1U5AA

Plasmodium falciparum lactate dehydrogenase complexed with 3,5-dihydroxy-2-naphthoic acid
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
316
structure length
306
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase
publication title Mapping the binding site for gossypol-like inhibitors of Plasmodium falciparum lactate dehydrogenase.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 114
structure length 306
sequence length 316
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2004-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1u5aA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1u5aA02
1U2GA 3WTBA 4JCOA 3OQBA 2TMDA 4NDNE 2NU8A 4WCFB 2O3RA 1Y8QB 2RHRA 2EV9A 1ORRA 1JDJA 2D2IA 1WWKA 4TRJA 3V2GA 3VPGA 4FFMA 2X1HA 4AJHA 4L76A 2PR2A 5FFFA 5BSHA 3WQRA 1JLLA 4CLHA 1BG6A 3EYWA 3LYLA 1AUPA 4OAQA 2BRUA 2Q1WA 3BHIA 2Q1TA 4J4BA 4K6FA 4R3WA 3FRJA 2VQ3A 5JY6A 4J43A 4L4RA 4I5DA 4KTTE 2F1KA 3BMNB 5FF9A 4J7CA 1H5QA 4XYLA 4Q3BA 3MCVA 1GY8A 4B7UA 4UUNA 4W99A 1MB4A 1NHWA 4J91A 2W98A 5TRTA 3C1AA 3T7EA 3I23A 1EFLA 1BWSA 3WG9A 3UCXA 4MIOA 5CPFA 3G3EA 2O50A 3F46A 4E5MA 3CUKA 1KY5A 4DYDA 3F47A 1ONPA 4IM7A 1GTMA 4RLHA 4JBGA 1HLPA 3I9OA 4D43A 3MTJA 2EKLA 5C7OO 3ZHYA 4XCVA 3GR6A 3PWZA 1WVGA 4ITUA 2GYYA 2NTVA 1J4AA 2AQHA 2OHXA 1E5LA 2C29D 4IPTA 5A9SA 2W90A 2UV8A 4CLEA 2J5RA 1HE2A 4CV2A 2ZB4A 2WE8A 1IY8A 3GC6A 2WEKA 3OHSX 4WJZA 3ON5A 1ZSVA 4QEDA 4PLFA 1QLHA 3PHGA 5EPOA 1DO8A 1M66A 4WGGA 4YXFA 1E3JA 1PX0A 5F3RA 5GZ6A 4DUPA 3SVTA 2NLOA 3OJ0A 4AJJA 4GSKA 1PJBA 1U8FO 1Y8RA 4ALJA 3P2OA 3ETGA 2ZTLA 4DC1A 1QLJA 1B26A 4JJFA 3VZSA 4QUKA 1R66A 1ID1A 4IMRA 5ICMA 1LU9A 3DZKA 1EE2A 4CQLB 4CR7A 3G79A 4MVJG 1WP4A 2YHUA 4WCDA 1I2BA 1NYTA 2HMUA 3SJUA 1U1IA 1HKUA 4DC0A 5KKAA 1C1DA 4BO0A 2X0JA 1DLJA 4ND4A 1E6WA 1F06A 3GPIA 1G6KA 4DLBA 4PZEA 5DP1A 3SLGA 2X9VA 4Y67A 4BNVA 1ZH8A 2H9IA 2FR8A 4II2A 5A05A 2C2YA 2WDZA 3DBVO 5TS3A 2CUKA 2XF8A 2IEBA 5T67A 2PY6A 1XQ6A 1TLTA 1YGYA 4PLYA 3HG7A 4CJXA 4QX6A 3ONEA 3WICA 4RORA 1NFRA 2PZJA 1PU2A 1VC2A 4BB5A 5G2OA 1TVEA 3CZRA 3ZNNA 1XIVA 3K30A 5ER6A 1I3MA 3KBOA 4E5NA 3V8BA 3KVOA 1RM4A 3SC6A 2C54A 3F3SA 1M76A 4B7XA 2Q3EA 5FWNA 3WXBA 1NR1A 3E9MA 1A71A 1EUZA 2ZKLA 1H6DA 9LDTA 3D4PA 1H6CA 2EEZA 1QRRA 1O8CA 2YW9A 4BNTA 4BGVA 4XWYA 3FWNA 4WKGA 5KJEA 2OO5A 3QP9A 3B1FA 4P4NA 1NTOA 3WGYA 3AJRA 3ENNA 1QYVA 1V3UA 4GX5A 1ZCJA 1GDHA 5FI3A 2I67A 2VHVA 1JTVA 3WQQA 2YV2A 3GNQA 3PDJA 1DRVA 2PFGA 4UAGA 4Z9YA 3C24A 4TRMA 4N5LA 4OSOA 3WGZA 4A26A 2BF7A 3UFXA 3VDRA 3OM9A 5JC8A 2AQIA 1P1FA 3VKUA 2G1UA 4IJVA 4TZKA 2R00A 2CSUA 1N5DA 2I5PO 3AY3A 3RUEA 4AVYA 2AG8A 1VJ1A 1EVJA 2Y1DA 3UAGA 1UZNA 2VWHA 2IZ0A 5CAEA 2QIOA 3O26A 4FFNA 4BQPA 4CMJA 1JKJA 2OP1A 3KM0A 3KYBA 4GL4A 5JYEA 1T26A 4IUYA 5A02A 3KB6A 4JQCA 3ZW9A 2E6UX 1EZ4A 2J3HA 3C1OA 3WWZA 3QVSA 1XKQA 3EVTA 4JROA 1E7RA 3PYXA 3GG2A 2EJWA 3ADOA 3GLQA 1A9ZA 2EKPA 4UULA 1B2LA 3DHYA 3OJLA 5KCZA 1FDVA 3AY7A 1RPNA 2CDCA 2FN7A 3D4OA 1C14A 2Y66A 3P7MA 1EFKA 4I9HA 4U0JA 3Q0EA 5C7IO 5EJ2A 1BVUA 3C7AA 1LI4A 4IQGA 3LVFO 4JJGA 4MVJH 3UN1A 1A9YA 2ZTVA 1KVTA 3DZHA 1K6JA 3LLSA 1NVTA 1X14A 4EUHA 4I9UA 5IDQA 1NVMB 1ZXLA 1ML3A 1P44A 3GAFA 4CM9A 1I30A 1OC2A 4ND2A 4E2XA 4E32A 1AGNA 2GZ3A 1E3EA 2X4GA 3KSZO 1E77A 4DBZA 2R00C 2B4QA 5K9ZA 5MGBA 5G0SA 2YHIA 3B70A 1MLDA 1E3WB 2B4TO 3PHHA 4YAJA 1IUKA 3ZI0A 2FOIA 4RQUA 2NNLD 2EERA 3ABIA 1YB1A 3H5NA 5BNFA 1XA0A 4J0EA 3R6DA 1CERA 5H82A 1TXGA 4P22A 2YJZA 4RVDA 1LRKA 2Q2QA 4ZQGA 1EUDA 2ILTA 1JU9A 3OJFA 2X7HA 4QO8A 5EQFA 3FHLA 1N1GA 4MVJI 4NQZA 4D79A 3E18A 3NT2A 1S6YA 4KDEA 4BMVA 5JMWA 1F17A 4OQYA 2GASA 3PHJA 3OSUA 1QP8A 3VTZA 4BNZA 4CM9D 2B37A 2QZZA 3PP8A 3PTZA 3RUFA 5CG1A 5HTOA 4QQRA 2Y1EA 3SXPA 2QQ5A 1UXHA 3KEQA 3ZV5A 2Y1FA 4Q3EA 2J5QA 3KLMX 3JYNA 1N2SA 4E30A 2HMTA 1TI7A 3ULKA 4PLVA 4TMFA 2DKNA 4LRSB 4LISA 3O03A 4JK3A 4GQAA 2VNSA 2B35A 4R9SA 1EQUA 4L4SA 3K2BA 3OA2A 4XR4A 1P1HA 3JQ6A 4GX0A 3D7LA 1HXHA 3C7CB 1P3DA 2VRBA 3NDIA 4FC6A 5IJZA 4RVUA 2HAEA 1A72A 5JS6A 3H7AA 4I5FA 5LCXA 1GYQA 2J3IA 3KRTA 1KOLA 2AE2A 5I8WA 4RL6A 2W2LA 2OBYA 1GQQA 1B16A 3WGTA 1U7TA 3VVBA 1JVBA 2JCYA 4BO3A 2WYVA 3ZHXA 3GVIA 1YBMA 4GLLA 5TF4A 3WIDA 1MGOA 3LDHA 1H94A 2AA3A 4NFYA 4YB8A 3TN7A 4RGBA 1WPQA 3C3XA 3QRWA 1D1TA 2GPTA 4KWHA 2X22A 1R0LA 2X86A 3C7DB 5IAAA 1BTOA 2PWZA 4TWRA 3GGGA 4D7AA 1PR9A 1JAXA 5IN5A 4WUVA 4E13A 4UUOA 3RKRA 4BO1A 2WYUA 1HZJA 3B20A 3Q3CA 1KYQA 5TT1A 2GZ2A 4FFLA 2VOJA 5EESA 2Y0DA 3AOEA 3MEQA 2YHIB 2ET6A 4S3MA 3WYBA 3CSDA 3GEDA 1OMOA 4HWKA 4PG4A 2RAFA 3RC1A 5G4KA 3GMSA 5HS4A 1AHIA 4EGFA 4YEDA 1W6UA 1YJ8A 3ZU5A 1UXJA 2JD1A 3A4VA 5JXWA 1C3VA 2PLAA 3DDNA 4S1VA 1MP0A 1IYZA 5JAZA 5JYDA 4XIJA 3FTNA 4IGFA 4N5MA 4NH4A 2HUNA 1XYGA 2DUWA 4NHEA 4D44A 3ASVA 4PFJA 1L1FA 3AOGA 4U5QA 3Q1LA 1X7HA 4YAKA 4M87A 5DULA 1NBOA 1V6AA 2VHWA 3U4HA 1FDSA 4YBZA 3FBTA 3V2HA 1DRWA 1M75A 4CV1A 2AG5A 4CMHA 3BMCA 1T2EA 1X7DA 4Y8VA 4YR9A 4IDEA 3ZV3A 4U0KA 4CM5A 3G0OA 5TQVA 5JC1A 3O9ZA 3DBRA 5JW6A 3E6AA 3QVTA 4ZQBA 4CMGA 5KOIA 1I2CA 5L40A 5KNLA 4RF2A 1HDXA 1GD1O 4WEQA 3JQGA 1O89A 1B0AA 2VWQA 3F9IA 1MV8A 1RM0A 3INTA 