1U5CA

Plasmodium falciparum lactate dehydrogenase complexed with 3,7-dihydroxynaphthalene-2-carboxylic acid and nad+
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
316
structure length
305
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mapping the binding site for gossypol-like inhibitors of Plasmodium falciparum lactate dehydrogenase.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
total genus 114
structure length 305
sequence length 316
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2004-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1u5cA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1u5cA02
2PD4A 3LC2O 4NBVA 4CM7A 1R6DA 1X15A 2R00C 4LSWA 3WYEA 2O3JA 1T1SA 4XDYA 3W8DA 1WP4A 2X5JO 4IINA 3ZV6A 2X5KO 3X2EA 4E5YA 2AQHA 1IPEA 4WNIA 1X0VA 4PG5A 1ONPA 3M1AA 4J43A 4WOJA 3TNLA 1NQAO 4ZD6A 1KY4A 1ZJYA 3BZUA 2QZZA 2YQ4A 3HDJA 5A02A 1UXKA 1QLJA 1WNTA 3TQHA 4D41A 4E5KA 4AJPA 1G1AA 5CEJA 1E3SA 3WICA 5JPIA 3H9QA 5EQFA 4YJHA 3GK3A 1UDBA 1VJTA 2I66A 3ADPA 1H6AA 2EGGA 4ZHSA 2OZPA 5HS4A 2FZWA 1LDEA 5B12A 1QR6A 1ZVMA 3OIGA 2WD7B 1WDKA 3IP3A 2ZK7A 3CH6A 4FFRA 3TOZA 4CQMA 4LCEA 3E1KA 4OSPA 2HU2A 5JAQA 3UVEA 3RUDA 4E5MA 2J3IA 3WGTA 5KJ1A 1E7MA 2WYUA 4PCVA 2XF8A 3DBLB 2FHSA 3E9NA 4MVJP 3QY9A 2RHCA 1P0CA 3WJAA 1WAMA 4NNJA 1YONA 2EV9A 1DFGA 2X6TA 2WJPA 4NU5A 3PHJA 2BLLA 2HK7A 3DXFA 4QQRA 5JCJD 1MV8A 3R0IA 4TWRA 3UKOA 1M6HA 2C7GA 3IJPA 2O7SA 5DOVA 4A03A 5JYDA 1YO6A 2I67A 4IPTA 5F5LA 4W7HA 4BNTA 2HQ1A 3Q9NA 4WLNA 4EUFA 4JBIA 4II3A 3ZZNA 3VPHA 1XG5A 4B3JA 5GZ6A 2X5OA 1EQUA 4BQPA 4KTVE 3RKRA 5KKCA 1GY8A 2D1YA 3QRWA 5G0SA 2O4CA 3D4PA 5DF1A 3TPCA 2OP0A 2Q2VA 2Q1TA 3RJ5A 1E1MA 3O4RA 2YV1A 3OETA 1ZIDA 4OO3A 3ONDA 2NVUB 1BHSA 5GZ1A 3E9MA 2DQ4A 4IDGA 1UH5A 5BSGA 2BD0A 1RWBA 1VSUA 1IHYA 1NR7A 3DOOA 4PFJA 3JQ9C 1ONOA 1YL6A 4E2WA 2QQ5A 4YT4A 2PK3A 4RJTA 3GPIA 3SJ7A 4LRSB 5JO9A 3B1FA 5TRTA 4JGBA 1C14A 1PJTA 1ADGA 3PQFA 5JMWA 1EUZA 4K9DA 3ORFA 3WNQA 4DIFA 5A5EA 1GUYA 4PLYA 2Q99A 4NBTA 2X9NA 4CLHA 3I4CA 5I8ZA 1BXZA 1A27A 3IDSA 2PR2A 4E33A 3ZWAA 2AEFA 5I9MA 2GNAA 2J3HA 1MFZA 1KEVA 3AOGA 3D1LA 5JCJA 1AXEA 5I7FA 3G1TA 3GNQA 3JQ7B 4FGSA 3OQBA 1ZK2A 2EG9A 1Q1NA 3M1LA 2GZ1A 1E1NA 3HFGA 5H81A 1SC6A 4U0KA 3NTOA 4U6SA 3EZLA 3C3XA 3LYLA 1U2GA 3O38A 2AQ8A 1VL8A 3GRKA 3RUCA 3ZHYA 1P1IA 2UYYA 2C82A 3AWDA 1X14A 3D0OA 4A26A 5T67A 2WTBA 5CEFA 3NJ4A 2FPIA 5DOZA 4ZQBA 3GUYA 4DC1A 1XEAA 3PEFA 1YQXA 5I7VA 2PTGA 4N5LA 4TSKA 4FJ1A 1K89A 2RAFA 1SOVA 2UV8A 2UVDA 4H15A 4YACA 4Z9XA 1Y1PA 4MVJH 1LNQA 2CVQA 1K6XA 3KSDO 2NSDA 2PY6A 3RUEA 3OF2A 3P5SA 2OBNA 3I9OA 4YTEA 3KHUA 3JQ9A 3RUIA 1PS8A 1CEQA 4LVUA 3W8FA 3WIEA 4CL3A 5C7LO 1Y81A 3G0OA 1BTOA 3I9MA 4IBOA 4M1QA 1LDNA 4BKQA 4FB5A 3SC4A 3KEQA 5I8WA 3LLVA 1JVSA 5F21A 1GQQA 1DRUA 4PRKA 4FQ8A 3SVTA 4A0SA 2YFQA 4RLHA 1HYEA 3U4CA 3VH3A 3AW9A 3KLPX 3DZGA 3GEMA 1LBEA 2NV6A 4OIMA 1NFRA 5A3VA 1YBMA 4CMGA 4OAQA 3WBBA 1P77A 4CR7A 2HDHA 3KSZO 4HX5A 4B7XA 1YOVA 4KUGA 1CQIA 1JWBB 1XR3A 2DBRA 4IXTA 3LSYA 1XA0A 1P1RA 1ZH8A 1I24A 5JAZA 1X1EA 1KETA 1ZJZA 7ADHA 1C0IA 4RF5A 4XR9A 1UP7A 1NVTA 2AMFA 3TZQA 4CV2A 4CODB 1OFGA 5ICSA 4E31A 4K28A 3WGOA 1D1TA 5DCWA 4KTTE 2RHRA 3HDYA 4HADA 5IXSA 2X22A 1IY8A 4EUEA 3NGLA 1Q0HA 4BNXA 1OC2A 2FMUA 5JAIA 5EESA 4KMSA 5F1KA 1ISHA 1PQWA 5JC8A 1NWCA 1Q0QA 5L7WA 2VHWA 1I2BA 3ANNA 4CV0A 3JYNA 1UUFA 1I2CA 5G0VA 1YRLA 3CINA 4GMGA 1D3AA 2LDBA 4C7KA 2P9CA 3GN2A 3NT5A 1PS9A 2GD1O 1IL0A 2D8AA 3FNHA 1LDBA 4XCVA 3WFIA 1OAAA 4YAGA 3KLMX 1IZ9A 3DFZA 2XPCA 2X4GA 1NASA 3GY0A 1N7HA 3DMTC 2A94A 4ZU3A 4MJLA 2Z1NA 2Q2WA 4ZA2A 2CY0A 2VN8A 1R16A 3H7AA 2Y1OA 4RQTA 4WCFB 3U4HA 2JD0A 4NR0A 4PIVA 5A9RA 3MWEB 2CF6A 3PPIA 2ZB8A 2Q1SA 1E3WB 1ADCA 1E77A 1G6KA 5JAMA 4XIYA 4EJ0A 4G81A 3QVWA 4E2ZA 2EKPA 5KIAA 2NACA 2NLOA 2BFPA 3I23A 4HFMA 1R37A 2BRUA 1HE2A 3TWOA 2P9GA 4M55A 1G0OA 5JXWA 2RIRA 2BELA 1F06A 2D2IA 4E12A 3GC6A 3JQAD 4J16A 1EVIA 2O48X 2AEJA 2NU6A 1PJSA 4QO7A 4J4TA 4W4TA 3KETA 2WE7A 1VPDA 4TVBA 1P1HA 1PL6A 1XHLA 2ZATA 2I65A 1E6EA 1GV1A 2O2YA 1QYVA 4Z3KA 2BFMA 4JP2A 5FFFA 4CLRA 4AJ4A 2CVZA 1VL0A 3O8QA 4CMEC 1HEUA 1YXMA 5TX7A 3DZKA 3RC9A 1JN0A 1C3VA 2GN6A 2Q3EA 3SEFA 3T7EA 3A28A 2ZTMA 4WEOA 4CM4B 1YBAA 3P7MA 2GUGA 2G17A 4J4HA 1K2WA 2G1UA 3UXYA 4D0RA 4RDHA 4DIBA 2ZTVA 4IJUA 1QORA 4YB8A 3EDMA 1P3DA 2B35A 1ENZA 3INGA 5T6BA 3IS3A 3UOGA 2Q49A 1BMDA 1OC4A 2CSUA 2Q50A 1JKFA 3DONA 3PZRA 2V65A 5IDXA 2TMDA 4ZICA 3H8VA 4BNZA 2AW5A 1EK6A 1YDWA 5JY6A 5BQFA 4FPXA 5ICMA 4YQZA 2HK8A 1BSVA 2FOIA 2E6UX 2GLXA 3K31A 4RORA 5L4NA 4P38A 4R3WA 1IE3A 4RPLA 5JLAA 3RFXA 2CMDA 3BHJA 3EK2A 3JQFA 2Q45A 3AUUA 4GQAA 4BNIA 1WZEA 3QVTA 4IS3A 3NGXA 1H9AA 5B4VA 2JAHA 4NFHA 2CUKA 2E4AA 2PZKA 4PVCA 4DYVA 2NADA 4AJEA 4JBHA 1NM5A 4EYEA 2H63A 1JWAB 2QW8A 5DT9A 3F3SA 4Z0PA 1QG6A 3H5RA 3DAFA 4BMVA 1M6WA 4G65A 1ZFNA 1IULA 1QKIA 3RUAA 2E48A 2Y1GA 3LT4A 5IFLA 3WGQA 3GG2A 4CM4A 3DQPA 3ETGA 4YT2A 3CKYA 3LC1O 4S1VA 4UEJA 3TZ6A 1DHTA 3ADOA 5IN5A 4RO0A 4L9RA 4OXNA 4RZIA 4PZEA 2EF1A 3BMOA 5T57A 3RFTA 2VHXA 4PZDA 3L77A 2Q4BA 1F12A 4WLUA 4QXMA 4BKOA 2X1HA 4HFJA 4RL6A 1DPGA 1CYDA 1LJ8A 