGA 4BVAA 3BIOA 1JN0A 1W73A 1FJHA 1CJCA 1YS4A 3K2EA 4HX5A 4WKGA 4DYDA 4AJ2A 4BO1A 1QYCA 3HN7A 2AG8A 3GMSA 4IXTA 1GQYA 1EBUA 4ZHSA 5C3MA 4B4VA 3PZBA 2FR0A 4XQGA 1C1XB 1NP3A 2GR9A 1IULA 1PS0A 3EAGA 4NBRA 4YRDA 1ZK2A 3F6YA 1MG0A 3WBBA 1LDMA 3DBVO 2DVMA 2QZZA 1M66A 1ENPA 2DT5A 3CZMA 4GBJA 2ZB3A 4R1SA 1XDWA 1SZJG 2F00A 1KVTA 2IDZA 3AY6A 2O3TA 3CIFA 1I36A 4J1SA 5I9MA 3ANMA 1YQXA 1Q0HA 3NTRA 5KJ6A 4NBVA 2ZYDA 2HK8A 4P4NA 2O3UA 3AI2A 3L6OO 2P91A 4D41A 3GVPA 3K5PA 5CPBA 4UVEA 5FFFA 1I24A 3RQSA 2W98A 1QYWA 4J91A 4OGWA 1GV1A 1H6AA 1NR7A 1IHYA 1O95A 3KEQA 4OXNA 3KB6A 4INAA 4BKUA 2V65A 1XWFA 4C7KA 2VZ8A 2NU8A 2WSBA 2QX7A 3CTMA 3ZDFA 4E5NA 4RQTA 3DOOA 4ALMA 1NFQA 1YKFA 2Q3EA 4RF4A 3AY3A 3W4IA 3F5SA 3M1AA 4XEHA 4A27A 4AL4A 1AE1A 1LRKA 3DXFA 5KJCA 2Z1NA 5CDTA 1PU2A 3V5NA 1BVUA 1ZMTA 1BRMA 3ETDA 1UDCA 1VJ1A 4G2NA 4RVSA 3IC5A 3S1LA 1MA0A 1AGNA 3PDJA 1MFZA 3I6QA 2DU8A 3WGOA 1ZBQA 4C7JA 2D3TA 5T64A 3UW3A 2JCXA 4BO8A 3WQRA 1A7AA 1K3TA 5EERA 3QVWA 3I9NA 4KWHA 5CDGA 1UP7A 3LK7A 1L7EA 4KUEA 4BKRA 1MLDA 1U2GA 5TT1A 2ZQYA 5L45A 4GMFA 2YDXA 4IM7A 1MGOA 1YXMA 1WDKA 5COBA 3GEMA 1CETA 4CQMD 3DFUA 2J3HA 3U62A 2VYNA 4O0LA 4W82A 1P1JA 2OGUA 4LISA 1PGPA 4N18A 3D7LA 3BMQB 4WLNA 1P33A 3RC9A 3ZHYA 3TNLA 3G3EA 5DF1A 5JY6A 2Q2WA 1ADCA 3JQFA 4GMGA 1ONOA 2IYOA 5F21A 3MEQA 4EEXA 2I76A 4FOOA 1AXGA 4E21A 3PXXA 3ZWVA 1BHSA 3VPXA 2CVOA 1GDHA 3KSZO 1F06A 3ICCA 4NFSA 4DA9A 4JLWA 1SOWA 3NYWA 2J5KA 1C0IA 1QG6A 3MTJA 2NU6A 2I66A 5COQA 3GQVA 1HKUA 5F1PA 1ADFA 4MJLA 2FOIA 1NVTA 4KWIA 4BNUA 5DOZA 5T5QA 1UXIA 3OFSA 3AOGA 2PH5A 4RPLA 4ALJA 3NDRA 4MP8A 3ZWCA 3JSAA 4BNIA 4GKBA 4LMPA 4TZTA 5FI5A 4LVCA 2JD0A 3WIDA 2AEJA 4AJHA 4FQ8A 3GNSA 5IN5A 4HFRA 3RKRA 3ZCXA 4L8VA 1D4FA 1GEGA 4II2A 4A7PA 5KOIA 1VLLA 4GH5A 3HZZA 4MVJH 5DBGA 4Y9DA 1DFIA 1PQWA 2VWHA 3QP9A 4RVGA 5IF3A 3AU8A 1VM6A 2LDXA 3FN4A 5CPFA 2PR2A 5MDHA 2A94A 1RM0A 3EY4A 1R37A 2EV9A 3KXDA 3O8QB 3ZV3A 3LZ6A 2O3QA 1IPEA 1NAIA 1I2CA 4Q3DA 4DXHA 3DDNA 2CF6A 2W2KB 4HADA 3CMMA 3L9XA 3BMOA 1LU9A 2QRLA 5CEEA 3UOGA 3V1TC 5JO9A 4CUZA 3PDUA 3W6ZA 3W8EA 4D3FA 2NVUA 3WYBA 4W6ZA 4MDHA 4OM8A 5A9RA 1RPNA 3KETA 1NTOA 1QORA 2HJSA 1HRDA 3IIEA 2FZEA 3PJFA 4J1TA 3IKVA 2B4RO 1EQUA 2PA3A 1SB9A 3RFVA 4XB1A 5A3JA 4HV4A 5A1TA 3WWYA 1JVSA 1I3NA 2BGKA 3OQBA 3QHAA 4BNVA 4CR7A 4EJ0A 4XRGA 3JQ9A 4I9UA 2AXQA 1E6WA 2YUTA 3U4IA 4PLVA 3CMCO 1EE2A 1XSEA 2UUPA 4R3NA 3EUWA 2B35A 3JQ8A 4JBIA 4MO2A 2EERA 4OQZA 5A03A 1PX0A 3WGYA 2Y67A 2FN7A 3GFBA 3OH8A 3X2FA 2ZTVA 3RD5A 1DIHA 1LRJA 2CMDA 4U7WA 3GN2A 3UCEA 1BTOA 3G79A 1QYXA 4BNTA 3IDSA 5JO0A 1WPQA 3NRCA 2WE8A 2O48X 4A26A 5A02A 1A4UA 3I6IA 3PEFA 1U4OA 4E31A 1ENZA 1PTJA 4J9VA 3TFQA 2I99A 1R16A 5TSDA 4GLOA 1YONA 1P1KA 4NH4A 4ND4A 4OSPA 1U3VA 1A9YA 4NBTA 4PN3A 4DUPA 3W4JA 1PGOA 4U6QA 3VVCA 4DIBA 1Y8RA 1LLDA 2VZ0A 5GZ3A 4WCDA 3ZWWA 3WLEA 1DIBA 1LDGA 3C1TA 2BHLA 2P68A 1U5AA 1C0KA 4CR6A 4II3A 2PGDA 1DOHA 3JD0A 4BNMA 3HJAA 4RDIA 4AJ4A 5KIAA 1U2DA 2BGLA 4CL8A 2HO5A 1LI4A 2H9IA 2RH4A 4EYEA 3GHYA 3D0OA 2RHCA 5I8ZA 2IEDA 2VN8A 1XG5A 5B37A 3R3SA 4CLEA 1WXDA 2XXJA 1YJQA 4XA8A 2VCYA 4JBHA 2OMEA 1E3LA 1BXGA 2JAPA 3DZIA 2X1HA 1LJ8A 1QR6A 4TROA 4WOJA 4ZQEA 4E32A 1GYRA 2BRUA 2I9PA 4EW6A 4MVJE 2VYVA 1PQPA 3BA1A 5IZCA 1ZK4A 3K6JA 4ZQGA 4KDFA 5BSHA 4XIJA 2WYWA 1DC4A 2PKQO 3L9WA 5L9AA 1KERA 1Z6ZA 5L95A 3W4KA 3C85A 4B4UA 2FR8A 3DZBA 3ZZNA 3M6IA 4BB6A 1PIWA 2P9EA 5BSGA 1VSVA 4I9NA 4QSMA 4D44A 1W4ZA 5HA5A 4TRMA 1YVEI 3ZV4A 2YHIA 4ZGWA 5AXBA 1LSJA 4HUJA 2R00C 1EK6A 2XF8A 3S55A 1WDMA 2HRBA 3HQ4O 1KY5A 4YT8A 3DBLA 1DLJA 1Y9AA 2H6EA 3G1UA 4H15A 4PG7A 3H2ZA 1FDSA 4J0EA 1GZ6A 2GN6A 5U4QA 1D1TA 1XU7A 3N74A 4GQAA 1PZEA 1HE3A 3RUEA 4DWVA 4ZJUA 1WP4A 2BI7A 3EVTA 4CLOA 3FNEA 4M55A 4EBFA 3QIVA 1EZ4A 3KLPX 2AQKA 4XWYA 2WDZA 5BSFA 2Q1UA 1CEQA 2VHXA 4WLVA 4E6PA 3FR7A 3RU7A 1JWBB 