1U5CA

Plasmodium falciparum lactate dehydrogenase complexed with 3,7-dihydroxynaphthalene-2-carboxylic acid and nad+
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
316
structure length
305
Chain Sequence
b'APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase
publication title Mapping the binding site for gossypol-like inhibitors of Plasmodium falciparum lactate dehydrogenase.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 114
structure length 305
sequence length 316
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2004-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1u5cA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1u5cA02
4XIYA 4W7HA 1SCUA 4RPKA 2EXXA 1E77A 3B1JA 4ZA2A 4FFLA 1ZXLA 5HS4A 3PQDA 3FSRA 1T1SA 1DSSG 4PVDA 4PLFA 4NG5A 3PJFA 4JX8A 3T7CA 5A9TA 3U09A 4W99A 3VHRA 3QVWA 4DLAA 2FR8A 3SVTA 3WGOA 5I7EA 4NHEA 2B5WA 4CM5A 2P68A 1GFSA 4W9NC 2E49A 1BVRA 2NU7A 2AQHA 4Z3KA 4J7XA 2HKIA 3EC7A 3QLJA 2Y1DA 3UKOA 4BOYA 1E3LA 2D2IA 2WE8A 4GPD1 4CMEC 5I7VA 4BO5A 5IFLA 1U4OA 4RF2A 4RL6A 1HYGA 5EJ2A 4IMPA 1HE3A 4MJLA 3WQRA 1ZW1A 4L4RA 2P91A 4CR6A 4TVOA 4MINA 5B4UA 5K6AA 2Q4BA 4TKLA 2VOEA 2O48X 4MKXA 2VRCA 1B0AA 2HUNA 2JJYA 3R1IA 4MP6A 5ER6A 1ONNA 2I65A 4XYMA 1YONA 1PGOA 2C5EA 1F06A 3CMCO 1E1KA 2C2YA 2DC1A 3U4HA 3LC1O 4ND3A 1XU7A 2J6IA 3G1UA 4DMLA 3AFNA 2BFOA 1EQUA 1B8PA 1BVUA 3VH2A 4BGIA 3L4SO 4BQPA 1X1EA 4J7CA 3UAGA 3BMOB 4LSMA 2R2GA 1UXIA 4BNJA 1BG6A 1E7MA 1LLDA 1KOLA 4J9UE 3O03A 4WUVA 1RM4A 5CEEA 5JDIA 5JLAA 4NBTA 2DKNA 4U7WA 1DIBA 1ONPA 3KYDA 3VDRA 5BR7A 1M75A 1AXEA 1OI7A 3QY9A 3IQDB 1PS9A 4GX5A 3OFSA 4LRTB 5GZ6A 3AY3A 4FW8A 4GQAA 3TF5A 3DZKA 2H63A 4M1QA 3OSUA 5CG2A 1LRKA 4I9UA 3GN2A 1UXGA 5L45A 5AXAA 2Q1WA 1Y5RA 1KEVA 4ZVVA 2X6TA 5JYDA 5DCUA 2F1KA 4WLFA 2BMAA 3DBLA 3ZWAA 4U6SA 2BRUA 4CMIB 1T2CA 4M54A 3NDIA 2VHZA 3ASVA 3GPIA 3OIDA 1UZLA 3EZLA 5TJHA 4RJTA 4KP7A 5HA5A 5LDGA 4Y6SA 1GD1O 1YE3A 3L4BA 3G1TA 3UXYA 1LXCA 2O3TA 1WNTA 3HG7A 3QRWA 5DBGA 2AEJA 1BXGB 5JC1A 3RU7A 5JAQA 4LK3A 2DTEA 2A92A 2E6UX 4W9NA 4FQ8A 3BMNB 5EL0A 4IQ8A 4L75A 1GADO 3RSHA 2JCVA 2YUTA 4FCCA 4BNGA 4KDEA 4CMEA 4E32A 1UZNA 2UUPA 1LLCA 3AUTA 3H9UA 2V6GA 4YR9A 4L73A 2P4HX 3INRA 3ZV3A 4R5HA 4J90A 1E6EA 4PLPA 3I6QA 3LSYA 1V3TA 2VOJA 4TQGA 4E30A 4TRMA 1DBVO 3IC5A 2PY6A 2B4QA 2OBNA 2PFGA 3DHNA 4NU6A 3WJAA 2G17A 3QIVA 2AMFA 3P5SA 2AG8A 2WWRA 4JLWA 4OXYA 4RVSA 4QO7A 3EVNA 5JW6A 3ITDA 2QZ9A 3UN1A 1F8FA 4K6CA 1IZ9A 1KERA 2X1HA 3M2TA 4CQMB 1U3WA 1WW8A 1Y8QA 4M49A 1GCUA 4R01A 4CM4B 3KLMX 3PLNA 1H6CA 3QWFA 5IG2A 5C7LO 2BGKA 2D0IA 2FP4A 3DHYA 1NQOA 3KYBA 4CODB 4LW8A 1KVTA 3H9EO 4A27A 3I5MA 4CLEA 1EVZA 3DDNA 1E1MA 1UJMA 3DBHB 1TI7A 3D3EA 1IPEA 2Y1FA 1HE4A 4GSKA 2YW9A 3CEAA 5DCYA 3GRKA 4XDZA 2A94A 5CDUA 3EAGA 3RUHA 5KJFA 5EQDA 2YZ7A 2Q1TA 1PTJA 1B8VA 3C85A 2ZCUA 4E2XA 2OP0A 5ILOA 4QT0A 2Q49A 1Y81A 4CV1A 4IM7A 4BNXA 3NJ8A 2OUIA 4NBVA 1Z82A 4CLRA 1XWFA 1WZEA 1N7GA 1JTVA 3MTJA 1TVEA 5GZ1A 2Z95A 3PHHA 1X0VA 3AJRA 3KM0A 4EGFA 2ZB3A 4R1SA 4BNNA 1DAPA 1ZO8A 1HETA 4LMRA 2NQTA 5TT0A 4C4OA 3DC2A 2Q1UA 4EUFA 3OJOA 1ISIA 3WXBA 5DOVA 4FFRA 