3COSA 4XRRA 5FEUA 4J6FA 1XG5A 4URFA 3NT5A 1NP3A 4YYZA 2Z95A 3NJ4A 4RDHA 2YDYA 2YFHA 4AJKA 1QYDA 1KEWA 1GEEA 5DBIA 1GQ2A 4UEJA 5LC1A 3U3XA 4FGSA 1WZIA 3U5TA 4O6VA 1X7GA 4EYEA 3HB5X 2DQ4A 4HP8A 3ROPA 2WTBA 4R68A 3S2FA 4RPLA 3RCBA 2FRDA 5ILGA 4ND3A 4BNHA 1EUCA 3KXDA 3P19A 4HX5A 2NQ8A 2X5OA 5CDUA 2FPPA 4GMGA 3TFOA 2J8ZA 1VSUA 1ZNQO 2DTDA 2GLXA 4N54A 1GADO 3OQ1A 4JN6B 5C7LO 2OOSA 4C7KA 3WGOA 2D5CA 3PK0A 5G4KB 4DIBA 3JD4A 2P9CA 5AXAA 1SAYA 1W8DA 2CVZA 2DFVA 3DZGA 4CM7A 3W4IA 1NPTO 4PRKA 2BGKA 1LDBA 2HRBA 4B4VA 2HJRA 3TRIA 4HADA 4YRAA 4L8VA 1MC4A 4E2YA 2EGHA 3RFTA 1HDRA 1UZMA 2Q4EA 4HFJA 4KUEA 1N9GA 3RBXA 2AMFA 2BI7A 2YQ5A 3FWZA 2P91A 2FZWA 4CV3A 1LTHR 4IDCA 1D4FA 3NYWA 3BA1A 1YB5A 4YJHB 3BMCB 5ER9A 1P45A 5L7TA 3PXXA 3KETA 3I3OA 4FPXA 3I52A 4Q3DA 3TPCA 1Q0QA 3DBRB 5TGDA 4E3ZA 2DTXA 3PI7A 1LJ8A 1LRJA 2G76A 1ONNA 4BVAA 2XXBA 3AFMA 1P74A 3QIVA 1B14A 2AW5A 4HXYA 4RQTA 5T8KC 4BO6A 1I33A 2EW2A 1LSSA 1PL7A 1JA9A 4XEHA 2PV7A 4KQWA 2E82A 4R16A 1VI2A 4MP6A 3F1KA 4P8RA 1C1XA 1VE9A 2ZCVA 1Z6ZA 3GDGA 4GVXA 1EVZA 4R54A 1NM5A 2UDPA 1IB6A 1QYWA 1Z7EA 4CLXA 4E4YA 1NX6A 5TX7A 5A9RA 3FNEA 2BFOA 2CZCA 3HUDA 4EEXA 3A1NA 4ESOA 3GK3A 1JN0A 2O48X 4UUMA 1YVEI 5BSGA 1YOVA 3OH8A 3I4FA 4YT8A 1NQTA 1QR6A 3ANNA 3HQ4O 1Y8QA 2YQ4A 3VVCA 1LC3A 3D64A 1W73A 1B8VA 4UEOA 5A5EA 4GI2A 4P4GA 5JMPA 2QX7A 3S8MA 1PQUA 1YKFA 2I65A 1JQBA 4F6CA 1OBFO 2HK7A 3PEFA 4OM8A 2CNBA 3CINA 4D46A 4FIZA 5CDTA 1Y7TA 1YDWA 1ZMOA 2EP7A 4J0FA 2FY8A 3P2YA 4ID9A 5HBRA 4YJFB 3WGGA 1ZK4A 1ONOA 5HM8A 1LXCA 3F6YA 4FN4A 4R1SA 2X0NA 1N7GA 4L75A 3BTUA 1EE9A 2PGJA 3JQFC 2A4KA 2C82A 3Q9NA 4R51A 2Z1MA 3W4KA 5CEFA 4BNIA 4PVDA 1DAOA 2G17A 5EL0A 1N9GB 3ETEA 2VUTA 3NGXA 4PVCA 5H83A 5C3MA 5HRUA 4XQGA 3WIEA 3GOHA 3KEOA 4XYGA 4XJTA 1HDGO 1VRWA 1YL5A 3EGOA 2E48A 4E5YA 3L4BA 1OZAA 3AUTA 1XGKA 3LQFA 3ZU2A 1ZEJA 2HCTA 1CQIA 4ILKA 3X2FA 4ALKA 3RUHA 5F21A 3ZV4A 3TFQA 5GMOA 4WCFC 4DPMA 5EN4A 1CYDA 3VH3A 4NU5A 3OICA 2HQ1A 3UVEA 4UVEA 1LNQA 2G82A 2ZB8A 4BB6A 5COAA 4GAEA 1ADGA 2BFMA 3WLEA 3WS7A 5F1KA 3UXYA 4I5EA 5IZCA 4I8XA 1CJCA 4BMSA 3Q9UA 3AU9A 3T7CA 3F4LA 2O7SA 2Q2WA 2YV1A 3VZRA 2OORA 4RPJA 2OGUA 1PEDA 4J49A 1BRMA 2D0IA 3Q6IA 3QW2A 3GGOA 1ZKMA 3WBFA 1O0SA 1TT7A 4D45A 4WLOA 4TROA 4BNNA 3DTYA 3DZBA 4J7XA 5LDGA 1EMDA 2NTNA 4BKRA 4CQLA 5GZ1A 2ZCUA 1KY4A 4OIMA 1YOVB 3LU1A 1SBYA 4TVBA 4XYBA 2AE1A 4K28A 5JBIA 2NVUA 1I01A 3WGQA 2FR1A 2IXBA 1KIFA 2EG9A 1DC5A 3DOOA 4J2OA 4MJLA 5CP8A 3ASUA 4KQXA 4B3JA 2C59A 1NQOA 4YTEA 4ALNA 1PL8A 2FP4A 1DB3A 1LBEA 3DB2A 2B83A 4AJ4A 1QXSA 2IRWA 4F6LA 3TJRA 3L4BC 4LVUA 3ITDA 2ZK7A 3WWYA 3CZMA 4GWKA 1VL6A 4DXHA 3STHA 3ZWXA 2Q4BA 2UAGA 4BKUA 4CM3A 3PJFA 2VZ0A 2VUSA 1VL8A 3ZWMA 4Q3CA 2AEFA 5COBA 1VJTA 4NPCA 4A7PA 3IKTA 1NPDA 4DMLA 5IZCC 2VNAA 4LK3A 3UH1A 3V1TC 1HDZA 5G0WA 4Y9DA 5JDIA 3IP1A 4Q39A 2AEJA 1NHGA 4XR9A 4BIIA 4N18A 3GT0A 4J2HA 5A3VA 3GHHA 1DIRA 1JWBB 4IXWA 2C7GA 4O1MA 3WJ7A 4YJDA 3RAJA 4B3HA 3PQEA 2VUUA 1HEUA 1Z45A 3TNLA 4H15A 3RQSA 3UUWA 2V6MA 2I66A 4ZU3A 4J7UA 4E0BA 3VH2A 4CMCA 3RIHA 4DGSA 4F3YA 5T64A 2GN9A 3HADA 5A3JA 2V6FA 4Y6SA 5ILOA 2YV3A 2VWGA 2EKQA 5ITVA 2J3JA 3EC7A 3JQBA 5B4TA 4JGBA 5T57A 4WASA 2P9GA 3ZW8A 1LLCA 2Y93A 3K92A 3MWDB 1HE4A 3E5MA 4DA9A 4BL5A 1E1LA 2WYWA 2O23A 3WLFA 2OUIA 4J4HA 4BNGA 4H3VA 1IPFA 4Y98A 3VOSA 3WMWA 3GZNB 4BNLA 2FMUA 3FN4A 5L4LA 3LLVA 1DIGA 1E3SA 2G0TA 4Y6RA 4J9UE 3JCZA 1E3LA 3OEYA 4MIEA 1IHYA 1YBAA 2NVUB 3TL2A 1DBVO 3TQHA 4YACA 5B4UA 1F12A 4MDHA 4CMIB 3M2TA 3QVXA 3E8XA 3IMFA 1NVGA 5EQDA 1IPEA 4NZ9A 5DNAA 1U3WA 5EIOA 3MJEA 3SBOA 5ICSA 4RPGA 3W1VA 3KSDO 1B7GO 3L6EA 4MKRA 4MVJP 2JHGA 3BHJA 1GV1A 2JCXA 3OA0A 1GV0A 2RCYA 4BUCA 1U5CA 2BMAA 3QE3A 2IODA 2Y1CA 1SB9A 4FBGA 4J90A 4CM6A 3HHPA 4XX0A 3JQ7B 4DQXA 4D0SA 1BVRA 4BMNA 3VH1A 4PIVA 3AM5A 1NFQA 4XGKA 5IXSA 1E3WA 1QYCA 1FDTA 5HA5A 1Q7GA 2OP0A 3IIEA 4AJPA 5EINA 3D5QA 1PGNA 3A06A 2PZKA 4BNUA 4O59O 4RV9A 1DAPA 2B4RO 1I3LA 2PD4A 4CM4A 2V7PA 5KKCA 4TKMA 5ENDA 2VOEA 3OETA 1LSOA 3CMCO 3GN2A 2JFFA 2PKRA 2VYNA 4LRTB 4DVJA 2ZYDA 2QG4A 5I7SA 3RU7A 5U4QA 5ADHA 1U3UA 4QECA 3JQ8B 3RVDA 2EWMA 1T1RA 2GO1A 4OXNA 1ZJZA 4NFSA 1NAIA 4JJIA 1Y5RA 5TLSA 1K2WA 3BTOA 1SOWA 2IYPA 1RM3A 3AUSA 4J9VA 1XQ1A 1A7AA 1SMKA 2FZEA 3WNVA 4DQVA 2X6TA 3JQAA 3L07A 2QZ9A 2Z5LA 4B79A 1T25A 4AICA 4FSHA 3GN1A 4WLEA 4RPHA 1B3BA 4TKLA 4XDYA 3V2UA 4E33A 3AY6A 4K26A 2Q46A 3JD0A 3LF1A 4L4XA 4CM8A 4U7WA 3DQPA 3Q11A 4R01A 2B36A 4WOKA 3QV1A 1PWXA 1XU9A 1SB8A 5IXYA 1FMCA 5B37A 3JQEA 3GUCA 2CVOA 4EZBA 2VYND 4BGUA 4Z3KA 1ZUD1 2I76A 2A94A 2O3QA 3CPSA 4YDRA 4Z9XA 4OXKA 5EERA 1KS9A 2VYVA 5JO9A 2VHYA 2BGLA 3RC9A 3W8DA 3ROKA 1FXSA 3IP3A 3FCOA 4YQZA 4P38A 3FPCA 3N74A 1HTBA 1U8XX 2Q1UA 4E5KA 5I9NA 2PA3A 4BNYA 5G0TA 3H5RA 3NT4A 1I2ZA 3OECA 1K0UA 1E1KA 1R37A 4CUKA 4IJKA 1DPGA 2C2XA 4ZJUA 2D5AA 3DFUA 1MUUA 3PRJA 4OXYA 3H8VA 3RASA 4AL4A 1Z7BA 2HMVA 4WNCA 1WAMA 4B4WA 4DLAA 3LT0A 3NAQA 1UDAA 4YWJA 2BGMA 4ROSA 2DAPA 3D3WA 1Y1PA 3H9EO 1PGJA 2WD7B 4GWGA 2QHXA 2Q2VA 3BTVA 1CDOA 7MDHA 5IG2A 2CF6A 2QYSA 3WNQA 4G65A 3SEFA 3JYPA 5IF3A 4R1UA 1E6EA 3DFZA 4Q9NA 3GY0A 1I3KA 2FPIA 3K2EA 3I9KA 1PL6A 