3LSYA 2ZCUA 2HMUA 1QSGA 5CAEA 3N58A 3VAZA 2Y0CA 1I3LA 4E4YA 1PJ2A 4UVGA 4JCOA 3ZGYA 3E5RA 2P9CA 3QQPA 1X14A 4XR9A 1P77A 5FYDA 4Z0PA 2Q2VA 2YV2A 3KOUA 1XIVA 3TZKA 3JQAB 3HHPA 3MTGA 4ZU3A 5IZ4A 1IHXA 1UAYA 2DC1A 4IDFA 3V1YA 2NVUB 4FSHA 4CR8A 5F5LA 5JS6A 1T1RA 4R16A 1T2AA 4Q3CA 3BMCB 3UAGA 3HUDA 3RASA 1HE5A 2C7VA 5DULA 5IFLA 2G76A 3FPCA 1KVSA 2GLXA 4RL6A 3I4CA 1LQUA 2VHYA 5B4TA 4FFNA 3TQHA 1EFLA 4EZBA 4LMRA 1C1DA 1JQBA 1JTVA 4IQ0A 4BGUA 3JQ8B 3UH1A 2I67A 2HK9A 3VC7A 1KY4A 1YRLA 1SEPA 1TA4A 2QRKA 3U4DA 4OXKA 5TT0A 2PGLA 1E7QA 1KBZA 3FPLA 3JQCA 4JJGA 4YJHB 1U28A 1Y5MA 1R12A 3GUYA 2QZ9A 1ENOA 2G5CA 5B4UA 1RJWA 4B3HA 4RVFA 4BV9A 4BNHA 3I9LA 3E48A 2AE1A 2GSDA 3LT1A 1Q1NA 1UXJA 2HQ1A 1IUKA 2X4GA 4CV1A 4E3ZA 1K5HA 4AJNA 3NAQA 5HBRA 2NWQA 4FD3A 4TKMA 1A5ZA 3OM9A 1Y8RB 2EHDA 3ZHBA 2UAGA 4MIOA 1N8KA 4DIOA 3MJCA 1KC3A 3L0DA 4XD2A 3ADOA 4CM4A 3MJTA 4K6FA 1Q7CA 3WSWA 4E2YA 4CQMA 1U8FO 1ORRA 2JFHA 1SCUA 1JKFA 3GN1A 5C37A 3H5AA 2C7GA 2WTBA 4EJMA 3Q1LA 4O6VA 3PWSA 4BS9A 4RF5A 1PS8A 4YAKA 3TJRA 1PJCA 4LK3A 3WYCA 4GKVA 2QIOA 2W4QA 3ZWNA 5FEUA 5IDXA 2UUOA 2VWPA 3HDHA 4ONEA 1PWZA 5KVVA 2AE2A 3ZU2A 1GQ2A 1MFPA 5FF9A 3ULKA 1I01A 3EZYA 2VQ3A 1HLDA 2GGSA 3D64A 4DPMA 2Q50A 2B83A 3OIFA 1V6AA 2D59A 1U3TA 5A9TA 4PLCA 3PJGA 4Z3KA 3AWDA 3D4NA 5AOVA 4WEQA 3SJ7A 3TN7A 3CINA 1E6UA 1DXYA 2PKQP 1MC4A 1E7MA 2EG9A 4AG3A 2SCUA 4TSKA 5JNLA 1CQIA 1XU9A 4FJ2A 3BYZA 2PD6A 4MPDA 5DZSA 5KJEA 3P2YA 3QWFA 1R0KA 4D3SA 1HZJA 2WYVA 4BNJA 1Y1PA 1GZ4A 2P5YA 4MKXA 1F8GA 3R6DA 4R9SA 2B69A 5IDYA 4GLLA 5I9LA 2VRCD 3DAGA 3VPSA 5BSEA 1UH5A 1SO8A 2CUKA 1K6JA 3W1VA 5JBIA 4YWJA 3WBFA 1ISIA 1MP0A 3KUXA 1UP4A 3SLGA 1FMCA 3WNQA 4AJIA 3IUSA 1K89A 3JQEA 5JDIA 9LDBA 1NYTA 5DCWA 1WMBA 4ZQHA 3H6KA 4ID9A 4WLOA 3WGGA 4FFRA 3HDYA 4ALKA 2VWQA 3D4OA 4GGOA 3AUTA 1AXEA 1TI7A 4ROSA 4XRRA 1YDEA 3ZU5A 3C7DB 4OKNA 4NU6A 4JXKA 3NTQA 4BNFA 2ZYAA 3MCVA 3ENNA 3MWDB 2D0IA 4NIMA 4DQVA 1MUUA 1ONPA 1BXKA 2YJZA 1R4MB 3H5RA 3ONDA 3FTNA 1F14A 4TWRA 1PS9A 2PTGA 3DBRA 4GWGA 3V2GA 2A92A 3L4SO 4LRTB 2I6TA 3AOEA 4JN6B 5JPIA 3VH2A 2X23A 5EPOA 1ZK3A 3D1LA 1D1SA 4XYLA 3WGIA 5CG2A 4UUNA 1QMGA 4DC0A 1MV8A 3FF4A 3E03A 1PJ4A 3JCZA 2VTDA 1Y8QA 3X2EA 4IIUA 1NM5A 3HB4X 4ZRNA 2AHRA 2EWMA 1Y81A 5DOVA 1UDBA 4AJEA 4N7RA 1ISHA 4I5EA 2C5EA 2GO1A 2ZTLA 4KUGA 4D79A 4QUKA 3IL2A 4BO4A 3RJ5A 5A5EA 4UEKA 1Q2XA 1FXSA 3DTTA 2NTNA 1R0LA 4YXFA 3C24A 3IP1A 3GGGA 4MVJD 3I4FA 5DN9A 1P31A 4I8XA 4NI5A 3RC7A 3QJ5A 3WJAA 1DHTA 4B79A 4DTIA 4FFMA 1I0ZA 3SJUA 1PGQA 2VRBA 3VZPA 3DOCA 4K9DA 3LT4A 1VKNA 2D5AA 2PLAA 2VOEA 5KJFA 3DOJA 2JCVA 1LDEA 3ADPA 3WDSA 3GNTA 3PJEA 3WXBA 1U7HA 3INGA 3ZV5A 2HRZA 4KOAA 5LC1A 1T4BA 3L6EA 1ADBA 3KYDA 3GY0A 1YJ8A 2DFVA 1HT0A 1DBVO 3GOHA 4GAEA 4ND2A 2VOJA 3COSA 3PI7A 3RUCA 4BNYA 1B15A 2ZJ0A 2EGHA 4WUVA 1BW9A 1I2ZA 7MDHA 4RF3A 3FNFA 3ORFA 2VHVA 4CM4B 1PSDA 2B0JA 3BTVA 3KO8A 3QWIA 1ARZA 2PZLA 1WW8A 2Y1CA 1WNTA 2G0TA 4YAGA 4BO9A 1WDLA 2J5RA 4RLHA 4QECA 1PEDA 4QX6A 5LDGA 3DAFA 3E18A 2X9VA 3TL3A 1E7SA 1HXHA 3Q6IA 2C29D 4PZEA 2IZZA 3H5NA 5IDQA 5IJZA 3DHEA 4OSOA 1YDWA 1H2BA 3GNQA 5ADHA 4CM1A 1F0YA 1P1HA 1NVGA 3ZNNA 5JXWA 1H94A 3TZQA 4Q3AA 3DMTC 4BO5A 2I3GA 4D43A 4AJLA 4R9RA 1Q0LA 2A4KA 2EP7A 2YDYA 1PL8A 2PV7A 2EGGA 2DUUA 4JJFA 1WZEA 1OFGA 4YRAA 2CFCA 3RUHA 3LC7O 3QA9A 3UXYA 4LRSB 4MVJI 3BTOA 3VVBA 3JD1A 4NNJA 1G0OA 1O0SA 3IQDB 4YAJA 5ITWA 5CEFA 3ZNPA 1YGYA 3DAPA 1UAGA 4JROA 1O94A 1IL0A 1FDUA 3B1KA 1U7TA 5G4KA 3K31A 3VZRA 4QO8A 3O9ZA 4M87A 4IQ8A 2NLOA 1NVMB 2Y1EA 3RSHA 3ZWAA 3HN2A 1RM4A 2P5UA 3HFGA 1CIVA 1IYZA 2DAPA 5CDSA 4OIMA 4BO7A 4H16A 4OH1A 4PVCA 3I9MA 1HYHA 1GPJA 4RPKA 5FWNA 3CPSA 3GT0A 4JNKA 3RBVA 1P1RA 2ZJ1A 4GGPA 1YBAA 5AXAA 3TZ6A 1NWHA 1XELA 1RYEA 2GERA 2I5PO 1ZVMA 5IG2A 1UZMA 4PLZA 1XYGA 2FWMX 4GX0A 4MVJF 3QLJA 3QWBA 1JU9A 3HB5X 4YJGA 1EVZA 3TZHA 