1U5AA

Plasmodium falciparum lactate dehydrogenase complexed with 3,5-dihydroxy-2-naphthoic acid
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
316
structure length
306
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mapping the binding site for gossypol-like inhibitors of Plasmodium falciparum lactate dehydrogenase.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
total genus 114
structure length 306
sequence length 316
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2004-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1u5aA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1u5aA02
2AQIA 2SCUA 4ZRMA 3S8MA 2QG4A 5AXCA 2WYUA 1Q1NA 4LVUA 3NYWA 4MP6A 4ZQHA 4M89A 2NU8A 3BXXA 2WE7A 3GF4A 1GFSA 4EJMA 2EJWA 4XGKA 3JQ8A 3GQVA 4AL4A 4YA6A 3K6JA 1I3NA 4B7CA 2X9NA 1XSEA 4RV9A 5ICSA 1NQOA 2VRCA 1KEUA 4FD3A 3RI3A 4CR7A 5A9SB 1P1HA 2EEZA 4XQCA 3TDKA 1EE9A 4XKJA 4NFHA 1PL8A 4WEQA 1NTOA 1RM4A 2P5YA 4CLRB 5A9RA 5G0TA 2B69A 2BH9A 4PZDA 3I9MA 3DMTC 1K2WA 1NR1A 3WNVA 4FQ8A 2PH5A 1ISFA 4CV3A 1ONOA 1HLPA 2YYYA 3TL3A 4AJKA 4IDDA 1OC4A 4IINA 1EVZA 1AXEA 3IOYA 3L4BC 5JAZA 4PZCA 4BO4A 2AA3A 5I7EA 3EAGA 3OHSX 1U5CA 5T67A 4HADA 3WGZA 1LU9A 4R1SA 4CPDA 4KUEA 1FMCA 3PIIA 4PLHA 1C1DA 3LF1A 2CNBA 3SC4A 3GEDA 3L9XA 1YL7A 3PQEA 4NBTA 5A04A 3S2FA 2PTGA 3DBHB 4YPOA 2JCVA 2X6TA 3FWZA 3NDJA 1X0XA 2HK7A 2HMSA 4CMAA 4NK5A 5A9TA 1UXJA 3H5AA 1GL3A 3P2OA 4LK3A 2B5VA 3TZKA 4MOWA 2Q46A 3CE6A 4CMJA 5ILOA 1AN9A 3TJRA 3VHRA 1EQUA 3A4VA 1HEUA 3WJAA 3G3EA 1U4OA 2ZCUA 3QJ5A 2JFGA 3ZI0A 4J1TA 5C7IO 1V9LA 2WMDA 5IZCA 3MTGA 3KSUA 4DYVA 1B0AA 3KLPX 3NDRA 3AWDA 4NI5A 1DO8A 4NFYA 5L4LA 3DFUA 3ZNPA 2AEMA 3KEQA 3L77A 1JW9B 5BT9A 3KXDA 2QX7A 2QYTA 2HMTA 1R12A 2P4QA 5T64A 4BIIA 1T24A 3GPIA 4DREA 3MEQA 4OXYA 2HMVA 4U0KA 3EMKA 1QLHA 4Q3NA 1LRLA 3UN1A 1I2ZA 3W6ZA 5A5EA 4H3VA 2X4GA 4GVLA 2JCYA 1MLDA 5L7WA 1TT5B 3H9UA 3OH8A 5IXSA 3ANMA 5G4LA 3H9GA 5KJFA 1HLDA 4PVDA 4ZU3A 1NVMB 1UJMA 3U3XA 4YEDA 3M6IA 4UEKA 4ND4A 1ZH8A 3Q9UA 1ADFA 4TROA 4JCOA 2NVBA 5CPFA 1CIVA 1E1NA 4OH1A 1HZJA 1B14A 2NU6A 3BIOA 3WMWA 3ZHXA 5ADHA 3WGQA 4MP3A 2QZ9A 5BSHA 1HZZA 2OOSA 4ND1A 4JP3A 3GNQA 5KCZA 1SNYA 2DAPA 1EBUA 5K6AC 1GQYA 3QLJA 4CLOB 3ZN2A 1Q7GA 1IUKA 4CM8A 1ZUD1 5ICMA 1G0OA 3SXPA 1C0KA 3KVOA 2CZCA 1NP3A 2OP1A 5F5LA 3FF4A 4RCVA 1B15A 1BXKA 1HYEA 4MIYA 4PLVA 4OM8A 1ISHA 4DBVO 1A7KA 2JD0A 3VTFA 5JPIA 1NBOA 1YGYA 4GGOA 3ROMA 2VUTA 4J3FA 3UCFA 3GNSA 1BVUA 3NTQA 4KDFA 3ONFA 4NPCA 3GZNA 1EZ4A 4WLNA 5T8KA 3QP9A 5F3RA 3ASUA 2B35A 3O26A 1HE3A 2C0CA 4XQ9A 2Q1SA 1EUZA 3QHAA 3R3SA 2Y1GA 3ZWNA 1EE2A 4JGBA 3AM4A 3EGOA 3VPGA 4FFOA 4R3WA 4IQGA 5EINA 5T6BA 1L1FA 2ZATA 4YXFA 5BR7A 1JKFA 1PSDA 4FJ1A 4BGIA 2CMDA 2QRLA 3PGXA 4GGPA 4QO7A 1GYPA 4QFCA 3JQBA 5A5FA 4H16A 1KVUA 4WUVA 1BRMA 3DO5A 4GKVA 4BO8A 4IDAA 2X7HA 1TEHA 1HF3A 4WCFB 2NUAA 1PGJA 1Z7BA 1C3VA 4F45A 3WLFA 4QX6A 5DULA 4IXTA 1BMDA 1PR9A 1R4NA 4J4BA 2GLXA 1ML3A 1VM6A 3WSVA 4G5HA 4M86A 2FR8A 4BNVA 4KTVE 1MP0A 1DFHA 1M6HA 1TI7A 4NJMB 2I9PA 3EVTA 4BKRA 4ZJUA 4NIMA 1WLYA 2H63A 4EI2A 5IDXA 3PGJA 4IQ8A 3M2TA 2VYVD 3TRIA 3KSDO 4XGNA 2HK9A 1QV6A 1GAEO 3H9EO 4L73A 1Y9AA 2BELA 1VKNA 3ROKA 2EKQA 1ZJYA 3HDJA 4XRRA 3SBOA 5L9AA 1R0LA 3RU9A 1C0LA 4RZIA 2OZPA 3F4LA 1I3KA 5JW6A 2VHVA 3B6ZA 4OMUA 4GLOA 2ZCVA 1QKIA 4MKXA 1J5PA 4OL9A 4JBGA 2E4AA 2VYVA 1JWAB 5HTOA 1A9YA 1ENOA 4QEDA 3GLQA 3V2UA 3D3WA 2OHXA 4PLFA 5JCXA 2PKRA 1ZO8A 3T4EA 4YAEA 2ET6A 4OXKA 4YRBA 5CFZA 2IZ0A 3NT4A 3GUCA 3PHHA 1HE5A 3GOHA 4WNCA 4IDEA 4DL9A 3U5TA 2J8ZA 4LRSB 3D3WB 4YRDA 1SOWA 2DBQA 4GL4A 4XYEA 3ZV5A 1Z74A 4F3YA 1T4BA 4BB5A 1WDMA 3AY6A 3PEFA 4XDYA 5C3MA 1P77A 1V35A 5KJCA 2E6UX 5L45A 4XRGA 1DJQA 1WMAA 3WG9A 1F14A 1YL5A 2I3AA 3FNEA 4CUZA 4RF4A 2PY6A 2NTVA 4Z3KA 3S1LA 3DZFA 4G2NA 1BDBA 4AJ2A 4ONEA 4CQMD 2G5CA 3R3JA 3LC1O 1O0SA 3EDMA 3LZ6A 1KC3A 2PV7A 1EBFA 5B12A 4Z0HO 1K0UA 1PQUA 2CVZA 1XEAA 1H2HA 2F00A 1MA0A 3WOHA 4AJ4A 3I3OA 4R4JA 1IZ0A 4O5OA 5DCYA 4NJMA 1I3LA 2P9EA 1C0PA 5CDTA 3O8QB 4HUJA 4B4UA 4MVJI 3UICA 3VVCA 1LLCA 4WCDA 4OSOA 4Q3CA 3O8QA 3GAFA 3TQHA 1DIHA 1DXYA 1HYGA 5JCJA 1HKUA 2JHGA 2GCGA 2Y05A 1PWZA 1NWCA 2X5JO 3F6YA 3TZQA 2PWZA 1I0ZA 1A71A 2O3TA 3SJUA 2Y1FA 3DZIA 2BRUA 3ZU4A 1UP4A 5L40A 1EVJA 4XIYA 1P3DA 2Q1TA 2CF5A 3GVHA 3MOGA 1HDOA 3TNLA 2CD9A 4BB6A 3Q1LA 1YB1A 3G1TA 3OMLA 4DYDA 1EQ2A 5EQDA 3GN1A 3DONA 4AJLA 2DQ4A 4W7HA 3L4SO 1JN0A 2W2LA 5DP2A 2I65A 3PFFA 2X9GA 4D45A 1M75A 3H5NA 4IPTA 5JNLA 4Z9FA 1RKXA 1U3VA 3KHUA 3S2GA 5CDSA 2FR0A 2VN8A 4N18A 4GSKA 1I01A 1K6JA 1S6YA 1HSZA 1SMKA 1L7EA 1HXHA 1TLTA 5C7LO 5A02A 1W73A 3NEPX 4IUYA 1BGVA 1BXZA 3OM9A 3GGGA 3TZCA 3PWSA 1P1JA 4RPLA 1ZJZA 4YRAA 4ZQGA 5GMOA 1GZ4A 1PTJA 3GEGA 2HUNA 5JBIA 1ZKMA 1PJ3A 3ETEA 3U9LA 4OXNA 3LT1A 3LK7A 4E3ZA 5EERA 4I08A 3QQPA 4AVYA 3DZGA 2BFAA 1LC0A 1YE3A 2HDHA 3GAZA 4J1QA 2ZYDA 4U8GA 1DFIA 5C5IA 1U3TA 3ZWXA 3D7LA 3MJEA 3TOXA 2W2KA 4YTEA 2WD8A 1GCUA 4DUPA 4GH5A 4NBUA 3WWYA 3AUTA 3LYLA 1YO6A 2AW5A 4BMNA 4D44A 1YBAA 3KYCA 1MXFA 3B20A 2V7PA 1H5QA 1QYCA 2FHSA 1XA0A 2GD1O 3CXRA 4IMRA 4XA8A 1YBVA 1MG0A 5DZSA 4A26A 5BQFA 3SLGA 5A05A 