3WX0A 3NV9A 4FOSA 4ND5A 4CM4B 4DPKA 4U6SA 4E5PA 4R41A 4XDZA 1ISGA 3BYZA 3TF5A 3FR7A 4FC7A 2QRJA 4GPD1 5I9MA 1WXDA 3JQCA 4BKPA 2Z1NA 3PLRA 4W6ZA 1MXFA 4HY3A 4TSKA 1GZ4A 3FNFA 3QHAA 3DMTA 3U4IA 1PJSA 3JQAB 3JYQA 1ZSYA 4PG5A 3T4EA 3DTTA 1E7SA 3DOCA 4CL8A 4EJ6A 1DIBA 4WLNA 3DMYA 5AOVA 1PS0A 1B15A 4CR6A 3IAHA 3NKLA 1UUFA 4CM8B 5CDSA 4DL9A 4O5OA 2PKQO 4ONEA 1XHLA 5TNXA 5COQA 4BNJA 1M6WA 2JFGA 3WGHA 2NSDA 3QSGA 4BS9A 5KTKA 2GN8A 3OMLA 3U09A 3MJSA 4A03A 2O4UX 3ST7A 4U8GA 3U4CA 2OBNA 1R16A 2ZYGA 3NX4A 4K1LA 2OFPA 4TZTA 1PZHA 3RROA 1PJCA 4LSWA 1XELA 5TIIA 1P1IA 1XEAA 1HLDA 3PDUA 3GEGA 3OQ6A 1VSVA 1U7HA 1G0NA 2WSBA 3ZV6A 4FW8A 3EK2A 4KTVE 1E5QA 2Y0EA 5BT9A 1F8GA 3TWOA 5IDWA 1KC1A 3ZNPA 4FJ0A 2A92A 3RU9A 4L74A 2P9EA 1YQXA 4WNIA 8LDHA 2O4CA 3IQDB 4O63O 4Z6KA 4FFRA 5IN4A 1V35A 2D4AA 2Y99A 3D4NA 3U9LA 2D59A 1HSZA 4KOAA 1YXMA 2BELA 4GVLA 1T2DA 1UAYA 2A9FA 2W2LD 3D3WB 3JQDA 5K0ZA 4FS3A 3QLJA 2LDXA 1HDYA 3PGXA 2I3GA 2YUTA 3JV7A 1F8FA 4WLFA 2PKQP 1H6BA 1M2WA 1ZK2A 3MJVA 3EZLA 2C5EA 4PG8A 2AHRA 4ZQEA 5L7WA 2WD8A 1VJ0A 1HDOA 2QW8A 1ISFA 4TVOA 4R1TA 1GPJA 1I36A 4HNGA 3I9JA 2ZYAA 3FI9A 1M67A 1HT0A 1JVSA 3GUYA 4QSMA 4E21A 1GUZA 4W7HA 4ZQHA 3I9NA 1M6HA 1H2HA 4ZN6A 2NQTA 3BMOB 4GGPA 1B8PA 1TT5B 1PJ2A 2WJPA 5L3ZA 3D3EA 1W0CA 2AQ8A 3K8ZA 4TRRA 1EK5A 4E12A 2ZB3A 1BXZA 1HETA 3FD8A 4M89A 3VPXA 2GSDA 1JW9B 2DTEA 4YJHA 5A04A 2BLLA 2CY0A 4CMBA 3QVWA 2P2SA 1ENYA 4RCVA 5CPBA 5TT0A 1C0KA 1LLUA 3LT2A 4G81A 4RVHA 3W6UA 3ZWCA 3B1KA 4PCVA 5CEEA 2VT2A 1NFFA 5A5FA 1XCBA 4A5OA 1P77A 1V8BA 1ZO8A 1UXGA 4G2NA 4B8WA 3DONA 3K73O 3AOEC 2HK8A 2QRKA 1RM5A 4R5MA 4ZA2A 4AFNA 3PYMA 2DM6A 3M1AA 2GF2A 3H65A 2NADA 4IDFA 1YDEA 2HDHA 4C4OA 3JD3A 3OF2A 2NVBA 3QWBA 1ZVMA 3GVCA 2AQKA 4FQ8A 2RH8A 4IQ0A 9LDBA 3HN2A 4RF3A 4RF4A 3F1LA 4MP3A 4JP3A 3UW3A 1YH3A 5DOVA 2JCVA 3CE6A 1F14A 5A03A 2X5KO 2JL1A 4DIFA 5JNLA 3GDOA 4YQYA 1K6XA 5LDHA 4J1QA 2NU7A 1LRLA 2Q50A 4BO9A 2P68A 3RJ9A 1H9AA 4PLPA 3WMXA 4M86A 2IE0A 2DBZA 2X0RA 3ENKA 1AXGA 3D0OA 1V3VA 5CHEA 3RUIA 3HZZA 3W8FA 3NTOA 4YJFA 4BQRA 1WDMA 5CEJA 3M1LA 2Y1GA 4N5NA 4CLOA 1DIAA 1E3IA 1QV7A 3HB4X 3HSKA 3KYCA 1OOEA 4CR8A 5A1TA 4Z0HO 4B4OA 4JIGA 4KDFA 5GY7A 4GLOA 1T4DA 2W8ZA 2XXJA 5KJCA 4BO5A 4NBRA 1SOVA 5I9LA 4M8SA 5G4LA 4P4LA 2NU9A 2D3TA 1PSDA 2JHFA 1GPDG 1X0XA 4LVCA 4WOJA 1AE1A 1NQ5A 1VL0A 3MOIA 4OSPA 4XB2A 1YBVA 1UDBA 4CLRB 4DLLA 4G5HA 2C0CA 3CKYA 2Y05A 4WLVA 1KERA 4M49A 1EVYA 5IDYA 1H6AA 3ROQA 1DJQA 3LF2A 2IZZA 3GVXA 1PIWA 2HLPA 3I5MA 2EXXA 1LX6A 3PLNA 1DC3A 4IIUA 4W9NA 3GFBA 3JTMA 1RYEA 1WMBA 1JAYA 2UUPA 3DXFA 3K31A 1ZJYA 5AXCA 1HF3A 2W2KA 3E1KA 3IOYA 4UVDA 3TL3A 2HJSA 3I6IA 3N58A 1MA0A 1OFGA 2JAHA 2HRZA 1T24A 2BD0A 2TMGA 1ULUA 1EDOA 4KMSA 2ZJ1A 1IE3A 1OAAA 4FFOA 1ADCA 1RJWA 4CODB 1QV6A 3DOJA 2X23A 2Q1SA 3LSYA 3JYLA 4IS3A 2PZLA 3C85A 1U28A 1KVUA 4BNFA 2ZB7A 3JQ9A 4Z0TA 4INAA 3AM4A 1NXQA 5I7VA 3INGA 5DT9A 5JAQA 4HFMA 1T4BA 4EW6A 4EBFA 3TZQA 2W4QA 4AJLA 5MDHA 2HSDA 3SC4A 4QT0A 1CEQA 1ZW1A 1YWGO 1DXYA 1H0KA 3RC2A 5THQA 4GKVA 4NJMA 4IINA 1P1JA 5AXBA 5JLAA 3AK4A 4JX8A 1GU7A 3W4JA 1PJLA 4IQ8A 4RVSA 1GZ3A 2EGGA 4W9NC 2OZPA 2YDXA 4OJNA 4OO3A 4CLOB 5F5NA 4YA6A 3OFSA 3KYCB 1SC6A 3BXXA 1R4NA 4Z0PA 5CDYA 3QWFA 3DZIA 1PJ3A 4OKNA 3RBZA 1H2BA 4J4TA 1CQJA 3KYDA 4UVIA 3K5PA 4GH5A 5JY1A 5DF1A 3ZWAA 3LT4A 3DHEA 3WBBA 3W8EA 1FJHA 1YRLA 4II3A 1DFHA 1QORA 3DAGA 4GKBA 1HL3A 4OKIA 1XDWA 2Y67A 4NMHA 4J1NA 1CWUA 1EK6A 4M54A 5L51A 4XQ9A 4KUHA 4MKZA 1ZK0A 1VLLA 4CMKA 1GUYA 3UICA 1GCUA 1Q0HA 1PR3A 4EJ0A 3DHNA 2JFHA 1HYHA 3TZ6A 4R1NA 2VRCA 3H5AA 4BKQA 1LDMA 2NVWA 2W2KB 1KC3A 4IJUA 4RVFA 2SCUA 4YRDA 5F1PA 5AQ1A 3PQDA 3NDRA 3OIGA 4L0QA 2P5YA 1X15A 1SCUA 3Q2KA 4D3SA 1FK8A 1BMDA 3HFSA 3ZU4A 3NEPX 1ZK3A 1UJMA 2PZMA 2O3JA 1VM6A 4L73A 3PWKA 4AJOA 3G1UA 3RUDA 3S2IA 2YZ7A 4GMFA 1Z73A 1BW9B 4JLWA 1NPYA 3GZNA 1KEPA 4J16A 3UCEA 2PTGA 3E48A 1LQTA 5DCUA 1GYRA 2BFPA 2E37A 4ALIA 1LLQA 3CMMA 1MFZA 2VRCD 3NDJA 1AXEA 2CVQA 3ZN2A 4QFCA 4IZIA 5IFLA 1PJ4A 3DZFA 4RVGA 2DVMA 3ADPA 1YJQA 1KETA 1GQYA 4XYEA 3QWAA 3RUAA 3JSAA 1ZFNA 4NJMB 4RJTA 3H2ZA 3GVHA 1PGPA 1PWZA 4XYMA 1ULSA 5DCYA 5F5LA 2XAAA 4DBVO 3H9GA 3K6JA 4XKJA 2RHCA 2ZATA 4NK5A 3VH4A 4A0SA 1P33A 2ZTUA 4BNMA 2YFQA 4YRBA 5JFOA 2PH5A 2DPHA 1R4NB 3ZU3A 1HSOA 3L9XA 5HWSA 3GG9A 2X0IA 3EVNA 3TOZA 3H3JA 1Q7BA 3WYEA 1OC4A 1ARZA 1ENZA 1Q7CA 3I1JA 3UOGA 3I9LA 2J3KA 3JQ7A 3L6OO 3V1UA 2JD0A 3KYDB 3ZNOA 1I5RA 4HNHA 3NUGA 1HE5A 3ROMA 3V5NA 2JKVA 3IUSA 4Z9FA 3DBLA 4E6PA 3L77A 3LT1A 1KBZA 3GPDG 2F00A 4HUJA 1IOLA 1HWYA 3QJ5A 1FDWA 4CQMB 3P5SA 1UAGA 1PZGA 2HMWA 1PQWA 3PJEA 3BAZA 3KV3O 3GAZA 4YAIA 2EJVA 3D1LA 3R0IA 5TJHA 1IZ9A 1T2AA 3KZVA 3ICPA 4HFNA 3AI3A 8ADHA 3AW9A 4NBVA 4NR0A 3GEMA 4X54A 3GVPA 4BGEA 4I5GA 4I1IA 1R4MB 3JQ8A 2GERA 3C8MA 1D1SA 2I3AA 5B4VA 4PG6A 1SEVA 4PGFA 4PLWA 3PHLA 4Z3DA 3WDSA 1E6UA 3AWDA 1PS8A 3KHUA 3DBHA 1YQGA 2FSSA 4CUZA 1XU7A 3JYOA 4DQUA 1ISHA 3ONDA 1PGQA 3MTGA 5DCWA 3DR3A 1I0ZA 4NU6A 3ZWPA 3MWEB 2PGLA 3HDJA 1I3NA 3VZQA 4LCEA 3RFVA 2R6JA 1DHTA 2VTEA 2CMDA 2FPGA 3O8QA 1E1MA 1I32A 1K6IA 1QG6A 4KP7A 3H9QA 3QA9A 5DZSA 7ADHA 3E82A 1DFGA 1O9BA 5JDIC 