1QYXA 2IDZA 3SJUA 3RFVA 2QW8A 2TMDA 3NUGA 3O26A 3E5MA 4DIOA 4LVUA 3LC2O 5AQ1A 4G2NA 3WLEA 4DBZA 2DM6A 4CQMD 2QQ5A 4DXHA 1XU9A 1EBUA 5FWNA 4XB2A 5IDWA 3VAZA 2ZQYA 1IUKA 4PRLA 3UF0A 5MDHA 4J43A 2B4TO 2X8LA 4Z9XA 3AOEC 2EERA 5EPOA 4K26A 2IZZA 5ES3A 2I76A 1ADGA 1DRWA 3DBRB 2PGJA 1DIAA 3ONDA 4ZICA 2ZYAA 3AUAA 2WEKA 4TRRA 4BKPA 3KHUA 4YYZA 3VZRA 6LDHA 2XPCA 3G3EA 1LRLA 2VWQA 3OJFA 1IOLA 4E31A 4J1SA 2ZQZA 3ZWBA 3E03A 1O9BA 1E6UA 2DAPA 1S6YA 4BO1A 3RC7A 5IZ4A 3ZGYA 5JAIA 3GNQA 3H9GA 3CPSA 1O5IA 3GDOA 2PV7A 1SOVA 4S3MA 3BIOA 4ZQHA 4XWYA 2EP7A 1EE9A 3DZFA 2P4QA 2CDAA 4IBOA 2C2XA 4PLVA 4ALNA 4GI2A 4YBZA 2UVDA 5T5QA 5T6BA 4ALLA 5A06A 3F5SA 3K30A 3LDHA 1E3EA 1P1FA 1ZK1A 4IDDA 3T4EA 1RM0A 1NVMB 5ICMA 3L6DA 1GAEO 1WWKA 3FI9A 2O3JA 4FGWA 2Q3EA 1ZUD1 2O3SA 1YB1A 1KC1A 3OETA 3NDRA 3M1AA 3CIFA 4CLXA 4ZN6A 4B8ZA 3GEDA 2Y93A 4DLLA 1T24A 4NBWA 3V2UA 2VTDA 5TLSA 2VZ0A 1QYWA 1MB4A 3PI7A 3VKUA 4AL4A 1Z6ZA 1DDOA 3P2OA 4OOEA 5ENVA 3OP4A 4YQZA 3AW9A 3ICCA 5L95A 3E1KA 4WEQA 3UCEA 4L74A 4YT8A 3O8QA 2IEBA 1E7WA 1P77A 4OGWA 2HQ1A 1AXGA 4Z9YA 1T2AA 2POQX 4MVJF 1ZK4A 4KUGA 1O8CA 1U3TA 1VPDA 4CV3A 3RC2A 4WCFB 3PHGA 4AJEA 1VM6A 1Z75A 2ZCVA 4YJFB 5JCXA 2WD7B 2C0CA 3BMQA 3K96A 1A4UA 4CQLA 1NBOA 3QQPA 1TB4A 3GGOA 3GR6A 4BNUA 2UDPA 3AOEA 3GY0A 2IE0A 1LC0A 1J49A 5A05A 1LDBA 1HEUA 1NHWA 4PG5A 4CM9D 1ARZA 4CM7A 2J3IA 3OBBA 2AQIA 4ND1A 5TT1A 1O95A 4XR9A 1XEAA 3AM3A 2AW5A 1HSZA 1CEQA 5IN5A 1DAOA 2I9PA 1E0DA 1PS8A 4B3JA 1R12A 3C7DB 1XELA 2W98A 1UUFA 2X5OA 2HLPA 4YCAA 3WSVA 1VL8A 5F21A 4XQCA 3DFUA 5TGDA 4Y8VA 1IPFA 3E8XA 3K2EA 1H5QA 3TOXA 3FWNA 3VPHA 3PYXA 3AM4A 5H81A 3Q3CA 1ENPA 3PWZA 5DULA 5ADHA 1N1EA 2AG5A 4CUZA 3OICA 3HFSA 1LDYA 3CUKA 2NVBA 1ZK0A 3LC7O 1BDBA 1T2DA 3BZUA 2PKQP 5G2OA 3UCXA 5CEFA 3IAHA 2W2KB 3WQQA 1ULUA 2OHXA 1YOVA 4H3VA 1P33A 2OO5A 4R68A 4DQVA 3DTYA 4I8XA 1NYTA 4E4YA 2D1YA 4H16A 3RUAA 2HJRA 2BI8A 2VYND 1R4NB 3ETEA 3ETGA 3S8MA 4AFNA 4BQRA 4JCOA 1ENOA 3NDJA 3NTOA 1EZ4A 3GUCA 1NFFA 1D7OA 4TRNA 1WAMA 5C7OO 5LDHA 1HZJA 3LLSA 4DYDA 4NFYA 3WGQA 3ZW9A 2WE7A 4NFSA 4IPTA 2YJZA 1WMAA 1P1JA 4QO8A 2GYYA 1E5LA 3RCBA 4BNFA 2HMUA 4YJDA 3S2GA 1P0CA 4CR7A 1DPGA 2OMEA 4MVJG 2Q4EA 1GEEA 2FZWA 3ULKA 1K6XA 1VKNA 4MPDA 1GZ6A 4HXYA 4MIEA 4IJKA 2OL4A 3H6KA 4N54A 4UVDA 4CPDA 2D4AA 1C1XA 3GZNB 4KUHA 1NPDA 5IF3A 3GLQA 1C1DA 1HDXA 3CKYA 5CG1A 5JSFA 1MG0A 3FWZA 3I9KA 3PZRA 3KBOA 3P19A 5DOZA 1ZH8A 4A26A 1FMCA 1P44A 4O6VA 4Z9FA 4BMSA 1W8DA 1IE3A 5TC4A 1AN9A 4IS2A 1JU9A 2V6FA 2ZB8A 3ZWMA 3ADOA 1LTHR 4YRBA 3ORFA 4RVGA 3CMMA 4DUPA 2JAPA 1XSEA 4ALJA 3D4NA 1GU7A 4UVGA 4FFOA 4JN6B 2WJPA 1NFRA 2O7QA 4DMMA 5A5FA 3T4XA 4J1NA 3P2YA 4YT4A 5A4DA 1U5AA 2RBEA 1SOWA 4GGOA 4QXMA 1ML3A 3V8BA 4UAGA 1I3NA 1GUYA 2WYVA 4B3HA 4NBUA 5TJ9A 4FC6A 2H9IA 5KVQA 1ENYA 1PJBA 5HTOA 1EVJA 2HMTA 3K8ZA 3HDJA 3E6AA 3WGHA 1YKFA 3EZYA 1Q0QA 1NP3A 2VCYA 2X86A 1UDCA 1A4IA 3BMNA 4MIYA 3N7UA 1DC4A 1DC6A 1OMOA 4Q3NA 1DXYA 4RGBA 5BNTA 1F14A 1NNUA 2NU8A 1YDEA 1XKQA 5JC8A 1YRLA 3FF4A 3KSZO 1Y5MA 2VRBA 4HP8A 4JIGA 2IODA 4PGFA 5G0SA 4J4TA 1UAGA 1A9YA 1VRWA 4TSKA 4Y9DA 3FPCA 1T2FA 3P7MA 4G65A 4A73A 1P31A 4II2A 