4I9HA 4XGKA 1T2FA 1PR9A 2O2SA 4RORA 2Q4EA 3HG7A 1ENYA 1PWXA 4EGFA 1EDOA 1B16A 4J6FA 4MIYA 5B12A 1X7DA 4Y8VA 4PRLA 2JL1A 1DIRA 2X0IA 4CMCA 4XKJA 3NV9A 4IQGA 3C8MA 5G2OA 3L6DA 2R6JA 2Y66A 2NM0A 1N92A 1SMKA 1Z82A 3K73O 1B8VA 4J7CA 2AMFA 2CSUA 3ROPA 1DPGA 3K30A 3UCFA 3E1KA 1Y8QB 4WLEA 3KYCB 1WLYA 3NT4A 4PLTA 5KCZA 1D8AA 3IMFA 2Y1OA 5EQFA 1S7CA 1LBEA 2GF2A 1QV7A 1JA9A 4IUYA 2GZ3A 3NX4A 4J43A 2CZCA 3JQGA 5JC8A 3KBOA 2B4TO 1I3MA 3PYXA 3I52A 1PJQA 1YE3A 1IZ0A 3GPDG 2VZ9A 3BHIA 4ND1A 2OUIA 5CP8A 4EI2A 4PLWA 3AK4A 3TOXA 3NKLA 3RKUA 2R2GA 2UV8A 3FNGA 1KYQA 3RBZA 3UICA 3UHAA 4ALNA 4EUHA 5K6AC 3IKTA 4LCJA 4JK3A 1VJ0A 2YW9A 1V3VA 3GDGA 4CUKA 4YTEA 2WM3A 3D5TA 1UJMA 1DRUA 2O23A 5ILOA 4GSLA 3QVXA 4Y67A 4I5FA 3LU1A 3GVIA 1B26A 1L7DA 1QLJA 3A9WA 4RJTA 5ITVA 3GZ4A 4NPCA 1Z74A 4L73A 4YCAA 1X1EA 5FI3A 1ZMOA 3SX2A 4WCFC 1ZXBA 2P2SA 1GYPA 5CDYA 3G49A 3KV3O 4IS3A 3PHIA 5BNFA 4UUMA 1IZ9A 2V6GA 1FDWA 2PD3A 2WYUA 4FDAA 4FN4A 4R1TA 4CM8B 4CL3A 2ZCVA 4CLHA 4UEOA 4J7XA 1ID1A 3Q3CA 4B7UA 1IPFA 3PYMA 2AEFA 3RCBA 1OAAA 4M1QA 3ZWBA 2AG5A 3GF4A 5A9SA 2Y93A 3JV7A 2VWGA 2H63A 3BZUA 3E9QA 2E6UX 1NPDA 2UDPA 3FRJA 2Q2QA 4BGIA 2PZJA 3GDOA 1HDOA 5JSFA 5TNXA 4QO7A 5A4DA 4LCEA 3TWOA 4E0BA 3D3EA 3TFOA 1TLTA 3F4BA 4UULA 2B4QA 2C5AA 1VL0A 2IODA 1SC6A 4C4OA 3PRJA 2E37A 4KTVE 2PWZA 4RPJA 3AU9A 2P4HX 1DSSG 4BMNA 4U0JA 1GTMA 4IDEA 4Q9NA 4R69A 1GUYA 3SXPA 3B20A 1DAOA 4E33A 4KDEA 4BKPA 4GX2A 4E2ZA 2VRCA 3GGPA 3M1LA 3BXXA 4M89A 3GG9A 4OOEA 4BO2A 2PNFA 2O50A 3U09A 4LSMA 3IS3A 4M54A 3GVCA 1LUAA 1EUCA 2DQ4A 4DGSA 1U3UA 1LA2A 2C54A 2GCGA 2HAEA 3DMYA 5KJ1A 3EDMA 3MWEB 2B5WA 3FWNA 2BFMA 1ZH8A 3DTYA 3O4RA 4RLSA 5H82A 2NTVA 1RM5A 3BHJA 3GVHA 4DIFA 2PK3A 1A27A 3WX0A 2ZB8A 5L7TA 5HTOA 1P0FA 3GPIA 3UGKA 2Q45A 3DZGA 5IDWA 3TOZA 2QW8A 4EDFA 1BMDA 1NWCA 2BLLA 4FC7A 1PZGA 8ADHA 1C0LA 3L4BC 1GPDG 3WWZA 3WYEA 2ZB4A 5JDCC 1E3IA 4H3VA 1VI2A 4F6CA 3RU9A 3SLKA 1JKIA 2RBEA 4J9UE 4BIIA 1E1KA 1KS9A 4Z3DA 3KZVA 1OC4A 4B8ZA 4CMEC 3CSDA 1KIFA 4YAEA 2E4AA 3I23A 4N54A 2V7PA 5G0TA 3F9IA 5ES3A 4RDHA 1M67A 5JMWA 2G1UA 4YAIA 2VT2A 1DEHA 4S3MA 3DWFA 3NDIA 4W7IA 3KRTA 1P74A 1ISMA 4MVJA 3T4XA 2YQ5A 4YBZA 1B0AA 2Q1SA 4FS3A 3ITKA 3GAZA 3RFTA 1ZW1A 3FCOA 3LF1A 4I1IA 5JAIA 4QXMA 1VL6A 3QWAA 3T7EA 2VUUA 1EVYA 4KZPA 3RC1A 4D3DA 4D46A 5JCJD 1DLIA 2AW5A 3JYQA 4Y6RA 2J3JA 3MJEA 4LVUA 5CDUA 2HLPA 1O9BA 4OXYA 4Z0HO 3GA0A 4FR5A 2NV6A 1PL7A 1O89A 5F1KA 3U49A 1QP8A 1V3TA 9LDTA 2Q46A 5KKAA 4FB5A 1H6BA 1M75A 4J90A 4BL5A 5ER6A 2HMWA 3E9NA 1F17A 1IE3A 2GN4A 1E3WA 1AN9A 1VPDA 2BF7A 4PFJA 4G65A 5LDHA 2AQIA 4OHUA 1AUPA 1BGVA 2C07A 3RFXA 1HYGA 2V6FA 4UUPA 2OZPA 2FSSA 4QFCA 1H9BA 2RCYA 5IN4A 3K9QO 2Y68A 2O4UX 3NEPX 1ZEJA 4B8WA 3UVEA 1F8FA 3LYLA 3ZWMA 2VUTA 4A10A 2OHXA 1PQUA 4ZQFA 5JYEA 1EK5A 3B70A 4NJMA 1O5IA 5ENVA 1LDYA 2QYTA 4YJFA 2BH9A 4B4OA 3HSKA 4IINA 2EKQA 2X8LA 5COAA 3RUAA 5ICMA 1OC2A 3F5QA 3RVDA 2WE7A 4TKLA 1E3SA 3PP8A 3NT5A 3OJEA 4CM7A 3VTZA 4IZIA 5JC1A 4FPXA 4G5HA 5GMOA 2H1SA 1I5RA 3BMOB 4TQGA 1QYDA 3QWHA 3RROA 3VKUA 2GZ1A 4BNNA 1RKXA 3TZCA 1E1NA 2Z95A 4YT4A 2EKLA 1I30A 3AFMA 4YJDA 5AQ1A 1GV0A 4BHTA 4BMVA 3WTCA 3ROMA 4WE3A 1GYQA 3WICA 3O26A 1J6UA 2NU9A 2PH3A 3JYLA 4FBGA 3F4LA 4AJJA 3PZRA 4E5PA 4PG8A 1NQTA 2GN8A 2BKAA 5H83A 1NASA 4Z9FA 3MZ0A 4UVIA 1R0SA 2HK7A 2FP4A 3DONA 1QYVA 1EDZA 3H9EO 4CM3A 1WVGA 3HWRA 3PLRA 3C7AA 1JW9B 2O4CA 1PGJA 4MVJG 4NBWA 1GL3A 5L7WA 2RIRA 2VNSA 4CQLA 1I32A 3WMXA 2EP5A 1NXQA 4HXYA 1DRWA 4YPOA 3SBOA 4AJ1A 1R4NA 4CMAA 3C3XA 3GAFA 2D2IA 1ZIDA 2HDHA 2R00A 4IDBA 1Y6JA 3BTSA 1GAEO 3CXRA 5L4NA 3A4VA 1H5QA 4I08A 3S2GA
chains in the Genus database with same CATH superfamily