3M6IA 1KVSA 1P31A 6ADHA 1ISIA 2PGDA 4EI2A 4NJOA 1UP4A 1PTJA 2ZQZA 4PLGA 3HE3A 3FR8A 2GGSA 3BMQB 3JD2A 3TDKA 1U5AA 1Q2XA 3WFJA 4YPOA 1A4IA 2UVDA 1XLTA 2V6BA 4MOWA 5T6BA 4YJGA 3GH3A 4B8ZA 1D3AA 3IKVA 2EW8A 4D0RA 1E7WA 4BHTA 4BV8A 1ADBA 2DBRA 2FHSA 3L6DA 4IDDA 2GN6A 3U62A 1QMGA 1N1EA 1MG5A 3VKVA 3HNPA 3EY4A 5BR7A 4TRNA 1SNYA 2CFCA 4MIYA 4PZDA 5K6AA 4DPLA 1B8UA 3BIOA 1EBFA 3BHMA 1UXKA 4FFPA 5I7EA 3JQBC 1O95A 4NIMA 3DBLB 1LDEA 2GR9A 3NTRA 3AFNA 2NWQA 2WD7A 3O38A 4EJMA 1CETA 1N8KA 2ZIZA 4M55A 2VZ8A 3ITKA 3PZRA 3HN7A 3DAFA 1I8TA 2X8LA 1WW8A 4OQZA 1GCOA 1MXHA 3JD1A 3A28A 1YB4A 2UYYA 4EEZA 3WYCA 1L7EA 1A7KA 2A35A 1B3RA 3E5RA 4PLHA 4A10A 2C20A 2POQX 3FNGA 1KEUA 4XB1A 5TC4A 3IC5A 4Q3NA 5BNTA 2PNFA 4WLUA 4IY1A 1K3TA 4F45A 1WDKA 4BNXA 2PD6A 4CMAA 4QXMA 4GSLA 2WWRA 2ZQYA 3PJGA 5G0VA 4AJIA 4ALLA 1PS9A 2DPGA 3DBHB 2IZ1A 1XWFA 4JP2A 3QWIA 4WPGA 4H16A 1IL0A 1O94A 2VTDA 4XQCA 5A9SB 2NTJA 5C5IA 5KWEA 2VHZA 1R15A 3GMDA 4LMRA 3QQPA 5HS6A 1ZK1A 2Y68A 2RBEA 1E0DA 3KSUA 1XSEA 5CFZA 1UP6A 3MJ4A 3O8QB 3WFIA 5KJFA 3H6KA 1DRUA 1BHSA 1EDZA 4YT4A 2O3TA 2VZ9A 5K6AC 1Q1NA 3L0DA 1JKIA 2BHLA 3NTQA 1R0SA 1Y9EA 1IULA 4FJ2A 2YYYA 4A27A 3UGKA 1BDMA 1VKOA 3GRKA 2B0JA 1FDUA 4R5HA 1DIHA 2XPCA 3IL2A 4JXKA 1Y8RB 1T2CA 4UEKA 3H9UA 5JSFA 3R3JA 1DC6A 2DFDA 5L9AA 3HJAA 1V9LA 4PLZA 2GDZA 2H5LA 3JQAD 4YJGB 2IDZA 3GQVA 4RLSA 1GYPA 1UR5A 1UP7A 5CDGA 4PLTA 3PVZA 3QVOA 4LCJA 4Q3AA 1H9BA 5L95A 1C1DB 4L9RA 5AVOA 5BQFA 3VAZA 1Z74A 1LDNA 2BI8A 4XIYA 3AM3A 4AJNA 4R9RA 4B3IA 3ANLA 4BO4A 1C0PA 4IDBA 3RI3A 1AHHA 1OI7A 3NJ8A 2O2SA 1PZFA 3GHYA 2RIRA 2H6EA 5B12A 1E7QA 1VKNA 1RWBA 3S1LA 2C5AA 2NV6A 4BOYA 1N92A 5BNIA 1U2DA 4XQEA 3L4SO 3ZCXA 3B1JA 1GL3A 2DT5A 3PGJA 4MP8A 1HDCA 3KO8A 2VYVD 3PHIA 5DN9A 3I9MA 4NBUA 3IJRA 2H1SA 1ENOA 4FB5A 5I8ZA 2V6GA 2HMSA 2FWMX 5JO0A 4ND1A 2E4AA 2Q49A 4NFHA 4IBOA 4OMUA 2FR0A 3ZWOA 1GAEO 1DSSG 2PD3A 2HU2A 5U9CA 1U3TA 4AJEA 3H2SA 3U49A 4NI5A 5JCXA 2D1YA 3H3FA 4J3FA 1R0KA 3BMOA 4BNKA 2X5JO 3RBVA 1TT5A 3MZ0A 4GBJA 5KVSA 4D3FA 1DJNA 4CM1A 4EUEA 4ZRNA 1EQ2A 5DBFA 2BFAA 4YT5A 1K89A 1LC0A 3ZNQA 1E1NA 1I24A 2J5KA 3GGPA 1HZZA 1C0LA 1EEHA 1O5IA 1E92A 1DOHA 1R6DA 2NM0A 1WMAA 2OL4A 2E49A 2ZJ0A 3LZ6A 3M2PA 3RC7A 3ZHZA 3CIFA 4DREA 1FF9A 2J6IA 4LW8A 4CMEA 4DMMA 4XGIA 4H7PA 4ZRMA 3A9WA 1ZSNA 3FBGA 4CL3A 3NGLA 3AI2A 4IDAA 5THKA 4ZD6A 4HFRA 3EDMA 2NACA 5ES3A 1A27A 1MFPA 2LDBA 1Y5MA 3GA0A 1BSVA 3ONFA 4FJ1A 4MVJA 3EHEA 4EDFA 3LC2O 2DLDA 1RKXA 3SX2A 2I99A 1U9JA 5T5QA 1BXKA 2DBVO 1R12A 4DIOA 4IIVA 3H4VA 3HWRA 3MJCA 4ZQFA 3VC7A 2I9PA 3G1TA 1WLYA 4RO0A 3ZZNA 4OH1A 3ZWWA 3DL2A 4HKTA 1G0OA 5F1OA 1SEPA 1P1RA 4RPKA 4BO7A 4ZICA 3R3SA 3E9NA 1YO6A 2P4QA 3T4XA 2IYOA 1QKIA 2GNAA 4CV0A 4D3DA 5H81A 2X9GA 1LA2A 2WE7A 4IS2A 4YAEA 2PK3A 3PWSA 1PQPA 5DOZA 3HDQA 2CD9A 1J5PA 3DMTC 5TJ9A 3VHRA 2G5CA 4YCAA 3QY9A 3WQSB 4MVJD 1MC5A 4W82A 1Y6JA 3K9QO 5G0UA 2CDAA 1K5HA 1F0YA 3OEWA 4MVJF 4CMEC 4A2CA 4F46A 4MVJM 4ALMA 1DFIA 2WM3A 2P4HX 3IS3A 4PG7A 4UUPA 1LSJA 4PZCA 3U0BA 3OP4A 2V65A 2Y1OA 1DC4A 2B5VA 1E7MA 2JJYA 4AJ2A 1SZJG 4QO7A 1AN9A 3ZH2A 5A06A 3ZWBA 3ANMA 3PYLA 1L7DA 1T1SA 5TSDA 1A4UA 3A14A 4CLRA 4OYRA 2DBQA 3S55A 3PQFA 3UCFA 4LGVA 1NQAO 2EF1A 3B6ZA 3KOUA 3S2EA 1I10A 4IJWA 5I7FA 4GX2A 5A4DA 3EUWA 3VPHA 4RDIA 5IZ4A 3ZWNA 5L7YA 3ORFA 1PZEA 4NBTA 2H63A 4DTIA 1QYXA 3SLKA 3TSCA 5KJ6A 4O0LA 2BKAA 2GD1O 4N7RA 2GRAA 3G17A 1ADFA 2DC1A 4LMPA 3HDHA 4OGWA 4FDAA 3OJOA 1CRWG 1W4ZA 4FCCA 5JPIA 3CTMA 2GZ1A 3ZDFA 5BSFA 3VDQA 3NRCA 3I83A 1P0FA 4NNJA 1GR0A 1PGOA 3AU8A 5AYVA 4BNWA 5BSEA 1NNUA 3MJTA 1DHRA 2R2GA 3AUAA 4I08A 4XGNA 1C0IA 3ZGYA 3RWBA 2XOXA 3OIFA 4J1TA 1KVRA 1S7CA 2GCGA 3HFGA 3UHAA 4BV9A 1ZXBA 5DP2A 3EZYA 3GNTA 2HKIA 4MKXA 2PH3A 3GRPA 3HDYA 3WJAA 4RZHA 1ZMTA 3ZHBA 3IDSA 4GGOA 4JNKA 5FI5A 2BH9A 1P9LA 4FR5A 3L9WA 3RKUA 1LSUA 1J0XO 3S2GA 1D8AA 1SPXA 1DEHA 1IHXA 1D7OA 4YVFA 4AJ1A 4E2WA 2RH4A 4BKOA 4W4TA 4JBIA 4GX1A 1NAHA 2QYTA 2ZTMA 3VPSA 1YL6A 3OBBA 3BZUA 3SJ7A 3E03A 3R1IA 3ICCA 1UDCA 2Q99A 3WOHA 1CIVA 1YS4A 4WE3A 3IUPA 5KVQA 3LC1O 1YONA 1O6ZA 3W6ZA 4FOOA 2Q45A 4DWVA 5J23A 5KVVA 3H9JA 4XD2A 3E9QA 2WMDA 3AUUA 4WK6A 4I9NA 5T8KA 1HYGA 2AXQA 5ENVA 1U3VA 5EMHA 3PIDA 4UVGA 4IMPA 1VPDA 1PJQA 4KWIA 4R4JA 4CLDA 1X13A 4OOEA 3C1TA 4UVHA 4YAGA 1X1EA 2JAPA 3TZHA 1LEHA 1N7HA 1NR7A 3AI1A 5JE8A 1KEVA 3EMKA 2GUGA 1CF2O 3WB9A 4NK4A 3GNSA 2EP5A 3F5SA 3PFWO 3F5QA 1TEHA 4RF5A 4W7IA 4ZHSA 5IDXA 2OMEA 3RUCA 1Y81A 5ITWA 5L45A 1YE3A 2EHDA 5KIAA 1TB4A 4DRYA 2O2YA 2UUOA 4D41A 3CEAA 1UXIA 3CXRA 3LC7O 2IEDA 3DC2A 3I4CA 3X2EA 4IGEA 3LK7A 4CUJA 4BO8A 3D5TA 1ISJA 1EVIA 3VZPA 1DLIA 2I6TA 4DYVA 5FYDA 4YT2A 1YL7A 2AEMA 4AG3A 1J6UA 3G49A 4HBGA 3O4RA 1ZEMA 3FNHA 3INRA 1UZLA 2D8AA 1T2FA 5KJ1A 1X0VA 4PN3A 2VN8A 3QWHA 4NBWA 1GEGA 3U4DA 4OL9A 1BW9A 3KUXA 2C7VA 3JQFA 3JQGB 3OIDA 4IZHA 4JBHA 3GZ4A 4B4UA 5JAIA 2VHXA 3KLPX 4EITA 5L4SA 1SO8A 3WSVA 1HRDA 4KZPA 1WDLA 1YQDA 1UH5A 5JDCA 4ZGWA 3FPLA 1ZZEA 3TOXA 2C07A 5JCJA 4BO2A 3TZKA 4Y6PA 4OHUA 2X9NA 1BXGA 3IJPA 3WSWA 1JWAB 1NWCA 4XZ3A 4E2ZA 1IZ0A 1LLDA 4ZVVA 1V3TA 2DUUA 4WCFA 4MVJE 4PLCA 2DU8A 4IDGA 1NASA 2P5UA 4WEOA 5DBGA 