2P91A 4FC7A 4NFSA 5THQA 1GAEO 4QECA 5IAAA 4DMMA 1W6UA 1ENPA 1CRWG 3F1KA 4JN6B 4XGIA 4E13A 4EGFA 1J0XO 4XD2A 4BO7A 3TFOA 1C0PA 4F6CA 3ROQA 3IUSA 3RU7A 2BKAA 2HJRA 2PH5A 4GBJA 3GVPA 1LSSA 5TLSA 2X0IA 3NT4A 4P4GA 1S6YA 4AL4A 4B4OA 2VHVA 1P45A 3CZRA 3I4FA 3AOEC 1IYZA 2JFHA 3PHHA 5TJHA 3GRPA 1TI7A 2WM3A 3RI3A 4D79A 4O0LA 2ZQYA 1QYXA 3WR5A 4FFOA 3DHNA 4MPDA 2YV2A 4D0SA 3MJTA 3VZPA 3HFSA 2GPTA 1JQBA 2X23A 4IDEA 3QW2A 4MP6A 1FDSA 3HUDA 3ZU5A 4J3FA 3IAHA 2VT3A 3INRA 1FF9A 2DM6A 3C24A 3JCZA 1GDHA 3MTGA 1I2ZA 3IJRA 2DPGA 1ZSVA 2VT2A 5G4LA 2XAAA 1H6DA 3MJVA 1SZJG 5IDQA 1R0KA 4YA6A 5C5IA 1YGYA 1A72A 4RVGA 3H2SA 3K2EA 1W8DA 2WMDA 3H5NA 3H9EO 4AICA 4FFPA 3U62A 2ZTLA 1RM3A 2C29D 1HSOA 4R1NA 4UAGA 5U9CA 2YZ7A 3I83A 3WGYA 4JP3A 1YDEA 1DLJA 3UHAA 2BI8A 5IN4A 5CHEA 3RSHA 1QYWA 4IXWA 1HF3A 5COAA 3MZ0A 3H5AA 1KS9A 3HNPA 3D3WB 4ILKA 4BNMA 3IIEA 4WLOA 1F8GA 4OKIA 5KCZA 1ZK0A 2ET6A 4MDHA 4QT0A 3BYZA 5DZSA 3QSGA 3EYWA 4RF3A 3GZNB 4BS9A 1V3TA 4B3HA 1K6IA 1ZXBA 2AG5A 2NVUA 2UDPA 5IG2A 4CMIB 4JROA 2GZ2A 3VPGA 1GPJA 1XWFA 2OGUA 1MXHA 3IQDB 2QRJA 2BGKA 3LLSA 4Z0TA 3WTBA 3DL2A 3E6AA 4BNUA 3BMQB 1NPTO 3BTOA 2G82A 2ZCUA 3WWYA 3K96A 1HDYA 3B1KA 1GQYA 2I6TA 1TT7A 1W0CA 4O5OA 2VRCD 4HBGA 4K26A 4NH4A 3X2FA 1ULUA 1HSZA 3O26A 3U4DA 2JHFA 1IB6A 2O3TA 1UZNA 4AJ1A 5DULA 2O50A 3DHYA 3ZI0A 4F45A 5ER9A 2A9FA 4ALJA 4W82A 1YJ8A 2C2XA 4L8VA 3RQSA 3DAPA 3WQQA 1KIFA 2B36A 2VZ8A 3PDUA 4AJOA 2B5WA 1VJ1A 3EGOA 1JTVA 4B8WA 3AY6A 4ZJUA 3U49A 1UDCA 3KOUA 2J8ZA 1MUUA 1Q7CA 2R6JA 4OXYA 1YQGA 4BOYA 1KEUA 1D1SA 3H2ZA 5IZCA 3I9KA 3SC6A 2GSDA 5F1PA 1YBVA 3ENNA 3GEGA 4EEZA 1FXSA 1SB8A 1M76A 3TRIA 1Z82A 1LLCA 4AJ2A 3OSUA 3KV3O 5CDGA 1B16A 4I5EA 4CMCA 4ND1A 3INTA 3LDHA 2DKNA 3BHIA 3MOIA 1AUPA 3BAZA 4M87A 3WMXA 4DLBA 4WLFA 4WCFA 3V2HA 3GDFA 3ITDA 4YJGA 4ZQEA 1LQTA 5LDHA 3D3EA 1DBVO 3IUPA 4PG4A 3UFXA 1Z45A 4E32A 4AVYA 1NPDA 5FI3A 2JD2A 4PLGA 2HJSA 2ZYGA 3AY7A 2B4TO 3L6OO 5K6AC 4CLDA 1B3BA 3S2GA 4YT5A 1I8TA 1J6UA 3QWBA 4E3ZA 3VAZA 3IKTA 3Q9UA 5U4QA 4XYGA 1S7CA 3VDRA 3ZH2A 2FR1A 1PGOA 1P9LA 2DAPA 4BL5A 1XU7A 4JJGA 1EE2A 4CMKA 5L95A 2BH9A 2FZEA 4JNKA 4IJVA 5CG1A 3OJ0A 1RJWA 4CM9D 4ALNA 3A06A 4Q39A 4HKTA 1DFHA 1UDAA 4Q3NA 5L4LA 3WLFA 2ZB4A 4BGUA 4L73A 2A35A 2PKRA 3ST7A 4PG6A 5I9LA 3UW3A 3LT1A 1QRRA 4CQLA 4M89A 3ZWXA 2BFAA 1ZMOA 3ETEA 3M2TA 1MG5A 3D4OA 1RM5A 1CF2O 4R51A 3ZU4A 4TRJA 1BW9B 3BMCA 4R68A 2HRZA 1DJNA 4L74A 2PKQP 4LGVA 5U1PA 4HY3A 4UUPA 1YB1A 1E3WA 1U3TA 1B7GO 3K92A 1RPNA 3W6UA 2ZYAA 4PG7A 2NWQA 1ULSA 1E7RA 4GL4A 1T26A 2D5CA 4GVLA 1QSGA 4Q3BA 3G1UA 1DAPA 4TVOA 2D3TA 5TS3A 1DFIA 1WWKA 2Y1EA 2VUSA 3FWNA 1P33A 3RC7A 2W98A 3COSA 4E5PA 2FPPA 1JAXA 2DFVA 2I99A 1ONNA 2J3KA 3GH3A 4ND3A 4N5NA 3C8MA 4OOEA 2JJYA 2NVBA 2X8LA 3NJ8A 3WIDA 5A03A 4B3IA 1A9ZA 4CR8A 1LC0A 3KTDA 3PYLA 3QP9A 2YY7A 4I9NA 4WPGA 4TRNA 1Y9AA 3OM9A 2PZMA 3RUFA 5KVCA 4OL9A 3L4BA 1DEHA 5EN4A 3GFGA 1KVSA 4KQWA 3IL2A 1HTBA 2VWPA 1DC6A 3PGXA 5A3JA 4J4BA 5JE8A 4MVJI 1R4NB 4Q3CA 3I3OA 5TC4A 1TXGA 2W2LD 4NBWA 4CQMB 1PJ3A 3ZWNA 3CEAA 1GCOA 1NR1A 4J6FA 4LCJA 4E6PA 1E0DA 3ZHZA 2ZJ1A 3OH8A 4GX2A 3TDKA 4XQEA 3JTMA 1KOLA 3ZU2A 1JVBA 3ROKA 3WQRA 5JDIC 3WNVA 1LUAA 3D7LA 3WGIA 1TT5B 2YW9A 4HFNA 3L0DA 2RCYA 3O03A 4E30A 4PN3A 3VZQA 4A2CA 3OJLA 3PGJA 1EDZA 2PLAA 1ZW1A 3GFBA 5DP1A 3JD2A 4YWJA 2VRBA 3D4NA 4BUCA 4CMIA 4HV4A 2WYVA 3R6DA 4J91A 2DTXA 4FN4A 4FJ0A 2I9PA 1EQ2A 3WDSA 3C7DB 2POQX 3DO5A 4IQGA 1O89A 4R5MA 1FDUA 1LQUA 3FF4A 4OHUA 4W7IA 3SX2A 3VZRA 4MVJA 3KYDB 5JSFA 2NUAA 3WGZA 5A9SA 4IY1A 1YH3A 1UR5A 3C7AA 4BHTA 2D4AA 1SAYA 4DUPA 2P68A 4H7PA 4DXHA 5KNLA 2FRDA 1KVRA 3E48A 3F1LA 3Q2IA 1P74A 4R54A 4DGSA 1B2LA 1B26A 1NHGA 2DTEA 2P4HX 3VHRA 3JQDA 5IDYA 2V7PA 5DBFA 3CIFA 2DBVO 3K2BA 4BGIA 4J1NA 2SCUA 1A71A 4DVJA 3TJRA 4OGWA 4ZN6A 4KDEA 2Z5LA 4B7UA 1U3WA 2JCYA 4J1TA 1N7GA 1ZSYA 2AEMA 4J90A 2NU7A 4IDBA 4R9SA 3DZBA 4CLEA 3IOYA 4JIGA 4BNGA 4DRYA 4GKVA 3FNFA 4AG3A 4DIOA 4E4YA 1NXQA 3V2UA 4XRGA 1GZ4A 1NVMB 3AUAA 2I3GA 3DZIA 4MVJD 3GGPA 3ANMA 1NQTA 4GGPA 3PHGA 3WTCA 1X7DA 3KYBA 1PX0A 4AJKA 3PJFA 2HCTA 5MDHA 3NT2A 3OQ6A 2ZB7A 3C1AA 2B37A 5CDSA 1RM4A 1Z7EA 4G2NA 4Z0HO 1MA0A 4A27A 5TT0A 3RBXA 5MGBA 5JC1A 3BXXA 5AXBA 3K8ZA 4NQZA 2C20A 3PWKA 2JFGA 4D45A 4PLHA 1PU2A 2E37A 3DBVO 4MINA 4XA8A 3PHLA 1T24A 1EFKA 3MOGA 3IP1A 5GY7A 3GOHA 5T8KC 4AJIA 1EZ4A 5ES3A 4OH1A 1HDGO 5DP2A 3TZCA 4R16A 1PTJA 1XELA 2XOXA 5TSDA 1J4AA 1B14A 4DTIA 2YDYA 1K3TA 1Q7GA 2X86A 3KYCA 4D3SA 4WOKA 2OFPA 3FSRA 5EIOA 2F00A 1R4NA 1XDWA 1DRWA 1H6BA 4JCOA 1U5CA 1UXIA 2IODA 1YKFA 3BMCB 4Y6PA 5AVOA 4BNJA 1GADO 2O3SA 4GWKA 3L07A 1WXDA 5BR7A 5KKAA 3JQFC 2GERA 3GAFA 4EW6A 5COQA 1QV7A 2FP4A 3PI7A 2PGDA 1GPDG 4D42A 2ZCVA 5K6AA 1YL7A 2VYND 1ISIA 4PLCA 3HADA 3V2GA 4AJHA 2C5AA 2X0NA 4DBVO 2B83A 3QVSA 3JQAA 4OYRA 1HDCA 2HRBA 3EZYA 4FJ2A 4YYZA 4XX0A 1Z75A 3EAGA 2JD1A 2GASA 1NQ5A 2HSDA 4TQGA 1T25A 2YHUA 4YAKA 1LA2A 3Q2KA 2YHIB 2J5RA 4BKUA 1KEWA 3A9WA 2B4QA 3PIIA 2C0CA 1H2HA 4WLVA 4RPJA 3MTJA 4FOOA 5LCXA 3D64A 3ZNNA 2G76A 4M86A 4TZTA 4KUHA 3GGOA 3FNGA 5DDIP 1H9BA 1U3UA 4JXKA 3STHA 3FCOA 3GEDA 4YJFB 3ZWYA 2VHZA 3EMKA 1NHWA 