3SG0A 1KF0A 3EG9B 2IS4A 3B48A 2QBYA 2XUGA 4KRGA 1KDOA 2W90A 4A92A 4IJKA 2YJ4A 1CUCA 4AF6A 1YT5A 3D7SA 3U7EB 1PJSA 2EZ8A 4KKXB 2JLUA 4KEAA 3T12A 2HBZA 2BFWA 5F3RA 4CVNA 5K0JA 1L5SA 4QGFA 4C7OB 2WQ6A 3GZNA 1ONNA 4EHJA 1J99A 2Q27A 5IAJA 1WKBA 1QDLB 4W1RA 4LFCB 1XHEA 3WB2A 2SHKA 1IXKA 3ETHA 3C2QA 1E0KA 1X8KA 1U9YA 1JHUA 4XWTA 2Q4DA 3ZE6A 5C8YB 5AVRA 4BAGA 1O54A 2WNHA 1ZJYA 3HCOA 4OK3A 2J3QA 1IBKB 1AGYA 4UU8A 1EB9A 4AMUA 9ATCA 1N36B 4HGNA 3GGSA 4B4KA 5AUNB 1CULC 1ZGCA 1WMAA 3O03A 2VJPA 3OECA 4ZVVA 5EA2A 4DPKA 1FP4A 1R3UA 5TF0A 1FDTA 2W6IA 1JB9A 2B5VA 5EJ2A 3ABOB 3TTSA 4EGSA 1QANA 3VHRA 5L3QB 2C2KA 1F2TA 4KQFA 3G8CA 4MWOA 2R62A 1EAMA 3H9QA 4L51A 3KAPA 4MJ7A 3PIRA 2V6MA 2VP4A 4JLOA 4XJTA 4UU0A 5IM5A 3TTWA 1UBSB 1XROA 4H0CA 2AEEA 5MN4A 4COKA 2P35A 5D7BA 5HVNA 2ZIGA 2ZT7A 2X41A 2NV2B 3EOAI 2OHVA 2H92A 3AHEA 2BFEB 3GRKA 1KZ7B 1MR3F 3P7MA 4XAQA 2Y9PB 4PPYA 3E22B 2O8FA 1BE8A 5MFPA 4YACA 3ZN2A 1N6HA 2NUTA 1NAHA 2VT3A 2EKPA 2APJA 1TF7A 2HK6A 4YONB 5CG1A 1UUFA 3ZDAA 4JKIA 2DQSA 2CBZA 1M6YA 4X24A 5T4HA 2Z98A 3TSCA 2IOHA 1RXUA 2RI6A 3F46A 3IAEA 1D7AA 2V5UA 1HEYA 2ODBA 2RG1A 1G2QA 1W8DA 4KQ9A 4KX5A 4P4UA 5G0UA 3BJEA 3T3DA 3KOYA 4LPKA 2Q0XA 1DQYA 1Z6QA 2GAOA 3HLKA 5CVCA 2Z6QA 2AYXA 1GGJA 4N6GA 1DMRA 3WS7A 1Y5IA 3PUXA 3C3PA 4IMRA 4W5WA 3TLGA 3RW9A 4P35A 5AW5A 3OQHA 4FDLA 4M8SA 1WXFA 4RD6A 2RH9B 4KAJA 4ZREA 3N8HA 3K1AB 3RF7A 1RRMA 4RVHA 1VG8A 2HSDA 3IRVA 4UTNA 1KEKA 1X1AA 1GL6A 3OMLA 3LXRA 5F3WB 1I2AA 1KKMA 1NQAO 3HP4A 3MTIA 1MZPA 2ZGVA 4C78A 1NJ2A 1T8YA 3JVVA 2H59A 1E5QA 4W9NC 3OQJA 2Q4OA 4P22A 4OHBA 1EUZA 1DB3A 2AOTB 4FEEA 2GBLA 3L8HA 1PRYA 2BM9A 2H2FA 2WICA 4HDAA 4P5PA 4PX9A 2O7SA 4TYMA 1CIPA 1I6MA 5JJLA 2Y1LA 4B2IA 1XCBA 2QX8A 3QE4A 4S35A 5EL0A 1KR5A 4BVHA 3PITA 4ZZ0A 2C3YA 3HR8A 4M2LA 3ZV6A 1KVQA 1XRRA 3B7WA 2F1KA 4RFSB 4EF5A 1MB4A 1YD7A 1EWQA 2J4FA 3E3OA 4OO3A 3Q1KA 1R5NA 1FFWA 3TCNA 2OXRA 2GPTA 1NW8A 2YH2A 2ZP1A 1VSUA 2G25A 3KYBA 1KP3A 1QPBA 5TLSA 3U4QB 4PCVA 1ZH2A 1OH6A 3GLQA 1NLYA 4IWXA 1QMPA 2O8CB 2VQEB 1UINA 5C1DA 4PLHA 1GCAA 1Z22A 3Q9SA 4UTVA 1B8UA 1UM8A 4BX8A 2I78A 3R8XA 2OBLA 2ZR7A 4B5LA 2NU9B 3OX2A 4JEMA 1U2PA 4W7HA 1TQDA 3BMNA 5I7SA 1RZRD 2C5FA 3ZE8A 2DERA 4FBMA 3PYLA 4KLRA 1KA9H 4G9EA 1FP2A 2Q3MA 2OAP1 1ESEA 3JWHA 4GI7A 4R98A 2IS1A 1EGMB 4LGCA 5JMPA 1SUIA 3I4LA 4WNIA 4CKEA 1P4SA 1LSUA 4FEYA 3EHEA 4YV2A 1KO4A 4DB4A 4FINA 5DYWA 2JANA 4MZDA 4TLEA 1AN0A 1IN1A 1RRKA 2C99A 4HYYA 4PBRA 5DHAA 1BZYA 2W58A 3CUKA 4B9AA 1EX6A 3L0ZA 3MS7A 3QLVC 2QZSA 4XSVA 1I4DD 1R8JA 1KPIA 1UQTA 2G82A 4GBED 2ONJA 4TQAA 1OU0A 1MDFA 2AXEA 4L27A 1DG9A 4Y9RA 5K4HA 3LH5A 2IXFA 4J3FA 4POOA 4MDFA 3BL8A 4GSKA 4UFNA 2CNLA 3B2NA 5E6RA 3RM3A 3ZLTA 4BMDA 1VQ1A 3DZCA 3A10A 3LHDA 1JQJC 4N0PA 5F2EA 4CDMA 1Y37A 3GJTA 1ZRNA 5J5AA 4KAXA 3G8YA 3RUIA 1CUVA 4EYGA 3VA7A 1XQ6A 3DE3X 4DRZA 2IYWA 2VZLA 3SJBA 3CH5A 2PL3A 3ONEA 1S5PA 3CLUD 1FFCA 1XTJA 3KQPA 4IDGA 3GBSA 5KTOA 4MDEA 1QFSA 3ZNQA 4IRMA 1Q57A 1WJGA 1JPUA 2FEXA 2Q4BA 2VYVD 3EOBI 1STOA 4MWGA 3WE7A 621PA 3N2ZB 4FYVA 1E2IA 2A14A 4GOLD 4J3JA 1G16A 4N0DA 4Q9JA 3BJIC 3EFOB 4EHFA 1JILA 4KE7A 4U7TB 4BDTA 1XPRA 5BN1A 1UWKA 1CTQA 2AG6A 1RP7A 4Z1MD 1G21A 3BSYA 5HBGA 3RS0A 4ZARA 2HW8A 2VDVE 1SPXA 3LBIA 1M6HA 2P6PA 2QY9A 3I37X 4O3FA 1V1JA 2QJTA 1Z88A 1SHTX 2WJ6A 2WWRA 3D6NB 2XYPA 3KM0A 3TXAA 2FPPB 4PSAA 3GX1A 1O95C 3N6VA 5FB3A 3KVVA 1ISPA 1WEKA 2OAQ1 4OHXA 1CE8B 1GAWA 1YVPA 1W6RA 4Q4AB 3NEYA 5A7GA 3TXXA 2VNKA 4HWGA 4J4HA 2Q29A 3DM9B 2WHXA 3A36A 4R83A 4YT2A 4JLVA 1JHAA 3DZKA 4IGFA 5ALXA 1GKYA 3WGZA 5EEHA 5DEOA 5HYVA 1LDBA 4G5OA 2QR5A 1O96B 1J8YF 3DF7A 3DOFA 2ZZNA 1LXCA 1UPBA 4NOKA 2PMBA 3U5TA 3CONA 1JR3A 1J1ZA 1MIHA 3UBTA 2OBXA 1BCRA 3FD8A 1SKMA 4EGJA 3DXZA 2OESA 4Y2QA 1B3RA 2G5TA 3E5HA 3AXSA 4JSRA 4O1MA 1ZJ5A 3VTFA 4KGDA 2W2KA 2XOXA 3AJAA 4RXMA 3N8NA 4DL9A 1MG5A 1ZM3A 3QOFA 3U4CA 5DYIA 5EGSA 2QQ0A 3QE3A 2ZR8A 2XIQA 3DZHA 1V45E 4XD7D 1CJVC 3G17A 1PZHA 2YV1A 3PWZA 2VC2B 5JS8A 1SXHA 2OSBA 3HXQA 1U2GC 1CG6A 4KK3A 