2B5WA 3I6QA 5C37A 1BGVA 2X58A 4XRGA 4K9DA 3V1YA 3FSRA 4MINA 4TQGA 3PPIA 1ISMA 5U1PA 4LSMA 4FD3A 4IXTA 2JD2A 3BTSA 1DDOA 4K6CA 2FSVA 1HE3A 3EW7A 2VCYA 1RYDA 3BMNA 5JCJD 3Q2IA 4CQMA 3UF0A 3FTPA 1LDYA 4M1QA 3MOGA 3OJEA 4LN1A 3DWFA 5GZ3A 1EBUA 5L4NA 4U6QA 2CDBA 3GDFA 4XJSA 4E31A 5KVCA 2GN4A 1Y9AA 3DZJA 4CMIA 2O3UA 4A73A 3JQ9C 1MG0A 1V0JA 1A5ZA 2VWPA 3VTFA 1HYEA 5DDIP 3RSHA 1GFSA 3WTCA 3PJDA 1MX3A 4FGWA 5JDCC 6LDHA 1ZIDA 3PFFA 4MPDA 3RD5A 4UREA 3RJ5A 1GZ6A 2CF5A 1R4MA 3ETDA 3N7UA 5A9TA 1BDBA 2OXIA 4D42A 2O7QA 1H93A 5B1YA 3GF4A 2NU6A 4HV4A 4QTZA 2B69A 4RZIA 1NWHA 1XR3A 5L53A 4BGIA 1X1TA 1U4OA 2HO5A 3PIIA 3F4BA 1ZBQA 4NG5A 2NUAA 3RFXA 4C7JA 2YY7A 4CQMD 1G1AA 4OOFA 4R3NA 1LQUA 5AXDA 5CG2A 1JKFA 1Z75A 4MO2A 1P0CA 1TA4A 2HK9A 4CPDA 2Y0CA 1GUFA 3EAGA 4XA8A 3WGIA 1Q0LA 1ENPA 3PZBA 4J1SA 3WR5A 3ZWVA 3KTDA 1Z82A 1LUAA 4PRLA 2VT3A 4R69A 2QRLA 2EIHA 3DO5A 3K96A 1C1XB 1QSGA 1WZEA 3DEYX 3BMQA 1E7YA 1PJTA 4KUGA 4EUFA 4B7CA 3VPFA 3GFGA 1KVQA 2O3SA 4QFDA 1WNTA 1LDGA 3ZWYA 3FF4A 3TZCA 1P1KA 3CH6A 1BXGB 1U4SA 4WECA 1J49A 3UKOA 5JAMA 3DAPA 2IXAA
chains in the Genus database with same CATH superfamily
1U2GA 2XY4A 4JCOA 3OZEA 5K3CA 1XRSB 2RI6A 4WESA 2J32A 4LRUA 4WCFB 1Q5PA 3PL1A 4CCAA 3OQIB 1DXHA 1R3DA 4QXPA 1JDJA 2D2IA 4TRJA 3V2GA 4AMZA 4FFMA 4ER3A 5JSFA 1QC5B 2PR2A 2C3MA 5FFFA 3S4YA 1BG6A 2VNKA 2ZRIA 1AUPA 4TKVB 1MV5A 1AD2A 2YWGA 3P0FA 2V54A 5HJ2A 4J4BA 5AD1A 3MT0A 2PA0A 1TPZA 1GRRA 4CG0A 1ESDA 4EATA 1OWNA 4DA4A 2OPBA 4L4RA 2KPOA 2R85A 4Z54A 1KTIA 5FUMA 3K9BA 3QKWA 3SEQA 5D84A 3AESA 5A5DA 1TOAA 4NJEA 2XMRA 1H5QA 3NVDA 4WXPA 3LVRE 4Q3BA 2A0FA 2P9JA 3KFLA 3MCVA 1NN1A 1GY8A 3NH9A 4TGLA 4FHDA 1HE8B 1WQ4A 4IV5A 5CT6A 4W99A 3RANA 4B0PA 2HIGA 3DAYA 4J91A 4O2RA 1R8QA 5TRTA 4DHWA 2OAQ1 3CNHA 2E6KA 1BWSA 1RR6A 1ECJA 3DV0B 5CPFA 2O50A 4F96A 4NV3A 4H1TA 2J0VA 2AF3C 2W2XA 1IY1A 1KY5A 3C3AA 1JJIA 1MH1A 3R2JA 1SXJE 2HOQA 2QTVA 4JBGA 1Z2NX 3JR3A 5E2BA 2VDRB 4V0MA 3MCZA 4D43A 1AKWA 1M83A 1OY1A 3V4LA 1XNGA 4JAVC 2XZTA 4JKOA 4XDGA 1Y3DE 5J40A 1PKXA 2JRLA 3DDHA 1BD4A 1G6Q1 3IPAA 4DZTA 5F3DA 2GYYA 2P67A 3M7IA 1VB3A 4CETA 3EEFA 4R2KA 4KO8A 1XKTA 8ABPA 1OQAA 2GXQA 2UV8A 2CNWA 3IJ5A 4NCKA 1W0KA 1HE2A 3KJZA 2ZB4A 2WE8A 1DNPA 1YCHA 3GC6A 5BUCA 1DG3A 1SK8A 3QFCA 5DFAA 5CBKA 3DE5X 5JIBA 1G8YA 4L7VA 3HGMA 4Z1OA 3PQ5A 3G23A 4WGGA 1HT1E 4YXFA 2IPLA 2PKXA 3VSCA 2XQVA 1M2VB 1OBOA 3C1UA 4K03A 2Z2XA 4KQGA 3KKKA 3H9BA 3K9WA 4R9VA 4R6WA 2E89A 4GSKA 3TTXA 4EQ6A 1PJBA 1Y8RA 5JAOA 2YFKA 1CJUC 1JDTA 1O9GA 2H1RA 3NTXA 1RWMA 1J1UA 3FYHA 4EF4A 2ZTLA 4DC1A 1V96A 3FHJA 5EP4A 1BEUB 5HZHA 4JJFA 3VZSA 2V7VA 3FPJA 4IMRA 3EDCA 5ICMA 2BR3A 2ZJ8A 1ZRMA 5CVDA 2QG6A 1FBNA 1WHSA 5AW4A 1Z15A 1WP4A 1U1DA 2HMUA 2QTMA 1U1IA 3ISJA 5AW6A 3TRHA 2ISQA 4DC0A 1U04A 4WESB 5KKAA 5K8LA 4BO0A 2F4VB 2X0JA 4QQFA 1RXUA 3B9RA 4IHQA 3UHOA 3VR1A 2IOFA 1JJAA 1F06A 1A8SA 1Y9ZA 2P0AA 2HDOA 4U7JA 1NL3A 4WY8A 4V0QA 1KTVA 2NO0A 2X9VA 4DLBA 5JFGA 5MN5A 1ZH8A 4UHFA 4U7HA 2FR8A 3DEZA 4Y2JA 1KBQA 1GGJA 2Y27A 3EIOA 2FFHA 5A05A 3S68A 1U7XA 4ESEA 4KXQA 1EX9A 1DTSA 4Q05A 4UXJA 1I7PA 2XF8A 3P9KA 4RKRA 3VVLA 2VT6A 5T67A 1E4OA 3TZLA 5IM4A 1QUFA 3EF0A 3HG7A 5CFNA 1B76A 5M29A 1N78A 2IS4A 4MJXA 3GLGA 1NFRA 1Y37A 2PZJA 4G97A 4WKBA 3TR6A 1VC2A 1VG1A 4ZCLA 4LX0A 2OQIA 4NJEB 5G2OA 4URZR 2QE7A 5DW3A 3TQOA 1ZXXA 2HCBA 1XIVA 5ER6A 2OXTA 3ZNNA 4YCCA 1C50A 3KQQA 2J9RA 3KVOA 1RM4A 3CR3C 4H4DA 4F1JA 1CNMA 2EVWX 5GWXA 2GHQA 4PO1A 2Q3EA 2VP9A 5AVSA 2WIDA 1XNRB 3W9SA 4G56A 4RH3A 1KO8A 5EFOA 2WV7A 3NUZA 1UM9B 4BCBA 3X2SA 3FM9A 2WTAA 4RNDB 3D4PA 5DBEX 4LY0A 4ZVLA 2V5VA 3WBKA 3CUWA 1KU6A 2YW9A 4CW7A 3LDUA 1WSBA 1JV2B 4GYJA 4BNTA 4RLQA 5TPZA 5K6TA 1OE0A 3BULA 1C7RA 3GOQA 1O95D 3EZXA 3UJ7A 2G9VA 4JKIA 3I6BA 5AW3A 3OMXA 4Q1BA 3VNVA 3IEIA 1CD5A 3AF0A 4DQDA 2M9MA 1XCMA 4C6SA 1PSZA 3DO8A 3L82B 4ZCRA 2G80A 1JTVA 1N6LA 3BORA 4NECA 3PDJA 1DRVA 5CR9A 3SIXA 1L8QA 2G25A 4X64B 4HQNA 4TRMA 1FJGB 4A8HA 1RMQA 3KR0A 1AMOA 1SC9A 1OH6A 1OGYA 3UFXA 2IGTA 5HEKA 1R74A 2YINC 3VDRA 3OM9A 5GTDA 1IH8A 1C2YA 4P35A 1MQ8B 1GGMA 1ELOA 5IMBA 2IL1A 2BFCA 5DSTA 1XQWA 2DYKA 5KBYA 3RUEA 1U7UA 3CLVA 4YAFA 4EQ6B 3GBSA 1SY7A 1BGXT 1VJ1A 3CQ9A 5B6PA 3CUEF 1S2IA 4OMFG 1MENA 1Q19A 1WA5A 4C08A 2VWHA 4DLYA 1O6FA 2XYPA 4GD3Q 3AO0B 1BN6A 4G84A 4BQPA 5JRDS 3E27A 1ORHA 3KM0A 3L8FA 2V58A 4GL4A 4W5WA 5ALOA 2B8NA 2V96A 3BA6A 1T26A 1WD7A 4J0QA 4JY7A 1O94D 1WHSB 4OHXA 2E6UX 2VRWA 4PQEA 4AXBA 4EHJA 3BJZA 4MGKR 3QVSA 2KM1A 2OK7A 2VJMA 3D3NA 3PYXA 2WU4A 5HQ3A 2OD9A 3PFIA 2EJWA 4R2IA 2Y6VA 3UMCA 3ADOA 2C5HA 1HFWA 2ZBRA 3FVTA 4UUBA 3RC3A 2YIDA 1Z2EA 1BU8A 4BXOA 4UULA 4XM1A 2ZJ4A 5HKLA 4D9CA 4Y2QA 2O1SA 3X1YA 2CDCA 5FADA 1C14A 4W5OA 3R75A 3H0KA 3ZY5A 4FGUA 3CCFA 4GEKA 3CKMA 1EFKA 3P7MA 4I9HA 1DOAA 2ADMA 2ON6A 1RI3A 3VC3A 4B31A 3DGEC 4E1VA 4BX3A 5C7IO 3K9NA 3C7AA 1RLJA 4C20A 1FQJA 1AVTA 2GEBA 3DQZA 3EBLA 3L49A 4FMDF 4O2AF 4ENQA 5BUSA 3UAWA 1MOPA 1U0BB 5I7OA 3BH0A 3KKMA 5IDQA 1ZQ1A 1NVMB 2XVMA 1ZXLA 1ML3A 2OBBA 4H0CA 3ZE0B 1S96A 2C3OA 2ZJOA 3NBXX 4LCBA 1K0FA 4E2XA 4A15A 2BY4A 4MS4A 2GZ3A 3DVAB 4PQFA 1EIZA 3NHFA 3HLYA 4DBZA 1FW6A 