3WYEA 3ROQA 4LCJA 2VQ3A 5TS3A 3IP3A 1TB4A 3E5MA 1OFGA 4UEOA 1D4FA 4CM1A 2VZ9A 5THQA 1LC3A 4CM7A 1D1TA 1B8UA 1DDOA 4QXMA 2Q1WA 3HUDA 3OIGA 2HCTA 1PX0A 2CSUA 2DFVA 1SPXA 1R37A 3W4KA 5BSGA 4UAGA 1Y9EA 1HTBA 1EDZA 3BMNB 3M2PA 1SOVA 2DT5A 1DHRA 2IE0A 4FJ0A 4RVHA 1N9GB 5GY7A 4P4NA 1B3BA 3VPSA 4RGBA 1AHIA 3H3JA 2BI7A 2O3RA 4CMHA 4CQLB 4DPKA 3GFBA 4HWKA 1E77A 2AQHA 2O3SA 3QSGA 5ER9A 4DQXA 3EYWA 4BO9A 4EDFA 1KVSA 3HN2A 1PJBA 2J3IA 3ENKA 1GQ2A 5JSFA 1D3AA 1GR0A 4KWHA 4FSHA 4JJFA 5KJ1A 3GK3A 3MJ4A 1EK5A 1E7WA 1HDYA 3HJAA 4J90A 5I9MA 2AHRA 1VSVA 1JKJA 4OSPA 1X14A 4FB5A 4CMGA 2JFFA 1IHXA 4L8VA 1YVEI 4GPD1 3EZYA 3F5QA 3DBLA 4E21A 1YQXA 2G17A 3GHHA 5IN5A 4BO3A 4C7JA 3IS3A 4L0QA 1HDGO 2PR2A 2B0JA 1CYDA 2ZIZA 4TRMA 2CDAA 2PH3A 4PLGA 1Q7CA 3GDOA 2X23A 2NV6A 1E1MA 3OA0A 1XQ1A 4P22A 4YJHB 4BNFA 1TA4A 3DAGA 4XR9A 4J1SA 2HMUA 2UV8A 3QWFA 1HDRA 5I9LA 1UH5A 3OICA 1DPGA 4LRTB 4GI2A 5JY1A 1DLIA 5U1PA 3E1KA 4LSWA 4OKNA 4AJOA 2BFMA 1BWSA 4YWJA 4KUGA 1XCBA 1IULA 1E7QA 1P1KA 4XYMA 5U4QA 3W4IA 1W0CA 3AI3A 3ITDA 1NR7A 1I8TA 3T4XA 2QHXA 3DAFA 2UUOA 3ZV4A 5DNAA 2PZMA 1ZBQA 3UCEA 1GADO 1N2SA 4TSKA 4UVIA 1D1SA 3AM5A 1P1FA 4RVFA 5G4KA 2IEDA 4ROSA 1E3JA 2WD7A 2DU8A 3WX0A 5FEUA 2W8ZA 4NNJA 4W6ZA 3GVXA 3JQ6A 4UEJA 4MJLA 4BVAA 4AICA 1FXSA 4FFRA 1E3EA 1E5QA 1SC6A 1NXQA 3I9KA 4E2ZA 1PQWA 3WNQA 1XG5A 2ZQZA 4BQRA 1ZXBA 3FWNA 2O3UA 3EK2A 1H2BA 4K9DA 1WDKA 3OQ6A 4I9UA 2PGJA 4J9VA 4JIGA 4XJSA 2O2YA 1RWBA 1V3TA 2VHWA 3DWFA 1NQAO 4Y8VA 1PJ4A 5EL0A 4CQMB 3QE3A 4BMSA 5AXBA 4B8ZA 1KS9A 3RC7A 3IUSA 4MIOA 1R16A 3Q11A 1GPDG 2O2SA 4CUJA 3VZRA 4E5PA 5A4DA 9LDBA 4AJJA 4PG4A 3WMXA 4FDAA 4NBWA 4S1VA 3NT5A 4IDCA 5CDYA 3Q6IA 1VJTA 3H3FA 3KLMX 3F1LA 3FTNA 4TQGA 5JDIC 2GYYA 5TX7A 1LRKA 5CP8A 4RPGA 3IUPA 4O6VA 4Y6RA 3FBGA 2VZ8A 2DPGA 5THKA 2FSSA 4KOAA 2YDXA 3TFQA 2HRZA 3INTA 3D4PA 3A9WA 5JFOA 2PNFA 4F6CA 4GQAA 1U9JA 4WEOA 2X5KO 2OORA 1U3UA 1PGQA 3MJVA 2ZQYA 5IDYA 4UUPA 3HNPA 4ZN6A 2O7QA 3EW7A 5L53A 3JQ9A 3A06A 2WJPA 2GUGA 1N9GA 3ANNA 3NTRA 4GWGA 2EGHA 3BTSA 1TXGA 1BSVA 2GASA 4C4OA 4YT4A 2GO1A 3WGHA 3CMCO 2OFPA 2UAGA 4J0FA 4PLZA 4CM8B 4URFA 1OAAA 4ND5A 5KWEA 1B16A 5U9CA 1PL7A 4E4YA 4DQUA 1T2FA 4DC1A 4FPXA 3WYBA 3GNTA 3CSDA 1ENYA 2DC1A 5IF3A 5ES3A 1P31A 3ICPA 1RYDA 3WGOA 1HDXA 4DQVA 2X0RA 4EUEA 2O23A 1DJNA 4E5KA 2O7SA 1NX6A 3VZQA 3IJRA 3FNFA 2VNAA 2UVDA 3FPLA 3PZRA 3U4CA 2AE2A 1X15A 3IC5A 4FFPA 3RASA 4PN3A 5EJ2A 2AXQA 4JBIA 1SO8A 5JY6A 1VL0A 2EG9A 4D46A 3I83A 4CM9D 3GG2A 4RO0A 3WB9A 3NV9A 3AFNA 3RUAA 1PZEA 1WZEA 5KTKA 2VRBA 4OAQA 3WGYA 3B1FA 3BHJA 2HJSA 3GHYA 1BXGB 1R6DA 1ZK1A 2NWQA 1JU9A 1P45A 2YQ4A 2VNSA 5DF1A 4CV2A 1WZIA 4E13A 3BYZA 3V1TC 3U4DA 1VJ0A 1H9AA 3LLVA 1EEHA 5JDIA 1N5DA 2O50A 4IGEA 4P38A 2RH8A 4LSMA 4PG8A 4ND3A 1ZK3A 2TMGA 1NHGA 4A5OA 3F47A 3L6EA 4CV1A 4EGFA 5JAQA 1ZVMA 4NZ9A 3GT0A 5HBRA 3KSZO 4BNMA 2ZTVA 2E48A 1BXGA 1F12A 2G82A 1JKIA 4BQPA 3NUGA 1BTOA 3OIFA 3NJ4A 4YACA 4YJDA 3MWEB 1E3WA 4LISA 5TF4A 1DIRA 3U62A 5TJ9A 3LT0A 5AVOA 1GYRA 2C59A 3KBOA 1WDLA 3NKLA 2JJYA 1T2CA 1WMBA 4CJXA 5TC4A 3AI1A 1ISJA 4KQXA 4OYRA 5B4UA 4NMHA 4CL3A 3BHMA 4CUKA 2Y0DA 4Y6SA 4YBZA 4UUOA 4EZBA 2FY8A 3EVNA 1ZK2A 3L07A 5HWSA 3E9QA 1IZ9A 2VHXA 3OA2A 5G0VA 3LLSA 4EEXA 3UAGA 1EMDA 1E6WA 1ISMA 2VCYA 2P4HX 4MPDA 3QVTA 5LDHA 3FNGA 4B4OA 4I5FA 4CMIA 3P19A 1Y5MA 1U7TA 1WXDA 4PLPA 1YBMA 3TZHA 2OBNA 2FR1A 3INGA 5JAMA 2NU7A 3GDGA 3JYOA 4Q3BA 1GTMA 3DBVO 5ENDA 1CERA 3RU7A 5L51A 4Y98A 1ZNQO 3WGTA 3VDQA 1V0JA 1H6BA 3LU1A 3DBRA 3DZJA 2CVOA 3ZV3A 4CMBA 2X1HA 3R1IA 4IBOA 4GWKA 2JAPA 5TJHA 3A14A 3QVWA 4FCCA 4XYGA 1LLDA 4L4XA 4GLLA 3ZWBA 3A1NA 1LA2A 3LF2A 3Q3CA 4XD2A 1FF9A 2O48X 5KJEA 4JJGA 4OHUA 1YKFA 1LSUA 5IXYA 2XXJA 4OGWA 4PG6A 4DWVA 4CR6A 1U3WA 2JHFA 1PGOA 3K8ZA 1NVTA 2WTBA 3WSWA 4BNZA 3NTOA 3RJ9A 5KVCA 4N54A 2YY7A 1WP4A 3UXYA 4BNKA 5EPOA 1UXGA 4BL5A 1NASA 1VL8A 1H6AA 1IOLA 2FWMX 5GZ6A 4IMPA 4CM5A 4IQ0A 1YOVB 1N7HA 5FYDA 1R66A 2NQTA 1P44A 1J4AA 5CEFA 4J9UE 1RPNA 1O5IA 5L95A 1SB9A 2PZKA 3CUKA 1NPYA 4RORA 4KZPA 3AOEA 4Q3DA 4D0RA 1E7SA 3LQFA 4FGSA 4GBJA 5KKCA 3BMQB 3ZWMA 1BVRA 1SZJG 4RLSA 3I5MA 1WVGA 4XEHA 1N1GA 2AQ8A 2ZYGA 3OETA 2R00C 1EUDA 2C54A 3QWBA 1E3LA 4EYEA 4NBVA 4K1LA 2C5AA 4ALMA 2C82A 4YVFA 3VVBA 1KEVA 6ADHA 5IJZA 2YFHA 1P0CA 1VSUA 2DBRA 2PA3A 1F17A 4J0EA 4WOJA 2B4RO 2QW8A 1LLUA 3M1LA 1KOLA 5AQ1A 3GVCA 5L7TA 1LDBA 4BO2A 2VHZA 1BG6A 3CH6A 2EWMA 4WGGA 5JE8A 1DRUA 4EITA 3TOZA 3UCXA 1ZFNA 1U5AA 4FFNA 3DHEA 1KERA 3IAHA 1W6UA 5IZCC 1E7YA 1PL6A 2YFQA 3Q9NA 4BS9A 1CDOA 1O94A 3VH4A 2OGUA 4N5LA 2Q2QA 4P4GA 2YZ7A 3FD8A 4HFMA 3ZNQA 4GMFA 3PJGA 1ZCJA 4ALLA 2DPHA 1EVIA 1ENZA 3WYCA 3JQGA 4GX1A 2EF1A 1GZ3A 3M1AA 2FPPA 5CDGA 3V5NA 4BNIA 5DCWA 3A28A 3JQBC 3PPIA 3U4IA 3QVXA 3ZNOA 3L6OO 2WM3A 1XU9A 2WEKA 3KEOA 3UHAA 3ZU2A 3BTOA 1R15A 2V65A 4DMMA 2ZB7A 3DL2A 1G1AA 1E1LA 5KIAA 3FBTA 3KYBA 2AG8A 3LT4A 4CM4A 1AGNA 4NU6A 4PRLA 5JO0A 1UUFA 1CETA 3DBHA 1OC2A 3EC7A 1I5RA 3W4JA 3X2EA 4ZHSA 3INRA 2V6MA 1HE4A 3RWBA 2JAHA 4KTTE 1YXMA 3QWHA 2AQKA 2UUPA 4IIUA 4Q3EA 3E18A 2EW8A 3Q2KA 1UDAA 2DVMA 4R51A 5JS6A 5KVVA 4DLAA 3GFGA 4ND2A 1MC4A 1GEGA 4E2YA 1UZNA 