4ND2A 5ILGA 3S2IA 2FSVA 1M66A 1MLDA 1DB3A 4WLOA 3VC7A 1NR7A 2AA3A 4CQMA 1HLPA 2BKAA 3LVFO 3OJ0A 4LCJA 1FF9A 2E82A 3TZQA 1MC4A 4CM4A 5AYVA 1KVSA 4RLSA 5G4KA 1EEHA 4BNZA 4WEOA 4F45A 1NQTA 1I30A 4MP3A 1AGNA 3PWSA 2PD4A 5F1KA 4J7UA 2HO5A 3UVEA 4DGSA 3OQ1A 4G81A 3WFIA 4XR4A 3UOGA 4BGVA 5DZSA 5DT9A 4Q9NA 4UVEA 3ZHBA 4AJOA 1BXKA 2JKVA 3VTFA 3KRTA 2DU8A 3U4CA 2HU2A 4BO4A 2Q2WA 4XD2A 4AJJA 4BKOA 4MVJI 1GTMA 2RCYA 3ZWOA 1RM5A 2UAGA 2YDYA 1RYEA 2P5YA 1IYZA 1N8KA 1PQUA 3DTTA 3ONFA 1T2EA 4PZDA 1PWXA 1UZMA 1Q0LA 4IZHA 4C7KA 5B1YA 2H6EA 1N92A 3E9MA 3RFXA 1V3VA 4ONEA 3WLFA 2X58A 2O7SA 2EG9A 4JQCA 1PL6A 3RBVA 4AJKA 1HL3A 5COQA 2X22A 4A7PA 1CDOA 1BHSA 4R1UA 2V6MA 3I9NA 3MJ4A 3QWAA 1EVIA 4Q3EA 3F1KA 1N7HA 2I67A 1DC5A 1RM3A 2HMVA 5TF4A 2YY7A 2IEDA 4UUMA 4YPOA 5JYEA 1IY8A 5L7TA 3NRCA 4J4HA 1BRMA 5BSEA 4BGUA 3PDUA 2NUAA 3AUUA 4JJFA 1ULSA 3HSKA 1DC3A 4GKBA 4IIVA 1ZEJA 4EI2A 5JMWA 1NM5A 4KOAA 2GZ1A 3S2EA 3I52A 4CM8B 3PFWO 4RPJA 1HKUA 4KDFA 5CPBA 7ADHA 3R3JA 4OOFA 2VYVD 4NBRA 3WGTA 1JWBB 1ZFNA 4BNWA 4AJ1A 2BGLA 4XX0A 4BNKA 2HK8A 3GGPA 1ADCA 3DBRA 3DZIA 1U2DA 2EF1A 1MG5A 5IDQA 4Z6KA 5EINA 4DYVA 3H9QA 2R00C 5BSGA 3MOIA 2EP5A 3F3SA 2JCYA 1MX3A 1DEHA 1LLQA 3JD0A 1WLYA 3QE3A 4XEHA 1M6WA 2GERA 1KC3A 4XRGA 2X0IA 3DAPA 1H2HA 4MVJH 3KYCB 3GDFA 3NJ4A 1PIWA 5GY7A 5I8WA 3ZHXA 3GFGA 4Q3AA 4TVBA 4J4BA 4YXFA 4CM9A 2XXBA 2NNLD 4DRYA 5I9NA 1P0FA 5DF1A 3LYLA 2DBQA 2FWMX 5DDIP 3S2FA 1AUPA 1ZJZA 3AFMA 3OQ6A 4BO7A 4EEZA 5G0WA 3VZQA 3V2GA 3UICA 1BWSA 1HDCA 2B4RO 2AXQA 1GY8A 4CMHA 4O0LA 5B4VA 1HXHA 1C3VA 2O2YA 4I5DA 3KSDO 3TZCA 3W6UA 5ER9A 4HNGA 3ADPA 2YV1A 3O4RA 4I5GA 3ZH2A 1VL6A 4W6ZA 5FFFA 5TQVA 5LC1A 4EBFA 5CFZA 4MP8A 2VZ9A 1DFHA 1XIVA 4GWGA 4J1TA 4P22A 1HSOA 1TT5B 3Q9NA 3RUEA 3U3XA 3WIEA 4R69A 4L8VA 3EHEA 3IKVA 1NR1A 3A4VA 4FB5A 5FYDA 2ILTA 4J1QA 3JQ8B 5GMOA 2VYNA 1ZSNA 3QP9A 2B36A 3GC6A 4UVIA 4MIOA 1FK8A 4BL5A 5JCJD 4R3NA 4E12A 3TFQA 1KVUA 2Y05A 1VL0A 2R6JA 2QHXA 3MOGA 2EGGA 3PEFA 4BMVA 3IL2A 4HUJA 1A7KA 3C8MA 3JQ6A 1ISJA 1O6ZA 3O38A 3CE6A 4E13A 1KEPA 2V7PA 4YT5A 2Z5LA 1MFPA 4FD3A 5DNAA 5JNLA 2C82A 1NPYA 1Z73A 3FRJA 2YV2A 3F6YA 3TL2A 1DIRA 3C7CB 4FGSA 1EQ2A 4UULA 4XQ9A 2DFDA 4RCVA 4ZQGA 5B4TA 1ISHA 4D41A 3INTA 2G1UA 4INAA 1WMBA 5TIIA 1XA0A 2R00A 3PDJA 1JQBA 3L77A 3F4BA 5A3VA 3W4JA 4LCEA 2I99A 3GT0A 3H4VA 3RFTA 4ITUA 4Z0PA 5KJCA 2JCXA 4RF5A 3W8DA 4CV2A 3F46A 2ZATA 1EUCA 3PIDA 1JWAB 5AVOA 5A04A 5IN4A 3DZGA 4IDEA 4MDHA 1BGVA 2B0JA 3DMYA 3GF4A 4FS3A 3AU8A 4R51A 1UDAA 2C59A 3L6EA 3GVIA 4QSMA 3I83A 1L7DA 2HRZA 2GGSA 5C5IA 3PRJA 4NNJA 1B3BA 1DRUA 4R1TA 1A72A 2C7VA 4CUKA 1G6KA 3W4IA 4J16A 3LK7A 4PG7A 4U8GA 5I9MA 3TOZA 2O3UA 4IDFA 3WWZA 1QLJA 1M67A 2UYYA 2UV8A 1EUDA 1U8FO 1R4NA 4PLGA 4YVFA 5CDSA 3ZNQA 3WICA 3JYPA 3WX0A 2EV9A 2PH3A 5L7YA 1E3WB 2P9GA 2IYPA 4HY3A 9LDBA 4BNVA 8ADHA 1DRVA 4YB8A 3PFFA 3NTQA 4HFRA 5T67A 2TMGA 1ISFA 4AG3A 3HNPA 1F0YA 1N2SA 2EGHA 3VZPA 4DC1A 4BNLA 1G0OA 4CR8A 1M6HA 2HJSA 4MVJP 4J9VA 4QFDA 3PTZA 4Q3DA 1EK6A 3U4DA 2D3TA 5KVVA 4E2YA 4CLOB 1KEWA 2I3AA 5CP8A 3DL2A 4XZ3A 3GZNA 2GR9A 3H3FA 1VKOA 1NWHA 1ZZEA 3GNTA 4BO6A 4FDAA 2FPGA 4YJHA 