4NXMB 2AYZA 4TN1A 2JI7A 2WIJA 3P52A 4ID3A 3EPLA 1C8LA 3FOEC 2YHIA 3B70A 1MLDA 3PHHA 4R31A 3D2CA 1N6RA 2ZB2A 2FOIA 4P0PB 2NNLD 5K0FA 2EERA 1P7YA 2QX4A 5BNFA 2ZRGA 4HR7A 4Z7QB 2XKJE 3E3LA 3BWBA 3NOVA 4J0EA 2QUZA 2G5GX 4UJ3A 2YJZA 4RVDA 5EJ6A 4U3JA 3OJFA 2ZAYA 2X7HA 4NC9A 4PAOA 2EC5A 3UJDA 5GM1A 3V55A 3LWNA 3VYVA 1KDYA 1GQFA 4ZWNA 5K4AA 1U0NA 5ICSA 4D79A 4BFVA 2FMIA 3H99A 3SD7A 2IIPA 3ILSA 4PF1A 3WK6A 5KYXA 2RMKA 2B34A 2FDRA 2GD6A 2JAWA 2Q5CA 4FTWA 4OQYA 3UFXB 3OSUA 4CM9D 5AVTA 4BNZA 3RUFA 5HTOA 1ZRSA 2J87A 3EOBI 3R3HA 4LECA 3T1HB 2AJDA 2C9BA 2BFCB 1Z29A 2OCLA 2Y1FA 4Q3EA 1HR0B 5CM2Z 3DEAA 1OFVA 5K3DA 2GEUA 5EUBA 4MA0A 2OHFA 4TVKA 3VI3B 1TM7E 5CW1A 3HM2A 2DKNA 1T3SA 2C2ZA 2MOKA 1P9WA 1ECCA 4JK3A 4GQAA 4UFOA 1F8UA 2B35A 1NSFA 1DX4A 1V7CA 4R9SA 2QVLA 3IDFA 1GGFA 3K2BA 4L4SA 4XR4A 3BWDD 1L1QA 1L4YA 2QN8A 3DMNA 3EMDA 4RD1A 5CHYA 1J42A 2C5BA 3IXLA 2O57A 1TA0A 4KXUA 3ZXIA 4DPMA 1R8SA 1RE1A 1N9ZA 4FC6A 4KG7A 4X8MA 4B85A 2VJMB 4ZOLA 3LH5A 2HAEA 4FMCF 2EJUA 2J3IA 3KRTA 2NUBA 4GBED 4UAVA 2RHHA 5HQ3B 5EHZA 3RS8A 3HJHA 3S8EA 2GHRA 3BQ9A 4RL6A 1WUIS 2BEVA 4PFQA 1SKQA 3DXXA 3ZCRA 3WGTA 3Q40A 4UHBA 1U7TA 3SBDA 3AM1A 1JVBA 4I1OA 3JAWA 3X3HA 5TF4A 2D0PB 1MGOA 1DKOA 3WICA 1NQWA 4Q6WA 1IWOA 4DY4A 1U7ZA 1GKUB 2AA3A 1NBMA 2DT8A 2KJQA 2PL1A 3L7AA 3PC7A 2XUHA 1WPQA 3M3PA 4YV0A 1ITZA 1GXSA 2GPTA 4KWHA 2H85A 3TVTA 2H2WA 1NJ2A 4B6RA 1A3CA 1GUAA 2X86A 3C7DB 4IVQA 1BTOA 2E4WA 4G36A 1TZKA 4DEVA 4TWRA 2P7IA 4ZEXA 3GGGA 1M5TA 4D7AA 2XLBA 1B6SA 1CJVC 4QTXA 2M1XA 4UZFA 4M9CA 5IN5A 2BGUA 3PPYA 4HQ6A 4OI1A 4WUVA 3RUPA 4F06A 3KHKA 4BO1A 4HB4A 1AMNA 3B20A 1UM8A 3DBIA 2HLNA 4HMQA 4P5EA 2VOJA 3UV7A 5KTNA 1JDPA 3NIWA 2DF8A 2YHIB 3HHEA 1E58A 1C1HA 4FT2A 4M3NA 4FS8A 2ZUSA 3CSDA 3ZCTA 2X0KA 3G5MA 4KLRA 2VF4X 4M21A 3RC1A 4IIXA 4REMA 3V8PA 3GMSA 2QMEA 4IOJA 4KN8A 2PJRA 1T4MA 3M1IA 4QBHA 2FPKA 3DULA 4GYWA 1CEXA 1G8KA 3KVRA 2Y1XA 4YJ3F 1C3VA 2PLAA 4QLAA 3K3PA 2V1UA 1OWLA 2NOAA 5EWJB 3GLGE 4DCTA 3CZPA 4NH4A 3QU7A 521PA 2B7CA 2W8BA 1DC7A 2IQIA 3OY7A 4PFJA 2H0QA 4NU8X 1FJXA 4GP9A 5TR9A 1CTQA 1SN7A 4M87A 3V8VA 3ND9A 1NVWQ 3C14C 1NZDA 3OHPA 4J8PA 4CYMA 5BYJA 1Z6AA 3AP1A 4TL8A 2PXXA 1Q7EA 1PX2A 1VFPA 1NMEA 3FBTA 1JALA 3O47A 3DM5A 3HZOA 3BWYA 3FSGA 3K35A 3W7AA 2R8RA 5IT4A 2AG5A 3WL5A 1QQBA 2BSAA 2J30A 3RDPA 3BMCA 3SDSA 3B89A 4YR9A 3MAJA 1RLMA 2QMOA 3NBMA 4IRXA 4QUJA 3O9ZA 4F04A 4UTRA 4LZAA 3OE1A 3E6AA 1MW9X 3A26A 3MG9A 4EUSA 3QVTA 5C1DA 2DRIA 2Y4OA 3AR6A 4FIDA 3AB3A 5KOIA 5L40A 1KJJA 1WB6A 4IZ6A 4RF2A 2DETA 3H2IA 1A9XA 4MV3A 2WYHA 4N49A 1PFGA 1RAHA 2GM3A 4ZU6X 2NV2B 2XCQA 4ZOLB 1USWA 3F7TA 4RIFA 3DB1A 3KSAC 1IVSA 4IIBA 2HNAA 5EZYF 4UUAA 4AMUA 4BMCA 4S1TA 2BGWA 4RD6A 2XLCA 3HO8A 1ABFA 2JS7A 3JAWB 2V5AA 1OLOA 4F85A 3QHQA 4NPAA 3A2NA 3EG5A 3K16A 5BN5A 3IIJA 2Z95A 1RT9A 2Z3WA 3ZHOA 1WDTA 2H4FA 2OXEA 4DV5B 2YFHA 1KEWA 1GEEA 2FW1A 2BVNA 4HLQB 1GQ2A 1GXSB 1FP1D 5C1PA 3O2NA 4HDKA 4FGSA 3UENA 1E3DA 1QFYA 3P96A 5HIMA 4BECA 4KPYA 4IL5A 1RAEA 4QM7A 2RGXA 4HP8A 3CXUA 4R68A 2FEOA 4FMBB 4G0QA 4W5QA 3VHXA 4CIBA 2FRDA 4BNHA 3OEHD 3CLHA 1EUCA 1VLMA 3ENWA 1L5SA 5JV5A 1JG6A 1KNXA 1JLRA 2QDKA 3O5AA 2B99A 5FRDA 1KHTA 3HJTA 3MAGA 1ONBA 2FPPA 3J81A 5LB2A 4BLOA 5CIYA 1ZNQO 1TUEA 4HWOA 4N54A 1GADO 3BE4A 5F73A 3OQ1A 3BXFA 4JL8A 4MW9A 4UDOA 3W05A 5KWVA 1SUBA 3D4BA 1M0WA 1U81A 1D5WA 4NE2A 2A5YB 3I42A 1KRXA 2CMFA 2DFTA 2D5CA 4JC0A 4V2IA 4DIBA 2Q3FA 3NO4A 4CM7A 2CVZA 3FDIA 2WT9A 1SCNE 4WL0A 1TQ2A 3AJEA 5LMZA 5JD3A 4DW8A 5ECYA 4YXWD 3OESA 1JHXA 5KYKA 2CVHA 4YRAA 1SU6A 3TMAA 2IYLD 2XHZA 3RFTA 4B34A 4PX9A 1TAGA 5AVWA 4KUEA 2Z3VA 2W8BB 5EOVA 1ILEA 1IAQA 1N9GA 2QUIA 5K01A 1AHNA 1TFRA 2UYGA 3RBXA 1L6RA 2NO1A 5I9SA 4JSYA 4G0MA 1ZA1A 4HAYA 3K0CA 4XLLA 4UU0A 5AKIA 5AKZA 5CDHA 5K0CA 4HNVA 1LTHR 2PQ2A 2QUHA 1B1AA 2XBLA 3NYWA 3NYRA 3JVEA 3QKSB 1CUAA 2QB5A 5AW5A 4EELA 4KXVA 2IEAA 3TKAA 2AZTA 5I5EA 3ESCA 3BMCB 1Y7HA 2YVQA 4NBSA 4TTSA 5KNBD 4UD2A 3CA8A 3I3OA 4FPXA 4Q3DA 1DZIA 4ZAXA 5TGDA 5K0EA 2DTXA 1E3MA 1LJ8A 2ZSFA 3CX7A 5FA8A 4BVAA 2HA2A 1Z5WA 1KR2A 3PHBE 1J9EA 2WJ4A 1OTHA 1PK7A 1A9XB 1RRVA 1SVWA 4I2NA 1JYEA 3IHWA 4R1LA 3U19A 3GLUA 3ZTYA 4HXYA 4RQTA 4BUJA 2QRUA 4YRPA 4MW2A 1FNCA 4BO6A 1I33A 1PL7A 1JA9A 4XEHA 2PV7A 3BFVA 1H1DA 1QIJA 4N41A 3OF5A 3ZHRA 1C1XA 1VE9A 2MSNA 2ZCVA 3VOAA 3ZHCA 1Z6ZA 2ZI7A 4RYLA 4R54A 1IZ7A 3IAUA 4DADA 1BFUA 1FUEA 1EFUA 2ZYVX 2ZIAA 4EYOA 3KD3A 5GADl 4RETA 2V5UA 4JB8A 5JXJA 2WNHA 1WDWB 1YOVA 2JA1A 3OH8A 3PQCA 5BSGA 2QAGA 2OHVA 3V80A 2DHDA 1NTRA 2C2GA 1L7PA 5EMKA 1R6UA 2YQ4A 4E5UA 3GPLA 3FVVA 1US8A 1IUPA 3QXGA 1EM6A 3VHXB 1ZQ9A 4KXNA 3BDAA 4FN5A 4LHWA 5AVXA 1EUCB 4IG4A 1G7CA 3HVHA 4U7TB 4KPEC 3LAWA 3VV2A 1LK5A 2OOKA 1F38A 4COKA 2C5LA 3PQ7A 4BJ6A 4C0LA 5B1EA 1OBFO 2IPXA 2NU7B 2FPPB 3ZDZB 4DKJA 2IYTA 3CINA 2O0MA 3O91A 3D2BA 2QLFA 4RH0A 4LSGA 4EHNA 1FS6A 3G5AA 2ZPAA 4FIZA 5CDTA 2W6OA 1F48A 3T9AA 1JPJA 4L8YA 1TK2A 4YJFB 3H3XA 4JODA 1ZK4A 4R83A 5HM8A 1LXCA 1SKMA 2H2DA 2YN2A 1GNVA 2GCEA 3DE7X 1HFEL 3PC6A 4F2HA 4QOGA 2A4KA 2C82A 1X1DA 3CISA 3Q9NA 5HCIA 4WD3A 1N0UA 3BC1A 4X60A 4ARUA 5HXAA 1NBME 2BE7A 1JQEA 4BNIA 5CEFA 