3SBOA 4ZVVA 1TA4A 4TRMA 1ZEJA 2HUNA 4FS3A 1LDYA 2OMEA 1VL6A 2W2LA 1JDJA 2EP5A 1R4MB 1JKJA 5CEEA 3GVIA 1M75A 5DNAA 4GX5A 4YAEA 2PD6A 2O23A 4ALLA 4U0JA 2YFHA 3GMSA 4R3NA 4HNHA 4JQCA 1RYEA 1LLUA 1DDOA 3AOEA 4EJ6A 2EERA 4WLEA 1NNUA 3AFNA 2VTDA 2GN8A 3IKVA 4S3MA 1E1KA 1IZ0A 1GEGA 2BHLA 2IEDA 2VUUA 1U1IA 5K9ZA 1SEVA 2QYSA 1SMKA 1HE3A 2BGLA 3UUWA 1ML3A 2NTJA 4IIUA 1ZK3A 1T2AA 2O3UA 2RBEA 5AXAA 2Y05A 1CIVA 1HDZA 4BNLA 2PGLA 2C07A 4NJMA 2FWMX 3OIDA 1HWYA 1I3LA 3EVTA 2BMAA 1N9GB 4BB5A 2OORA 3W4JA 1V3UA 1R0LA 1BXKA 1IUKA 4LW8A 4W9NC 2AG8A 2XXBA 2EJWA 4XDZA 1Y8RB 2BFOA 1PQUA 5DN9A 2H9IA 4YQYA 4UVEA 3K5PA 4HUJA 4U5QA 4BKPA 3GZNA 1Y7TA 1KEPA 5KTKA 4J1QA 5FF9A 1PR3A 1R15A 3L6DA 3H3FA 4D44A 4Y8VA 1QYDA 2BI7A 1PGNA 3GVXA 3WGHA 2IEBA 1PWZA 1GYPA 2JAPA 4RZHA 1Q7BA 1T2FA 3NEPX 1P1FA 1VC2A 3GUCA 4I1IA 3GNSA 1Q2XA 2VZ0A 2B5VA 1E5QA 4IIVA 3HDHA 3NKLA 4LSMA 2EW2A 4R5HA 4CQLB 3AK4A 5A4DA 2GYYA 4JJIA 3AUSA 3SJUA 4AJLA 5HRUA 2OXIA 4BNYA 2CDAA 4PG8A 4NBUA 4L75A 4I5GA 1HDXA 2FR0A 4CLRB 4ALKA 4CV1A 4QEDA 2C2YA 4INAA 1DRVA 2D59A 3HG7A 3P2YA 1U7TA 1CJCA 2WSBA 3Q1LA 1WVGA 4MOWA 1PL7A 4ND4A 3RU9A 5A9SB 1VRWA 1XLTA 4CM8B 4ID9A 1EEHA 1PZFA 1XQ6A 1Z7BA 3M2PA 1GEEA 2AHRA 1JU9A 4TKLA 4U6QA 1E5LA 1WMAA 4YJHB 5FYDA 3VH4A 4GLOA 3I9JA 4E21A 5C7IO 5KVSA 5BSHA 2TMGA 1U7HA 4QO8A 3GQVA 2F1KA 3E18A 1ENOA 4L4RA 1GYRA 3WGGA 4CM5A 4P4LA 2ZQZA 2OUIA 3HE3A 2OP1A 3BTUA 2BGMA 1VSVA 2PWZA 4B79A 4EDFA 2Y0EA 1A7KA 1HKUA 4NK5A 4BO8A 4CR6A 5BSFA 1SEPA 4I5DA 1RM0A 4DMLA 5AXCA 3F47A 4Z9YA 3DDNA 1MG0A 1X0XA 2V6MA 1DIHA 3LZ6A 4UULA 1OMOA 4U8GA 1LRKA 4WCFC 5G0WA 2ZIZA 5B1YA 3ETDA 1WDLA 2WD8A 3T4XA 4ROSA 3Q3CA 1E6UA 1ZXLA 4RLSA 4EUHA 5JBIA 3WS7A 2HKIA 1VM6A 1D7OA 1YJQA 3B1JA 1Y8QB 5IJZA 4XYLA 2OBYA 2VOEA 3WLEA 2X9GA 4DBZA 3LVFO 4FFMA 2FPGA 3UCXA 1TEHA 4J0FA 5L3ZA 1FDWA 5HTOA 1U3VA 2OL4A 4IMRA 3G79A 4OQYA 3ENKA 4YJDA 1I36A 1GYQA 3HB4X 4FSHA 4ALIA 1Z74A 4YJFA 3JQ8B 1IOLA 1MFPA 5L9AA 4RPGA 3BTSA 4PLVA 4CMJA 1ISGA 4J9UE 5FEUA 4CMEA 3PRJA 2W2KB 1OBFO 2I5PO 3PWSA 3WG9A 3I9LA 4PLZA 1Y9EA 2GO1A 3SXPA 1ID1A 1DO8A 3TZKA 4R1SA 4ZRMA 3U0BA 5L40A 2Q1UA 4J2HA 1H0KA 4CJXA 5K0ZA 1N1EA 1QLHA 3JQBC 3MCVA 1LLQA 4K1LA 2X7HA 3CUKA 2NQ8A 3JQ8A 1X7GA 1WZIA 4G5HA 3V5NA 4MVJE 1HZJA 3VOSA 4KOAA 3PK0A 5KWEA 2EGHA 1KVTA 2GZ3A 1I32A 3R3SA 1SCUA 1TLTA 1L7DA 5CG2A 1UZMA 4IQ0A 4YRDA 3O9ZA 3ZWBA 2JCVA 3OBBA 3QVXA 1TVEA 1LRLA 4RPKA 2HMUA 1VE9A 3JQGB 5JDIA 1GFSA 3UCEA 3ZV5A 1DSSG 4TZKA 3LC7O 3QWIA 2EP7A 4LISA 2DU8A 3JQCA 4I8XA 5G0UA 2CZCA 4Y9DA 3RC2A 5HM8A 3GPDG 1IPFA 3H65A 2PKQO 3AI1A 1NX6A 1GD1O 3BMOB 3WMWA 4BQRA 1LC3A 1MC4A 5ITVA 1PJQA 1DXYA 3G17A 4X54A 4FR5A 4DREA 3IC5A 1YOVB 2YJZA 1CERA 1R66A 2HO5A 2JFFA 2X58A 4XYEA 4CMAA 4DYDA 4FW8A 5A5FA 1GR0A 4KWIA 1NAIA 1O8CA 5BSEA 1N1GA 3R1IA 2PV7A 4ONEA 1HZZA 2NVWA 2VNSA 2Q46A 2EW8A 1N92A 1KYQA 2D0IA 2QRKA 2Q2QA 1PGJA 2Y67A 4L4SA 5JO0A 1I0ZA 4F3YA 1DIGA 4KQXA 3KBOA 3G49A 2DPHA 1U5AA 1DC5A 3LF2A 4K6CA 3HHPA 4J0EA 5ENDA 2J5KA 5BNTA 3QJ5A 3RBVA 3I6IA 1MP0A 4J7UA 2O3QA 3PJDA 1I01A 4QSMA 4QTZA 1I30A 3GVCA 1AE1A 4EI2A 1DJQA 5CFZA 1PR9A 1ZSNA 2EIHA 1QYCA 3PDJA 4QUKA 4A5OA 2AA3A 1PZEA 1V6AA 3RVDA 4NJMB 4R01A 5F5NA 4OXKA 2E49A 2AQKA 2GF2A 7MDHA 2YUTA 4Y6SA 1ISFA 2UUOA 3ZHXA 4YAIA 2X0JA 3PHIA 3A4VA 3JQAB 5DBIA 4YT8A 3ROPA 3GDOA 3VH1A 1K0UA 3ICCA 1GCUA 4XQGA 1HXHA 1UXGA 3S55A 6ADHA 4BNKA 2IZZA 4P4NA 1O95A 1ZCJA 3EC7A 1E1LA 4MIYA 1LTHR 2H1SA 3Q0EA 3ON5A 3RJ9A 2W90A 4DA9A 4DQVA 2PD3A 1VKNA 4AJNA 4CQMD 1T2DA 1WMBA 5CAEA 5TF4A 5KJCA 3ASVA 3K30A 2UUPA 2CDBA 1NFQA 5TT1A 4II2A 4XQ9A 2J3JA 3NDRA 4RF2A 4OSOA 5JCXA 3NDJA 1LI4A 3GMDA 3ITKA 3VTZA 3NAQA 1P1KA 1HYGA 2QYTA 4B8ZA 1QP8A 2P2SA 4MKRA 4YJGB 2ZYDA 2W8ZA 4ZQGA 2DTDA 3KO8A 4RPHA 1UXHA 4QX6A 2OOSA 3PVZA 1DIRA 2Z95A 5B37A 3LT0A 2P4QA 3RD5A 4ITUA 4XJSA 2DLDA 4EZBA 1U8XX 2GRAA 3GHYA 4QFCA 1E6WA 3TOXA 1ISMA 3HJAA 2Y1FA 4MP3A 1M66A 4YRAA 3QHAA 4LMPA 5KJ6A 5EQDA 1BRMA 3PQDA 3WX0A 4LRTB 1SNYA 2QZ9A 2X9VA 4KP7A 1EBUA 3C1TA 5JFOA 1NPYA 4FDAA 2X0RA 3TZHA 1FMCA 1LRJA 5TQVA 3DZJA 1ZK1A 5KVQA 4BNWA 1P0FA 3V1TC 3N74A 4IQ8A 5ILGA 1KY5A 3PFFA 4XJTA 5I9NA 3I52A 1AHIA 1HE4A 4N7RA 4OQZA 4CM9A 2AE2A 3OEWA 4GX1A 3GR6A 4R4JA 3KXDA 5AOVA 1C1XB 1EVJA 4IJWA 1Q0LA 2YDXA 3GNTA 4M49A 3A1NA 4XGKA 5JMPA 2H5LA 5KJEA 5L7YA 4BV8A 4Q9NA 1UZLA 1HLDA 2VWQA 3LU1A 3JSAA 4GSKA 3AM3A 3AM4A 2JL1A 4NU6A 5IDWA 4UUOA 4FBGA 3BMNB 1PZHA 3MJSA 1VKOA 1CQJA 5A1TA 1M67A 1I10A 1AN9A 3H9JA 3KZVA 1Y8RA 1H6CA 2Y0DA 3H9GA 4IGEA 3WOHA 4GVXA 4C7JA 3OJOA 4NK4A 1E7WA 3D3WA 1GUZA 1JKIA 3U9LA 4MO2A 5J23A 4JK3A 2H6EA 4DQUA 3E5RA 3W6ZA 4Z6KA 3DC2A 4WCDA 1A4IA 3VPXA 4D3DA 3GZ4A 4BGEA 4ESOA 1DIAA 3ZV3A 1ADBA 3DFUA 3OA2A 1EBFA 2QG4A 1GTMA 3NRCA 4M54A 1E3EA 1PJBA 3RBZA 2PZLA 3QWHA 1W73A 1XCBA 4J49A 3UF0A 1C1XA 2ZJ0A 1L7EA 3OJEA 3CXRA 5IZ4A 3CTMA 4CL8A 3UICA 2C54A 2QRLA 5L7TA 1F0YA 2IDZA 2CVOA 3HQ4O 3I9NA 4AJJA 1DC3A 3LT2A 3UGKA 3W4KA 5L53A 1LLDA 1N5DA 2PH3A 3OQ1A 1D8AA 1KBZA 3ZWVA 3QLJA 4A73A 4HFRA 1J5PA 4WJZA 2W4QA 1A7AA 1G0NA 2DBZA 2HK9A 4PLPA 2JHGA 4I5FA 4RVUA 5ITWA 3I5MA 1K5HA 1BGVA 3CPSA 4ZQHA 1LSJA 2DFDA 2VYVA 1N8KA 