2CVQA 4QSMA 3IL2A 3TN7A 4XYLA 1I3MA 4ZRNA 1C1DB 4JXKA 4TRJA 3ITKA 3DMYA 3HG7A 5EMHA 5F5NA 3ZWVA 2FZWA 3RFXA 2B5WA 4B3HA 1LNQA 4PLWA 2NVWA 3NRCA 4L75A 1H6DA 1E6EA 4YJFA 2Y93A 4HKTA 5K6AA 1FK8A 3VAZA 3G17A 2FPIA 1DAOA 4WNIA 2IEBA 2W2LD 4CMEC 4WLUA 2EKLA 1F06A 3WGIA 4PFJA 4MDHA 1KIFA 5IZ4A 2AEFA 3AM3A 3AU8A 3WWZA 1YJQA 3G0OA 1E7RA 5CG2A 3BMCA 4J7CA 3IIEA 1JTVA 1YQGA 2BGLA 3VPFA 4D0SA 2J5KA 3MCVA 2G1UA 5MGBA 2ILTA 2UYYA 4DBZA 3JQ9C 1KYQA 5DDIP 2Q50A 3AI2A 2C2YA 2Y1CA 3PJDA 5L3ZA 3ETDA 4LW8A 3D5TA 4R69A 1V3VA 1MC5A 2AE1A 1Y7TA 4E12A 4PIVA 4YQZA 5BNFA 1PR3A 4FGWA 3FNHA 4WASA 2NQ8A 4D41A 2VWGA 5B4TA 5TLSA 3HFGA 1DRVA 1CWUA 1EDOA 1P9LA 3LSYA 3ON5A 1FDTA 3GVPA 1YH3A 1YB5A 4QTZA 5CDUA 3PJEA 1O6ZA 2DLDA 3H5RA 1G0NA 1Q0QA 3RFVA 4ID9A 5AXDA 5KNLA 3H2SA 3GN2A 3HDHA 2PGLA 4IIVA 5AYVA 1GCOA 4BNHA 4RQUA 4R16A 5KOIA 4IDBA 3DC2A 3HE3A 1ZIDA 4A2CA 3IMFA 4IY1A 4EUFA 4JQCA 1Y8QA 1JWBB 2FP4A 4MVJG 4UULA 1JAYA 4MVJD 1O89A 3QRWA 3B70A 5EESA 4XIJA 1LQTA 2IZZA 3N58A 5GZ3A 4CV0A 3LT2A 3GZ4A 1R4NB 1HYHA 4BKOA 3F4BA 1R4MA 2QIOA 2BKAA 1DC6A 1PJQA 3BHIA 3L6DA 5DP1A 4OOFA 2PD6A 4CQLA 3QIVA 3QVSA 1ONPA 5HA5A 4IXWA 4MVJA 4NR0A 2HJRA 4DXHA 1LXCA 2X8LA 3HZZA 3JD1A 3AK4A 1GY8A 1I2BA 2ZB4A 4DPLA 3D5QA 2Z5LA 3I9LA 4BNGA 2Q1UA 3RC9A 4PG7A 4RPKA 4KUHA 3L0DA 4E5NA 3VDRA 5EQFA 4CODB 2IXBA 4OO3A 1E3WB 2D5AA 4XJTA 4TVBA 2PKQP 1RJWA 3JD4A 1VRWA 1PJCA 1UP7A 3DDNA 2J5QA 1SCUA 5TGDA 4FR5A 2FRDA 1NFFA 5C7OO 2O4UX 3GZNB 2DBZA 4W4TA 1G6KA 3ROPA 3JQ7B 1JAXA 2D2IA 4IJWA 4WKGA 4AFNA 3JQAA 2WE8A 4XB2A 4Q39A 4JNKA 3F3SA 2BGKA 3B1KA 1GQQA 4A0SA 4C7KA 2Q2WA 1K3TA 3PVZA 4Z0TA 3BMOB 5IFLA 2OO5A 2NTJA 1UDBA 3PDJA 5A06A 3N7UA 4FC6A 3MOIA 4U6QA 1LI4A 1OI7A 2RAFA 3QV1A 4YJGA 1ZSNA 2P9GA 2ZTLA 3LVFO 2DFDA 5DOVA 4JX8A 3VPHA 3F1KA 4RQTA 1GUFA 5TT0A 2QRKA 6LDHA 4J7XA 3E9MA 3OEYA 1Q7BA 3PDUA 3HHPA 4BKUA 1HE2A 2BGMA 4YT5A 2HRBA 4J1NA 4E2WA 2I66A 4CMIB 3KYCB 4PVCA 4BNXA 5H83A 2W4QA 2R6JA 3GMDA 3MTJA 3ZWCA 2IXAA 3UOGA 3O9ZA 4P8RA 4JROA 4J6FA 4UVGA 1HWYA 4B4WA 2EGGA 4X54A 1Z75A 1FDVA 4I1IA 1U8FO 2GN9A 4M49A 4YAJA 3VOSA 4R01A 3UGKA 8LDHA 4BKQA 1LX6A 2W98A 4WLVA 3SJ7A 1LDGA 4RDIA 4Q3AA 5JMWA 2ZJ1A 4W99A 3H9JA 2Y67A 2B83A 3PYLA 1J6UA 3S2EA 3X2FA 4NU5A 4O1MA 1ISIA 1T1SA 5TSDA 1UAGA 3ZDFA 1ZXLA 2HU2A 2X0JA 3C1TA 4OKIA 5T57A 4KP7A 3GR6A 4HY3A 3PZBA 3HFSA 3RFTA 1A9ZA 1T26A 2I5PO 1PS8A 3MJCA 4CLDA 1LEHA 4CM6A 3GH3A 3Q0EA 2X0NA 3SX2A 3E6AA 3I9OA 3VH3A 2RCYA 3VKUA 1XWFA 4W82A 1FJHA 1KC1A 4BKPA 1Z6ZA 4TKMA 1QYXA 3DOOA 1PS9A 2FMUA 2J3JA 3DOJA 1LDMA 2P2SA 2A4KA 1E92A 1DAPA 2F1KA 3UF0A 1MUUA 4DIBA 3NAQA 4EEZA 2Y1DA 5J23A 3C1OA 3B1JA 4PLTA 5C37A 3G79A 2XXBA 2I76A 4IS2A 4BO1A 3KTDA 5H82A 1HRDA 4J4TA 1DB3A 4WE3A 4G81A 1HT0A 4R9SA 3OFSA 1YONA 1DIAA 2I67A 4LGVA 3GPDG 2HMWA 5JYEA 2CDCA 1NVGA 1Y8RA 1DHTA 2AMFA 3BMQA 4WOKA 3K30A 3ZGYA 2J3HA 3FRJA 2GN4A 4W9NC 1GU7A 1IB6A 3ADOA 3C7AA 3JV7A 4F6LA 1BDMA 1GPJA 3OBBA 4PLYA 1EVYA 4Z6KA 4DRYA 3WDSA 3VZSA 4IDGA 1D8AA 9LDTA 1F8FA 1CEQA 3AUAA 4IZHA 3VC7A 4M55A 2D0IA 3JQDA 1ZMTA 2GZ3A 3KO8A 3WQQA 3KB6A 3ORFA 3JQAD 3ZWPA 2VT2A 4O0LA 2EP5A 4K6FA 3PYXA 3JQCA 1LSOA 2GZ2A 4Y67A 3PLNA 4IJKA 3U0BA 3KYDB 4A03A 4RVUA 4YB8A 5FF9A 4JBHA 1HETA 1EUCA 2NVUB 3OQ1A 1Z45A 5JC8A 2DM6A 5COBA 1K89A 3DZHA 1VC2A 3PHGA 3V1UA 1UXHA 2YJZA 1ZZEA 4BO5A 2GGSA 4ALJA 4FN4A 1HL3A 1ZK0A 1X7GA 1KETA 4J16A 1VPDA 2P68A 1S7CA 3AOGA 2CDBA 4U5QA 2Y0CA 3LDHA 3VZPA 4B7UA 1SEPA 1TT5A 4MVJF 4I8XA 4ZQBA 3V8BA 1DLJA 1UP6A 3K9QO 4CQMA 3DMTA 4S3MA 5TNXA 5BNTA 1E6UA 3WQRA 1X0VA 2VOEA 5I8WA 1ZEMA 4W7IA 2RIRA 1UXKA 2BFOA 3JQGB 1IE3A 2GSDA 5F1PA 4NH4A 4ZGWA 1HSOA 2XOXA 2D3TA 5L7YA 1CRWG 2WDZA 3ONDA 1DIBA 1JQBA 1B3RA 4UVDA 3W8DA 4EJ6A 1ZSVA 1MB4A 4CM3A 4DLLA 4EJ0A 1KEWA 4MVJP 5G0SA 1E7MA 1FDWA 3ZW8A 4BNTA 4XDZA 3H4VA 4YDRA 3VH1A 2X5OA 3ASVA 3OQBA 4YAKA 1N7GA 1X7DA 3PTZA 5COQA 1PEDA 1Q0HA 1JVSA 1KEPA 1W4ZA 2G0TA 1H6CA 3ZZNA 1PJSA 1C1XB 2ZTUA 4NBRA 1VE9A 4IGFA 2J5RA 5ILGA 2YHIA 4YYZA 4B8WA 4XX0A 1Y81A 3PK0A 2JFHA 3RUHA 4E31A 3I9NA 4TKLA 1WWKA 2AEJA 3E82A 4N7RA 4P4LA 4HFNA 4DC0A 2BI8A 1XQ6A 4RF2A 3DTYA 4WLOA 1QORA 4BNNA 2DUUA 1JA9A 3DR3A 3FTPA 2EIHA 4OQYA 3JD3A 5LCXA 4TZTA 1T2AA 4BO7A 2ZKLA 3ZU3A 3ANLA 3EZLA 2GF2A 2Q3EA 2ZTMA 4HNHA 4R5MA 4AJEA 4RF3A 1ZW1A 2Q99A 2C07A 2PZLA 4XYBA 3KYDA 1UAYA 1A7AA 1I10A 3FN4A 3P5SA 4KQWA 1DBVO 1YDWA 1J0XO 3ZWWA 3PI7A 1ULUA 3C7DB 3JQEA 4CLEA 4E32A 4CLXA 5FWNA 5FI3A 1PWXA 3WIEA 1PIWA 1R0SA 4RJTA 3W8EA 1ID1A 5DBIA 5G0WA 2HKIA 2H6EA 2C20A 1LQUA 1Q2XA 1XDWA 1GEEA 5ER6A 3E03A 4WCFC 1WPQA 3PWKA 2GPTA 3C24A 4HFRA 4U0JA 4CL8A 3I52A 4LN1A 1DC5A 2IYPA 4E0BA 4CR8A 5I8ZA 1QP8A 3KRTA 2HK8A 4CLOA 1LDNA 3QVOA 1ZMOA 3JYNA 1KY5A 2VTEA 3NX4A 3RAJA 3AOEC 4GX5A 4GX0A 1NFRA 4DPMA 1DOHA 3GG9A 1QV7A 1V3UA 1A4UA 2Y1EA 3RUCA 4DIOA 4ESOA 4G65A 4ILKA 2Q45A 3I4FA 3RVDA 3AUUA 5K9ZA 4YT2A 5H81A 1WNTA 2DUWA 2X86A 2I6TA 2J3KA 4FJ2A 1H93A 1U4SA 3GEMA 4R1TA 3CKYA 4NJOA 4XQEA 3BMCB 4Z9YA 3E48A 4YJHA 3FR7A 3ZHYA 1ISGA 3MJSA 2IRWA 1Z7EA 5EN4A 5BNIA 5CEEA 4GVXA 2PFGA 3WGGA 4FFLA 4RPHA 4D43A 2VOJA 3PHIA 2H1SA 4R41A 1K6IA 1IPEA 3WFIA 2Z95A 3HSKA 