4HV4A 5L51A 4IY1A 1KBZA 1JKJA 1XR3A 1PEDA 1GQYA 4G5HA 1SBYA 3K6JA 4YQYA 3GVPA 1PR9A 3AK4A 5EIOA 1DJQA 4WE3A 1Q2XA 4AVYA 2YYYA 3EK2A 1JVBA 1L7EA 4RPGA 3QVTA 3KXDA 4B4UA 2FPIA 4YDRA 1X1TA 1Y8RB 3V1UA 3G0OA 3ZHYA 2BHLA 4WLVA 2DFVA 1EUZA 2EW8A 4XDYA 2VN8A 1GR0A 3ABIA 1CIVA 1K0UA 3RJ5A 1H6DA 3K5PA 1NXQA 1N9GB 4RF3A 1X15A 3BHMA 2GO1A 3GK3A 4AJNA 3MZ0A 2J5KA 2EJVA 2P9EA 4O1MA 2RIRA 3BAZA 1NFQA 2HRBA 1IB6A 2PA3A 1DIGA 3ZWYA 3BTSA 5HM8A 1U5CA 3DHEA 3F1LA 1IHXA 3UW3A 1PZGA 4U6QA 4Z0TA 3A1NA 4MKRA 3ZDFA 1YL5A 1SO8A 2PLAA 2AQKA 2VT2A 2NVUA 2OOSA 5IJZA 5F3RA 3H5RA 1WP4A 4N18A 1HYHA 4RPHA 1GL3A 4I1IA 4DPLA 5HBRA 2XOXA 2Y1EA 3ZWCA 3GVHA 4AJ2A 2P2SA 3PQFA 3ITKA 1KVQA 3L07A 3LZ6A 4M89A 2Y67A 3ZW8A 3ST7A 3F47A 4GBJA 4N5LA 3WSWA 3GPDG 3OJLA 5THKA 5IZCC 2ZIZA 4UEJA 4AJLA 2RHRA 4BKUA 1LQUA 3V1YA 3RKRA 4R16A 3QWIA 5T57A 5JAMA 3HQ4O 4W82A 4ZHSA 1JW9B 1SMKA 2NTVA 3FR8A 4NZ9A 2ZB4A 4XGNA 3WFJA 5KVSA 3DOJA 5A9SA 3OEYA 5A03A 1J4AA 1Q7GA 4YACA 4XCVA 1E7QA 2GN8A 3ROQA 4E0BA 3MWEB 4TMFA 4HNHA 4BKQA 4QECA 3WQSB 1G0NA 2VUTA 1V35A 2EKQA 2NTNA 2FOIA 3JQAB 1X14A 4NPCA 2VYVA 3IS3A 2FSSA 3C1AA 3CZRA 1PGJA 3IP3A 4QX6A 5K9ZA 2Y1OA 3DONA 5GZ3A 2C29D 4KQXA 1R37A 1C14A 3ENNA 4Y6RA 2NWQA 1L1FA 3GH3A 1DHTA 3H2ZA 1E3IA 1JVSA 4IZIA 4WLEA 3ENKA 2VHYA 4YRDA 1PJSA 4URFA 4PLZA 2FPPA 2DTXA 1GYPA 2IYOA 3U62A 2FMUA 1CRWG 4PFJA 4HKTA 1VSUA 1R6DA 3MWDB 5J23A 3B1FA 2YHIA 1FDVA 1FDTA 3K92A 4NIMA 1KVRA 3BTVA 1XYGA 1Z7EA 3DEYX 2B69A 2FRDA 3NGLA 1SEPA 4R5MA 2DTDA 3AI2A 3GEGA 2Y68A 3U49A 3ZV5A 4PN3A 4LN1A 5BNFA 4A10A 4D46A 3NAQA 2BD0A 1NAHA 1UP6A 1BW9B 5G0UA 1EBFA 1Y9AA 1QV7A 1O89A 5K0ZA 5DP1A 1E3JA 3M2PA 1U28A 4ZD6A 3MEQA 5F5LA 4K1LA 2O50A 3A06A 2ZYGA 5JO9A 4IGEA 1PR3A 2VUSA 5G4LA 4RVDA 4IDBA 2W8ZA 1QYCA 1FJHA 3KZVA 5IZCA 3WGIA 4EDFA 2ZTLA 4E5MA 4XJSA 3S1LA 3TL3A 4IJVA 3FD8A 4A03A 4ALKA 4TKMA 5EQFA 1X7GA 2EJWA 2ET6A 1G1AA 1YB4A 2GF2A 1PZEA 1U3UA 2CDBA 3V5NA 1GEGA 1LBEA 2VNSA 1P1HA 3PPIA 1RPNA 4LRSB 5JCJA 1MUUA 1U7HA 2GN4A 3DMTC 4LVCA 2HAEA 1V0JA 4NH4A 3UGKA 2IZ1A 3QWHA 1YB5A 1AE1A 4OMUA 3QVOA 3ZN2A 5CAEA 1U4SA 3JYLA 1WDLA 3ANNA 3NGXA 1B3RA 4BNYA 5I9LA 4GH5A 3BYZA 1ZIDA 3DOCA 5FI3A 3D0OA 4WNIA 4BNIA 4L4XA 4UEOA 1ONOA 3ZWXA 3QV1A 3Q9UA 4ILKA 3Q2KA 2CVQA 1H9BA 4CMAA 4RV9A 5CDGA 2YQ4A 2CF6A 1HDYA 1F17A 3HDHA 2AE1A 1BSVA 1NTOA 2PZLA 3Q11A 5JPIA 4F6CA 5JBIA 2GSDA 4RDIA 2I6TA 2XAAA 2CUKA 4OXNA 1PS0A 5IDXA 1WPQA 3U9LA 3KO8A 4DIFA 4XA8A 3B70A 2PZJA 3IJPA 5BT9A 1QXSA 2AEFA 4OL9A 4QQRA 4RDHA 2CF5A 4RQTA 2NACA 1A5ZA 5A02A 1H9AA 1OFGA 1Q7BA 1T25A 4JNKA 4ND5A 4XQGA 5MGBA 4IJWA 5KKAA 1TT5A 2X23A 2Y99A 4HFMA 4OYRA 3WTBA 3C24A 3E5RA 1H6BA 3OIFA 4QFCA 2EHDA 3GMDA 3K73O 3RC1A 3GAFA 4M86A 2WDZA 3V2HA 4DPKA 1LDMA 3QVSA 1MA0A 1P9LA 1Y9EA 1DOHA 4R41A 1QYDA 5ENDA 1XDWA 3WBFA 4O63O 3NT4A 4PG6A 1CERA 4P4LA 2PKRA 2JD1A 3PZBA 1Z45A 2AQ8A 4J0FA 3FTNA 3TZKA 4GSLA 3SC4A 3R6DA 4P8RA 3ZWNA 4AJIA 1YJ8A 5L3ZA 4QUKA 3JYQA 4RLHA 4WKGA 4YRAA 2PWZA 4NJOA 4XGIA 4EUHA 3KV3O 3VPFA 3WMWA 2CNBA 3BMOA 4K6FA 4UREA 3RI3A 2A9FA 2CMDA 1F8GA 4CM6A 3ZZNA 3BA1A 3KUXA 4R3WA 2F00A 3DMTA 2ZJ0A 1LJ8A 4Q3BA 4P4NA 4GVXA 