3ZNQA 1YVEI 3KVOA 2DVMA 4FCCA 1PJ2A 5CP8A 2IYPA 3WFJA 1PZGA 3OECA 2VYNA 1LXCA 3PZBA 4RDIA 3D5TA 4IMPA 2BF7A 3RWBA 1TT5A 1M2WA 4CMBA 4B4WA 2JCXA 3LQFA 3DZFA 3QV1A 2CDCA 1WPQA 4KWHA 4J9VA 1NQOA 3C85A 5G4KB 3VPFA 3S2IA 3PWZA 4D46A 3VH2A 1ZBQA 1XU9A 3DB2A 6LDHA 4MP8A 4YXFA 3ZU3A 4IZHA 3N58A 3PIDA 1ZUD1 4HWKA 2IXBA 1HE5A 3ZDFA 2EKQA 4UVGA 4RV9A 2V6BA 5T5QA 4XGNA 1HETA 3AI2A 3KB6A 1U28A 5EJ2A 1VLLA 4M8SA 5DCUA 4BO3A 1PJCA 2IZ1A 3GGGA 1I33A 4Y98A 3DBHB 1NTOA 1LEHA 1AGNA 3GN1A 1T1RA 4ND5A 5EINA 2HMVA 1E7SA 3PQEA 3DMTA 3BHMA 1SB9A 2G5CA 3U4IA 4BV9A 3WBFA 3VDQA 3RKUA 3S2EA 5I7SA 4BNFA 4CUJA 5GZ3A 5JDCA 1T4BA 2P5UA 4IDDA 1ZKMA 2P9EA 5ER6A 3CMCO 1OI7A 5G2OA 1NYTA 4YR9A 4PLFA 2CFCA 2HMTA 3DAGA 3ONEA 1YQDA 2RH4A 2J5QA 8LDHA 4XR4A 4XQCA 4I9HA 5EERA 4BGVA 4YDRA 1ZEMA 3FRJA 3ABIA 1W4ZA 3RUHA 2O4UX 1VI2A 3KSUA 4CLXA 4GSLA 1ZZEA 3DMYA 2VCYA 1YB4A 3GDGA 4YCAA 3BA1A 5ILOA 2R2GA 4XWYA 2WDZA 4K6FA 4N54A 2HLPA 1E92A 1YE3A 4DC0A 4YRBA 1ENYA 2PZJA 3JYQA 5A04A 1V0JA 2WYWA 4J7XA 1C1DB 4N18A 2PA3A 4WK6A 4FOSA 3FTNA 4O59O 2C5EA 1PEDA 1ZNQO 3V1UA 3SLKA 2A92A 2FN7A 1MGOA 1F8FA 1Y8QA 3NTRA 3NYWA 3ZW8A 4MKZA 1Y6JA 3DBLA 1BWSA 2I3AA 5COBA 1HT0A 3B70A 1EMDA 3AU8A 2GN4A 4XYMA 3W1VA 5IF3A 5CDYA 3F9IA 3JQEA 5A05A 3WQSB 2ZTUA 4JBGA 4BMNA 3DBRA 3L9XA 5CPFA 3V8BA 3WB9A 1PJLA 3PXXA 1PQPA 1DIBA 1WDMA 5L51A 3HDQA 1ZK4A 3S2FA 3ROMA 5ENVA 3IMFA 3BMQA 5I7EA 4I08A 4EJMA 3ZWMA 2VTEA 3ASUA 3JD0A 3U5TA 2P5YA 3ONFA 3AFMA 5CDUA 1LDGA 3V1YA 3OJFA 3MEQA 4YAJA 2NU8A 2CD9A 4AFNA 4BIIA 3HZZA 4E2XA 3GHHA 4IZIA 2B0JA 1KC1A 3OMLA 2DT5A 1UP4A 3I6QA 2EHDA 3QWAA 2IZ0A 3RAJA 4URFA 3TL3A 1A4UA 3RCBA 2GDZA 5B4UA 5C7OO 1D4FA 2YHIA 3QIVA 4NFYA 5HBRA 2W2KA 5F1OA 4DPMA 2IXAA 4YBZA 3RASA 3NTQA 3CMMA 5KJFA 4UVIA 1I3KA 3FN4A 4YPOA 4OKNA 1JA9A 2HMSA 4CLOB 4WE3A 1UJMA 2CNBA 2WE8A 3W4IA 1O0SA 3M6IA 1XGKA 3PYMA 2Y93A 1OOEA 1QV6A 4RCVA 3VKUA 4UVHA 4GLLA 3OIFA 1BVUA 1P31A 1KC3A 4W99A 4PVDA 1SBYA 3GAZA 3U3XA 4DPLA 3B6ZA 1EUCA 3DTYA 5AYVA 3FD8A 3K6JA 3CZMA 3UAGA 4CUKA 2NQTA 3AJRA 4Q3DA 4YVFA 4A7PA 4CV3A 1EUDA 3KRTA 2VZ9A 1YWGO 5DBGA 5AQ1A 5BNIA 1PGPA 5T64A 3DWFA 2ZB3A 4KDFA 3H3JA 4CLOA 2Y1DA 3KM0A 3OEYA 4J2OA 1BXGB 4WEQA 1BDBA 2VWHA 1YS4A 4WECA 1WW8A 2VNAA 1XQ1A 5HA5A 3FPLA 3EW7A 1I3MA 1PGQA 4TROA 4NPCA 3TSCA 5L4SA 4O63O 4Z9FA 4PGFA 4GGOA 1QMGA 2GGSA 3JQ6A 4BO1A 4DPKA 1GUFA 2EEZA 3K73O 5L45A 4CM1A 1V9LA 4R1TA 5TGDA 2B4RO 1A5ZA 3FHLA 4NDNE 4UEOA 3VC7A 4B4VA 1GL3A 2V6GA 4BO9A 5TJ9A 1EVYA 5TNXA 3F6YA 1BXGA 1WLYA 1ADFA 1RYDA 3LF1A 5H82A 1TB4A 5DCYA 3FTPA 2EJVA 5THKA 4CUZA 5JNLA 1X1TA 4MVJF 3ZWPA 3GG9A 4PLTA 4KUEA 1MXFA 3EVNA 4BB6A 1O6ZA 3L4BC 1B3RA 2C7VA 4KZPA 4FGWA 1UAGA 3H6KA 3SLGA 1VJ0A 1E7QA 4OMUA 4E5NA 2I76A 4OM8A 5FWNA 1J49A 3I1JA 1H93A 4O1MA 2GR9A 4NHEA 4H3VA 4PZCA 3WYBA 1ZO8A 1O5IA 2VRCA 3JQGA 3ZNOA 3MJEA 5CPBA 3E5MA 3C1OA 1PWXA 3F46A 1O94A 2NU9A 4LMRA 3RIHA 3AI3A 3KYCB 4H16A 3OICA 1QXSA 4NI5A 4O6VA 5LDGA 2Z1MA 1FDTA 4ALMA 4EITA 5JDCC 1C0LA 3C7CB 1EFLA 5G0TA 5F3RA 3KYDA 2V6FA 3FBTA 3G3EA 2ZKLA 4P22A 2AXQA 2O2SA 4TRRA 3CSDA 4B4UA 1FK8A 4FD3A 3PFWO 1C1DA 1PIWA 2DUWA 1B0AA 3UCFA 5H83A 4BO2A 2AE1A 3TFQA 1DOHA 3E03A 1XKQA 3DOJA 1HLPA 2DBQA 5B4TA 4MIOA 4XIJA 5TIIA 3F5SA 5LC1A 4Q3AA 3WSVA 5CDTA 4BNNA 5BT9A 1I3NA 4IDFA 4GKBA 1GV0A 3DHEA 3PP8A 2NTNA 2IYOA 2FSSA 3JYLA 1NBOA 3NX4A 1R12A 3PYXA 4BO4A 8ADHA 4GPD1 1CWUA 1B8VA 1N9GA 5ADHA 1DLIA 1GZ3A 4P8RA 4BVAA 1BW9A 1U8FO 4EEXA 1ZMTA 4WUVA 3ZHBA 4R1UA 3VKVA 3FR7A 3ZN2A 4CMHA 2QX7A 5JY1A 3GA0A 3Q6IA 4NBRA 9LDBA 3ICPA 1MLDA 3ZCXA 1DHRA 1HRDA 1UXJA 1RKXA 2R00A 1XSEA 1HDOA 1Z73A 2FSVA 5HWSA 1K6JA 3Q11A 4C4OA 4MKXA 3QWFA 3R3JA 4OJNA 2NTVA 3E82A 3HN7A 4ZRNA 2PFGA 4RVHA 2O3RA 1AHHA 3ZNPA 1ISJA 1HYHA 2WEKA 2VOJA 1Y5RA 1A9YA 1HL3A 3HN2A 5C37A 1B8PA 2E82A 1UAYA 1PS0A 1FJHA 3NV9A 4E0BA 1AXGA 5C3MA 3T4EA 5T8KA 3F4BA 4XRRA 1SPXA 3NDIA 1JAYA 3DZHA 4BKRA 5G4KA 1Y5MA 3GLQA 4JJFA 3ZV4A 2YQ5A 1V35A 3QA9A 4B7CA 3PTZA 3S1LA 3VZSA 2LDXA 1P44A 3PJGA 3EHEA 4IUYA 4MVJG 5EMHA 3VVCA 3NUGA 4IDAA 4BNHA 5IZCC 1R0SA 4GMFA 4U7WA 4XZ3A 4GAEA 3WSWA 1NVGA 3DR3A 4RVFA 5KOIA 3ZWOA 5JYEA 5A9TA 4RVDA 4YEDA 3PLRA 1P1JA 1MB4A 3W8EA 3UN1A 4HP8A 9LDTA 2GN9A 3PLNA 4IGFA 1E3IA 3HSKA 1E3JA 4IJKA 1U4OA 4UVDA 3DBRB 3L9WA 2Y1CA 4TKMA 5GMOA 1HDRA 1IHXA 3P19A 3E9QA 2Q1WA 1KERA 1BDMA 3ZWCA 5BNFA 5JS6A 3ZWWA 1GU7A 2Y68A 4LN1A 4UREA 4DQXA 3F5QA 4N5MA 1U9JA 4JX8A 1MC5A 2VHYA 3TF5A 4UUMA 3FR8A 2D5AA 3MJCA 1O9BA 1GZ6A 1KVQA 3QE3A 4F6LA 4HXYA 4UUNA 3OFSA 3DTTA 4GH5A 4E2YA 4UEKA 1NWHA 2C59A 2WD7A 4HNGA 2YYYA 1R4MA 1V3VA 4L4XA 4ZQFA 1FDVA 4A10A 3OA0A 3OP4A 4FFLA 1BVRA 1SO8A 3L4SO 2VWGA 2RH8A 3MWDB 4JLWA 4OOFA 3ZW9A 4R9RA 4D43A 2WWRA 3JV7A 4WGGA 3CE6A 3P2OA 3AY3A 2HAEA 3BTVA 4NG5A 4W6ZA 3RROA 1T4DA 1XYGA 4PLWA 3TL2A 3H4VA 4R41A 4D3FA 5JW6A 1YB5A 3PJEA 4D7AA 2XXJA 1E7YA 3KUXA 1NP3A 4PRLA 2O7QA 3KEOA 2A4KA 2FY8A 3JYOA 2EWMA 3F4LA 2FR8A 5KVVA 1PJ4A 1B15A 2DC1A 2HMWA 1CDOA 1ARZA 1SOWA 2UAGA 3FPCA 4FFNA 2J6IA 3AM5A 1JLLA 2NM0A 4XKJA 3FNEA 4IDCA 1NAHA 4BNVA 3QQPA 5FI5A 4CM6A 4XYBA 1EE9A 2EKLA 4ZGWA 4GI2A 4EBFA 4GX0A 3GT0A 4RGBA 4FC6A 2ILTA 4LK3A 