3PHLA 4Y6PA 4XQGA 3OIDA 5CG1A 3KV3O 4OJNA 1SEVA 3GC6A 3BTUA 1U28A 1Y5RA 3RSHA 1P33A 1N1EA 1RM0A 3RKRA 4MVJM 3WFJA 5BSEA 2D8AA 1A5ZA 4UVHA 5AOVA 4F46A 1NAHA 1R4MB 4GAEA 3WQSB 3U49A 4ALNA 4RVDA 5G4KB 3OECA 1YB4A 3W8FA 5HS6A 1X13A 2RH4A 3RUIA 5B1YA 3QWIA 1M6WA 3F46A 7ADHA 3D4NA 3HQ4O 3JQAB 3JTMA 2O3JA 1IY8A 3AJRA 3D1LA 3JQ7A 4B79A 3ZWAA 4B7XA 4O59O 1U2GA 4IJUA 3SVTA 5IDWA 1DEHA 2OUIA 4AJIA 4EBFA 3PYMA 3DBRB 2BHLA 4WCFA 3WR5A 4YT8A 2C5EA 4U6SA 2X58A 5BSFA 2YDYA 4I9HA 3RQSA 2EHDA 3RUFA 4DLBA 3CPSA 4PLCA 4R54A 2Q2VA 4RZHA 2C7GA 1NHWA 4YAIA 1NFQA 2DKNA 5FFFA 2BLLA 3AY7A 8ADHA 1LRJA 1Q0LA 3UFXA 2Y66A 2LDXA 1V6AA 5I7SA 5CEJA 1OZAA 2LDBA 3HDYA 2FPGA 5IDQA 1I33A 3PQDA 4AJNA 1E5LA 2VWHA 2IYOA 4I9NA 2VHYA 3RCBA 3GY0A 4J49A 4TRRA 2P9CA 1A4IA 1KBZA 1DFGA 1EFLA 3VKVA 1YQDA 2JKVA 3RUDA 1FDSA 1XU7A 3JYPA 1NM5A 4KDEA 4R9RA 1XYGA 1LJ8A 2PK3A 1YJ8A 4FBGA 2AG5A 3LC2O 3RD5A 1C14A 3DFZA 1O95A 1ZEJA 3K2EA 2VWPA 4PCVA 2X22A 3AUSA 2BMAA 1CQIA 3I1JA 4YJGB 3K96A 2JD2A 5A3VA 5F1OA 3HADA 3I6IA 2V6FA 3IDSA 3WICA 4R68A 3KOUA 3RBXA 1QYDA 1ZK4A 4WJZA 3NGLA 1E1KA 1SBYA 2ZYAA 2Q4EA 1H0KA 2WWRA 4BUCA 3EUWA 4QT0A 4MVJE 2FOIA 4BO0A 3VPXA 4XZ3A 3R6DA 5DBGA 3G49A 3OJLA 1BW9A 1QYWA 2J6IA 4HV4A 1ADGA 5L4NA 1VI2A 2VUSA 2GZ1A 3OJ0A 4IJVA 4PGFA 1SAYA 1GYQA 4L74A 4CMEA 4Q9NA 1TVEA 2E82A 3PIDA 4UUNA 2VYND 2VWQA 2C29D 3JQ8B 2B4QA 4M54A 3H2ZA 2E37A 1IHYA 3H8VA 3RUEA 5KVQA 3DZBA 1GD1O 3JYLA 4TMFA 2I99A 2PLAA 5JDCC 4PZEA 1XGKA 3T7CA 1YWGO 2GDZA 1I2CA 3E5RA 2QYSA 3W6UA 3SEFA 3L4BA 3KM0A 1YS4A 4J2HA 4J2OA 1DSSG 1C0IA 3BAZA 1I30A 2CUKA 3DEYX 3F9IA 4NFSA 3E8XA 4WLFA 4R1NA 4WPGA 1BW9B 1ZSYA 1OOEA 2PGDA 4I5EA 2QRJA 4AG3A 2OXIA 2B36A 3ZHZA 4RVGA 2X9VA 2P91A 1PZFA 3IP1A 1MG5A 3K5PA 3VH2A 5I9NA 2EKPA 4TZKA 4J4HA 4FC7A 1J49A 1Y6JA 1A72A 1PZGA 1T4DA 4K6CA 3ZV6A 2R2GA 1XLTA 3IKVA 4D42A 3RROA 2C2XA 3DOCA 1K5HA 3O03A 2EP7A 1PGPA 4HNGA 3DAPA 4IS3A 3ZW9A 4J91A 1NYTA 2ZB3A 3WS7A 4A10A 3ETGA 4N5MA 4ALIA 1KY4A 3CINA 2FN7A 3H6KA 1WW8A 1Y8RB 1BHSA 3V2GA 4HX5A 3IKTA 4M8SA 4II2A 2DBVO 2XPCA 3QY9A 3V2HA 3E9NA 2IZ1A 4H7PA 1AHHA 4QUKA 3UKOA 3KETA 1PS0A 5CHEA 3RC2A 2YHIB 1AXGA 1OBFO 4BGVA 3JSAA 4CMKA 3O38A 5TRTA 5HRUA 3COSA 1PQPA 3DHNA 4K28A 4AJ1A 2FZEA 4A73A 5T8KC 1M2WA 1JDJA 2HO5A 3SLKA 3D4OA 1MV8A 3TZ6A 2EV9A 1M66A 3CZRA 1DC4A 1T1RA 5IG2A 1VL6A 4DIFA 1P1RA 3OEWA 4FS3A 4J43A 1YOVA 2GN6A 3FI9A 3WBBA 1NWHA 1XELA 4XCVA 4ZA2A 1LLQA 4R5HA 2D1YA 3PWZA 1E3IA 3T7EA 2CY0A 2XAAA 1NNUA 3DBLB 2PD4A 4AJPA 3HWRA 3WTBA 3ZU5A 2Q49A 2NSDA 3QA9A 2JCXA 3KUXA 1U1IA 4LCEA 3GMSA 4W9NA 4WECA 5JDCA 2VT3A 2VRCD 1EK6A 3R0IA 4RDHA 1JLLA 3JD0A 3OF2A 3EHEA 2WYVA 1ADBA 3ZNNA 5TIIA 2G76A 5HM8A 1NAIA 2BF7A 2VZ0A 5DN9A 1NQTA 1W8DA 3CIFA 3PHJA 2YUTA 4O63O 7MDHA 5KJ6A 4U7WA 3K73O 4NQZA 3FCOA 3AFMA 3TL2A 3VTZA 5A1TA 3IQDB 3AW9A 4BNLA 4OIMA 3JYQA 4MINA 3OJFA 5COAA 2QZZA 3NT2A 5FI5A 1LTHR 1N92A 1VKOA 4JJIA 1KVTA 1LSSA 5JCJD 3P2YA 4D3DA 4GMGA 4RL6A 4IM7A 2HAEA 4BNJA 2W90A 4Z9XA 2VTDA 4BHTA 2TMDA 2DTDA 3GGPA 1U7HA 1GDHA 3L9WA 5JYDA 3C85A 3CZMA 3CMMA 2EERA 2YHUA 5K0ZA 3FR8A 1E0DA 1R0KA 1IYZA 4UUMA 2V6GA 3PP8A 3DQPA 4BNWA 4EW6A 5L4SA 4JLWA 1PJ2A 4BV9A 1ONNA 4B3IA 4PG5A 3PJFA 2NVUA 3D64A 2Z1NA 1PGNA 1YRLA 3I6QA 2ZJ0A 2E49A 1QLJA 3CEAA 3W1VA 2DTEA 4MKRA 3JQFC 4I5DA 3ABIA 2HLPA 3BA1A 2RBEA 1X1TA 3PXXA 3ZWYA 4FFMA 3JQFA 5ENVA 3GVIA 3FPCA 2YV1A 1D7OA 3N74A 1RM5A 2QQ5A 5A03A 2P5UA 4GX2A 3UVEA 4FIZA 4M87A 1K6XA 4ZVVA 4TRNA 1M67A 1O9BA 1PU2A 4RF5A 4BNUA 1HDZA 3BMOA 5JO9A 1C1XA 3DTTA 4KWIA 1QMGA 3OJOA 4QECA 2GERA 1NPTO 3S2IA 4KMSA 4B3JA 3GUYA 1B7GO 1XR3A 4L4RA 4WLEA 5DOZA 2IDZA 2UDPA 5F21A 4BMVA 4DVJA 2Y68A 5AXAA 2NLOA 4D7AA 3DXFA 2A35A 1ULSA 2Q4BA 2OMEA 5JAIA 3U09A 4E30A 4UVEA 4OOEA 1QXSA 1UXIA 1DIGA 2WYWA 3WJ7A 3C8MA 3MWDB 4H15A 4QQRA 2WD7B 4NG5A 4FOSA 1T2EA 2X0IA 5IN4A 5CPBA 3RBVA 1AE1A 4JK3A 3WTCA 4BGUA 3TPCA 2NTNA 3IJPA 1VJ1A 3QW2A 4IDFA 3UW3A 2Z1MA 2NM0A 4Y9DA 3HN7A 3WIDA 3UH1A 4B4VA 3TFOA 5B37A 4YAGA 4AJHA 4RLHA 3AY3A 4E2XA 4JP2A 2A94A 4YJFB 2PZJA 2GNAA 1UR5A 3HDQA 1I24A 1MXHA 2OBYA 2EJVA 3NGXA 1T25A 1U2DA 2BD0A 1RM3A 5B4VA 4MO2A 2NNLD 3H7AA 2NADA 3MZ0A 4DMLA 1PJTA 4L4SA 1F8GA 4TVOA 1VLLA 4N5NA 1ADCA 5CAEA 2O4CA 3GGOA 4I5GA 4MVJH 4YR9A 1P74A 1GUZA 3D3EA 2V6BA 3K31A 3D0OA 3LC7O 3MJTA 1ORRA 1Y8QB 1L7DA 1XHLA 5G2OA 2Y0EA 4Z3DA 1LDEA 3Q2IA 2OP0A 4L76A 3V1YA 2IODA 5JLAA 4LVCA 4BNYA 3S55A 1LSJA 4HXYA 1H94A 1X1EA 2B4TO 5DBFA 2YW9A 3WXBA 4CM4B 4IZIA 2GN8A 4A7PA 1GUYA 2EW2A 2H5LA 5T5QA 3ULKA 3I9JA 5G0UA 3TF5A 2H9IA 4XGIA 3K92A 5A3JA 2GR9A 4E5YA 3HB4X 2O3QA 1RYEA 4R3NA 2D4AA 4INAA 1EFKA 1QYVA 1OMOA 2OL4A 1AUPA 4DGSA 4NDNE 4CLRA 5DT9A 3PLRA 3C7CB 3CTMA 1IL0A 1YL6A 3OJEA 3PRJA 4JN6B 2BFPA 4NHEA 2R00A 4E5MA 1I32A 3K2BA 2XF8A 1X7HA 1B8PA 5I7FA 2HQ1A 2NU9A 4MKZA 5KKAA 4ALKA 1YDEA 2DTXA 4ITUA 2YQ5A 3OP4A 4PRKA 3FHLA 4NK4A 3DZKA 3UUWA 2JL1A 2POQX 1QRRA 2EXXA 4DTIA 5TT1A 1CF2O 4XWYA 1P1IA 1B26A 2PD3A 4MIEA 3GRPA 4XR4A 4ZICA 5MDHA 3GA0A 1QR6A 3HB5X 4WK6A 1O8CA 2I3GA 5TQVA 1V8BA 1UZLA 4HP8A 2CF6A 3G1UA 2CFCA 5EIOA 3ZWOA 4D3SA 4D3FA 5JMPA 1TT7A 1P0FA 2B37A 1IPFA 3STHA 4Z0PA 