1SULA 2JI9A 3CY6A 3JALB 4TTVA 4D98A 4YIKA 4CKXA 3UATA 3IRUA 3ILXA 1N9GB 2P2NA 5FOTA 2QWXA 2VUTA 1NLFA 3N0RA 5H83A 2CUZA 2X77A 1RRKA 2PUAA 3CG4A 4XQGA 3R7LA 5B7GA 4MUAA 3TXXA 4KK3A 2RHWA 1M1YA 4MWGA 5E0KB 4NICA 4YRIA 1XZQA 2WKPA 3C6QA 5LBTA 4B80A 4YGYA 3L4KA 4E5YA 3AINA 4H2DA 1OZAA 3LQFA 1JZQA 1E1YA 1T8SA 1AG9A 1SBHA 2HCTA 2LW7A 4YRGA 2C88A 4ALKA 1EX7A 4H77A 4QGGA 3RRZA 2VTBA 2DG2A 3KDPA 3DT9A 4FUTA 1CYDA 2XUPA 5EN4A 3U60B 3VYSB 2A0UA 3NC0C 4QGBA 4X6LA 5HPYB 2VA8A 1LNQA 5CA1F 4KR7A 2ZB8A 4BB6A 4G8BA 4K3UA 1XCJA 2ZSAA 3OTHA 4DJJA 2BH2A 2Q5OA 2VHTA 1GILA 2OCIA 2PZ8A 4I14A 1KKMA 1NYQA 4QU8A 4URWR 4I5EA 5AIAA 2G72A 1KJWA 2L42A 3PHCA 5F1KA 3I6MA 4I8XA 3V42A 1ZJ6A 5IZCA 4PIMA 5ARBA 4AKGA 1C30A 1M1NA 5FTKA 4HN4B 3ACCA 2EWVA 2YV1A 3R7DA 2J9FA 2A67A 4M4SA 2QVCA 4NCNA 4RKFA 3A0UA 3OFKA 2R44A 1BRMA 2GJSA 4H3KB 2XWQA 1Z2PX 3GL9A 3Q6IA 1QFMA 2G8NA 3GGOA 3P9YA 3QW2A 4Z86A 3CO5A 3IP8A 3RFFA 5CXQA 2V3CC 1A04A 3CJRA 4P7KA 5FOXA 4BKRA 2KW5A 4CQLA 1FQKA 2ZCUA 4AXXA 2G71A 4QC2A 4B8YA 1YQEA 1YOVB 2WU3A 3LU1A 1SBYA 3W7BA 4CG3A 4H0NA 4MQEB 5B7NA 2SNIE 2QVYX 1UBCA 3PD7A 2AE1A 3DSRA 2IVZA 2VSOA 4X1YA 3S27A 1EB9A 1ZA2A 2IYXA 1MOZA 4RGVA 4FR0A 3UK6A 3U4MA 2E55A 2IXBA 5CP8A 1KIFA 4J2OA 4EKGA 1XZDA 5JEEA 4L27A 4N3CA 3LMKA 4YTEA 2GYUA 2XBUA 5FHQA 4EFDA 1KXJA 1YZ3A 4V02A 1QXSA 1JL3A 3HCEA 3TJRA 2CBZA 2REBA 2ZK7A 2ZBFA 2FW7A 9MHTA 3QLUA 1G98A 4RDCA 4GWKA 2OFWA 4DXHA 3TBKA 3UB3A 2OHIA 2NXCA 4DJAA 1NVEA 3BX1A 4LFAB 2CXRA 1D2AA 1KJQA 2UAGA 4J3JA 1VLVA 2ZXUA 2QQGA 2VUSA 4Q34A 4S2EA 4U63A 4CXMA 3E2MA 4ROTA 4HT3B 1G8GA 1VJTA 4NPCA 2P77A 3FPHA 1FRQA 4TZ6A 3X1KA 3KQSA 1G7TA 3ZIDA 3IVCA 1AU9A 1K88A 1RLIA 4I3FA 3UH1A 5IASA 1YQUA 2H7VA 4B48A 5I47A 1QRTA 1N33B 1DI0A 3CVYA 1C4WA 3UXEA 3DLPX 1NHGA 4I4CA 5FNVF 1EVKA 4JOQA 5K8UA 3L02A 3EBPA 3GT0A 4RTJA 1X8JA 1IJEA 3JQQA 2HIAA 1TCBA 2QTNA 3CR8A 3KLBA 4J2HA 3BWMA 4UCWA 4X7MA 1JWBB 4WINA 2UVPA 5AKEA 5KCMA 1M1YB 3NVMB 5FR2A 3GPCA 2PS3A 4L85A 3F97A 4NBKA 1GN9A 2NIPA 2VUUA 3R5XA 2W6QA 1FY2A 3QLEA 3PFGA 5EUCA 1XJQA 3UUWA 1SUCA 3ZDQA 3NWJA 2QL7A 1AF4A 3LO5A 4ZU3A 3ZI4A 2VTBB 1HNXB 1Q74A 2R79A 4CMCA 5AVQA 1GL9B 5FPTA 4DGSA 1SCQA 2I3BA 4YO7A 5T64A 3HCCA 4ENPA 3TTVA 4K9KA 4DQ0A 2QR5A 2RD2A 2XYQA 5IJ9A 1TC1A 1UBJS 2X2EA 5AJVB 3QMVA 2XCRB 1P29A 1XLWA 4P2BA 4W1SA 5EP2A 1M1NB 2J3JA 2W00A 1IY0A 1P3Y1 1J39A 3EC7A 4YCBA 1W0JA 3IUQA 5BXYA 2J9FB 2ATEA 2FV8A 2ESRA 4X1KA 5H0IA 3ZW8A 3FZGA 3S8YA 3K70C 2BUBA 4YRMA 1MEOA 1N75A 3BB3A 4N3NA 1C3EA 3E2PA 3AX6A 1U3CA 1VMDA 1J07A 4BVBA 1MMFB 4BL5A 1I7NA 1DKMA 2L82A 2CBGA 4G4SP 4BNGA 2OUIA 3HU3A 1NC1A 4J4HA 4UMDA 3TNFA 4WKCA 3VOSA 1IUNA 3P9IA 3WMWA 2OFXA 2RGEA 3A7DA 1SKBA 2A78A 3RTGA 4LBZA 1ZOOA 1DV1A 1GL7A 3QVGA 5L4LA 1Z62A 1XTTA 1W1UA 2A7QA 2MIIA 3LZCA 4X1YB 3OEYA 4P4TA 4MIEA 1IHYA 1NY6A 1YBAA 2RHJA 1DBVO 4MYCA 3TQHA 3B51X 4BMZA 1B0UA 1QRSA 3M2TA 5TARA 4XTRA 3IMFA 1DDIA 1L7XA 1VSTA 1NVGA 4TXLA 5D2CA 1R9GA 4GZMA 4O4JF 4QTYA 4P58A 3PNVA 3EQ2A 2G5TA 2LTAA 3L4EA 1KMIY 1FMLA 3MD9A 1MVOA 1U3WA 3SBOA 4GOLD 1LF0A 1QYRA 1OZHA 3W1VA 4A5SA 1X2EA 4NMWA 3PGA1 3U13A 3I3SR 1OILA 3TK1A 2G36A 1ND6A 3E61A 3IE1A 1XRNA 4MKRA 3BHJA 2ZYIA 4ENSA 2JCXA 4BP3A 2Z6UA 3OA0A 3U3DA 4DARA 3EARA 3NR2A 3QLVA 4MYDA 1B73A 3DTVB 2B1JA 1DE0A 4YP0A 2NTEA 3DDWA 4J90A 3HHPA 4XX0A 1GN8A 2WQZA 1EINA 2XEXA 3E9CA 1ZWKA 2B1QA 3IPYA 1W94A 2XTNA 3AM5A 3LP8A 2QL9A 3JY6A 3RSGA 5IXSA 4P7BA 3LUCA 3I32A 5CVTA 2QVZX 4EPXA 5JSHA 5CW2A 4EY3A 2UVPB 3FWPA 5CCBA 4U4AA 3OZTA 3TEJA 1FTWA 1W30A 3CH7A 4Q16A 5SZJA 3HXOA 2PZKA 4OHYA 2HWWA 3QUCA 3O31A 2AIRA 3NMUF 3CX4A 3KAQA 3GXBA 4TX1A 1G9SA 1YS6A 1I3LA 1P61B 3HJRA 3KDSE 2PD4A 5FUBA 5F5XA 4FKZA 1XZIA 3ASZA 1GZ7A 4PNZA 1T1JA 4TKMA 1BMFD 5KKCA 2YVLA 4Y6OA 5SZKB 1KGDA 1LSOA 1KHHA 3OETA 2QTCA 3GN2A 2VYNA 3ELBA 3IUEA 4ISBA 2RKOA 1D1QA 2IS1A 5ADHA 2REXB 2YOHA 4RMIA 5DI3A 4E4TA 4HZUB 3FYDA 5CT9A 2GO1A 3L04A 3NFRA 4R0NA 5CJJA 1P2GA 4NYMR 3W06A 7GPBA 1NAIA 4TTAA 5FAKA 5TLSA 3BTOA 2F3UA 1SOWA 1NIJA 3AFIA 3VUEA 2C77A 2IYPA 2OZEA 4QVIA 1OZFA 1A7AA 2I4TA 5E95A 1V16B 2FZEA 4IWYA 1LD3A 3A27A 3JQAA 5GAJA 4Z4GA 4NONA 2Z5LA 2QYOA 4X1KB 1O4WA 1XAHA 4FSHA 1M2OA 4URXR 2V7TA 2IUSA 4WLEA 1JP7A 1XX6A 2XXAA 3KAKA 5T3UA 1TIBA 2C7BA 1BH2A 1OI3A 4CEHB 1T0BA 1YZUA 2LCIA 3EYAA 2RHLA 1KFKB 4K26A 2Q46A 1N36B 2AVNA 4U7WA 4AYWA 3RYIA 4D9JA 1N4DA 4R01A 5A3QA 3KUDA 3SHWA 4AN0A 1FMCA 3DKIA 3FCYA 1B2RA 3QVGB 5ALWA 3WZ2A 5JHHB 4ZRDA 1PFWA 4ZFNA 4EZBA 4X7PA 1LCIA 5F2OA 3MLAA 3IFSA 2VS1A 4DIMA 4E46A 2ZSEA 3GEHA 3UY4A 1MX9A 4A8JA 2O3QA 4ASUD 3E3AA 2JLQA 5KPDA 1WXQA 5IKOA 4CIXA 3S0JA 2JW5A 2OO5C 4MW5A 5AUPB 5HIKA 1DMRA 2LIVA 4HNQA 2BTEA 2K5UA 3CH5A 3Q88A 1GNQA 1FP6A 1WPXA 4ZP1A 1M1UA 3FUXA 1HTBA 3DMGA 1FP4A 4MWOA 4BNYA 3NT4A 4FFBB 2GBFA 3P27A 4BQOA 1BC5A 1E1KA 4EAAA 4W7SA 1DPGA 1JMKC 2BMDA 4KFCA 4QOSA 3M3DA 3G0DA 1XEWX 5FTWA 2HBZA 2AN4A 3GFFA 3OCJA 3O8OA 4B3CA 4FX2A 4ZYVA 4Q15A 1O58A 5KSYA 3R9WA 2ZJ7A 1Z7BA 2WHYA 1UC4B 1JE0A 2Y6UA 1WAMA 1FRFS 2BFFA 4DLAA 3OVMA 1YKSA 3IOEA 4AY4A 1SUIA 3LT0A 3BCUA 4Q1EA 3L0SA 1UDAA 4I1SA 1EP9A 2E18A 2F62A 3EH1A 4FYXA 4O33A 3S3TA 1PGJA 