3WXBA 2YV3A 3HWRA 3JQ7A 3L6EA 1ORRA 1DAOA 3BIOA 1MX3A 2PNFA 4DLAA 1DC4A 1L1FA 5A06A 4J1SA 1EVZA 3U09A 3WWZA 4DWVA 3TN7A 3VVBA 4J7CA 1I5RA 1DB3A 2AQIA 1LDMA 3ANLA 2Q4EA 1H5QA 1U4SA 3RFVA 2EXXA 2G0TA 2Y66A 3JQBA 3LK7A 3VTFA 1KVUA 1N2SA 3EY4A 2QIOA 1T2EA 4W9NA 1EK5A 4DLLA 3S8MA 2Y99A 1YL5A 4XB2A 1T2CA 2Y0CA 1C0KA 1NFFA 4WASA 5IXYA 4L0QA 3JD3A 5EPOA 4I9UA 3JD4A 4RF4A 3A14A 2VQ3A 5EL0A 3RC1A 1JW9B 1Z6ZA 1F14A 4WKGA 1OZAA 3K9QO 1EDOA 3GF4A 3ULKA 4BO0A 4Q3EA 4TMFA 5HS6A 2IRWA 4CM8A 1XIVA 4F46A 1PSDA 3DEYX 4MVJM 4WNCA 1V8BA 3BMNA 4LVCA 1X7HA 3D5QA 3FBGA 3MJ4A 4QFDA 3JD1A 2OO5A 4NIMA 4Z3DA 2VYVD 3OHSX 1LSUA 4RQUA 3AU9A 4IS2A 4BO5A 3DOCA 1LU9A 4XB1A 4XEHA 4FIZA 3N7UA 2B69A 4L76A 1CETA 1F17A 3H9UA 4BO6A 2JKVA 3QVOA 4ND2A 1LX6A 1UP6A 4CPDA 3AUTA 3VPSA 3FWZA 2OHXA 3WYCA 3ZGYA 3FI9A 1H2BA 2DUUA 4GWGA 1H94A 3DBHA 2GCGA 4Y67A 4NZ9A 4BMSA 3UH1A 4CM3A 1LSOA 2VUTA 4NMHA 3E8XA 2NNLD 5AXDA 3O8QB 2PGJA 1E3LA 4Y6RA 3WJ7A 1B8UA 2CF5A 4RVSA 3T7CA 3EUWA 4R69A 1X13A 2IE0A 1GQ2A 4IM7A 1U2DA 1BG6A 3GVHA 3B20A 4MIEA 4NJOA 1PL8A 2QHXA 4DL9A 3JYPA 3HB5X
chains in the Genus database with same CATH superfamily
2PD4A 4HB2A 3ZLTA 1KJJA 4MLDA 4F9TA 2Q9BA 2R00C 3EGVA 3FIUA 2O3JA 3LIIA 4LSWA 1N2CB 5EIHA 3WYEA 16PKA 3W8DA 4D81A 4F8YA 4E5YA 1J06A 1PLJA 3AYXB 4QWMA 4N47A 3T3IA 5EE5B 1ONPA 1OLXB 2N9UA 4WOJA 2TYSB 5EPUA 3FNRA 4HGRA 1KP9A 1ZJYA 3ZCPA 3BZUA 2QZZA 2WJAA 4Q1BA 4Y2YA 4CL2A 3BX1A 4HVTA 2YQ4A 3DXZA 3R9XA 5A02A 1GGNA 4CDNA 1TO6A 3TQHA 1QOPB 1G1AA 3EMDA 1UT5A 1E3SA 3AKYA 3HCPA 3H9QA 4YJHA 2XQKA 1UDBA 3JWIA 4IF4A 3Q8KA 1U1DA 1H6AA 2OVFA 1GGHA 2XJ4A 2ZRAA 3ADPA 2WB2A 1K8ZB 2WFLB 2C7BA 2FZWA 1LDEA 5B12A 1N33B 5K8CA 1USWA 2NZ8A 3OIGA 2WD7B 4BN4A 3AUKA 1WDKA 5JNTA 1WKVA 4PAQA 3MQFA 1HFKA 3TOZA 4LTNA 4LCEA 1SBTA 2C2HA 2C8JA 1GZVA 2GN2A 2HU2A 4OSPA 5BW8A 3PSHA 4KXYA 2R48A 5E0KB 1M5RA 1XTIA 3FXAA 4D3YA 4Y0VA 3DMNA 3IIMA 4YUXA 1SY7A 1XYVA 2BZGA 4MVJP 1SQGA 2VJNA 1VZ3A 3IQZA 2I4TA 2EV9A 4V0NA 2RK4A 4B40A 2TRSB 3DXFA 2BEVB 2X8JA 4Y1RA 2JLWA 4Y2TA 3L0PA 1PDWA 1QDUA 2XKBA 4WZBE 1CUVA 4X00A 3T7RA 1M6HA 3IJPA 5BYAA 1UJ5A 2O7SA 3NTLA 3Q3EA 1YO6A 4REMA 5JYDA 5KO2A 4FBMA 1J0CA 4I8DA 5BQOA 4HDNB 4W7HA 2ZSBA 4LA4A 3U6BA 3VR2A 3ZZNA 5I7OA 1ZG3A 1XG5A 2G1AA 1QCDA 1VG0B 1CVLA 3U39A 4HN2A 3AVOA 4M0LA 4B32A 3DV2A 2E1RA 3TRJA 2O4CA 3D4PA 2OP0A 4RBNA 3GU3A 3RJ5A 2HB6A 2GHIA 2AJDA 1JSXA 3OETA 5E1MA 2E4ZA 4EHJA 1I5EA 1PEAA 1UXOA 1S0UA 1CB0A 2ZAOA 3JAWA 3QLUC 1MO2A 2VP2A 2ZUCA 4O4LB 1K7FB 1P2DA 5BSGA 3JATA 2HYIC 5CVEA 3RWOA 1VL5A 2WNHA 3M9XA 1TA0A 3RR2A 2HSEA 5F78A 3WDMA 3SHFA 1ONOA 1YL6A 4GUAA 4TWZA 2HQBA 1IWOA 2RHBA 3ANYB 4GWLA 3DJFA 2O05A 4KNWA 2QQ5A 3IUQA 2CEAA 2QTGA 5LZ4A 4FI3C 4YY3B 3B3FA 3SJ7A 2WF5A 1TK3A 3VJRA 2IU6A 4WY8A 4V2IA 4P0QB 1KL7A 1TZKA 1EIZA 1EJ0A 5JPDA 2CLSA 1PJTA 1ADGA 1I1NA 1E18A 3PQFA 1F0KA 3SX0A 5JMWA 4U1RA 2QZPA 3CUEF 4L15A 1G2OA 3B85A 1ECFA 4FZ3A 1ZD2P 4WDQA 5CYFA 4B46A 3K70C 3C98A 1H4SA 3T7AA 4ZK2A 3VX3A 3M1IA 4LOLA 1Y6GA 5HKOA 3GLHB 4JEUA 4WUTA 4IVNA 2XBMA 5FTWA 3E22B 1D7AA 2JC3A 5DNCA 4ZI7B 1AXEA 3W7BA 5JEDA 2QAGC 1UPTA 3OQBA 1ZK2A 2EG9A 4LDJA 2J1LA 2A1UA 1M83A 5EKUA 4XIFA 5KOJA 3HFGA 3COZA 3IQIX 2XRMA 1PYDA 2Y1XA 4PX9A 4U0KA 4W8HA 4AUMA 1SA0A 3W06A 3BWDD 2XLCA 3C3XA 3LYLA 4BKMA 1U99A 1B0PA 3HACA 4G6ZA 2GB4A 2AQ8A 1VL8A 3GRKA 1NJGA 2HL6A 4P53A 3TRKA 2Q5FA 3L0SA 3A32A 1DRJA 2J87A 3AWDA 2VQEB 4X1OA 2O19A 2OLEA 3DMRA 1ATZA 3GUYA 3ORQA 4GBMA 4DC1A 5BV0A 1XEAA 1YQXA 5I7VA 5BN5B 2PTGA 3NALA 1NMXA 2C8LA 2GZRA 4GPZA 3H2YA 2UV8A 2GAJA 4GI5A 1ACLA 2UVDA 4WADA 4YACA 3PKZA 4WBNB 5TF0A 1NW5A 1X94A 1K6XA 3TH5A 2NSDA 2PY6A 4MULA 2CHUA 4P32A 4A36A 1NMQA 3FB1A 1FSFA 2YFYA 3X1KA 4YTEA 1EFTA 3CZPA 4U9IS 2YCLA 5C7LO 1Y81A 1BTOA 5M7EA 1LDNA 2WHQA 2IVFA 2IK8A 3SC4A 1Z0JA 1D03A 1GKUB 3LLVA 1AY0A 1OWPA 4PGAA 2GM3A 3U1VA 1UBJS 3ZR4B 3P2MA 2YFQA 1HYEA 2G4LA 2O7VA 4PSUA 3UMJA 2EL7A 3AW9A 5IC5A 2XITA 2B6NA 4FX5A 4LHEA 3EPJA 3GEMA 2NV6A 5DI3A 2CJFA 1P77A 3QFTA 1KJ8A 1QUFA 3K09C 4HX5A 4KRXA 4QDUA 1D9ZA 2DBRA 1WSAA 1GSIA 2ID7A 3LSYA 5E1OA 5GQSA 4CT5A 2PXHA 5D86A 4DIUA 1X1EA 2I0FA 3QLEA 4IP0A 3H9BA 4RF5A 3ROEA 3TZQA 1UP7A 5AM2A 3EPLA 3FOZA 5DNWA 2AR0A 4IDPA 1OFGA 2HT6A 3JASA 4E31A 4RULA 4C5CA 1JALA 1NRJB 4FWBA 5C1PA 2XVMA 2XYPA 4B2YA 3WP0A 1JBQA 1QBGA 2BFDA 2GNOA 3ZJ5A 4EABA 4EUEA 4BNXA 4YUYA 1ZI9A 4LPSA 5DM1A 1A9XA 3DUFB 4OU4A 4YRCA 3I39X 1C9MA 5J9FA 1IJBA 1Q0QA 4S0XA 1IQRA 4E1VA 1H2WA 3CUUA 4TL7A 2VHWA 3ANNA 1E60A 5CHYA 4CV0A 3W3AH 4AZ0B 2UZ0A 3IQWA 4NL4H 1EP1B 1SG0A 2CXXA 1KSJA 3CINA 4YRKA 3AKDA 3AL2A 3R5KA 1PI3A 1R27A 3NT5A 1IL0A 1YZYA 3ABZA 4BTLA 1O77A 4DG9A 5CDFE 4IXDA 3DFZA 3TK1A 3OE7A 6Q21A 3T0IA 2SKEA 2A94A 4MJLA 4TLAA 2A5DA 1AH2A 4ZA2A 4E08A 4X0EA 4F2PA 1R16A 5KC9A 2P6UA 4RQTA 5FHRA 1C9JA 3E9CA 4N1AA 3GLFE 4YAWA 4YJ2F 4EW2A 3JARB 3ZWQA 1TPYA 1E3WB 2DG2A 4XDHA 4C6SA 5JAMA 3KP1A 5BO5A 3QEJA 1M54A 4FGUA 4EJ0A 2MR5A 3UV7A 4E2ZA 2EKPA 4JYBA 3VMFA 4UCFA 3SC3A 4A6EA 4BUJA 3I23A 3FUTA 2HPZA 3TWOA 3W2GA 3IO5A 3QU4A 3I5AA 2BELA 5KBYA 3MQ2A 1N1MA 1N0WA 4HYTA 4M1WA 2O48X 4QO7A 4J4TA 4W4TA 5IWAB 2H0QA 3DE2X 