5CA1F 4OHYA 4MW6A 2VPPA 4L8GA 4GVLA 1QWOA 2E4YA 4HRAA 4U7PB 3UCXA 3AUFA 1DFGA 1YDMA 1W59A 1UR5A 4KW7A 1QG4A 2X7HA 2XRYA 4KUHA 3PRKE 3GFOA 2IU0A 3TKYA 5CBKA 4L3WA 3HB7A 5A05A 4OJNA 5FRDA 3IALA 2VDOB 4ZP1A 4RTPA 1XEAA 1CF2O 2RAVA 3O7MA 1AO0A 3H2YA 5D6OA 2XWSA 3I9V1 4JSYA 1LZLA 3B6ZA 3K6SA 5B3LA 2CHQA 4ZOEA 5EN4A 1KFJB 4HX9A 3RSOA 4D97A 1JT9A 3D2AA 4OFZA 3RT7A 4JV5B 2BMAA 1GQFA 1XWIA 2VF4X 4NMLA 1I51A 1RTTA 4PV7A 2I2WA 2XDQB 1ZFNA 2ZI3A 3IOYA 4I9FA 1H6CA 5DBIA 5C7OO 1GTSA 3T35A 1X15A 3O4GA 2NYUA 4R01A 3ABIA 3B89A 4KXMA 1WZUA 2F3SA 2PWPA 1TEHA 1UADA 3CVWA 1WXGA 2PWYA 2Z5VA 3Q8WA 1KVRA 1W4CA 2J0UB 3BDIA 4OKSA 1GLGA 3ZI7A 4TLCA 3DDSA 1NMEA 1TB4A 3CUEF 4O4LF 3ZJ4A 4PO1A 1C7IA 5T41A 5T7BA 5CTAA 3NGLA 5MGBA 1OLSB 4X7RA 5F1OA 4I19A 2QV0A 1BX1A 3MGKA 5DBHX 3GEBA 1G9XA 1QGYA 4XSGA 4F8YA 1OX5A 3RTBA 5HX7A 1MJGA 5ALPA 1G3QA 2C0CA 3NHRA 1QIKA 3P4UA 1SHJA 4IDAA 2CDRA 3HXKA 1ZSYA 3RYHA 4UC0A 3WMFA 1DIGA 4KXLA 5GINE 5ALLA 4BATA 2K6GA 1IONA 3P27A 4CL2A 1SELA 4PICA 1FNCA 4I5GA 1OX6A 1Z17A 4RESA 2QKYA 4MDYA 4ZVOA 1S6YA 3IO3A 2J6HA 5CVVA 2EEZA 4PQGA 3KQNA 1JEAA 2CC2A 2GFIA 2GRJA 1TZKA 5K8UA 4AICA 5AW2A 4UATA 4A8HA 2JEZA 4ND5A 2G77B 3Q3JB 4AFNA 1O8CA 5DNUA 1UBTS 3PC4A 3EVDA 2DR3A 1GQQA 3LIIA 4QQKA 5E4TA 1FLVA 2FQQA 1Y63A 1PNOA 5AKHA 5LM3A 2GHRA 3NIBA 4G5SA 4MKFA 4X8HA 3SC6A 5FYQA 1Y7HA 1PR0A 4RVOA 2WD7A 3L8DA 2ZJFA 3EC7A 4RVCA 4ETNA 2O2GA 4HO1X 4ZDKA 1I1OA 5KVAA 1DQSA 4J1TC 4NZ9A 5I7FA 4V0QA 3RRZA 2EZTA 2XE8A 1DE0A 4NK5A 2QIPA 2WHEA 1HQYE 3MMXA 3F3MA 3OHPA 1SU7A 2FPWA 1JLLB 2AI1A 3PQEA 3CR8A 3IIIA 3V1UA 4HNGA 1SBYA 3VPHA 1M6WA 2X4DA 1ZMXA 4WL0A 5K03A 3VNUA 4KXUA 1NW5A 3QUBA 4NOJA 5IBPA 1HKHA 3QPBA 3I6ZA 4FU0A 4I14A 1FZTA 3BJRA 2H3EA 1NSFA 2QTRA 4RO0A 2GD6A 2IIBA 2OVFA 4N4AA 1J09A 1EP9A 4WFQA 2GO7A 3KYDB 1E9EA 1TX4B 2CUNA 4TTTS 3Q2OA 1LLCA 5EY5B 5EIXA 3D0QA 4FMCB 3QIAA 4RY9A 2C00A 1PT5A 4CM9A 4PLYA 4YMLA 1BW9B 1J5PA 2HT6A 4RWEA 2Z8ZA 3H3FA 2Q2OA 4GXQA 4L28A 1W4RA 4EUFA 4GPZA 4ISBA 2IFTA 1U31A 1ZNYA 3ZGNA 4O2LA 1TU0A 4HY3A 1KDTA 4MRRA 4AS1A 4KH0A 3PHLA 2XB9A 3SZUA 4YRBA 4UEWA 3K1YA 2GFQA 2QSYA 1KAQA 1DDOA 1LWOA 2GWHA 3UFXB 2CLEB 5D5PA 1OLXB 3DO8A 3OLYA 4FDVA 2QM3A 2ZUSA 3H5TA 1PNQA 2GPNA 3G9ZA 3LKBA 1A96A 2Q2NA 3AJRA 4PGFA 3VR4D 5CVEA 1M34E 3JALB 4JA0A 3PNMA 3GC6A 2NO7A 2RAFA 4MPRA 4XLTA 2A35A 2WQ7A 2CFRA 1GG9A 1WHSB 2DKFA 1N3LA 1VJCA 2H9YA 4YN3A 3EJ6A 4FDTA 3WLOA 4N6NA 4KLAA 2EXXA 1U0FA 2ZAMA 5F3DA 3T3EA 4HBZA 3HVRA 3CW8X 3V9PA 3X1KA 3G9XA 5KDLA 3MC1A 1V1MA 3I53A 1HSOA 4MB2A 2P6NA 2UVDA 1BVRA 4HGRA 4PINA 4YCNA 2ZIZA 2QMZA 2B8EA 4O4IF 4MUEA 2HHHB 3T7AA 1AURA 1Q7GA 5F12A 2V4ZA 2D3WA 3JQAA 4L3VA 3X1MA 1GNSA 2VHJA 4HUQA 3V8BA 5IUJC 2FPLA 3IBCA 4J2TA 1BU8A 1Q1QA 1GN8A 1UJCA 1T0UA 2IYPA 2ZJBA 4LX0A 4Y2PA 5EMNA 2QD5A 4QRDA 1EX9A 5KEIA 1IY9A 2GHQA 5DLQC 1N2SA 3FMOB 2PVCA 1N33B 1DEOA 2DTDA 4Q7MB 1U9JA 1YSCA 4BNKA 1AD2A 1CW2B 1X86B 2ALJA 5L3ZA 4CNQA 3U44B 2BEKA 2DEUA 1SRQA 3NU1A 3E6AA 5G4KB 5HRUA 2AIRA 2FPGA 3AIOA 1EE9A 4RJ2A 2SKCA 5JV5A 4AQ7A 2R5WA 3OAAD 2WA2A 2X7JA 3AUSA 4RCVA 1GCIA 4EX7A 1SIWA 1ZC4A 5LB2A 4DQLA 5IRCD 2O5CA 1RWWA 2JAHA 5EXDA 3NBMA 3KXKA 4ZWNA 5SV2A 3U3ZA 1AC5A 3BERA 3H83A 1RHUA 2KB0A 3EIOA 4WESB 4YCBA 2QX4A 3INTA 3K9BA 4BFSA 3LG2A 4L07A 3NRJA 1GG8A 1SBIA 4RW0A 3U37A 4F71A 4JI0B 3B85A 1XNRB 1U4SA 1YB1A 3TIGA 2E5LB 2ZUFA 1V8ZA 5CA1A 3L7CA 3QVMA 4UNNA 3GLGB 2QRUA 1HLPA 2COUA 3AM1A 1Z8NA 2NV0A 3KD3A 1LC0A 4AMBA 3JX9A 3E70C 2QK4A 3GR6A 1Y42X 3INRA 4J0GA 4JX8A 1X1QA 5CRIA 5CFNA 5ITSA 4Y2XA 4ZYTA 5IM4A 1EFRA 2ZRJA 3H4VA 5GADl 2MR6A 3K9WA 2WJYA 1A2QA 1X7ZB 2BCGY 1NKSA 2ZWIA 3G0OA 4URFA 3A9RA 5CITA 2FSGA 4X54A 5FOWA 3VJMA 4QDKA 4OUDB 1ISFA 1E77A 1SUDA 4YROA 4ARZB 4FMPA 4V0OA 4P4TA 2O19A 1ZD8A 1JKXA 4JP2A 3SC4A 1X1DA 3URMA 3K96A 1KIAA 4N3AA 2FV8A 1JIKA 2H1IA 2OY0A 