5IAAA 4HFJA 3TSCA 4HBGA 1LDYA 1QG6A 3DB2A 4MP8A 4RVSA 2Y1OA 4BGEA 1MGOA 3NDIA 3PFWO 2PKQO 1GV1A 2WSBA 1NPDA 1KVRA 3C1AA 4II3A 3ST7A 4LMRA 3OSUA 4BOYA 1GV0A 4GSLA 3RIHA 4A27A 5GZ1A 3C3XA 4CM9A 4D79A 2A92A 4L9RA 1H9BA 4TWRA 2VYNA 1LUAA 3NJ8A 2HSDA 3TWOA 1U8XX 4J7UA 3P7MA 4YQYA 3KZVA 1ARZA 3JD2A 3GRKA 1Y1PA 1Z82A 2NACA 1KVQA 1E3SA 2D5CA 2GRAA 3RBZA 4CMCA 2VUUA 3SC6A 2Y99A 2YV3A 2ZB8A 3ZCXA 1N8KA 3H65A 4M1QA 2A9FA 3RKUA 4QFDA 1SB8A 5ITVA 1PJLA 1DRWA 1UDCA 5I7VA 3H9QA 1ENPA 3U4HA 5JC1A 1JVBA 1XKQA 4ZQEA 3EY4A 3ENNA 1LBEA 4FW8A 5LC1A 4QO8A 4ZQFA 1HDCA 1B2LA 4BO6A 3PQFA 1PZHA 3I4CA 3F5SA 3O4RA 3ZH2A 3QWAA 4DA9A 3RC1A 1A27A 1B8VA 1GZ6A 1WAMA 3DHYA 4UREA 3I23A 4GKBA 4LMPA 2JD1A 4YCAA 4BV8A 4CLHA 2C7VA 5JXWA 1DC3A 3ONEA 2FSVA 3WBFA 5ITWA 3FSRA 3RJ5A 1I36A 3BMNA 4ZD6A 5LDGA 2RHRA 4RPJA 1M76A 3BTVA 1T2DA 2W2KB 4E6PA 4FOOA 4K26A 1MFPA 1NQ5A 4OQZA 5DCUA 1MX3A 5HS4A 5F1KA 4E33A 1CJCA 1QSGA 2ZK7A 3ADPA 3GDFA 3ICCA 3AU9A 2RHCA 5KVSA 3ZHBA 1Z73A 1MFZA 2YV2A 2D59A 3JCZA 1F0YA 1FDUA 1UZMA 3BZUA 1XIVA 3WLEA 4EUHA 4R1UA 5A9SA 4XB1A 1CQJA
chains in the Genus database with same CATH superfamily
1QE0A 1E5XA 2SCUA 4HZUA 4EATA 3SKXA 1Z3IX 5JCPA 1KQNA 3ANSA 2X42A 1RVDA 2A57A 3NYWA 1DQYA 3RVQA 3ZD6A 1WOMA 2J08A 2JLXA 4C7MA 2WE7A 1QHXA 1ZQ9A 1WW2A 2HV8A 2ZAIA 3I9V6 1WCXA 2A86A 2EJWA 3JWEA 3OLZA 5J40A 3U1VA 4EJMA 1F0PA 5KTPA 1NJSA 2ISCA 1G4AE 1M74A 2D8MA 5K0LA 2WKRA 4B7CA 1RYFA 4XVHA 4KQCA 4YAFA 5FNZA 1H3FA 2PUVA 1UBMS 1XSEA 1XZNA 2F3TA 2R62A 2X9NA 3I12A 3IPAA 2WWYA 1LPBB 2F8TA 1CJUC 1P1HA 2JA2A 5KPDA 3OTIA 4HT3B 1EE9A 2QRQA 2GPSA 5GJBA 4HWRA 3ZIDA 4AYTA 3GLIA 3HLTA 1D5CA 1M3SA 1J21A 1PL8A 1RM4A 1ZGGA 1P4RA 1ZXXA 3DVRX 4DIUA 2B69A 4C2UA 4Q9JA 2ZJZA 1VHQA 5IM5A 2I8LA 1UPTA 4JJZA 5BRNA 3DMTC 4RUKA 4TLAA 4DMRA 3P4UA 4HAWA 4EY6A 5C35A 2CNKA 2NO9A 4OLJA 3L1HA 2HC9A 1YCHA 4B2LA 1ISFA 1UADA 2OGSA 3SF0A 1Z6QA 3CW8X 1KJYA 3F8TA 5HKOA 4ZJPA 1OC4A 4JQSA 5FUXA 4YJKA 3VPDA 2H4YA 1I3CA 4L27A 1JIUA 2F3UA 1PVVA 2VXYA 2C4VA 5JAZA 4JI7B 3PPYA 4IIYA 2UZ1A 3EAGA 4CCAA 3OHSX 1U5CA 4HDRB 4BNDA 1SVMA 1S1CA 4HQ6A 3SX0A 4CPDA 1VYVA 1WHSA 1I7SB 3LBAA 3KALA 4GEKA 4IRXA 4PHTA 3PIIA 1NVBA 1RRVA 2V7QA 1FA9A 4PLHA 4YCBA 4C30A 1Z4IA 2AK3A 3KQVA 1T4GA 2CNBA 4DR2B 3L9XA 4IQFA 1YL7A 3OE1A 4AULA 4RTOA 3S6JA 3PQEA 4RD0A 3KR0A 2DWPA 3DBHB 3JATB 2X6TA 4LZAA 1EHCA 1QF7A 1JXAA 2Z9DA 3NDJA 4Y1FA 1A76A 4MYDA 3THWB 3SYLA 3AIKA 4M38A 3B5IA 2NGRA 2ZJ7A 3A6DA 1UXJA 1WXQA 4F9TA 2FWRA 7GPBA 2X4LA 1FFAA 3SCZA 1BCRB 1UJNA 4ESVA 2QUHA 4M99A 1CZLA 5JQGF 3KTOA 4GPBA 5AW4A 1KTVA 3EOAI 3ONWA 4B4DA 3TJRA 3VHRA 2CLLB 1HT1E 3OTGA 2XYPA 5B7GA 3A4VA 3EQ2A 4FIDA 4J94A 4OI1A 3WJAA 1GNSA 1U4OA 1VRVA 2ODWA 3UYKA 2IU4A 4OY3A 3V48A 1HM5A 2XEDA 2XWQA 1FXWA 4J0CA 3WB1A 4C6HA 4EDHA 1BGXT 4BNDB 4AWBA 4O2AB 3QJ5A 3BXOA 4CIXA 2PWPA 2JFGA 4MUJA 1M8FA 2H1FA 1V9LA 4J1TA 1ONBA 3P32A 4UXHA 1N5LA 2IGBA 1TYAE 2I3BA 3KLPX 3NDRA 4KKVA 4YP9A 3EGWA 5L4LA 3GXBA 3DFUA 4MPRA 3ZNPA 3WK9A 3ZY6A 1XTJA 2R11A 1JW9B 5JH7A 3KXDA 4F4DA 2QYTA 3OD5A 3GL9A 4Q4AB 3N0XA 4GE3A 4UDNA 4JJ6A 4R1OA 3E5HA 2FWIA 3LX5A 4KOEC 4MW5A 3FRHA 5AI8A 3CX8A 1NXSA 1QLHA 3NH6A 4Q3NA 1LRLA 5T4HA 3I6ZA 3UN1A 3H4MA 2RDMA 4KIJA 4N0PA 2QI9F 3A4NA 3W6ZA 4DA6A 4R0MA 4H3VA 2X4GA 5A5EA 5FAKA 5CB6A 3RV3A 1I9GA 4HNQA 3S70A 3EEQA 3ZGXA 2Q5CA 1QZXA 2FQWA 1MLDA 3GGCA 5L7WA 4NDAA 1DI0A 4HHEA 4D81A 2JI4A 1MGPA 5BUZA 3H9UA 1NKTA 1YQTA 3FM9A 3OH8A 4UPVA 3H9GA 1IMOA 5E38A 4MMYB 4QYSA 2OO3A 1NVMB 3IDOA 1N34B 4HSGA 3M6IA 3QYPA 5CXQA 1ZH8A 3NHPA 3O8OB 2ZANA 2QLBA 2C5GA 3P94A 1VGVA 4DQKA 2A0KA 4FOLA 4JCOA 1S89A 4TROA 4CKEB 4NBLA 5HIMA 4OH1A 5HZGA 3DPIA 5BR1A 2FFRA 3AEKB 5A0FA 3BIOA 3W3AD 3N5KA 1XRPA 3UK2A 5BSKA 2ZZKA 3IVGA 5CHYA 1ZGAA 1XF1A 1ZIOA 2XLBA 3EVDA 3JTEA 5IH3A 4XASA 3WGQA 3WWOA 4CW7A 2QZ9A 4F72A 5BSHA 4QDOA 4JP3A 3GNQA 5KCZA 5AW1A 2BY4A 2DAPA 4DB2A 1P19A 2QR5A 1U0LA 3B6JA 1GQYA 1A8UA 1C9KA 3K0FB 5CUQA 1TMYA 3ZN2A 3LCRA 1Q7GA 1EFTA 1KI7A 3LKBA 1ZUD1 4CLOB 1NP3A 4O8ZA 2OP1A 5F5LA 3TLKA 3CRNA 1S9DA 2DX7A 1BXKA 3D8HA 3QX9A 4MIYA 4OM8A 4PLVA 4G67A 3RVSA 3SMQA 1QBKC 1SXJB 1OT3A 2IPNA 1ESCA 2VUHB 3UT5A 1JFRA 1M34B 1YGYA 2OAGA 1FE8A 2V9CA 1YK0A 1X1AA 2VUTA 5K0NA 4GDFA 5FTNA 3EXG2 3KHKA 4KDFA 1EJBA 4YRLA 2EATA 1A0OA 3GZNA 4WLNA 1U0SY 5IULC 2JJ2D 2R8OA 3D3NA 3K4HA 3ASUA 3PEWA 2FLWA 4QSHA 1VIDA 3CEJA 1GAWA 3OY2A 5HFNA 3BMXA 1RIIA 1PJRA 2G1JA 3R0XA 1AQYA 1JLSA 4NCNA 4EO9A 1EUZA 1IHUA 2FPPB 2Y1GA 3ZWNA 4UFPA 2OYSA 1EE2A 2EFJA 2EQAA 1GQRA 4B8YA 1VPVA 5KBYA 3IEUA 4FFOA 4HQLA 3MA0A 4IQGA 4R3WA 3V8RA 3PX7A 2TYSB 4LJ5A 4YXFA 3UKJA 5GJWC 2AG0A 2GAOA 1DJOA 3CG4A 5G3YA 5FR1A 1JKFA 3RF6A 4BWVA 1C50A 4TKZA 4BGIA 3QLUC 1TVCA 4PO1A 3UFXB 5LXTB 4FCVA 1GYPA 1EGMB 4MR7A 5A5FA 1P81A 4LVNA 2OV4A 1KVUA 2P65A 4WUVA 2W2NA 3DO5A 3WAGA 1C2TA 4YRJA 1PVDA 1VA5A 5LMCA 2H1CA 1QIJA 1QMPA 4CG1A 4IH4A 4WCFB 4BTLA 2CXHA 5AH0A 3WLFA 5DULA 3TSZA 1VYHA 2E4ZA 1BMDA 4ZV4A 1OI3A 2EKBA 2ALJA 1FU7A 1VHLA 1Y4DE 1ML3A 1VM6A 2GLXA 3L04A 4G5HA 4O02B 2CFSA 4TLCA 2G9RA 2Q21A 4B34A 4K0RA 4BNVA 5J4YA 3L49A 2M1ZA 1XZFA 1BE8A 2VNKA 1UPCA 3MWKA 3AI7A 3EIOA 