1CUCA 4YV0A 5DGCA 3EJWA 1CR1A 2GK4A 4TVBA 3RFFA 3IXMA 4P0TA 3PGMA 4OJTA 4UCXA 4G07A 1Y3IA 4IH9A 1K3UB 1FFCA 1A3CA 1RQGA 3LWDA 3TIGA 2NV0A 1E6EA 1CY0A 1TQ4A 2FZGA 2O2YA 2XUQA 3DMGA 3GARA 3IMCA 3PR1A 3UJBA 1SN7A 1N36B 2ZBQA 4QEKA 2CE7A 2CVZA 2FZVA 2OCDA 5TMDA 4CMEC 4WZAA 2Z1DA 4PYIA 3GP8A 2L17A 4PC7A 3RC9A 1RAAA 1JN0A 3IE1A 4ZT5A 1OB2A 4FMPA 1F9EA 3T7EA 2FN4A 4GMKA 4OAPA 2ZTMA 1YBAA 3UJ7A 1ZONA 3P7MA 4X3PA 3WYFA 2PR7A 2J0VA 4NFLA 3QE9Y 3IEUA 3A9CA 1GRQA 2QM0A 4CKZA 2G6BA 3UMYA 4FYXA 1G19A 2Q5QA 2OBFA 1X9HA 5HKKA 3TNYA 1P3DA 1R9GA 1ENZA 3INGA 1BMTA 5T6BA 3ZDXB 5JWOA 1GRNA 3ZE0B 1LZKA 3LLUA 2Q49A 4MQBA 2CSUA 1YZGA 2GOYA 2WI8A 2AVNA 3LO8A 4AO8A 5KREA 3DV0B 3CJTA 4TXLA 1M6EX 4BNZA 2QN1A 2AXNA 2I22A 3H13A 2A2ZA 4XE5A 5BQFA 3VR3A 1SBZA 2JA1A 4EYOA 3AB7A 3RSZA 5DI9A 2ZIEA 2FOIA 3D0KA 2AWOA 3K31A 3ZGXA 5ADWA 2VDUE 5L4NA 4OUDB 4BJ1A 3EK2A 3JQFA 3LP5A 4ZCMA 1SXJE 2Q45A 1GPYA 1FPQA 3X44A 4BNIA 3ZIAD 3ZUGA 3FMOB 2ZI4A 3KQTA 1J0EA 2R62A 5B4VA 1WD7A 1YJ5A 3LNCA 2PZKA 4MJXA 3ILVA 2FMHA 4NV0A 4HNRA 3IEXA 3PUYA 1Y4AE 2CYCA 5DT9A 5CAEB 1VMDA 4G0NA 4B6JA 4ENWA 3BL6A 3DAFA 1T91A 2ZYUX 1R00A 4BMVA 1M6WA 1ZFNA 1Z4KA 1IULA 2R8OA 1E4EA 2WIAA 2IIBA 2Y1GA 1JDTA 2Z98A 4TL8A 1XROA 1ZRNA 1DIOB 2YQZA 1QZZA 2Z3WA 3ETGA 3WGQA 3M7IA 3LC1O 4QUEA 4UEJA 1RYYA 2XADA 3ADOA 3TZ6A 4CHGA 2E5LB 3LCJA 4HDMA 1A4XA 4KBGA 4L9RA 2Q5HA 3CYFA 4AS2A 1Y98A 2EF1A 4JJ4A 3BMOA 1JHDA 1L6RA 2PSFA 2QLMA 4N49A 5T57A 3MTAA 4PZDA 4UHBA 4EYGA 1GAWA 2Q4BA 3QVMA 4G1EB 4QXMA 4BKOA 4HFJA 1RRKA 4YV1A 1Y5IA 1DPGA 1A7UA 1VYHA 2R1UA 3H6HA 2VKQA 1MRNA 5DTQA 2UXBB 1GNVA 3DXXA 1EDBA 2BUAA 1AUVA 5LU9A 1IBLB 4GR4A 1OF1A 5DBHX 3L0YA 3H1PA 3II6X 3IVGA 4QDXA 2J48A 3T5DA 4QDKA 3UIEA 3WZ2A 2JLXA 1GAEO 3I9FA 3MCZA 4KK3A 5I7AA 5C32A 1EZZA 1NP7A 1KO8A 2VF4X 4XGIA 4E13A 1P18A 2XA9A 1BE8A 1H05A 1CHNA 2BKAA 5TB5A 2ZOSA 1GG9A 2HJRA 2ZI9A 2IXGA 3DOHA 3JVEA 3SKYA 1QVZA 2AG0A 4GBJA 5B7QA 3GVPA 13PKA 1LSSA 1FQJA 2JGKA 3WNZA 3OX4A 3RU3A 1AJEA 4WACA 3I4FA 2QXUA 5CLLA 4CTNA 1CZUA 1M74A 2WM3A 4EYQA 4D79A 3FSGD 1QYXA 1SXJC 1DBSA 2W6ZA 1DMRA 3KJHA 3WR5A 4DAOA 5FWYA 1FRQA 1VBFA 2AJBA 4W9RA 4ZP1A 2YV2A 2GPTA 1JQBA 2VJLA 4O29A 3P52A 3DNMA 5KQPA 3L7AA 1FDSA 1ORTA 2H1LA 4JR0A 4FEYA 3INRA 4CIVA 2HQRA 1G5PA 5P8WA 1QAOA 2IEZA 2Q3HA 1GDHA 4RNDB 5BMVF 2I7CA 5F5XA 4MPPA 5MN4A 2O8CA 1H6DA 3TAHA 2COUA 3UTCA 1XVIA 5FLEX 4C04A 1R0KA 1KGSA 2AZ4A 2CBZA 1KWGA 3AVPA 1YGYA 2W58A 1F4PA 3QI7A 1U8UA 1A72A 3W04A 2FQWA 3K2EA 4RHUA 1U2QA 4S2EA 3IAFA 4OBXA 2VBGA 5GZ1A 3RG8A 4BVBA 4GEGA 4E4TA 4KR7A 1QGDA 2YTZA 2O5RA 5H3CA 3D4IA 2QL5A 2P2NA 4EHAA 2IIVA 2BI8A 3K0AB 4JLDA 2HWYA 3A25A 3F74A 4X6UA 4KK4A 4BJ6A 3YASA 4JJZA 3H5AA 1OXUA 1KS9A 5ALTA 5FOVA 4CF4A 2QTVB 4BNMA 10MHA 3SR3A 3P27A 4KQJA 3PUVA 3GH1A 3KKQA 3LYAA 1NN0A 4IKOA 3EZ7A 4PFQA 3HXMA 1Z5PA 2CLOB 5DZSA 4JYAB 3M6WA 3TW6A 1XQ9A 1A98A 3FVRA 1IZ7A 4KFRA 5J40A 3TX2A 1JNXX 2IYXA 4CT0A 4F9FA 3U3RA 4QKQA 4RD1A 4B3HA 1K6IA 2UDPA 5IG2A 4BVLA 3F7OA 4JROA 5JOQA 2RG7A 3E27A 5LLDA 2P3OA 1K6MA 4A0HA 1P0IA 1HE1C 1MXHA 3IQDB 2QRJA 5DYIA 1KHTA 3N7TA 5BW5A 4ZZ2A 2Z9DA 1P5HA 3C6BA 3E6AA 3A9SA 3HDGA 4INJA 3BMQB 3WA7A 1NPTO 1XTTA 3BGSA 3T5AA 2PRKA 1BFKA 2Q2NA 2Q6VA 4JSTA 3K96A 1KI6B 3WWYA 2JAWA 3B1KA 5JZVA 1QHNA 4DM7A 4BEBA 3FOEC 2I6TA 4O5OA 1W0CA 2JFVA 2FSHA 2VRCD 1ZN2A 1A5AB 3OHPA 1PEYA 4NH4A 1HR0B 1HSZA 2HJ9A 3QSYA 2Q7OE 2EJUA 1JVNA 1PVDA 2G9RA 2JK1A 2FZLA 4PYLA 5JT1A 2O6HA 1DBWA 1YDGA 3REGA 4Q66C 4CCYA 2QN9A 1IB6A 1P7PA 1G42A 1VLQA 3BZWA 2BUCA 3DHYA 4ME6A 4L8LA 1SA0B 5GJVC 1Z7WA 4UPVA 5KAMA 2CLCX 3UAXA 4CNBA 1ZZGA 4F86A 6PFKA 3DAPA 4RFSB 4H17A 1KIFA 3ZQUA 1HNXB 2B36A 4XLZA 3PDUA 4TMYA 3AVUA 1TGYA 2R6GA 4H7IA 3ENWA 3F7MA 4UBOA 2HRQA 3EGOA 3NNDA 3ZU6A 2Z8ZA 3GD7A 2H1RA 4CWAA 2E55A 1AO0A 2ZSUA 3KOZA 3PX3A 2VATA 3AY6A 2OV2A 2XI4A 1P9NA 2HCRA 1L5LA 2DWQA 1ULAA 2FSFA 3PC3A 4NATA 3VHQA 1Z0SA 3E7PA 3VVMA 1E2HA 3O8LA 2WUVA 3G13A 1A76A 3QLTA 1D1SA 2P79A 3CNHA 1UODA 5IZCA 1DL5A 2GSDA 1UIMA 5B58T 1SZDA 1XZDA 1B2RA 1YBVA 2J67A 3ENNA 3MTIA 4GPAA 1HURA 4EEZA 1FP4A 4MCAA 4PSVA 4JENA 3NOQA 1B16A 2P67A 4ND1A 5FOSA 2DKNA 1E1DA 2EZTA 3QBJA 4TL6A 4EUSA 1JECA 1TU0A 4MDEA 4G1BA 3BAZA 4DLBA 2H31A 4QICA 4WCFA 4ZQEA 1RTKA 2ZSEA 2ZZKA 2P30A 3PQ3A 3D3EA 5DV9A 1DBVO 1VA4A 1EFVB 1JXQA 1KYWA 1ZVQA 2C5HA 2EKBA 2VJBA 1KZ9A 3GLTA 3IUPA 4YP6A 1Z47A 1RE0A 1TM1E 1S89A 4PBTA 4FNOA 4YMWA 1NPDA 4F71A 4RH3A 1XK6A 2ZYGA 4HH1A 1G63A 3L6OO 5K6AC 4FS8A 4JYPA 4YT5A 2H65A 4XWKA 5LVAA 3PKJA 3DO6A 3QWBA 1WXXA 4A0GA 5ADVA 1F2DA 3FWHA 3HBMA 4G4GA 1HQKA 1GCAA 4KN8A 2E5FA 4RK0A 4TTJA 4XYGA 5DLPA 1WEKA 3CX7A 1Q57A 2FR1A 2UZAA 3FCAA 4MWCA 2AZXA 1ZLYA 3LO5A 1UK9A 4EFKA 3VYWA 1XU7A 2FPRA 3NG1A 3OM1A 4R1OA 1Z7GA 1JBEA 2BEVA 2NW6A 2X8JB 4S0ZA 5IULC 2GS9A 4HOYA 4ZVLA 1SCQA 1P62B 4GZMA 5LDDC 1TCCA 4F2HA 5CG1A 3C8HA 2J0UA 3JALA 5E4JA 1AZSC 3A06A 4FGKA 1QJCA 3KPWA 2EAUA 5AI5A 1MJHA 2W6IA 4R2WA 3N8NA 1YHZA 3RAEC 4WZAE 3H4TA 2V98A 3LGSA 1THTA 3ST7A 3HJFA 2ERCA 4PG6A 4QOGA 4DLUA 5AK3A 4CKWB 1DBRA 3T1NA 2DHRA 1G16A 1N5RA 3K6SB 4LRYA 4YUWA 2MOKA 1DINA 1P2VA 1MG5A 3L7NA 2O2DA 4ENSA 1E69A 