2RK4A 3P0RA 4NJEA 3WTBA 1LTKA 2Z3ZA 3M6MD 1YS6A 3PHGA 2YL2A 2QU7A 3RTCA 2BZGA 3HCEA 3OE4A 1U5CA 3U7RA 2F4VB 1O97C 1T2CA 4O4LA 3ZW9A 4R51A 1A98A 4WVLA 4F4JA 5I8WA 3FNIA 4LF6B 4DR4B 3RRYA 3GT4A 3U48A 3N2KB 4EKYA 4W9MC 1Z0ZA 3WLAA 5JPCA 2JK0A 2EDAA 4HFNA 4JJIA 2BC9A 4PIVA 2XNHA 4LZAA 1BHJA 1JEJA 2C4NA 4PSDA 1YAJA 4R54A 5B6IA 2W71A 3ACCA 4QU9A 1BSVA 2OKGA 2UZAA 2IPNA 3ND7A 4CTJA 3TW8A 5J1SB 1SD1A 3WIEA 1TVKA 3KVOA 4AF7A 2VP0A 3KT0A 3RQIA 3AILA 4IDDA 1XAHA 4V2UA 2I2AA 1KXZA 2WF7A 3GO4A 2Y0EA 2X9QA 3EVFA 5EE9A 1ZIXA 4DVJA 2OQ2A 4O1HA 2A9QA 4R8KA 3RJ9A 1YRQA 4UPDA 4TRJA 1XB2A 2WRZA 1ECCA 2Z3WA 3GLVA 3PNPA 3EZFA 2JLRA 3TAXA 2P9JA 3VU8A 4HZIA 3HY4A 5FPSA 3IJPA 3K0CA 3P2OA 1W6UA 4UM9D 1J2TA 2ID9A 2XCUA 1P4HA 2H7CA 2R44A 1V11B 3D7NA 4LW8A 2BEVB 2D5CA 4EA6A 1RRPA 4DUGA 3O95A 2SKEA 1ZKMA 3RSCA 3V34A 3F7MA 3RO7A 1Y3AA 2PGJA 5GONF 3JSXA 3UXHA 2YYAA 2A3RA 2WJPA 3KU1A 5IUKC 3QX9A 2X9LA 2Q5IA 3WGMA 5ESRA 4W5OA 1E8NA 2V45A 4ETWA 5JSZA 5KSYA 3IBTA 1IB6A 2NUBA 1EINA 3HADA 4Q9KA 1WRBA 3SQWA 1RTKA 3R6GA 2CNBA 2ABWA 3LLUA 3T4UA 4AQYB 3MMNA 4YRMA 1G5RA 3MUNA 3OPXA 3RWBA 4I1UA 3IURA 1HSZA 2GARA 3C6KA 3ZY5A 1PQYA 1XFDA 3DDUA 3TD6A 3MJVA 2GZAA 2HUPA 2WM9B 3BGIA 4D42A 4EECA 2C4HA 4RH0A 2XZLA 1TM7E 3OP1A 3IPXA 4PG4A 4DZTA 1NYQA 2QPTA 2IEAA 3ND9A 2K7FA 1Z68A 3OMXA 2R6R1 4NFHA 1P9NA 2J6BA 3SYTA 3MJ4A 5CYOA 3GEGA 4DADA 3FYUA 2OK8A 3E53A 1JIQA 5ALEA 4F4DA 4ZXPA 1T0IA 3MXOA 1ZUWA 3BBLA 4C05A 1YUNA 1XKTA 2WPDA 3ET5A 4PQYA 4W63A 5C52B 2P0YA 1D3AA 3NP7A 2WIKA 4J0FA 1SVWA 1A9SA 5HFAA 4QLOA 2HX1A 5C8ZA 2AQ8A 3AHCA 1VYVA 3MBKA 3DMDA 1P80A 1RCFA 1XQWA 4P08A 5BQFA 4TVOA 1DZ3A 3F1KA 3V1LA 5H8WA 2ES4A 3EWAA 4UHJA 4P92A 3CC8A 3ESYA 5I7AA 3NHPA 2CHUA 3SS7X 3VH4A 1IZ8A 2FLWA 2PX2A 4B7CA 4RIFA 2QDXA 1PFUA 3MRTA 4TS4A 5KU7A 1IG3A 4U8GA 2HEIA 2G83A 4Z8XA 3MTAA 4K6CA 2AFIA 4IO1A 5LD2C 4NV3A 2J85A 4DAOA 4F1WA 3QNUA 2EL9A 3EK2A 1N9GA 1TA0A 2MSEB 1T8UA 4GPTA 1R4MA 3DMGA 3ADDA 4PXAA 5GIOE 1SQ5A 4PAOA 3OT5A 2NVBA 2NZYA 3JQ7B 3A70A 2BFDA 1TM2A 3W90A 2EF1A 5JYDA 3GA7A 5BNZA 5AKXA 3CWCA 1X8XA 4PY2A 4D7AA 3EXG2 5KQPA 4X62B 1U3WA 3TNYA 1TA9A 4DV3B 4D9FA 2IZ7A 3JYOA 2E1RA 1KJQA 2WUGA 4QT0A 1FP7A 5DVZA 4LHXA 3HVHA 1DADA 1GGKA 3D3NA 3P0JA 5F9MA 4C76A 4LI0A 5K1ZA 1NUUA 2AS0A 2ZVPX 2AUTA 3BXHA 4EPWA 2W2TA 4DSZA 3FOCA 4O4IA 5DK6A 5AOBA 5K9ZA 2JG3A 2I7TA 1QXSA 5ALIA 4G9GA 4RSRA 3UYLA 2YXLA 4EWLA 5AJYA 5K6TA 4LNUB 3HUUA 3D59A 1ADYA 4F8EA 2OHIA 5EJGA 2MMGA 1PUJA 4DLXA 2D8AA 4QG3A 2EX4A 1ZRMA 3ZK9A 4WOPA 3E9MA 3KJEA 4NS1A 3T3NA 1TL7C 2YJ6A 3HNPA 1TU4A 1TZBA 3QY9A 5IDVA 4YP7A 1GNVA 2HA2A 4DV4B 4Q02A 9ABPA 5FI1B 3BB4A 4P7BA 2QF7A 2XHZA 1CB7A 4NZYA 2ERXA 3SC2A 1RLOA 2OKCA 3BQNB 4JX9A 3CF6R 4DHWA 1X1CA 4RA9B 1NN3A 1WXXA 1X6VA 2ZM6B 4IF6A 5EQDA 2G7MC 1XWWA 1CJKC 3P9CA 2H4ZA 3C7TA 2ACWA 4KC0A 4Q37A 4C30A 3KKZA 4QICA 5IMBA 4ZPJA 1M76A 2QLJA 4JVOA 2J6CA 2YWEA 3VGPA 1ATZA 5AKKA 2PX0A 2ZETA 5JDIC 4FOLA 2H0QA 3ND5A 2W6ZA 3QBDA 4DCTA 1DAMA 5C7IO 1JWAB 2VSFA 3UPDA 5DM60 1K2WA 1C7EA 3PUIA 1IATA 5IULC 3M4ZA 4OPMA 1Z63A 1VKOA 2CJWA 4MAFA 3WV5A 4DCNA 4TMZA 1CYEA 1AZLA 3SCZA 1HDZA 3GLFA 1JIXA 2MMCA 2XWBF 3DOUA 4XGNA 3TNFA 4ZMBA 1B74A 3W9SA 5CCEA 4BMZA 4GKJB 5EMJA 1NN1A 3LVRE 4TTJA 5FL3A 2VHWA 2YN0A 2OA0A 1B42A 1XN4A 4PHCA 1ZM2A 1YAHA 3UMGA 1XAGA 4OMCA 4KBYA 3PQDA 2YY5A 1PR3A 4XYBA 3SDZA 1HT3A 1V43A 1UFKA 3PI6A 3AOEC 4BNXA 3B1FA 2KJQA 4TWAA 1KDYA 4G4JA 2ZE7A 1OA0A 1L8XA 521PA 3OJWA 3DEZA 3ABSB 3SJCA 5IU6A 1KZYC 4HWKA 4XCVA 1A9ZA 1GNRA 3DZJA 3KT3A 4D96A 4NOMA 1EZ1A 2CNKA 4JU9A 4RTNA 2NPFA 1GLNA 1E3WB 4N48A 1BE0A 1DAIA 2CD9A 3HWSA 4N0MA 1KHHA 1DC6A 4S0XA 4U5XA 4HN4B 4PNEA 1U5BB 1L7QA 1PDWA 3MOGA 5GJCA 1PJ3A 2XZPA 1KEUA 1Y4UA 2FK8A 4IVQA 2AN9A 2GTPA 3DZFA 1ZKDA 3DMFA 4L5CA 3ESBA 2NMVA 4KREA 5K8IA 2NSYA 1LB1B 4YRGA 3DW3X 3C3JA 4LYFA 2O2HA 