3LT2A 5F5NA 3RUDA 3AWDA 1XGKA 1JAYA 2NVWA 3W6ZA 4BMNA 1J0XO 4E2WA 5A9RA 1I36A 1D1SA 2WM3A 4E5PA 2PD3A 4R9SA 1HT0A 4GGPA 1QR6A 2HDHA 1K3TA 2W2LA 1CJCA 1KS9A 2JL1A 1SPXA 1IZ0A 3WYBA 4E5NA 3FBGA 2FN7A 1FDWA 3LT4A 4OSPA 3SLGA 3EDMA 3DQPA 4BO8A 1DLIA 1KYQA 1PQWA 2VTEA 1YQXA 3JQ7B 1ISMA 4CMIA 2Q1SA 3IKTA 1JN0A 4Z0HO 4CJXA 4Q3CA 5I8ZA 3WGZA 3BMCB 2GCGA 1D3AA 3UHAA 5DP2A 3I1JA 3WWYA 3DOOA 3H7AA 4L0QA 4DIBA 4J0EA 3RASA 3SX2A 3LT0A 3TPCA 3WTCA 4EW6A 4GL4A 1WDMA 1NVGA 4I9NA 4JBIA 1BXGA 2C7GA 3ICPA 5KIAA 4J2HA 3GAZA 3LF1A 5BSFA 1E3WA 1PSDA 3E48A 2PD6A 2ZKLA 3I9LA 1N1GA 2Z1NA 4MVJD 1FDSA 1C0IA 1EFKA 4B4OA 3H2SA 3Q0EA 1QORA 3RVDA 1V3UA 5EESA 5U1PA 3NV9A 4IQ0A 4YEDA 5T8KC 3HN7A 4DA9A 2QYTA 2QX7A 3ZI0A 4D0RA 3X2EA 3I4CA 4YT2A 6ADHA 1I8TA 2EWMA 5TX7A 4F6LA 4PLWA 4DC0A 1OC4A 4PZCA 4CLOA 1P45A 2ZJ1A 3A9WA 3M6IA 4OQYA 3D7LA 1I0ZA 3HDQA 4YAKA 3VPSA 3ANMA 1H6AA 4DWVA 3ASUA 4GMGA 5AXDA 3PVZA 3WOHA 5DBFA 3MJTA 4R54A 2DVMA 2VNAA 3GG9A 4YJGB 5LCXA 4HADA 4P38A 3TNLA 3L6OO 4RQUA 3ZCXA 1Y1PA 1CQJA 2J3HA 4MOWA 4BKRA 3B20A 1LU9A 5L4LA 2NV6A 1C0PA 1Y8RA 4CMBA 3ANLA 4B79A 1BMDA 5AXCA 2Y66A 4BUCA 3AY6A 1AHIA 3OEWA 3IUPA 4JJGA 4GKVA 3C7AA 4OJNA 3DBHA 3VH4A 3OA2A 4EZBA 4XYEA 4OSOA 4YAEA 4L4SA 4ZJUA 3D5QA 4JP2A 3R3SA 4MVJM 4Y67A 2Z1MA 2ZYDA 2H1SA 5JMPA 4XYGA 3FNHA 1YH3A 3PXXA 4P4GA 1I32A 2GASA 1Z74A 4CLDA 1ORRA 3BXXA 5FF9A 3WJ7A 2V65A 3WNQA 3JYOA 4CM3A 3VKVA 4LGVA 4DLBA 4DPMA 3ROKA 2HSDA 3RD5A 4ALIA 2DQ4A 4XJTA 2P9CA 4EYEA 2GDZA 3FN4A 4JJIA 3CSDA 2B5VA 1GQQA 2OFPA 3HDYA 2QYSA 4WCFC 1GYQA 3TWOA 1D4FA 1B8UA 1K89A 2G82A 3E9NA 3FNGA 2BLLA 4RORA 3G79A 4FN4A 5B12A 1ENZA 3COSA 4NU5A 5JDCC 1TA4A 5L4SA 2GPTA 2QRKA 4CL8A 4CMJA 1WVGA 1MXFA 2RH4A 4BO2A 1A9ZA 3QSGA 3E82A 1GPJA 4BIIA 1N5DA 2X9GA 3PQEA 3KEQA 3IDSA 5FEUA 1FDUA 1GZ4A 5DBIA 3T7EA 1UXHA 3WR5A 4OKNA 1Q7CA 4ZQEA 2A35A 1I2BA 2JHGA 2OXIA 3O8QB 4WLNA 1IULA 3NT5A 4I5EA 3TZ6A 1LNQA 2IZ0A 1I24A 1E3SA 3RC9A 3DB2A 2PKQO 5COBA 2PNFA 1YQGA 1C0KA 3DFZA 1HE2A 1VLLA 9LDTA 4DQUA 1D8AA 2X9NA 2CFCA 1BDMA 3IIEA 1P1IA 2CY0A 2XXJA 4I08A 3TQHA 2YFHA 2O23A 2J5RA 1J5PA 3HZZA 2VUUA 3HFGA 4IDAA 3PP8A 2VHWA 4BV9A 4CQLB 5ICSA 1X7DA 2D8AA 1LDNA 4XYBA 1H93A 1HYEA 4K28A 2GD1O 1NVTA 4HFJA 2GN9A 3ZWVA 3IUSA 3L9WA 4GX1A 5IXYA 4D0SA 2CVOA 3PYLA 1P3DA 2BGMA 4TZKA 5CPFA 2B35A 4WK6A 4WCDA 1E92A 3K31A 1A71A 3EMKA 2PH5A 4GAEA 4NK4A 4TRJA 3DAFA 3IOYA 2VWPA 3MTGA 4UUNA 1LQTA 5U4QA 3WS7A 2I3GA 2Q2VA 3FR7A 3I4FA 3QVXA 5JFOA 3W1VA 3PLRA 2Y1GA 3RAJA 1DFGA 1HWYA 3H65A 1YO6A 3L4BC 4WCFA 1O0SA 4M55A 5A5EA 4FR5A 5CHEA 2WYUA 4YJFA 3JQGB 2XF8A 3U0BA 1E6WA 3ON5A 1SB8A 2WD7A 5KJ1A 4BV8A 3H5AA 3WNVA 3JQDA 4ZQFA 5JDCA 1YOVB 3Q2IA 4H15A 3G17A 3BHJA 5T64A 5JAZA 1LA2A 1ZXBA 2DBRA 1CETA 1ID1A 4PCVA 5L40A 4OQZA 1B2LA 1JDJA 4CMKA 3O9ZA 2GUGA 4UUOA 5B37A 3DZHA 4HBGA 1LRJA 1ZSVA 5KTKA 1QRRA 3PGJA 1JKIA 4M8SA 4CV0A 2HK9A 1V9LA 3OJEA 1QP8A 1YXMA 1XHLA 1HRDA 3Q6IA 5IAAA 1MV8A 3NX4A 3WYCA 1OBFO 4BS9A 3SLKA 3W8EA 4KWHA 5TS3A 4E2ZA 3FNFA 4BO3A 1C1XB 4K9DA 2EKPA 3QWBA 3GVCA 3VDQA 1XLTA 3CTMA 1C1DB 3IMFA 1U1IA 2WTBA 2FR1A 1SNYA 4MVJE 4RO0A 2OGUA 2W2KA 4EJ0A 5JS6A 2O4UX 