1TTPB 2CWWA 3NUQA 3BMCA 4TRJA 4R68A 3WMRA 4D9HA 8ATCA 4EQ6B 4L74A 4LGVA 1IHUA 5U1PA 3KX2A 5MFPA 2Y1WA 4UUPA 3WNBA 5IFKA 2EDCA 5JMOA 3K92A 5AKLA 3HLKA 5KNCA 1EDEA 4WINA 1TUEA 1ULSA 2CLEB 4ID3A 2GRJA 3R0QA 1CZKA 4A6DA 1YFJA 2BEJA 2R5WA 3S1AB 3E7FA 3TMAA 1DJMA 5IMSA 4Z0NA 3P4UA 3G68A 1QSGA 4Q3BA 4XTCS 5KYTA 5H4GA 2R6AA 4TVOA 4ARBA 1Y7HA 1EWQA 3CRZA 3E3LA 1F5SA 1JL3A 4YECA 3N0WA 1VI5A 5ERGB 5JAHA 3NFRA 1KH2A 2AR9A 1FU8A 3B8HA 2J45A 2JIRA 5EJ9A 5E9JA 2BY4A 4HAZA 2W98A 3COSA 3OSZA 2GZMA 2EWWA 4KC0A 3EGEA 4E5PA 3J7AC 2PZEA 1JAXA 2JJ2A 2HNBA 2I99A 4MQEB 4JBNA 3U2QA 4ILEA 4ZOLA 2J3KA 3M49A 1R6XA 4O2AB 4N3AA 5EHNA 3C8MA 1WA5A 1XZFA 2JJYA 2VUIB 3WIDA 3KCQA 2Y9MB 1ISRA 3EWNA 2P41A 1XRLA 1QWOA 2RH5A 3PYLA 4MAFA 3Q6NA 4CR8A 3H75A 4JLOA 2BP7A 3VKFA 1N2ZA 2Q28A 2QRPA 5JYBA 3EIXA 4AF7A 3C70A 3B1YA 5EN4A 3W5UA 1E4YA 3GFGA 3Q7TA 5JJ5A 1L1QA 1BU5A 2I4IA 2IYSA 1XEWY 4M0MA 3V5NA 4B7ZA 4OGGA 3BXPA 3O3NB 2VWPA 3MS2A 3GGSA 3GLKA 1JEJA 3HCAA 3MAGA 4WI1A 1FP2A 1OTXA 3RTEA 3TOCA 5ESXA 4ND7A 4UU8A 5D85A 1TXGA 1ORVA 1UMDA 3K94A 3TKYA 3M6LA 5KSOA 4N0EA 1GCOA 2FK8A 2R2AA 3TVYA 5F9HA 1E0DA 1OPXA 3L1HA 1AKNA 2YIMA 3NBZC 4HZIA 3HLTA 2F48A 1Z25A 5G3YA 3TDKA 1GGJA 1P4AA 1JVBA 5PNTA 5ALXA 2WTNA 2WR8A 5JDIC 1TT5B 2B8EA 3H97A 4M3NA 4OA8A 2CCKA 3C15C 4QNNA 2ZBEA 3R8CA 1NSTA 4F91B 3O03A 4IWYA 3TKAA 3VZQA 1VBNA 4TMXA 1G21B 4YWJA 1ZW1A 3GFBA 2R6CA 3HJUA 2H2GA 3JD2A 2QVGA 2PWAA 1TEVA 3K0CC 3W3AD 4RHTA 2AFVA 3R6DA 4PFSA 3WDLA 4UNSA 1JE0A 4X94A 2C2ZA 2WIFA 1QE5A 3EA5A 4LXYA 3Q7EA 3EARA 1UFRA 3IVXA 2DFKB 4R31A 4RJIA 2WTAA 1ZJ4A 2I9PA 2P2CA 4HYYA 3C7DB 4P36A 1A82A 2OCKA 4JP8A 2UYHA 4V3BA 2EF0A 3UG6A 3G0HA 5DHPA 2HBQA 3DDZX 4W7IA 4OV6B 4F4JA 3DCNA 1GN8A 4ZARA 2AC2A 4CN8A 2ZAIA 4MVJA 2CHEA 1GA4A 2IYQA 1PFVA 1GG8A 2RGNC 4WA8A 3TPZA 1MABA 1PT9A 3AW8A 3P20A 3DLTA 4BNDB 1ZA1A 3H8SA 3C8ZA 3L6BA 3LYHA 3U7JA 4Z1OA 4BUZA 4PYKA 3LCCA 3MLAA 2CHVA 4YJ2A 2J46A 2OILA 1NI3A 1U9IC 4V39A 5ICCA 5KNLA 1HE8B 3F1LA 3DMPA 3R3ZA 4MYUA 4R54A 4S1OA 1W36D 1T8UA 3AR6A 3QPDA 5LYJA 1EX7A 3TW4A 3VHRA 4AM8A 3JQDA 3OZDA 1PSZA 3EPPA 3KT3A 5IDYA 3M1YA 3B3GA 3HZRA 3SI7A 4RADA 3K2BA 3HKBB 1Z4LA 2XA1A 2SCUA 4NG4A 1A71A 5FULA 5AK6A 2ZP1A 1U3WA 3JASB 3QNUA 2WVHA 1XWIA 3ABRB 3PQ7A 1M10A 3Q7RA 4J1TA 2QMUA 4ETMA 2IP1A 2JH8A 3CLRC 3ICOA 2AZDA 5H7XA 4PYRA 3DZBA 4KPYA 3IOYA 3S2ZA 3TB4A 1GZ7A 4PNZA 3Q7IA 3OBIA 3EXFA 3R3VA 1M7HA 2YIJA 2I3BA 1G8KA 4LDAA 4M0CA 4OGLA 4XRGA 2ANBA 1KI6A 2A8YA 4IFTA 1KAQA 3W6OA 4MCIA 2I3GA 3DZIA 5ALYA 2ZQ5A 3FDXA 1C9YA 2D74A 2FHPA 4ZAVA 5F4ZA 2AFHB 2FGKA 5DGDA 4FCVA 3HM2A 3S28A 1S8FA 1VL2A 5GGXA 3PJFA 1X9GA 2GT1A 1S4QA 3I2GA 3QPUA 5CK5A 3RC3A 3C1UA 4G2NA 3L8EA 4WXPA 4Z0HO 1MA0A 1SQ6A 5M2QA 4A27A 1BGXT 4KXXA 5KNBD 2WSIA 2GVZC 1X1SA 3RBXA 2VDJA 1GKIA 3BXXA 3KAKA 4HLUC 5AXBA 3K8ZA 3PWKA 2G83A 3KKLA 1PU2A 4XA8A 1R6TA 4Y7CA 4IUBS 4B6GA 4OHRA 4AJIA 1X1DA 3TZCA 1FUIA 2PDAA 1JS1X 1RYFA 3VDNB 1PR0A 1PTJA 3I28A 3B1VA 1CEXA 3DOUA 2CJWB 4NBKA 2OCIA 3LXMA 5H5JA 3IBYA 4RGVA 3KZCA 2XB6A 2X86A 2ONZA 3KYCA 1GXSB 4ZEOA 1Y1SA 4WOKA 2NVOA 4J3JA 3FSRA 2IYYA 1BQ3A 1O4VA 1QU3A 3GLRA 3N2EA 3THWA 1XDWA 1F1JA 4G8JA 5KOHB 4QTYA 4OB7A 3BCSA 4MUBA 1D6MA 2HHJA 4AN1A 5AVOA 3B3QA 1AO3A 1OXTA 4IOJA 4P84A 4BNJA 2HTFA 1GADO 1NY6A 1V95A 2O3SA 2PFSA 2AYZA 3QOYA 4QUAA 2WA2A 4RJKA 5EE9A 3TDMA 4OHOA 3AB3A 4HSGA 5T7BA 1OR8A 4P3YA 3NIWA 3CFYA 2ENWA 2EWVA 2IOYA 4PANA 5COQA 2H59A 5IT9A 3ZD8A 1YA4A 2PGDA 4D42A 4YROA 3SM9A 5K6AA 4KNYA 3AVWA 3PGA1 3PE4A 4D9KA 4EW3A 3HADA 2CZQA 2QMYA 1ESEA 2J9FA 4CKYA 1J22A 3JVVA 1H1TA 4M76B 1ACMA 1OZFA 2OR3A 3EODA 4G1FA 2Q9UA 4JP1A 4JT4A 3HZOA 3CZCA 3PNVA 2KM1A 1AK1A 3EZYA 1J0BA 4KWTA 3X1YA 5HRAA 4NE9A 5KHOC 4UAVA 3IAS1 4FNAA 1FJGB 3UMRA 2JD1A 1MDFA 1NQ5A 3PXBA 3Q4GA 1O03A 2R1VB 3EGDA 3WQBA 3DQZA 3IP6A 4C7OB 1V4BA 3OAAA 3WRXA 4D8YA 1KQFA 4MRAA 1G5IA 2O8FA 3RB8A 3LXRA 3EIQA 2PUAA 3G9QA 1A97A 2BFFA 3H4MA 4PQGA 3L1UA 5A71A 2AXPA 2G5GX 4ZZ3A 4WLVA 2PQMA 3KZXA 2ACEA 4H1HA 3WLRA 4K6KA 2G76A 3K8QA 3D6FA 1ZOPA 3QNWA 2ZM5A 1PKXA 3STHA 5J1SB 5JNSA 4X3OA 1UEXC 4YJFB 1DX9A 3ZWYA 5EJ7A 2RKBA 3C74A 1XZBA 1T8TA 4WN3A 4ZVVA 5DM4A 4TZ0A 1CUWA 3P9KA 1XA4A 5J5AA 2LPMA 1W75A 4KYUA 4F5YA 5K2OA 2OMEA 2W2LA 2GM9A 2JI6A 1LY1A 3OEHA 2OV6A 1M75A 3GVIA 5JANA 4GX5A 3L4EA 1EFAA 3NWJA 4BZZA 3OPYB 4PO9A 3UW1A 4ZJZA 3HXPA 3VR6D 2YHBA 3IODA 4U0JA 1GJRA 3GMSA 2BMFA 2GVNA 1CW2B 4R3NA 4QTUB 2LTAA 5FBVB 4HN9A 3NTXA 3CVXA 5M34A 4GQIA 1XZLA 1UKZA 4UUQA 4LNHA 1W2HA 4M1OA 4ZVKA 2D00A 1XJ5A 1RU3A 1U94A 1NNUA 2VTDA 3KT8A 4O2RA 5KHAA 3IKVA 4NKRA 2B98A 4S3MA 1GEGA 1M1YA 3NXSA 3V6MA 5CFNA 1JBKA 2LCFA 1SMKA 3OU2A 1UMCB 3ZGZA 1F48A 2BKUA 4JJ7A 1ELOA 4MRNA 1ZK3A 4I9GA 5AXAA 2GAFA 2Y05A 1YU9A 2WUEA 1HDZA 1BEEA 4BNLA 2C07A 2X77A 4JEHA 2BM8A 2FWMX 3OHMA 3QUTA 4LPKA 1E3TA 3OE7D 2O1WA 4IGIA 1Z63A 1N9GB 3AUFA 3LA8A 3OZIA 4BB5A 4ETNA 5AVWA 2GEJA 1HBJA 2ZUDA 2R7NA 1IUKA 2IYLD 4X20B 5BUZA 4LW8A 3SHWA 4W9NC 2ZSIA 2XYGA 1G3MA 1NJ6A 2XXBA 1MQSA 1KZ1A 4IVPA 4LWOA 2BHTA 4BYMA 3FTFA 3AXSA 2GD6A 4F3TA 2YINC 1EB8A 4HUJA 4MRMA 4N7MA 4U5QA 1VLZA 2BFBA 4B83A 2CLMB 1PFYA 3ROZA 1Y7TA 