3AEQB 4JR2A 3I01A 1PR4A 2OG2A 4J0IA 5DTJA 2X0DA 3ZI4A 4BKRA 3KCQA 4UFNA 4DLVA 1OU4A 4ZJUA 1FRVA 5ALVA 4QTUB 1IVSA 1M54A 2I2AA 2VYVD 3NHFA 2R86A 3KSDO 3X1YA 1KGDA 1ULZA 1QV6A 2NPOA 3JAMA 3H9EO 1Z5VA 1IBSA 1KJZA 1RTKA 4Y6LA 1L5ZA 1VKNA 1EFVA 2VNHA 4ZYXA 4IG4A 3M3HA 3RU9A 1C0LA 2XITA 3WLTA 1Y3HA 2X2OA 4W9MC 2IZOA 1UWCA 1YUBA 2QM7A 3F4LA 3ESYA 4C6TA 4OMUA 3A04A 4JX9A 3VSEA 4RK0A 1AF4A 3OPYI 3T95A 4BFYA 4IIDA 5BURA 1UKYA 2DFLA 1T9AA 4KE6A 1A9YA 4MUNA 5IJ0B 1SU6A 1PP4A 3LOPA 3W0LB 3V4ZA 2X0FA 1EUDB 4G86A 5ESXA 3KJFA 1GRNA 2QUKA 3LWDA 2C4HA 1Q7TA 2LNDA 2ZBGA 3CKLA 2DLNA 3TLEA 3BBPA 2BFFA 3BX1A 5K3OA 3LY8A 1QIHA 2OZLB 3WQHA 1L1EA 4BO2A 3BFXA 4MYUA 2FQYA 2WIJA 1Z5ZA 4YREA 5JS1A 1R6XA 2CL6X 5JD4A 3C6XA 4DL9A 3I5UA 4Q4DA 3T8YA 2H1WA 3KSBC 1MZVA 5ALTA 1MH9A 3C5WP 1MEOA 2F8MA 2DPYA 4ZO9A 3ZV5A 4MWOA 1T4BA 4XFJA 2WSSA 1OWLA 2YN2A 1A82A 3PQ6A 4M7OA 2HQBA 3Q6MA 4G5QA 1AQUA 4QDJA 1E6CA 4UAUA 2PLNA 1V35A 5HFJA 1A4XA 4FYYA 3RSGA 5L45A 2PT5A 3BH6A 1EJ2A 2D5BA 1F14A 3WG9A 3O47A 1CR6A 4XUDA 5L3SA 1TUBA 4P3YA 3RSLA 2PY6A 2X0KA 2CNLA 2H4XA 2YMLA 2QAIA 3DZFA 2CCKA 4G2NA 3WA7A 3FROA 2X4IA 3U7GA 2MR5A 1LTQA 2G5CA 1O0SA 2WT4A 2H4ZA 3G0BA 3D7NA 2WFZA 4HVAA 2F90A 4CVNA 1OB2A 1CUSA 3I8SA 1PQUA 2CVZA 4GZLA 3R6WA 2F00A 1H2HA 4AJ4A 3I2IA 4MJ7A 2B0CA 3M6VA 4R4JA 1J0EA 2R6GA 4XM1A 5DCYA 1CZKA 3VX4A 2ORWA 4EVIA 3IT1A 1TJ4A 5CDTA 1EDBA 1J8FA 2HPZA 4TQ9A 4B4UA 5HPYB 3VVCA 4A6XA 1I51A 1BX0A 2JVIA 4HN4B 2PGOA 3IP9A 2FPXA 1RD4A 1DUIA 2ES4A 5KWJA 3IMCA 2ONCA 4DCMA 2Y4NA 1KK0A 2UZ1B 4JL6A 2GCGA 2Y05A 4G63A 4LZNA 2FAXA 2I6FA 3HUUA 1NWCA 2RAUA 2X5JO 1TJ5A 3F6YA 4RDXA 3UHFA 1QFSA 4RLQA 1E8DA 1D1PA 3KQOA 2Y1FA 3KX2A 2BRUA 4M1TA 3SJUA 1UP4A 1XLTC 5I5EA 4FK8A 4OU5A 5BXQC 3LL7A 2CUTA 4QZVA 3IGFA 1NP7A 1IJFA 2PH1A 2Q1TA 3LUFA 4DRZA 3AHDA 5IJ9A 3HXQA 2CF5A 3MOGA 4LF8B 3S8YA 3NTLA 1LF5A 2V6IA 1LH0A 3G1TA 1AMOA 3E05A 3VTAA 1FZTA 4K81B 5ALFA 1X86B 4W7HA 4Q9IA 2B6NA 3URMA 1WD5A 1NF2A 3W5SA 4YRZA 2X9GA 3NIWA 2R4QA 5JUWA 1QZ3A 2GF9A 2WF5A 4RW0A 4YFVA 3SBDA 5ALGA 4IPTA 3I0NA 1WKBA 3MERA 3CRZA 3MNFA 3ED1A 1TA0A 3GD7A 1TJ3A 2YNMA 5JNLA 1LWNA 4ZWNA 1U3VA 3SM9A 4FYHA 1CZUA 3CY6A 5EIEA 1I01A 1EA7A 1S6YA 1HSZA 1L7EA 1QIIA 1PNOA 3NONA 2RGDA 2F4NA 1A97A 2ORIA 3NEPX 4WA8A 3NRBA 3PQCA 4IUYA 3ZIAD 1I6WA 2VF8A 1Y3BE 4EG3A 3IHTA 2EZ9A 2IYEA 1GZ7A 3TZCA 5ALLA 2OQ2A 1U04A 1P1JA 4WW0A 4W8HA 1ZJZA 1G6Q1 3EC2A 4ZQGA 2CKMA 5GM1A 2HUNA 4GZ6A 4IIGA 1HY3A 4EPVA 5JBIA 1ZKMA 5K0TA 4HAXA 4C07A 4DAOA 3ETEA 1FFXA 2YFKA 3U9LA 1IG0A 1LPSA 3JZIA 3LK7A 1EG7A 3LT1A 2ZDQA 3LPLA 3QQPA 4PZAA 3SSNA 3X1DA 1LC0A 2CXXA 3GAZA 1JDTA 1SCNE 3HCPA 3TK1A 4BCDA 2HBZA 4CF7A 1CYEA 3OMXA 1SUPA 2W2KA 2WUFA 4YTEA 3TEMA 5CYGA 4EPYA 1GCUA 3DJYA 2F55A 5E4JA 2FFHA 3HO8A 2FWJA 3R7DA 1YO6A 3ET4A 1THGA 1YRAA 3ABRB 1NDQA 1DVRA 1YBAA 2C77A 2CLKB 1HZZC 2VHJA 3IQWA 3KYCA 1DKUA 1QYCA 2D5IA 2VTKA 2ZAGA 2ZJ4A 3CXRA 4I1SA 3IUBA 4IMRA 1MG0A 3DE5X 4X00A 3PA8A 5BQFA 4OBBA 1UBCA 2DUMA 3QYJA 1RWOA 5FUBA 2I6GA 2RGBA 1RW4A 3N87A 3SK0A 3WYEA 1DDIA 3VKGA 1F4PA 4EKGA 2O54A 3AHHA 3CIOA 3NKVA 3IP3A 1Z2OX 4EX7A 1W96A 5GINE 1RYHA 3SSMA 1D4FA 1VE6A 4UBOA 2JIDA 1Z26A 1MX9A 1EA5A 1NLZA 2XQGA 4LEIA 3SYKA 4C4SA 4IV0A 2JANA 1QQAA 2Q1WA 2BSQA 5GONA 1YR6A 4NCXA 2FJUA 3IQZA 221PA 3K4PA 2FPKA 3FOEC 4CF4A 3LBNA 5K09A 1R6TA 1BH6A 2AKYA 3OF5A 4QOJA 3W4KA 4UHKA 1I4LD 5FIUA 1HTBA 1FSSA 1OWPA 3W2IA 3LPMA 2G6TA 4DM4A 2OY0A 2A1TR 2FEMA 1L4KA 3JX9A 4FJ0A 1AXRA 2IFTA 3PENA 4RVHA 2YS7A 5DMXA 5IVIA 1KMCA 2QENA 2VJQA 3GRUA 3Q3VA 3VPSA 5KQLA 4XWGA 4AS2A 2CL7X 4LTMA 3SICE 2OCYC 3D9QX 2Y9MB 5FADA 1ISSA 1N7JA 4HWKA 4RIGA 4DPKA 2AGVA 2OWDA 2A3NA 3BKWA 4HBZA 3CKMA 1R3UA 5ER9A 4DQXA 4PO3X 1DQZA 1GQ2A 2BMWA 1D3AA 2BEUA 3F9CA 3LQKA 4C0JA 2G9QA 1QCCA 3BIWA 1C9NA 5LOVF 2O2HA 1ACJA 3MJ4A 3DB1A 4YI3A 2PE5A 3GLHA 1K6EA 3HJAA 4LXTA 2F6RA 3LCMA 4J90A 1E3DA 1M8KA 5TGZA 3EPJA 3PL5A 3ROFA 1VMIA 3E7WA 4L02A 4Z49A 1N5OX 1D2EA 4GRIA 5DX8A 1CUAA 1GNLA 2ZRJA 1A9QA 2PL3A 2XDYA 4OFBA 1KQPA 1XXLA 2C0QA 2C7RA 3CF2A 5T4EA 4BPBA 1H1LA 4UZFA 5FP0A 4X7MA 5IBQA 4M9RA 1X77A 4RKFA 3WMRA 1YQXA 1HDGO 2GTHA 2B0JA 3CURA 1MAUA 4L28A 1YZYA 2ZFUA 3ZZ1A 3WQBA 4KN8A 3FYUC 3GLFB 3RAGA 3EXHA 5K01A 3Q7QA 3PUHA 1P9NA 3AKDA 3HU5A 4P22A 3MLBA 1AU9A 1TA4A 2W2QA 1DT5A 3DAGA 3LNCA 3P97A 4XR9A 4YCNA 1UH5A 3OICA 2GJSA 3E3OA 5JY1A 1GG9A 1DLIA 1TM3E 3HCBA 521PA 1Y6RA 2CHUA 1BWSA 4YWJA 1I7NA 2YWJA 3X1JA 2VPYA 2X7XA 1E4EB 1KEZA 4UARA 3VNQA 5KC9A 4C0LA 5U4QA 3W4IA 1P1KA 5IWAB 1W0CA 4Q66C 2KPOA 3ITDA 1NR7A 2GPYA 3SJCA 2O5EA 1I8TA 1BDJA 3DAFA 1CR0A 2L0XA 2PZMA 1U0NA 1C7ZA 2IPAB 1GADO 4IO1A 2CKDA 4MUEA 4O4IB 4TSKA 2RJNA 2KW5A 4TTSA 5DSZA 3QQ5A 3W6PA 1RC8A 2JFVA 4R2KA 4ROSA 1MO6A 4JP8A 4F5EA 4MVXA 3E1SA 3TE6A 2DU8A 3WX0A 4EL0A 1ETHA 4NNJA 2VPTA 1Z18A 4LBZA 1N25A 3FFTA 1Y9DA 2P6OA 1J8YF 1PLKA 3OZ7A 4JXXA 1BU8A 4HEHA 4XFDA 4MV1A 3SHQA 1THTA 2JAWA 1KE2A 3JAKB 4HWGA 1SC6A 1XXHA 3ZG6A 3SZOA 3GCGA 4GPTA 3JWIA 3VU9B 2D1RA 4PFSA 3WNQA 5U4XA 2KX7A 3L4JA 4BQRA 2ZRLA 1T36B 5C52B 1Z0KA 3WK5A 4OFWA 1O77A 2JCGA 3FLAA 1SXJA 4M1WA 3UT5B 3ER8A 4G4GA 1NQAO 4C0XA 1KJ8A 