1ZMOA 3GFBA 1KY4A 4PLCA 4BNHA 4NFHA 2CSUA 1KIFA 4AJPA 1DIHA 2HMWA 2GLXA 3PGXA 4B4VA 4AJHA 4E21A 3PHLA 1NPTO 3H5NA 3DZJA 3RROA 2CD9A 1GYRA 5JE8A 1O94A 2JD2A 2DUUA 3LF2A 3VTZA 2RHCA 1H94A 1IHYA 2JHFA 1Q0HA 4NI5A 4RVUA 4DREA 1FXSA 4IUYA 1YVEI 2NU6A 1PJCA 3I23A 3SBOA 2NU9A 4ZU3A 3GMSA 3NTRA 3WGYA 1R66A 5JY1A 2ZB7A 4XGKA 1ZMTA 3ZWPA 2AE2A 5L53A 2PGDA 4MVJA 1U8XX 3RU9A 4FOOA 3MJSA 2X9VA 3UFXA 4CM1A 4YAIA 2NQ8A 3HE3A 3CH6A 4TWRA 3A28A 5IDYA 5COAA 4IS3A 3GOHA 4PIVA 2OP1A 2G0TA 2Q50A 3ZU4A 2C07A 4WLUA 1PJ4A 2Y0EA 2ZTUA 1ZEMA 2PZKA 4A5OA 3NT2A 3QHAA 1IL0A 3PJGA 1UXJA 2HCTA 4ZRNA 3HJAA 3KETA 2LDBA 2W2LD 1LDGA 3FPLA 1R4MB 1ADBA 4KTVE 4CL3A 4DVJA 1GPDG 2Y0DA 3F5QA 4S1VA 4AICA 5CDYA 3N74A 1HDGO 4GLOA 3TRIA 4FBGA 4Z3DA 1LSOA 4R4JA 1YL7A 3AI1A 3D3WB 1BTOA 2W4QA 4DQXA 3JD1A 5U9CA 4FSHA 2E37A 4RPLA 4IXTA 3TFOA 4W7IA 2G76A 1I5RA 3U5TA 5EERA 5KWEA 1F12A 3JQ7A 3WYEA 1YDWA 2WD8A 4FJ2A 3GVXA 3HWRA 5CEJA 1VJ1A 4FC7A 3JQEA 5KJEA 4JXKA 3U4IA 4EJ6A 3ROPA 4N5MA 3BMCA 4XRRA 3WBBA 4GVLA 5G4KB 2BH9A 1HTBA 1W6UA 1S7CA 2SCUA 4EEXA 2A4KA 4OXKA 2VT3A 3HADA 1X7HA 2CVZA 3PHIA 4NJMB 1V8BA 5THQA 3RUCA 1XQ1A 3B6ZA 2VWGA 2HK7A 1MFZA 4FJ1A 4DBVO 3HUDA 1I3LA 3FNEA 4DL9A 5TSDA 2ZK7A 8LDHA 4B3IA 1YQDA 3D4PA 2BFMA 4J3FA 1ZVMA 3ETDA 2BFPA 1X0XA 2WMDA 4YAGA 1QV6A 3K2BA 1SZJG 2P5UA 5KOIA 3CZMA 3AI3A 3UCFA 4R9RA 3FTPA 1P1RA 3GQVA 4IXWA 4F46A 2YFQA 7MDHA 5A1TA 4ND4A 1UXKA 4YJGA 4RVFA 2CZCA 1W0CA 3JD3A 3L9XA 3OF2A 3H3JA 3E9QA 4ALMA 4BHTA 5C37A 3OA0A 2D5CA 1I3MA 4B7UA 4EJMA 2O3RA 1VC2A 4HWKA 3RBZA 2JAHA 3L0DA 3OHSX 5F1OA 1R16A 1RYDA 1MC5A 2O4CA 3I9JA 2G5CA 4D3FA 3F9IA 1XCBA 5JY6A 1LX6A 3C3XA 1H0KA 3I9MA 4U5QA 1EVYA 1GZ3A 4WOKA 3GHHA 1GUZA 3H9JA 2FR0A 2B83A 4Y6PA 2C54A 4D7AA 3JV7A 5TRTA 3EW7A 3ZV6A 3BTUA 1E1NA 5TNXA 4YAJA 1J6UA 4MKZA 1U3VA 3PWKA 1WDKA 4JP3A 1XQ6A 1B16A 3H8VA 1R0KA 1CWUA 2H5LA 4OAQA 4BGEA 3GEMA 5C3MA 3CXRA 4XQEA 3WMXA 2BI7A 1RWBA 4GLLA 2I5PO 3D4OA 4NR0A 3R0IA 2Q2QA 2ZTVA 1NHGA 5HWSA 3WG9A 1JKFA 3KB6A 4PG4A 3TDKA 1HDRA 1TLTA 3C1OA 5KKCA 1HF3A 4E5YA 1K6JA 3HB5X 3FBTA 3V1TC 4ID9A 4RZHA 2AEMA 4FFMA 3TN7A 4WASA 3RIHA 1A7AA 2GZ3A 4IIUA 3JYNA 4TROA 4CM8A 4BB5A 4KMSA 3JQAD 1Y6JA 1ISGA 1LDEA 5L4NA 2J5QA 2AHRA 3AM5A 1GQ2A 3DAGA 3DWFA 3JQFC 3MJEA 3OIGA 4ZQBA 5KNLA 2DPGA 4KZPA 5C7IO 4BO9A 1U9JA 2X7HA 2DLDA 2D59A 1QLHA 1PWZA 1P74A 4Y98A 3WIDA 1NQAO 2J3KA 3EYWA 4YWJA 4B4WA 4E5KA 4WPGA 1ZKMA 3WDSA 1JAXA 2IRWA 1YGYA 3PIIA 4ZGWA 2EEZA 3AU9A 1EMDA 3KYCA 4JBHA 1OAAA 3LQFA 3GN1A 1B15A 3FCOA 4RZIA 4WECA 5I7SA 1U2GA 2DUWA 5EN4A 4W4TA 4CUJA 1CQIA 1OC2A 3DR3A 4E6PA 4J49A 2GNAA 2W90A 4I5FA 3VVBA 3VH1A 4J2OA 4D3DA 1CYDA 3A14A 2C5AA 3ONEA 1E5QA 3RWBA 3RBXA 4GX2A 1ZK3A 3EVTA 1SB9A 4GX0A 4N7RA 3QA9A 4JBGA 1ZJYA 3ZWWA 4D44A 1U7TA 5KCZA 2Q99A 4L9RA 1LLUA 5FI5A 5JXWA 1PZFA 1YJQA 4Q39A 3C1TA 5IXSA 5HRUA 5KVCA 1E1LA 1RJWA 4IINA 1YS4A 2NM0A 4NK5A 1YBMA 3DXFA 5AXBA 1LSJA 4LSWA 3RUFA 1HDZA 2VHXA 3JTMA 4JK3A 4PLYA 3VZSA 4HFNA 3KYDB 1BXZA 1DFIA 3F4LA 3N58A 1DHRA 1PJTA 3ZNNA 4CMCA 2PR2A 4D43A 4XYLA 3I9OA 1C0LA 1B26A 3HHPA 3EUWA 4E33A 2I66A 2BF7A 1T26A 1LSSA 3RJ9A 3LU1A 1GV0A 3JQ8A 