5CD9A 4P5PA 5FF9A 1PR3A 1CZNA 3C6QA 1QV9A 4KPUA 4MARA 4Q9JA 4IIGA 3UV6A 1Q5PA 1PFUA 3H3FA 3MILA 4UM9B 1JEYA 5AW3A 4D44A 1CG6A 3H5VA 1OHHD 2JDIA 1AS0A 3LZCA 2IEBA 1D0IA 1NGSA 4XVUA 4BLTA 1FFEA 3L4JA 5D6NA 1T2FA 5TQ2B 3NEPX 1F4LA 4OK6A 3Q5GA 1VC2A 3F97A 3GUCA 3ZI7A 4JB3A 4ZTUB 1Q2XA 4TKVB 5E6UA 4BE4A 5AHRA 4IIVA 2KWIA 5EWJB 1SBNE 2RB4A 3OFND 5FA6A 2IEIA 2EW2A 2HWKA 4R5HA 1KNQA 4CQLB 5A4DA 1U9ZA 1X1BA 3CNLA 3EVAA 4IMIB 1MQ8B 4RD6A 3KG2A 3CKKA 3VSBA 2JB9A 2AD1A 2NU7B 4I5GA 4EPVA 1LVGA 3UYKA 4ALKA 2LV8A 4QEDA 4HNAB 4D56A 1GPNA 3WK4A 2PKXA 4OSEA 5EXEA 1N5KA 2Z58A 4M53A 1I94B 4R2MA 4JXZA 3U19A 4LOIA 1YMVA 5JZOA 3C4JA 1OFVA 1Z22A 4FN5A 5LQJA 3ZHSA 3W2EA 1EVQA 2H54A 1FA9A 1XLTA 1PJAA 1IZ8A 4M0DA 2BR5A 1AKEA 5EG5A 1Z7BA 4C4RA 1ZCFA 2IY9A 3T5PA 1WXQA 3HCEA 2O8VA 4M83A 2AHRA 4MRVA 1JU9A 1GKLA 4RK6A 4U6QA 2DFPA 2M1XA 4RGYA 2A0UA 1VPVA 4YJHB 4OBBA 2B1IA 3LUAA 1VP3A 1NXOA 2A0YA 3I9JA 1KK2A 1P2TA 2P1ZA 3T95A 4E5VA 3LW7A 1MTZA 2F1KA 2IUFA 1W1WA 3CRVA 2ZRBA 3E18A 4XEUA 3TLGB 4L4RA 5AKHA 5T4EA 1X70A 1ORDA 1HK7A 3R8XA 3JVDA 3SJZA 1XNGA 2B2NA 1W4BA 1OXMA 1XXHE 2GD2A 3LVQE 2BGMA 3LVBA 1UPUA 4KQHA 3SYRA 4Y7DA 1VSVA 1ZJJA 2XBLA 1P8JA 3Q9SA 1DAHA 2VSYA 4Q05A 1H1DA 5A5DA 5LA6A 1JEDA 3ES9A 1NUTA 4BO8A 2NZYA 3LM8A 3VKHA 1SEPA 2ZRPA 4I5DA 4UDXX 4K6HA 5J2TF 4DMLA 2DQZA 3COPA 1MG0A 4LFBB 1X0XA 2V6MA 1JAZA 1DIHA 4G0XA 4DUGD 2AC4A 2YXNA 3LZ6A 4LJRA 4ETWA 3M4ZA 5GJWC 2DETA 1OMOA 2F1OA 2OV1A 2WHEA 4MUXA 3DLAA 2FG7C 4BU1A 5B1YA 5J4YA 2XWQA 2WD8A 3T4XA 1M6VB 1TEXA 2CNLA 2JGEA 2ST1A 3LFUA 1OWMA 1E6UA 1MGPA 1K27A 1ZXLA 3A6KA 3OM0A 4G9GA 4IGAA 4RLSA 5CIQA 5F33A 1ZCAA 3RSLA 3CNNA 1L6IA 1L4KA 4KX5A 5LZ8A 1V25A 3BKWA 3QZUA 2OG1A 4OI1A 4WHMA 1YJQA 3K0BA 4I4LA 3W05A 1O8BA 5IW8A 1Y8QB 2V7EA 4EB6B 3R5FA 1N3IA 3WLEA 5EUMA 3OTIA 4FFDA 4OYHA 3QYAA 3PA6A 1GCGA 4K9KA 4IHQA 3RYFB 4IXNA 1G17A 1P2SA 3WO1A 2O2CA 3VRHA 2YNMA 1U4NA 3W34A 4XDGA 1IQ0A 5IARA 1JDUA 5ALMA 2OL4A 3DOIA 4UM7A 5LOVF 4OX9Y 1UINA 3ZCQA 1USVA 2VDWA 3TD6A 3AIMA 4GPTA 1N77A 4FSHA 4ALIA 1Z74A 3REQA 4FUTA 4YJFA 3JQ8B 4G1MB 4DMFA 1MFPA 2K87A 1ZCZA 4RPGA 5LA6B 3BTSA 4LE0A 4P7KA 4NZPA 1BNCA 4UNPA 1ISGA 4MDYA 3HMKA 4RPCA 4KITB 2Q5OA 5FEUA 2ZETA 4QU0A 1SUIA 3LHFA 1ZH4A 1OBFO 3L7DA 4KXNA 1QG0A 3QUSA 1AV6A 3DE3X 4DCOA 4Q4JA 5KMGA 2VVTA 2JJ8A 5K2MA 1V7ZA 2R8EA 4J2HA 2AOUA 4ZZ0A 2XUZA 1D04A 3GBVA 3WLAA 4BKUA 1QLHA 1UIRA 3JQBC 4EECA 3MCTA 4F4UA 5IABA 1P2GA 4AUKA 2G9NA 2R751 3GP5A 1WZIA 5CH5A 4MVJE 3WNDA 5H9VA 1ZINA 2I7DA 3QXCA 2DFTA 1XVAA 4YNBA 4ESHA 1TM5E 1ZI8A 5SV2A 4NY1A 1K2VN 2O6LA 4FYYA 1KVTA 2YHAA 3O8OB 4HXEB 4A8PA 4BWFB 2CXTA 1I7LA 1I32A 3R3SA 4LYJA 5FWDA 3AVXA 1L7DA 1UZMA 4YRDA 3KQVA 1E9BA 5BQ3A 3FLBA 4A8TA 5FR2A 4JLUA 2HMUA 1VE9A 1Z2NX 4UAJA 4LI3X 3UCEA 2YBDA 2A7XA 3EXIB 3V9PA 2PJRA 3K53A 5DTEA 4Q21A 1P6XA 5AUOB 1A2KC 2G6TA 1JFFA 2QMZA 5A2QA 3JQCA 1TTQB 2GD0A 1I4TD 1Z3IX 2VHJA 3PENA 4L3VA 4Y9DA 3RC2A 5J3JA 4QGBA 4RK4A 5DRYA 1WXWA 5EHGA 4FCWA 2Z43A 1IPFA 1XMVA 4FYMA 3WMWA 4BQRA 1GD1O 1CRPA 4X1YB 4D0NA 1T8WA 3HUUA 1JV2B 2FAXA 2WIDA 3AP1A 5FTNA 3L7OA 4OREX 4C6HA 1DXYA 3G17A 4BFLA 4FR5A 1II0A 3IC5A 1YOVB 1L5KA 3D31A 3E53A 4LDZA 1XNJA 4DYDA 3Q3GE 5AH0A 2JANA 2IZ7A 4UBNA 4KE7A 1GR0A 1CJUC 2ZRFA 3R4VA 1KDYA 1OXSC 5H8WA 1L3CA 3BE8A 1N1GA 2VTVA 4FMDB 3ZIDA 4ONEA 4Q3LA 1XDSA 2Z4TA 2NVWA 3Q10A 5CA1A 2Q46A 2Y67A 1U0JA 2D0IA 3ZK9A 1WO8A 1JEYB 1I0ZA 4F3YA 4OCZA 1U8ZA 2VK4A 4KQXA 3ELUA 4ZU1X 4K9MA 5BOVA 3G49A 2DPHA 3H8JA 5E3IA 1WB9A 2E4UA 1DC5A 5BQ5A 3LF2A 2P78A 4K6CA 3KC2A 5KTYA 5ENDA 5KVAA 2J5KA 2BL4A 5IBCA 1J1IA 3CEHA 2FW9A 3EIOA 3I6IA 4TMWA 5C4GB 5LMZA 4FP9A 1I01A 1W88B 5DMXA 1AE1A 2PL1A 2W93A 3KDSE 3RBAA 4NE7A 3RABA 1PR9A 1N2HA 2QTRA 4Z4CA 1G1MA 2UZ1B 4KKXB 2CCGA 4C0WA 4A5OA 3U7HB 3H6GA 4YGXB 2FPMA 3A7DA 3AESB 4R2HA 4X93A 5LP6F 4HPXB 1F0NA 3ZWKA 2JJ2D 3OPVA 4X9XA 4HWRA 2C1EA 4HEA6 4TGLA 3WKBA 4HSEA 4R01A 1D6NA 5ALPA 2IYTA 2YUTA 3IT0A 3QEMB 1ISFA 2AJ8A 4Y6SA 4N48A 2HD4A 4YHBA 4JC0A 3RIMA 3FY4A 1PW5A 4MAMA 2X0JA 3WXMA 4W9MC 1GNLA 3A4VA 2C83A 2VP5A 3ROPA 2EZ9A 3FUVA 3QU7A 1VLJA 1PJZA 3MAJA 2PMDA 4ZCPA 1HXHA 3IEMA 1M1YB 4QIHA 3S55A 2IL1A 4B3MB 3AM1A 4BNKA 1KYZA 3FGZA 5GADl 1J2JA 3L40A 2H1SA 3PR2B 2HFKA 3ON5A 1P72A 2PZ8A 3Q0EA 1KBOA 1NJ8A 2W90A 2JBHA 4MYRA 5ICFA 3ECAA 4KAXA 3CU5A 2V7BA 2MDTA 4IDHA 1O6FA 1J2YA 1QX4A 4AJNA 1VKNA 5KJCA 2HLNA 2QDXA 5CCEA 2AZMA 1A5SB 3ASVA 4Y6LA 4ZMRA 3G0DA 1KSHA 3T99A 4BRSA 4UPEA 3HYCA 3SOZA 2X2OA 3LD9A 4IO0A 1NFQA 2J5XA 1H5NA 3VGPA 7GPBA 1KRXA 4TVSA 3L92A 1T3TA 3B6MA 4C4XA 3NDRA 2XRYA 4M7RA 4J1TC 3NDJA 3BDVA 4HMPA 3ITKA 4V0LA 5IAKA 3VTZA 4HVLA 3M3PA 3UANA 1Y9ZA 1XZCA 1J70A 4K9QA 1T6XA 3WAKA 4WY2A 3CNBA 2P2SA 2FW1A 4LQCA 3OEEA 1PR6A 1GPBA 3FYTA 4NEHB 4ZQGA 2DTDA 4L3OA 4E21A 3N5CA 1HDIA 4FKZA 4I50B 3OO1A 1DIRA 2ODQA 1YK0A 4CM9D 4YJ3A 4FOTA 3LT0A 1TUBA 2P4QA 4V1CI 5IVPA 4N6NA 4X7BA 4ZYZA 2OAP1 1KAEA 2DLDA 4V0KA 2GRAA 2OZLB 2IS2A 1E6WA 3FHOA 2WHPA 3HJAA 4QYXA 1U3FA 1OGIA 4EF4A 3FGOA 2HDNB 3QHAA 4L95C 5KJ6A 3GEIA 5EQDA 5KKNB 1BRMA 1M34A 3PQDA 5A0TA 4LRTB 5TQ0A 2RGBA 2QZ9A 1VGRA 2X9VA 2W6ID 3WZMA 4KP7A 1L5HB 1U8AA </