3DL0A 4ZI7B 1MO3A 3FKSA 4W7SA 4B3TB 5CYPA 2QXUA 4EEKA 2BFEA 3IKMB 1IBLB 3AYZB 3RC7A 3Q11A 3W9BA 1CSEE 1B42A 2JHAA 4P7BA 4UQPA 1YASA 3PXEA 3TTXA 3VZRA 4LHXA 4PG4A 4Q4HA 2UYGA 5BWOA 2JNWA 3Q4GA 5CDYA 2I9KA 3EXEA 4JLMA 4WZ6A 3HDGA 3NYQA 4ZCRA 3AONB 1T2VA 2V96A 2PR7A 1TFUA 3BSFA 4PCUA 3FTNA 5F77A 5CA0A 1XVUA 1R5JA 1UIMA 4H2DA 1LRKA 2ZRNA 5CP8A 1P17A 1CX9B 2F9MA 2QD3A 3QKSA 4JLDA 1V96A 2LE0A 3IUPA 3SHTA 3AX6A 4P2BA 2A5YB 2DGDA 2OV6A 2VZ8A 5AK5A 3S7ZA 3KG2A 1ZJ4A 5BRJA 1P80A 4E4RA 4KRFA 2XGOA 1GGVA 4F6CA 1TAUA 3D6FA 4YPFA 3A9CA 1AKMA 4RVOA 2C97A 1MOPA 3A9TA 1U11A 1NDUA 4ZO4A 2CXNA 3THOA 1P2UA 4Y2VA 2GK7A 3C8DA 2JGDA 4I7EA 1CUIA 2GLUA 5HQTA 1WS6A 3HNPA 1G21E 4GFDA 4B4KA 4CEIA 1Y1LA 3G2KA 3WRXA 5K6RA 1PFVA 3JQ9A 4B6PA 4M0MA 1D03A 2AD1A 2HZBA 3BD9A 5DH9A 5DLYA 2R7AA 1RXWA 4HLNA 3WGHA 4PHHA 4E22A 4PSCA 2OFPA 2UAGA 3G8YA 2MSDB 4AQYB 4W63A 5FWAA 4YRMA 1N3BA 4PLZA 2QKYA 5KWEA 3MLAA 4E4YA 5EUQB 4FPXA 2VF4X 5EJ8A 1DG1G 2XOKD 3GNTA 2C9CA 3CSDA 4HWSA 1VE1A 4MQ6A 4MWGA 4ZPJA 1C3LA 3H87A 3HCNA 3ICPA 4C6TB 3WGOA 4AP5A 1L5FA 4DQVA 2ID8A 1Y3AA 4LBWA 1THMA 1NVUQ 1WSWA 5BXYA 5EY5B 3VR2D 4E5KA 4GWLA 5FB3A 2L2QA 3RGWS 2PJZA 5C51B 1NX6A 2WNSA 3IJRA 3FNFA 3GLIE 2ZR7A 2KYRA 2ZJBA 2AE2A 2JCBA 2F7SA 2H17A 3B5EA 3HCAA 3IC5A 3K16A 4HAOA 4HDQB 3RIMA 4E1VA 5JIBA 2AXQA 1JF8A 4AY3A 2RSLA 2WJGA 4D3YA 1N8TA 2QXYA 2RKBA 5JVDA 2M6LA 5JY6A 4JUDX 2KLHA 4TWIA 4ZEXA 1VL0A 4QJBA 3OFKA 4H3SA 4DUZB 3I83A 1BMFD 1EBBA 2AYYA 4RO0A 2I91A 4GC5A 1CR2A 2Q5LA 5TQ0B 3UAYA 2NO4A 4OUDA 3KDPA 2EFCB 1H0RA 4F91B 2PSFA 2VRBA 3OF3A 1NLFA 2FPGB 2HJSA 3O4FA 2AMLA 4F21A 1X74A 3IKLA 4FDLA 2CXQA 1F9EA 5CFOA 1D1QA 5HJ2A 4C3ZA 3U4DA 4E46A 1VJ0A 1PLJA 1EEHA 4K9SA 4JYZA 2HWXA 3CNHA 3ODGA 4E3WA 1N5DA 2BKXA 2O50A 4MQFA 3HABA 5JH7F 4P38A 1C9YA 1XL1A 4PG8A 5EHNA 4QQNA 2TMGA 3PC7A 3AEKA 4JGGA 4OXXA 1NHGA 2J41A 2JKYA 4R31A 5EOVA 3MN1A 2GWHA 4EGFA 2I1QA 5E7QA 2V3VA 5HYVA 2OXCA 3ZE7A 3HTXA 1A4RA 1TUIA 3GT0A 3Q9SA 5CT4A 2FW1A 2YJ3A 1CNEA 2O0KA 4MLDA 3DE1X 4BQPA 3NUGA 1BTOA 1GNQA 3NJ4A 4BQIA 4YJDA 5MN5A 1E3WA 2Q1XA 3HYCA 1DIRA 5JPCA 1W2HA 3PS9A 2C57A 1ESNA 5TPZA 1H2AS 5AVOA 5GWXA 4JDUA 1OYWA 3JALB 3KBOA 4J7AA 4EPTA 2D2EA 4CJXA 1CRZA 1WMBA 1OGJA 3GPCA 5KDOA 1A8QA 4UMEA 1FPQA 5B4UA 2J07A 4TMZA 3FTFA 4YUAA 4N5IX 1E62A 5F7XA 2Y0DA 2ZSBA 1E4VA 1JIIA 3MFQA 3B7WA 5FCDA 2QUBA 3OJWA 2F1HA 1RI4A 1DWUA 1FIUA 3WL8A 4YUZA 2AKAB 5HWSA 3E9QA 4QGFA 2QPAA 1Z37A 2VHXA 1ZWKA 3UAGA 3S5JA 1EMDA 2J09A 4ZAYA 3ZY4A 5AVVA 1XRRA 3DGEC 4MRSA 2QAJA 1Z2DA 4HYQA 2LW7A 4XPIB 3IALA 1B6RA 1I2DA 3TEJA 1U7TA 3BE6A 5I4KA 4WXPA 1GPAA 5FORA 3TB6A 2XVMA 3CZ9A 3EE6A 3G2LA 3OKAA 4HQKA 4DLWA 1KQOA 2GEVA 2XW6A 1ZRSA 3INGA 5J9FA 4GLBA 1FVFA 1M33A 1NRJB 3MJHA 2QMQA 1GTMA 1KOFA 4MR7B 3TM5A 2ZYSA 3RU7A 5E1DA 2XTAA 2OZLA 3F96A 3G2QA 1H8HD 4PCAA 2VH5R 2GCIA 3DZJA 4N82A 4CMBA 2QTBA 4C0QC 1EWYA 5IYZF 3R1IA 4OI2A 4GWKA 3G7UA 4BFXA 2WP8J 4EUNA 4Z4QA 5TJHA 3B9PA 4JYAB 3QVWA 4CEHB 3TMYA 3ZWBA 2A67A 3ZLVA 1Z2CA 3C98A 2REQA 1O5OA 3E0XA 2P1RA 4XD2A 5TE9A 3NPMA 2W6NA 2YYAA 4OHVA 1YR3A 3FW1A 4BXOA 3M1IA 3B3JA 4DWVA 1SVIA 4CR6A 5IT9A 3K8ZA 1WKCA 1E2FA 1NVTA 2CJWB 3EHDA 1F4LA 3NTOA 4LY0A 1VL2A 2G63A 4BNZA 4G0XA 1WP4A 3UXYA 5ALEA 4BL5A 1RLJA 1H6AA 2W0MA 1QCYA 2YV4A 4LJAA 5GZ6A 2UUAB 3W5BA 5BQ3A 1RRCA 1NOKA 1TYEB 3M0EA 5CD1A 1J9ZA 2M2IA 2CB0A 1YOVB 2OCKA 1JE1A 4NBKA 1WCV1 5KHAA 3VA7A 1MHTA 3UJHA 1DOAA 1JA0A 4NE9A 4B7AA 5LDDC 1WR8A 1VIVA 4YRSA 3MAGA 4NMXB 3UPUA 4L5YA 5LWQA 3H1PA 2CL5A 2YJNA 3AOEA 4RZXA 2PKCA 4Q3DA 1GILA 1NA5A 4P3NA 2DKFA 2CYBA 4G09A 1MW8X 2QW0X 4N12A 2X5NA 2HREA 1H2YA 4IIJA 3B53X 1ZOSA 2IC5A 2WF7A 2YWEA 4ND7A 1K1EA 4QDUA 4TV9F 4TQAA 4S05A 1V48A 2FZGA 5J5AA 3TAUA 1KJJA 4ROTA 2ZYGA 2R00C 3QWBA 2C54A 2ZIFA 1E3LA 1EPUA 3M89A 4IIEA 4WXEA 5A7HA 4CCWA 4EYEA 4AB1A 3OFNA 3FYTA 2OD9A 2FE1A 4S35A 4YRPA 5JWHA 5TARA 1QP4A 4ALMA 2JI6A 3ETNA 1NRXA 4N6NA 4YVFA 3VVBA 1KP2A 6ADHA 1WCIB 1HX7A 1P0CA 1ZONA 4CF6A 4NCAA 3HB1A 4NCHA 4WAUA 2SICE 4J0EA 1HYBA 1NGSA 1V7QA 2PUAA 2BF4A 4C7OB 1JJVA 2B4RO 2VQDA 1NSYA 1J0BA 2JGJA 3M1LA 1MO4A 4MAAA 5L7TA 1QIKA 1LDBA 2OHOA 3R5KA 2A0WA 2R8ZA 1YE8A 2VHZA 2WUVA 2Y6VA 3DTVB 1BG6A 4JZKA 5JQGA 4MI9A 1Y6ZA 1NVVR 3OFND 4YMHA 5JCZA 3IEKA 3UCXA 1S8NA 5DK4A 1NBEA 4GMDA 1KERA 3IAHA 4RX1A 4UC0A 4E15A 1W6UA 2I4TA 1QQ6A 4H7EA 4G84A 1YF3A 3AHFA 1E9AA 2FSFA 1A5SB 4HZUB 2OTCA 3GLTA 4K40A 1O94A 3U13A 4BS9A 3IT3A 4KK4A 3VH4A 5JAPA 5JS8A 3FD8A 5I7AA 4PONA 3DBOB 1RQLA 3PJGA 1IWOA 1X3LA 3NYIA 4WZBB 1EVIA 4ALLA 4A2QA 2F48A 2EF1A 1E1RD 1YDFA 3M1AA 5B1HA 4FXOA 3OPMA 4EZEA 2O0JA 2P2ZA 4MW1A 4PGGA 3BGIA 1AQIA 3LDAA 3V5NA 3A28A 3NETA 3KIPA 3PPIA 4UJ3A 4L7QA 3KEOA 3UHAA 3ZIUA 5KO2A 3R7BA 3N2GA 1IUOA 1T4MA 1TCBA 1M8PA 1OJ7A 2PX0A 3WVNA 5JXJA 5A62A 2RGCA 2VEOA 4ED9A 3ZDAA 2ZB7A 1G1AA 1E1LA 4B84A 3KYBA 2H9AA 3MPOA 1AGNA 3AP2A 4MW6A 3TQSA 3WLHA 5JO0A 4RTKA 1CETA 2XH8A 1G9SA 4IEIA 4XQ0A 1I5RA 2DUJA 3AJAA 2CXUA 4F38A 3VR5D 1CUDA 4JNCA 5SYMA 3RWBA 4K2HA 4F2GA 1DXQA 4TYYA 4KTTE 1UBUS 1YXMA 5JADA 5HFAA 4O2BF 3ZE0B 4LDAA 5BQXA 5JS6A 3Q2KA 1UDAA 1XZEA 4XLTA 1HR0B 2G7ZA 1GEGA 1PUIA 3DMDA 