3KLPX 4E3ZA 1E7SA 4QTZA 1Q1NA 3AUSA 2YQ5A 3GG2A 3JQGA 3DBLB 3PJDA 3MJVA 4WOJA 3WB9A 4EITA 3DO5A 3TSCA 4D3SA 2X5KO 3MCVA 3HB4X 3OECA 1VJTA 4R1NA 4OM8A 2X0JA 4C7JA 2PZMA 4YTEA 2X5JO 1GUFA 3ZU2A 1ZK2A 1B14A 2NLOA 1MXHA 4XIJA 2QIOA 3GRPA 1PJ2A 1E7YA 1T4BA 4CMGA 2BELA 3JQFA 1QG6A 5EMHA 1CF2O 1UR5A 1KY5A 2VRCD 3FHLA 1R0LA 4O59O 1HE5A 2Q46A 4EUEA 4J91A 4BVAA 5DN9A 3D5TA 4O5OA 4BNTA 1RKXA 1I3KA 3JCZA 2DPHA 1VI2A 3BTOA 2JFGA 4X54A 2IXAA 4PG8A 4FJ0A 2RH8A 4XB1A 3Q1LA 2PTGA 3UUWA 2RAFA 1DLJA 5BNIA 3PYMA 5DCWA 3CINA 4GWKA 2JFFA 4BO0A 1OZAA 5L9AA 4II3A 4IQGA 1YL6A 1PGPA 4YA6A 1LEHA 1LUAA 3LT1A 3GA0A 2QZZA 1VJ0A 3W4KA 4GMFA 5F1PA 4YJHB 1B7GO 4KTTE 4L76A 1E7RA 1PGQA 2GZ2A 2NSDA 1M76A 1PJ3A 1ZSYA 3MJCA 3VVCA 1Y7TA 1Y8QB 4IDCA 3D1LA 4OH1A 1XG5A 4B7CA 3KTDA 3QW2A 5BSHA 1I10A 4IGFA 3JSAA 3ZNOA 4KUEA 4FFPA 1GV1A 2VQ3A 3EY4A 3AY7A 4BNMA 3OMLA 4FIZA 1SC6A 4H7PA 1GDHA 1NASA 3PJEA 2QRJA 3E18A 3VH3A 1UH5A 2DT5A 1YBVA 2O2SA 2OORA 2C20A 3KOUA 4UUPA 3JQCA 1K5HA 1QYVA 3KEOA 2EKLA 4BB6A 1EFLA 4IDGA 3JQ9C 3NKLA 2GN6A 4PLHA 1HZZA 1TT7A 3SC6A 2E48A 3DBVO 3SJ7A 4U0KA 3ZNPA 3PHJA 3JD4A 1K2WA 2LDXA 1YBAA 1EE2A 1HLDA 1UDBA 4CLRB 4F3YA 4XKJA 2B37A 2NVUB 3BHIA 1GCOA 4OIMA 4U0JA 1NWCA 3EGOA 3NYWA 3ZU5A 1LSUA 2ZTMA 3D64A 5H83A 1R4MA 2FHSA 4IJUA 4MO2A 2E4AA 2IXBA 1M2WA 4M87A 4PZEA 4RVHA 1NQ5A 4UEKA 4ESOA 3ZU3A 1EK5A 2J8ZA 2OZPA 2YHUA 1SAYA 2Q45A 3D3WA 4HX5A 2X0RA 5JO0A 1ZNQO 4CLHA 2V6BA 1UP7A 1WXDA 3GZ4A 2FZEA 2X0NA 1N9GA 4PRKA 1LC3A 2HMSA 5A9SB 1LI4A 1NAIA 2DBZA 3SXPA 4DTIA 1ZBQA 2FY8A 4D42A 5A3JA 1JA9A 1PL8A 1Z7BA 1P1KA 1DJNA 3W8FA 5AOVA 3INGA 2O3QA 2YV3A 5G0TA 1PL7A 3KVOA 4NJMA 4WGGA 3JQBC 1T4DA 1PGNA 3WGGA 1MGOA 4TZTA 1PU2A 3STHA 2EW2A 3ZV4A 3HN2A 3K9QO 3QJ5A 1NX6A 1R0SA 3ROMA 4KWIA 2WYWA 1KETA 2NADA 1KEUA 1PX0A 1D1TA 4OKIA 1I2CA 2JFHA 1JLLA 3I6IA 4B7XA 3I3OA 5KJ6A 2Y1CA 4FPXA 4UVHA 4WNCA 3KSUA 1PJLA 1TEHA 3GHYA 4OHUA 4N5NA 2OBYA 3RKUA 3RQSA 5L7WA 2YHIB 3GUYA 2WSBA 4B8WA 3VPXA 4JGBA 4OO3A 4LMPA 3OQBA 5ITWA 4WJZA 2VHVA 4A2CA 3JQ9A 4ZRMA 4AJ4A 2BFAA 1AHHA 2VWHA 1R15A 4PVCA 3RUIA 4JROA 3PK0A 5ITVA 1EDZA 5T8KA 3NEPX 1PJQA 2GRAA 4NDNE 1X13A 1I01A 4A0SA 1A27A 1PZHA 2QG4A 3OH8A 1WZIA 1DO8A 2X4GA 1H2BA 4LISA 3TZHA 3JQAA 2D5AA 3ZHZA 3UH1A 1I33A 4ROSA 3GGGA 3VPGA 1SEVA 2QRLA 3GDGA 4RF4A 4D79A 1VE9A 5K6AC 2Y0CA 1T1RA 1MP0A 4FOSA 5I7FA 4NQZA 4D45A 1ADFA 4IMRA 3VOSA 1W73A 5CDTA 2PK3A 1TXGA 2CDCA 3LLVA 1HDOA 1VSVA 1EDOA 4KQWA 1QSGA 5BQFA 1UP4A 3GNSA 5H82A 3AOGA 3JD2A 3S55A 2YDXA 2J3JA 1UAYA 3G49A 3TJRA 5JDIC 3BMQB 2EIHA 1I2ZA 3IJRA 4QEDA 2JD0A 1OOEA 2NTJA 2DBVO 3DZBA 1YWGO 1ZCJA 1QKIA 2VZ8A 2UUOA 4FFNA 4PLTA 5G0VA 1W4ZA 3M1LA 3OM9A 3IP1A 3JQBA 1BW9A 1PQPA 1QMGA 4I9HA 3B1KA 4NMHA 5HS6A 3X2FA 1V6AA 4J6FA 1K6IA 2PGLA 3SEFA
chains in the Genus database with same CATH superfamily