4TRRA 1NSYA 5C1BA 1MB3A 1Q0SA 2FFJA 4UBOA 3G0GA 4R6WA 3P2KA 4I1VA 1U8XX 3VNVA 3FBTA 1UT6A 1MH1A 1S0UA 2ONYA 4MV7A 3C3KA 2D2EA 3L06A 4BDSA 3OZXA 2PU7A 1T2EA 2LKDA 1HTBA 3ERCA 3WKDA 4PCUA 4HCJA 1SOVA 3E2MA 5GONA 1SUPA 3DCIA 3LM8A 4OB7A 5JE8A 4X64B 2ZRBA 1SVKA 3DFIA 3V8PA 3RGGA 4MKHA 2QAGC 1NU6A 1N7HA 3UG6A 1M5UA 2CDCA 3BJMA 4Q0MA 1ESMA 4XIIA 3ZHQA 2DPYA 2PSSA 1E4EA 3R3JA 4LDRA 4P83A 3M7IA 4FJ0A 4PVDA 4QNNA 4TZKA 3GT7A 2IHVA 3AB3A 1XZDA 4Z9YA 1RMYA 1V8BA 1WZCA 2P9YA 2RGXA 4LJ8A 4MI9A 4BLSA 1AQIA 4KQEA 3BRWD 5I7RA 3U7QB 4Q7QA 4PNHA 1G2IA 2FHSA 1SOAA 3DB2A 1WVIA 3CF0A 3DTVD 3LUBA 2I7DA 4OP2A 1MEEA 2P3OA 3OBIA 2BEUB 4QD3A 2PQ0A 1YB5A 1ZJJA 4WCVA 3U3DA 3AEKB 1CR2A 4DYVA 3NIFB 3DAOA 3SEFA 2BMVA 3ZE7A 2X2PA 3EASA 3L79A 2J87A 4BO0A 5HTKA 5I9NA 1QKKA 2IV3A 2B2CA 2HF2A 1P5JA 5KNBD 4GBGA 4IZHA 2I62A 2XOKD 2DFLA 3MM4A 4IY1A 4RENA 1SG6A 4AROA 2DHCA 3FCUB 3ED5A 3W05A 3OEEA 2CLKB 3I9OA 1YE5A 2UYQA 5DMHA 3AIIA 4LXQA 2XDYA 4FYPA 4B76A 3OEYA 1E20A 4KK4A 5AVOA 4MRSA 1C30A 2GJ4A 2JCSA 2XQGA 3H3JA 2ZRFA 3JD3A 3OD1A 5DNAA 1N5LA 5AHKA 2BUBA 3HNRA 4L4SA 5CLGA 5DNVA 4YRZA 4LWZA 1GG2A 3OE7A 4PC3A 2Q99A 2W6JD 1DKOA 1AKMA 2C0QA 2GQ0A 3W9BA 4UHDA 3OLQA 5I4KA 3EXHB 4XH9B 1QYIA 2HBRA 3IJ5A 3TLBA 1M1YE 1L7BA 4Y6QA 4Z1OA 4F6CA 4LJ9A 2WY2D 2ZUTA 1IDN1 1YVDA 2MTBA 4DV7B 4KPEC 4HDSA 4F3NA 4QZVA 3FOFC 1KEZA 1CIJA 4F4FA 4PLGA 4FR2A 4N3GA 4BQQA 5ALGA 1JXMA 3B1JA 3GCXA 1JRLA 1AZWA 5IMSA 1ZOPA 5BMVF 4LJRA 4BJHB 5FBHA 5A06A 4GDFA 1O94C 4G3XA 3MD9A 4W9NA 2Q1YA 2O8VA 3OA2A 3QVOA 3IVCA 2YV3A 1EX7A 4I50F 2YXEA 4C4YA 4D9IA 3SVTA 4DM7A 1T6YA 1BGXT 3AL0C 4MUIA 2XJ4A 4P3XA 3GZJA 4N6OA 3K94A 2IYLD 1KFKB 3UMCA 4DPLA 4K26A 4IIHA 1XDSA 4EEKA 3S28A 5AW1A 4BASA 4KO1S 4N39A 3V2HA 2Z5LA 2RGUA 4KMSA 3O83A 1DFHA 4MVCA 5FKJA 2Z2XA 1C80A 1T3GA 1AKNA 2W6OA 3F49S 3FWZA 1ZSVA 4H7EA 3SVZA 3TR5A 5BWOA 4DG8A 4DFDA 3IOEA 1CKEA 5KTMA 2JKVA 5L40A 4CBVA 1LI5A 4C5AA 2NPIA 1G3RA 5EINA 1PG5A 2OHFA 1DXOA 4ZT4A 1GO2A 3C74A 2YW2A 2SECE 5ED4A 1DTWA 4MEBA 3I5MA 3ZGLA 1X7GA 3AJEA 3IT0A 1XMJA 2IEGA 3AL2A 2I2CA 3K9HA 5AMXA 5JZSA 3AR7A 1AM4D 1CY6A 1Y9EA 2XB8A 1WEHA 1U0LA 2XX3A 4P8RA 4UUOA 2H08A 1U7DA 4WOBA 4X97A 1N6IA 1TXGA 4ZDWA 4KMRA 1NRJB 3A2MA 4GWLA 4B34A 3UCFA 3ZKWA 2H0AA 1TQ8A 1XN1A 3ZHTA 4RVDA 1H8HD 1JXAA 5JXGA 1E79A 1L8LA 1QCYA 1R15A 4EA8A 5BORA 5ICGA 4ZHQB 3L7YA 3WWCA 4BFZA 5ISMA 3LPLA 3BIOA 1W73A 5DI9A 1F0PA 1L5ZA 1T8PA 2GESA 5D01A 3WBKA 4B74A 1HE1C 2ZJAA 2PANA 3QLVA 5WRFA 1LPMA 3QM1A 4X1KB 4B84A 2VRWA 4MTCA 1A69A 4JBNA 4RGVA 1IEXA 3GMSA 2FW9A 1EBUA 4ESHA 1Z0SA 3QFSA 4UBMA 3C5WP 3N7TA 2ZM5A 1C1XB 3WLJA 2YWGA 3E61A 1JDPA 2ZKIA 1NXWA 3RYIA 4NBRA 4C6SA 1CZRA 1C3LA 1LDMA 2QS9A 2DVMA 1GVNB 4RADA 2QTFA 1FQKA 2WSYB 5JWHA 4C6RA 4D3ZA 3O47A 1ENPA 1XDBA 5IK2A 3CZMA 1P2UA 4GBJA 3T7JA 4R1SA 4NCJA 1Z3IX 1VHJA 3JWEA 1EG7A 2IOQA 2V6JA 4WY5A 1SZJG 1IH8A 3AY6A 3LL7A 4YK7A 4XE5A 1I36A 5JR3A 5BN4B 1DEXA 5FNVB 4W5QA 1G63A 5F64A 1Q0HA 1ZL2A 2PLWA 3CYFA 1ZR2A 2HJHA 2BFCA 4NBVA 2I2BA 2ZYDA 4HEQA 3BHNA 3UB4A 5D86A 2HK8A 4WN3A 3ZY3A 1D0IA 3D6JA 1DWUA 4ESVA 1II8A 4GSYA 4URWR 5DN6D 3D7MA 3K5PA 4RU1A 3NC1C 2I55A 5FFFA 3BA6A 5AUOB 1AHPA 1I24A 3BGVA 4L2IB 1PUIA 5T4BA 1G2OA 4J91A 1SUBA 4OGWA 4ZO7A 4YUVA 3T9BA 5A2QA 1FUIA 1O95A 4M0CA 2KPOA 2ZCJA 4TTPA 1YK0A 1Y3DE 2ZU6A 3DKKA 1M1ZA 2JI7A 4QYTA 1ZCFA 2QX7A 4E5NA 3WIOA 4YQFA 1IEWA 1BQ3A 1JBQA 1PWYE 3DOOA 4UBJA 1YKFA 2OM6A 1FYEA 1YR8A 3F5SA 5GGYA 3M1AA 1SWWA 3HGMA 4U4AA 3UJPA 4A27A 1IM8A 2TSYB 4LZZA 5CDTA 1BRMA 4JGIA 2MDTA 2VEDA 4HS9A 2DYKA 3KKOA 3EIQA 3LQRA 4BRUA 2A5YB 2R3SA 3IC5A 3ZIUA 3MFQA 1DCKA 1RHRA 1Q1ZA 1Z5GA 2VPQA 4F1JA 1GGHA 3MTQA 4MGIR 1Z5OA 3CG4A 3OZ7A 4C7JA 1XPUA 2D3TA 2QTWB 3HU1A 2MINA 2H2IA 3B9RA 2HIGA 2QP4A 4EZIA 1XJQA 3I9NA 1JL3A 1RQPA 1T29A 1GRCA 1NMQA 1FEZA 5IKEA 3LK7A 1L7EA 2C94A 