4W5RA 3NHMA 1YK0A 3AVOA 4GWGA 3V8NA 2Q2VA 3UJCA 1V11A 3BTVA 1CDOA 1UMDB 5IG2A 1Z35A 4URYR 2QYSA 3WNQA 1RYZA 1G8FA 4G65A 4IDOA 4DHEA 1KJZA 1OZ0A 3H8SA 4MTCA 3QG1A 4ZI7F 5JCZA 1DJPA 2C9OA 2XODA 3DFZA 4Q9NA 3WHLA 4C05A 3K2EA 1RZ3A 2P9YA 3SJAA 2GN2A 1RYHA 3BH7A 5KSWB 5L6MB 4JUCA 1Y8CA 2C97A 3VR4D 4DPKA 5K4HA 2WPDD 2XYRA 3LX5A 1EB8A 4W9MC 2V7EA 1ISGA 3SYMA 1N6OA 4KE8A 2C2BA 4HUTA 2OAEA 3TF5A 1WP9A 2FRVA 1T9ZA 1YVDA 4U1RA 1QV9A 4F3CA 4QYXA 4O4HA 4FC7A 3LXRA 3MELA 2QW1A 1DTWA 1NP6A 1VXOA 3AERA 1WXDA 3HMKA 1HT3A 2Z1NA 1JHVA 3JQCA 3MERA 3PLRA 3Q7TA 4O4LF 1O03A 3ZE7A 5CFPA 3DWGA 4W6ZA 5JZSA 4TSKA 5GM2A 1GZ4A 2OK8A 3AUJB 4Y2XA 3JQAB 5JVDA 3IBYA 4YIHA 3WLNA 3DTTA 3AF3A 5K8TA 4CL8A 2A9RA 1J56A 4M76B 4RY0A 3DMYA 3GCGA 3FMOB 4UNIA 5DLPA 2Z9CA 2MT9A 3HU2A 1OROA 3SN6A 3NKLA 2O19A 5F98A 4RADA 1E9RA 1XPRA 2PKQO 4TMTA 3PR2B 4DWOA 5KMGB 4ESVA 2PQ0A 1DARA 1N2GA 3M34A 3GJZA 4G1BA 2IY8A 4JHLA 4KR0A 1PK9A 2UXBB 4J75A 2H7XA 3TGLA 2NSDA 4D6YA 2A0XA 3QSGA 4PR0A 4PSVA 5DNWA 4OCZA 5LNK6 3U09A 1DUSA 3MJSA 3ZQJA 2ZP1A 2FWNA 4YLEA 2XGGA 1OWOA 1XWIA 1R16A 1RRMA 2OBNA 2PJZA 2ZYGA 3RLIA 2ZW9A 5D51S 5TE9A 4K1LA 1SCJA 4PCAA 4TMXA 2IYUA 2HHCA 3ZE1B 4BIMA 4LSWA 4PTYA 3ZUGA 1ODIA 2R6FA 1EG2A 2M6RA 2M6SA 4JEHA 4N65A 1P1IA 3RV4A 5TIIA 4BE7B 1YE5A 5DISB 4I1PA 2W71A 5HP4A 4IQ4A 4ZYZA 3ZV6A 1FP4B 2C99A 4KHPB 1E5QA 2JF0A 5BT9A 2JH3A 1SKAA 4KGDA 4RYDA 3WYDA 2AZXA 1V8ZA 1GPKA 1SKUA 1ZIPA 2P9EA 4I8IA 4WXYB 4M0MA 2XEDA 3O8OB 4WNIA 3RS9A 4AKSA 4ZK6A 3IQDB 2C4NA 5D5PA 3OE7D 3UW1A 4KI0A 2OD2A 2BFFB 4PBRA 2D4AA 3HR4A 1F1JA 3UK7A 3V8MA 3LECA 3U9LA 3JTEA 2PUDA 4DMKA 4EHFA 3JQDA 5AI5A 1LI7A 2C3PA 1XYYA 3MQ4A 4Q1VA 1LBTA 2I3GA 3M6XA 5C34B 1EGQA 4A3SA 4C4YA 2OKCA 1AS0A 1BHQ1 1M72A 1SIBE 1XRJA 2PKQP 1H6BA 2HYIC 4MCJA 1Y3HA 1ZK2A 5AI4A 2DHCA 3VO9A 1OGJA 3QXSA 4KYIB 1SUPA 2F3RA 4MRRA 4ZQEA 4BZXA 5L7WA 1TU3A 2QW8A 4TVOA 1WU7A 2FUCA 1GPJA 1BJKA 1BKDR 2ZWPA 4H59A 4R1TA 3WWCA 5C8DA 1WHTB 5AKXA 1I0LA 2C7OA 1JVSA 3A3NA 3GUYA 1SBNE 4QSMA 4E21A 4W7HA 4YO8A 4ZQHA 1KJ8A 3I9NA 2HJ9A 3JAKA 3HWSA 1NXOA 5IYZA 1RVDA 4YJ2F 1IRXA 4GGPA 4G0OA 4UBNA 3LY9A 3I58A 4UHDA 1PJ2A 5L3ZA 2GXAA 3D3EA 1DTWB 3OT4A 1OJLA 3Q3JB 2VDKB 1TMKA 1PG5A 1UBLS 3AQIA 4CKCB 4PWYA 1ANKA 3CTPA 2NZWA 1BXZA 3LVBA 3P0RA 1AKMA 4FMCB 5JVDB 2QQ0A 3SBXA 2O6HA 4PNPA 3WV5A 2C04A 3D0RA 3B1XA 2A4MA 4GC9A 4LMAA 1OXXK 1UBKS 2Q21A 1E1RA 4MGIR 1NN3A 2EOAA 3B1KA 1GR1A 2XRMA 1LH0A 3BGIA 3PJRA 1XRRA 3MS2A 2PYIA 4PCVA 4QGHA 5D1HA 3I1YA 1T1EA 3L93A 2ZWOA 2IF0A 3H19A 5DXFA 2FJ0A 1V8BA 4MA5A 4M38A 1QBKC 3DKVA 4O08A 3ZLVA 4B8WA 2PIAA 1CUVA 2QD2A 5GJCA 1Z6XA 2QM7A 5ARCA 4AFNA 1E4VA 1Y82A 3M1AA 2OCDA 3PYMA 1XVTA 4P3YA 4QXRA 5BV1A 1GT91 3KYJB 4RK7A 3WKEA 1JA0A 3KG2A 5IUNC 4Z51A 1GUBA 2CL7X 4CHGA 2CLMB 3AV3A 3K0FA 3TLGB 3WLPA 5KOHA 1QH8B 4WA7A 3BWCA 3WMEA 5C80A 1RDFA 4RF3A 4OFZA 1JNXX 2PGOA 1WSWA 3IBFA 1W1IA 1BROA 4CEIA 4GGMX 3UW3A 1L4HA 1MAHA 2FX2A 2XMSA 2QMYA 3CE6A 1J7KA 3LI2A 5A03A 3WP0A 2ZRFA 4A0QA 5B2EA 2PFSA 2HL6A 3WLRA 1L5MA 1X1CA 2VUIB 1P2SA 1LRLA 2ZJYA 3LRTA 4AP9A 4BFUA 2P68A 2PQ6A 5E2IA 2IE0A 2DBZA 1ICEA 2X0RA 3BIWA 3D0OA 3ENKA 3MCWA 4BVHA 4D8YA 2I2FA 3HZZA 5CEJA 5LLTA 2Q27A 1CEYA 1G6OA 1XTRA 2Y1GA 4N5NA 1PQ4A 1CQPA 3PGMA 2AFRA 1DIAA 4GLJA 2Q62A 1D03A 1Y3CE 2Z09A 4KFRA 3H4MA 3DDCA 3AF2A 3HJUA 1GITA 4R1MA 4TUYA 3Q7EA 5GY7A 4GLOA 1QK5A 5KJCA 1D6NA 2A0YA 1WXEA 2JH9A 3VU9A 1RKQA 2ZI5A 4JV5B 1DGQA 4MQBA 1SOVA 3LDFA 1J23A 2NU9A 4PC3A 4MROA 3SE0A 3QIAA 1PSDA 2JHFA 1Z0ZA 2P2CA 1JJVA 1X3LA 3AC0A 4JBNA 4R8MA 4LXTA 4ZKDA 2WZDA 2C4TA 1CW2B 4M22A 3W7VA 5IYZB 1OXBB 4CLRB 1UDBA 1N77A 4TWJA 2Y05A 1J2EA 2JIPA 1U8EA 1H4QA 1KERA 3EQ7A 3P32A 3RG8A 2OZVA 4GR9A 1POXA 1H6AA 1V5GA 2QTHA 3HDGA 3EZFA 3LF2A 2ZSUA 4IG9A 3F49S 5IJ0A 1I7SB 4KAJA 2XWSA 3MOSA 1P17A 3PUWA 3PLNA 4IIUA 4W9NA 1AJEA 2FSGA 3W2IA 3P9QA 5FPKA 5JNRA 3O8CA 1FZQA 1RYEA 1VBFA 1TLLA 1P5RA 4J6EA 4KZKA 1KQ3A 2UUPA 3PE6A 1ECGA 1U4NA 5IH3A 1TU0A 4ZAWA 4F4CA 3N58A 1P72A 2M1ZA 2WJWA 1DBPA 4MX8A 3ZH9B 4U2BA 1G19A 1S3IA 3EB9A 3HYTA 4F84A 1T24A 5JWRA 5K0TA 4O0MA 1U7OA 1FLNA 4L57A 1DADA 3TDMA 1RXEA 3QFHA 2FPXA 2IEYA 4GZ5A 4KMSA 3FKSA 3DLHA 2IZ5A 1V48A 1ADCA 2ORWA 4CODB 2ZAGA 5DYGA 1NULA 2X23A 1EH5A 1T9AA 4KRXA 5CVEA 3HNRA 1M7BA 5I01A 4AF6A 5KX5B 4JGIA 1QGAA 5EZQA 3C85A 3O8NA 3GLSA 2PT6A 1GSOA 1KVUA 5KOHB 2VVTA 3AFOA 1OLSA 4Z0TA 3I34X 3WL4A 1NXQA 5I7VA 4CEIB 5JTTA 3UPUA 3G7SA 4R2HA 4OBBA 5JAQA 2ZI6A 3C39A 2IYRA 3RVJA 4EBFA 2GBLA 4Q02A 4AJLA 3DP9A 3FB1A 5MDHA 3SC4A 5KNDA 1Z4LA 4KI7A 1ZW1A 2J9XB 5FOSA 4R7TA 4B2IA 1DXYA 2XA1A 1BYUA 1TFUA 2PRZA 1T91A 5AXBA 5JLAA 3AK4A 2WZCA 3ETHA 4CIYA 3W4JA 1XMOB 4RVSA 1Y3AA 3H7IA 1Z3IX 3MUFA 4HLNA 5FWXA 2FQ1A 1C4KA 2HCRA 1S2LA 2OZPA 2Q6TA 2VDMB 5E1MA 5HTKA 4DYHA 1SIWA 2X7XA 1PZXA 3GRYA 1JECA 1IEXA 2JGMA 1VGQA 1EWTA 4NYIR 1E96A 5J2UA 2C4WA 2O2IA 3ESXA 1OTYA 4X1OA 5AOAA 4OJQA 2WT8A 3RBZA 1D0SA 3VU9B 3BM5A 1SOMA 4KJZA 2CZQA 1CQJA 1M5UA 2IYYA 2Q0QA 3QKRA 5HQJA 2FW6A 4MWZA 2NU9B 1XTUA 5JY1A 3V46A 1P6QA 2YC2C 5KU7A 2A1TR 1NLMA 2DQZA 4IWXA 4ZMRA 3MINA 1KAEA 3CLTD 1FJHA 3LBFA 1QORA 4Z4HA 4GKBA 3E7FA 3SC3A