3FA2A 3DMGA 1XKXA 3OZVA 4QSMA 1YMVA 1SVNA 4ZRNA 3TAHA 1RBMA 3P8ZA 3Q40A 5JD5A 3QYFA 4JXKA 3BWDD 3ITKA 2GCOB 2XB6A 4LYFA 2DT8A 1QX3A 2WVJA 4U2GA 3RFXA 3ZWVA 1XDZA 4D1YA 4PLWA 5THXA 4YS6A 1CUJA 1E69A 1FK8A 2C03A 1HMPA 1V8ZA 3BK2A 2FPIA 4KIUA 5FHQA 2VKTA 4Z0NA 4JYBA 7YASA 1J1UA 1ZOPA 1AGYA 1L8QA 1N8SA 1SC4A 1TD1A 1XTPA 1Y3DE 1YQEA 4QU0A 2EKLA 4YXWA 5I4IA 4J0DA 3HXMA 2E4YA 4PFJA 4LCBA 5KVAA 2B3DA 3IEPA 4HDKA 4Q4AA 2EGUA 3QUSA 2Q4TA 3IB3A 3WWZA 2E1PA 1PT5A 2IXFA 2EFHB 3G0OA 5CG2A 4FEEA 5F35A 3VYRB 2P9ZA 2Q9CA 1A69A 5FWDA 5EJ7A 3OO0A 1JTVA 1JZSA 1Y0BA 1DTWA 1PG5A 3H9BA 3PHCA 3SEAA 5I48A 2AJLI 4CEHA 2FJ0A 4M2LA 5HQJA 4I99A 4QEZA 3ZIAA 3FCYA 1N9ZA 4HZIA 2HSWA 2G1UA 2X8JA 2FMHA 1YJAA 2ILTA 2UYYA 3T9EA 4DA4A 4LYAA 2PLRA 2Q50A 3AI2A 2JASA 4BCBA 5D5QA 2Z2YA 1V3VA 2XJ9A 2V7VA 4PIVA 4FINA 4YQZA 1Y7LA 2J6HA 1AKRA 1S02A 3CNBA 3A32A 5DLPA 2PTHA 4R1PA 5EKSA 2NQ8A 3M83A 1LPPA 3UJ6A 1DRVA 2PV0A 2NTEA 3AY0A 4IXDA 1LBTA 1UFVA 3PCXA 3R9KA 1EH5A 1RKVA 3K6KA 4MW2A 5ECDA 5C5CA 1LKZA 1ODLA 3ON5A 1U2RA 1FDTA 3GVPA 4H31A 2FZ4A 2JVKA 2R7NA 4QTZA 1FJXA 3FMIA 4NVRA 5CT8A 3OT5A 4HQRA 3UG6A 2DLDA 2QUIA 3H5RA 5IWCA 2ZS7A 4M88A 5AXDA 2ZM5A 2WSSD 3H2SA 4P7FA 3GN2A 3HDHA 2PGLA 3ENVA 4IIVA 3L8EA 3QHPA 1GCOA 1QWOA 1XRNA 4N39A 4OEHA 5F33A 5H02A 3DC2A 1ZIDA 2OFXA 1DAEA 3DVLA 1MJHA 4ECEA 2JGRA 4FDUA 4RKRA 3NATA 2DUNA 4WVLA 1GA1A 1WHSB 3VR5A 1VXRA 4CDNA 4F97A 3ZW7A 4YI5A 3JALA 1C5KA 2WIDA 4MVJD 1FBTA 2QV0A 3B70A 3NWPA 3QRWA 4HR7A 4WDRA 2CEKA 5ALXA 1XLVA 1AHNA 1PT6A 3R75A 1LFDB 1LQTA 4F4CA 5GZ3A 1AQJA 3BWMA 1CJKC 1F2UA 1J70A 3ZKAA 3P0HA 4JLAA 1SRRA 4K03A 4MV9A 3F4BA 1YRHA 4PN7A 4KMMA 2GD0A 1NN5A 1YQWA 4WBNA 1QS0A 4TVKA 3I2KA 4RZ2A 5B7PA 3KCNA 4X1KB 1F8YA 4WY2A 3FZYA 5E0KB 3ZJ4A 4CQLA 5IC4A 3F3KA 3QIVA 4C5CA 1MVOA 1GG5A 1M5UA 4DXHA 1SH7A 1Q7RA 4DDVA 2X8LA 3HZZA 4HLCA 3T38A 1A5TA 2H7XA 3GIDA 2JS7A 5BMOA 1YU6A 2Z5LA 3I9LA 4PV7A 5KSYA 4TL7A 3RC9A 2YZ2A 1K68A 4YXWD 4OJYA 1E6KA 1EVEA 1G8SA 2JH8A 5EJIA 4NATA 4AMVA 1AKYA 2W2PA 4NCBA 1OLXB 1R9JA 1S9HA 3K53A 3HB9A 1YIDA 5KQGA 3THSA 1VRWA 1UP7A 4KO8A 4N7BA 1IWBB 2MINB 4GMHA 5LP6B 3IR7A 4HXFB 1M2OB 1NOJA 2QD1A 2PUTA 1SHKA 1VLHA 2ORED 1VSQA 2ZROA 3TGPA 3BXZA 3E23A 2CLHB 2AN4A 2D2IA 2Z43A 4DCUA 3AILA 3COWA 4FGKA 1ZI8A 3DKKA 2QSUA 4NESA 5BSMA 4AFNA 2WU3A 4JXJA 3BB3A 4HNAA 3SS8A 3AH8A 2BFCA 4JNKA 3HPRA 1QKJA 3B1KA 2VYCA 3F3SA 3N7TA 3GFOA 3MWEA 2FWBA 4V1CB 2M6KA 2GKGA 1K3TA 3KZXA 4M9QA 3UJPA 4MWEA 1PFYA 2W6PA 3W7AA 1RC0A 1S96A 2NTJA 4H7KA 3SEZA 2C2ZA 1T15A 4NECA 5DW3A 2HYDA 3C45A 4XWTA 4UCQA 1N57A 5KTYA 1SOAA 1LI4A 3RABA 4AU1A 1OI7A 2ZRHA 4R1QA 1BXRB 5H68A 1T91A 1ZSNA 2ZTLA 3DDWA 4G5GA 4OQLA 1SUDA 3EXAA 1AV7A 5HZHA 1E4EA 2REXB 2QRKA 2WU8A 2BGRA 2WIGA 1FX1A 6LDHA 2RJ3A 1JB1A 2QN8A 2PLWA 3F6SA 4KQFA 5AM2A 3PDUA 1V8OA 2C04A 3Q3HA 4HDCA 3HHPA 4EG0A 4UOQA 2O8BB 2BBWA 3WV5A 3TUIC 1Z83A 4I1UA 3DKPA 1PR0A 1T5SA 3ZH9B 4HF7A 1QO9A 3DLBA 4OJTA 4A6PA 4CMIB 4EPXA 1XLUA 3PD7A 3HL0A 4RZSA 2BGUA 1QVZA 3WK8A 4DNFA 3MTJA 4FFDA 5EE9A 2C5LA 2WWVD 4JROA 2H57A 2LGJA 2VDWB 4UVGA 4FYMA 3HU3A 1HWYA 1TUBB 2HJVA 2R6R1 2OLEA 3AKYA 4ZODA 3ZLBA 2ZT6A 2DFKB 2HF8A 4MA0A 4HH1A 3EJWA 2FJPA 1SUFA 3FUUA 4JHXA 4R01A 3PRYA 3MG9A 4UBNA 3UGKA 4O4LA 4AO6A 8LDHA 3K6SA 1Y1TA 2W98A 4WLVA 2N42A 3SJ7A 4FE7A 2ST1A 4WK4B 5BN4A 3C8UA 4JLNA 3S27A 3R09A 1A2BA 4KVAA 2AI2A 5JMWA 2JPDA 2ZJ1A 4W99A 2OBLA 2QJFA 3FUVA 3H9JA 4MS4A 4Q4JB 3KEMA 4WBXC 4BJ6A 4AWAA 3KSMA 1RP1A 4XE5A 4KR6A 3BE5A 1Q22A 1HGXA 4PBTA 3X2FA 2R47A 1SXJD 4UPEA 1ISIA 4AC9A 4PSUA 5KTSA 3C0KA 2FEKA 3FVRA 1UAGA 3ZDFA 2CUZA 3EQ8A 3C1TA 5T57A 3H17A 4F2HA 3PZBA 1Q0TA 3EIXA 1XK6A 3RFTA 1SIWA 4BLQA 2I4LA 2B6HA 4EG4A 3BJEA 1XCLA 3MTEA 4LG1A 2O2CA 3D2BA 4IHAA 4ZCMA 3GH3A 2X0NA 5D1NA 3I9OA 2ISQA 4YRTA 1J0CA 3PF9A 4W82A 3UT0A 2ZRQA 1KC1A 5JSZA 4V02A 3PTAA 5KYXA 2FW0A 1JSLA 2CCGA 2JARA 4ICIA 2XT9A 3ICEA 2J3JA 3R0JA 4TYMA 2Z0MA 3N70A 1TRHA 6NULA 3HVRA 10MHA 1L4YA 4WJKB 3FYUA 1DAPA 2FUNB 1J39A 4QBGB 2JIBA 4FHEA 3OFVA 2XBLA 2AFIA 3K8YA 3SZ3A 4AS1A 3OOSA 3LO5A 5E1MA 5D84A 3WA6A 5IH7A 1RQXA 5D3MB 3FDFA 2Z3ZA 3C1OA 1UT6A 3EPPA 4LDPA 3VJKA 1G20B 3VSDA 3G79A 4P7JA 4LFCB 1IEVA 2XXBA 4BO1A 4YRQA 5H82A 4J4TA 4HXGA 5BR4A 3EPHA 4G81A 1UANA 4FNOA 4R9SA 1G20E 1DIAA 2IEZA 3GPDG 3OWOA 1M10A 3ABQB 3WBJA 4LDZA 1P7VA 4LNAA 4FDVA 4Q3KA 4ZK2A 1DHTA 2E9SA 3BMQA 4TT3A 3FCAA 5EXEA 3FRJA 4H3KB 3HACA 5JG7A 3KYJB 2ZUVA 1LW6E 3IURA 4WOBA 3QMMA 4F6LA 2BHTA 4JLJA 3IESA 1W59A 4OFXA 1QIEA 1SU4A 2VRWA 3HRKA 3MRTA 5FWXB 1ZM7A 4DCOA 4EJFA 3FNIA 1EVYA 1GKIA 4XVRA 3STUA 2FN8A 4EG6A 3AB8A 2W6CX 2HY7A 3WDLA 1XTUA 1NXXA 1YJCA 2VPZA 2B1IA 4YLGA 3KJQA 1QONA 1TVKB 3VPBA 1JR2A 1PDOA 9LDTA 3EXFB 1JFTA 1WL8A 1B1AA 3AUAA 1ZD2P 1WUKS 3O9VA 4M55A 4C0KA 1ZMTA 3RTDA 2GZ3A 4B5LA 1CUHA 2HSJA 3K15A 3KO8A 2GI4A 4W1PA 1OLOA 5H1YA 3ND9A 3LKZA 2WK1A 1G5FA 3SJAA 1D4OA 1ATIA 3H0CA 5JHHB 3QEAZ 4HH0A 4K6FA 2VNJA 3JQCA 4PGMA 1HEIA 3C14C 3MB8A 3OMWA 4JP5A 2ZAYA 4JI5B 3KYDB 5AKZA 3U0BA 4JI1B 4EKNB 4YUYA 5C1DA 2FPOA 3BRQA 3TEFA 4J1TC 4JBHA 1HETA 3T61A 3OCXA 4R0NA 2Q6LA 4OK5A 1Z45A 5JC8A 3OPNA 5DX1A 1I1NA 3ZZ0A