4BKRA 1UMCA 1E1QA 3QLTA 3PSHA 1U2GA 5K3EA 4JB3A 5TT1A 4OU4A 1V47A 2Q5EA 5BQ5A 5L45A 1U9ZA 4FWIB 4GMFA 2YDXA 3R9IA 1I7SB 1MGOA 2JGIA 1BH2A 2VXOA 3PFKA 1CDEA 1I4EB 3CLTD 1CETA 3NQ41 4TXJA 5DFAA 5BWLA 2ZBRA 1THZA 3GRCA 4ZVNA 1RLMA 2J3HA 4HQFA 2D4HA 4BN4A 4D8WA 1P1JA 2I6FA 3IP8A 3KPJA 4LHSA 1A2OA 1DC8A 1MVLA 1PGPA 2KX7A 4LISA 4W5HA 4WLNA 1E4VA 5EYPA 3RC9A 5FLYA 3TNLA 3VSCA 2IZOA 3I0MA 3JR3A 1F0KA 1S3SA 3OLVA 5EI5A 4AWAA 5HIIA 1F4VA 3OPYA 1TF2A 1ZHOA 3GWZA 4B0OA 3MEQA 3W77A 2E3JA 2I76A 5T6MA 3ZWVA 1BHSA 3VPXA 1GDHA 2RB4A 3DZDA 3KSZO 4JHXA 3ICCA 4IIBA 2C04A 3KKLA 2I54A 3TOCA 2A1IA 3VMMA 3PNLA 2J5KA 1FMTA 5HDQA 4FE4A 4M9UA 3UK1A 3CRZA 2B6NA 2VT7A 1GIAA 1GR1A 5COQA 5AM0A 1XJWA 3TRFA 4BXOA 4LXXA 2GAJA 5FBLB 2MSDB 1ADFA 2BIFA 2FOIA 4GEKA 3VOTA 3MINB 4BVJA 5T5QA 2J7PA 2FZVA 1A82A 3FCXA 1VLMA 4RPLA 2VTBB 1FX0B 3QPDA 1JG1A 2FWAA 4H31A 1Z9BA 3FXAA 4BNIA 4GKBA 1SKAA 5DSXA 1WXQA 3ZY2A 2AFHB 1WCV1 1JJFA 1M34A 3VBEA 1HYBA 3A27A 5BMVA 5B2FA 3ZCXA 1T3SA 3AETA 1MAHA 4GH5A 4QE3A 5BV7A 3HZZA 4QULA 5KOIA 3RYFB 4V1CA 4RULA 1AA9A 3QP9A 1EXMA 4I50A 1VM6A 3FN4A 4X3OA 5CPFA 4RK0A 1J70A 1RM0A 3EY4A 2EV9A 3FM9A 3LIPA 3TIXB 3UMRA 3G5AA 3LZ6A 4RTRA 1MABB 3H2KA 2FUNB 4Q1FA 4LDJA 4B3DA 2C7PA 2ZSDA 2G63A 1IPEA 1E64A 2FPRA 5CYPA 4AY3A 1Z4MA 4GZ6A 2R86A 1ZOIA 5MGNA 2CF6A 4EYOA 3L9XA 4Z5XA 2O06A 1QH1B 4TL7A 2NO6A 2PX6A 4X8LA 2IXGA 4YXWD 1GA4A 2C9BA 4ZRDA 4DA6A 1JXQA 3E7WA 1PR6A 3W6ZA 1JFSA 1T9GR 3QEOA 1GDDA 2LNDA 3D54D 4W6ZA 4OM8A 1OXBB 4G4GA 2H06A 1GKLA 3KFXA 3VUFA 4DLPA 1MRNA 2WJ3A 3PJFA 2FFBA 4LEIA 4J1TA 5BRNA 3IKVA 4X44A 3EG5A 5A3JA 4HV4A 2EKBA 1L4FA 3BOSA 4GNRA 1P5HA 1J21A 1A9TA 1CZOA 1JVSA 2HADA 1Z4NA 4H3KB 4PRYA 4ZPXA 3VYSB 3VJKA 2B5OA 2ZB2A 3BUSA 2GM5A 4UMFA 1XNGA 2GYVA 1YZQA 5EGNA 4MB6A 3TL6A 3JW8A 3UZUA 2Q5LA 3PWTA 1E6WA 1EIZA 3R77A 1DQNA 5ICCA 1RWXA 3KZKA 4CL0A 3CPHA 2I3DA 3GLIB 3R5XA 1C8LA 2AH5A 5E3IA 4M4SA 3Q6MA 3O4IA 4LF4B 4G23A 5KYUB 3JQ8A 2I0FA 4HEJA 1QWSA 4K86A 3RU3A 2GK3A 4MR8A 3OPMA 1O7JA 4IH4A 3RD5A 4RDCA 1RQXA 1OKKD 4U3JB 3UJ9A 1I0IA 2QD1A 4ISCA 4HNTA 1E2KA 2V0NA 3GWGA 2XOEA 1LNZA 3GLHE 3P9QA 3UCEA 1BTOA 4IDNA 1QYXA 4NYJR 3S2SA 3R9KA 3SYKA 3NNSA 1X42A 5JO0A 3NRCA 4KXNA 5KKNB 2FW1A 4HDRB 4A26A 1FQWA 2QSZA 1H2YA 2PRIA 2YRFA 3Q12A 5F78A 1ENZA 3ZLJA 1W0KA 3KR1A 4J9VA 2QE7D 2I99A 3FIJA 3M6AA 1R16A 1EM8B 4TT8A 4UCFA 1Y1TA 1KOFA 4G5RA 1QTNA 3AKYA 1YONA 5DHSA 2P41A 3VR6D 3PUWA 2G80A 3H8JA 1GZUA 1KDPA 1SVLA 3OTHA 4NH4A 1U3VA 3L40A 2JGLA 4OSPA 4RHEA 4WHMA 4GMXA 5EJIA 2J33A 821PA 3VVCA 2OCGA 1F3LA 1Y8RA 2VZ0A 4PAWA 5GZ3A 4WCDA 3ZWWA 4YCLA 1K27A 4E22A 4UDNA 3ONWA 3DMNA 3G7SA 3VVMA 1KI9A 2P68A 1U5AA 1GGVA 3CH7A 3JXEA 4II3A 1DOHA 3JD0A 3PA8A 4MS1B 4QOHA 4R1PA 4V3CA 1A8PA 4CL8A 5BVGA 4O02B 3UK0A 1KO7A 4JUAA 1KOGA 4EYEA 2WJGA 2RH4A 4N7JA 5LBTA 5TQ0B 3C14C 2Y8EA 5GJBA 2CEKA 2HR1A 3D0OA 2Z83A 1KYVA 1ZGZA 1W35A 1QB8A 1PE0A 1BXRB 1L5WA 3NWPA 4PR0A 1E6CA 4XDGA 5CJJA 3G0DA 1L5VA 3NG1A 3V8EA 3SQDA 3IV7A 5JUWA 3LWDA 1S3GA 2XXJA 3TQSA 2QVXX 1G98A 3MNFA 1B6RA 2XGMA 3OFND 1IIRA 1YJQA 3VPBA 1A04A 4Q00A 4QGSA 2VCYA 4JBHA 3V6LA 4GU5A 4KXWA 4CKCB 1CF4A 4M83A 4H1VA 3ILXA 1MT3A 3BKXA 4TROA 5F7ZA 4E32A 4JYZA 1GYRA 4NXNB 1M2OA 1D2MA 3WLTA 5SZKB 4MVJE 5FBRB 1PQPA 2WWWA 3MQ4A 1YASA 4C0KA 4ZQGA 5BSHA 1VIAA 2DJIA 4XIJA 1ACMA 2GEKA 4B44A 3C98A 4DUYB 1DC4A 2PKQO 4XFJA 3A6EA 5L95A 3EZXA 2AFRA 2CFTA 3C85A 3GLUA 3W4KA 4IH9A 3V7FA 5AOAA 4JI1B 3QELB 2M98A 4H6VA 3K70B 2FDXA 3QFTA 3SKYA 1T0PA 1JSXA 1UKVY 1W4ZA 3BE6A 5HA5A 5KTNA 3ICQB 1JR3D 3T7DA 1EP2B 2HRDA 4HH4A 4ZGWA 1BA3A 1A50B 2H16A 1LSJA 3TPZA 4HUJA 1GG5A 2VCHA 2R7NA 2XF8A 4WT7A 1CRPA 1SFRA 1V8FA 3HQ4O 3DBLA 4A8JC 1DLJA 3ZZ1A 1NBME 3F2IA 1GPMA 2H6EA 1CUXA 2GH1A 3G5TA 1QFJA 1FDSA 2DUMA 3FH0A 4MR7B 3WK6A 1WXHA 3AIKA 4HH1A 3U19A 4ZFNA 2RHWA 3V7WA 1AUVA 2W2OA<