3E9YA 3INYA 5B1DA 4RPKA 4X1YB 4YREA 4DXAA 4J0KA 1XTRA 4JHXA 4B34A 1CFZA 1QVRA 3DYBA 1Q1GA 3GX1A 1NRIA 5KUTA 4UEQA 3MXOA 2Q28A 1NXPA 2SKCA 4X1OA 3KOMA 1TF2A 3PQDA 1EFCA 1T1SA 1DSSG 1UDWA 1XZAA 2FKAA 2HNBA 4PVDA 2VQSA 3PJFA 4NG5A 4F56A 3C97A 3BXPA 5B30A 3D8TA 2GN2A 3AWIA 3ANXA 2I33A 2XB8A 3SVTA 2FR8A 2VF2A 1C9EA 5KQLA 4RXTA 2IOQA 4TLDA 2P68A 3NC0C 1GFSA 3AR3A 4EI9A 3KE8A 1CQXA 4F8JA 4LOIA 4FDLA 2NU7A 2AQHA 3D0RA 5KOJB 4U39A 2ZS9A 3AB8A 4TGLA 1RW4A 1Z0SA 1K98A 1WUTA 2JGDB 2HKIA 3QLJA 1UJ6A 3I05A 1JEDA 4BOYA 3O4GA 1J25A 1ABEA 3UH0A 3I5YA 2XMZA 3K0BA 1NQXA 4JSTA 2ZYHA 1G5FA 1HE3A 4MJLA 1E4EB 4TXNA 5DM0A 3KELA 1U4NA 1CVRA 4H6PA 2P91A 3QKTA 4TVOA 4MINA 1N77A 2C4HA 3A6FA 1RP7A 4TKLA 2HM7A 2L0XA 4AN0A 3BH6A 2FZCA 4JH0A 4IR7A 4MP6A 4EMBA 4QARA 4FWTA 1ZH6A 2N1BA 4H3HB 4CKWA 2BVNA 3AILA 3K1AB 3QLVC 3CMCO 3IIIA 1E1KA 1P5JA 2YNMD 3QBTA 3G1UA 1RMYA 5AIAA 1B8PA 3NRBA 1MQ8B 3R3YA 4HGYA 2J6HA 5E0OA 4BGIA 5BV8A 5HKKD 2GHRA 3TRDA 4LSMA 5E7MA 1DAMA 1BG6A 1E7MA 3K6KA 3O03A 1RM4A 2WIAA 4NATA 2DKNA 5DTMA 2DYKA 1YU9A 2F67A 2FFRA 2K87A 2XBLA 2GAAA 4MX8A 1JB9A 4UMFA 3UK6A 3VDRA 3KQNA 1M75A 2PZBA 3A3OA 1AXEA 2VVTA 4ZT3A 3IQDB 1PS9A 2EFYA 3A9VA 1FTWA 3TIGA 4GX5A 3OFSA 3VR4A 2G3YA 3KZCA 1R8XA 1VGVA 4BLVA 2ZB2A 2IK8A 3ZLBA 3NTUA 1W7AA 4N0QA 3TF5A 2VJYA 3WNBA 1G3IA 1BRTA 3OSUA 3SF0A 1JSLA 1ONBA 2W70A 2QUHA 2Q1WA 1KEVA 4J3JA 2XMPA 2XHEA 2IV2X 1O87A 5LP6A 2NGRA 5IXJA 1SUIA 2WINI 4QPNA 4DAEA 3ETJA 2UYCA 4RSRA 1OA1A 3QXXA 5FBKA 4ZK6A 2R7KA 3FFAA 5T3UA 4M54A 2PWPA 4RGYA 1RHQA 4PHHA 2E7ZA 5PGMA 4MQLA 1UZLA 1S02A 5TJHA 4JJZA 4KP7A 5LDGA 4IH4A 2WJVA 4H1WA 1E0KA 3GRVA 3D59A 2ZVJA 1NMQA 2YVAA 3G1TA 1YAJA 4RKFA 2ZREA 4RKEA 3UXYA 1BCSA 1UKAA 1WNTA 3HG7A 3N76A 1JIIA 2ANCA 1N7IA 1KQGA 5JC1A 5EP3A 1FYXA 2DTEA 4RJLA 1VGRA 2A92A 3Q3JB 2ZJYA 4RK6A 5C9ZA 4FQ8A 1EHIA 3BMNB 9ABPA 4IQ8A 1ZJWA 2CE2X 4L15A 4NE9A 3F7NA 3SZ3A 4BNGA 1E0JA 5I7HA 4E32A 2UUPA 3JZAA 3AUTA 1K5PA 2WR8A 4KYVA 3I3SR 2ZWVA 2OKGA 1JRLA 3H9UA 4YR9A 3LPMA 1UPAA 4FFSA 4RX1A 3BWCA 2HTFA 3GLHE 2GXQA 3PF9A 3JATA 5FAKA 4J90A 3U13A 2CXPA 1E6EA 4PHFA 1V3TA 1PLKA 1L4NA 2C3UA 3L5KA 4LGMA 6PFKA 3MT7A 4NZYA 3PSHA 4OLJA 5BVHB 3DS8A 3WJAA 2E5WA 4QOGA 2ZSIA 3P5SA 4JLWA 4MNTA 2DQYA 2G4VA 4TV9B 1G7RA 1XVAA 2HQBA 3ITDA 3ZE6A 4K6CA 1IZ9A 1R9GA 4ZCPA 3O7MA 2CLKB 4UCWA 2J9GA 1Y8QA 4ZANA 1TQ4A 2RGCA 1DU4A 5HCIA 4CM4B 2IY7A 2C7PA 4LGYA 4BV3A 1P4AA 3MOSA 3UW1A 2ZJ4A 2CHEA 2HQOA 2R2AA 3IA2A 1NQOA 3KYBA 3MMPA 4TUYA 2QBYB 4OK5A 4GR4A 1VKHA 2EP8A 1XKTA 4U2CA 5A7FA 4CLEA 1EVZA 4B5KA 1E98A 3BAFA 2C4NA 3HR8A 5CVDA 2IGTA 1PRYA 2BCEA 3H1EA 3DBHB 1TI7A 2AXPA 2ZT6A 3D3EA 3HI4A 3OY2A 4WADA 4ZDWA 4QGHA 4AB1A 4WIAA 2YW9A 4IIJF 2ZYTX 3B2EA 4U00A 4DR5B 5F64A 1GARA 3D81A 5HOEA 3RUHA 3ZXYA 1QZZA 2Q1TA 1XRQA 1B8VA 3C85A 3ROXA 4NLLA 2QY9A 5FO0A 1GO2A 2G1JA 4M8IA 1RXEA 1N0HA 1GN9A 3ES9A 4RD0A 3NJ8A 2OUIA 4WZ6A 5C35A 1N1MA 3IQEA 4CLRA 4QNNA 4R9NA 4F04A 1XWFA 1KJ8A 1N7GA 1YZTA 2JHAA 1E2DA 1U7ZA 2IU3A 3AINA 4I1OA 4D82A 5F4ZA 2RK3A 2PMFA 2HSGA 1FSPA 3OJWA 4KQHA 3K1JA 3BXOA 4D0LB 2J9FB 2HA4A 5L3SB 5B3JA 3K7EA 1GPNA 1HETA 4HSGA 3JRNA 3ZZUA 1F6BA 3DC2A 2QPLA 3SDSA 1IBCA 1MRZA 1Y0BA 3LLUA 3IPYA 2OHIA 3KAJA 3TW8A 4DGQA 3AGQA 3OZTA 1ISIA 2FUG1 1XQWA 3WXBA 3FZQA 3V2IA 5JEEA 5DOVA 2DCUA 1YK0A 3KC2A 3L8GA 4KHZA 1YVUA 1ZGBA 2OC4A 5CH5A 4AIIA 3IRUA 1W36D 3ENQA 2TMDA 4OLHA 2ETVA 3PQ3A 3LXXA 4EYKA 3EVAA 3NWPA 3A4TA 2JLBA 1UQTA 1K8QA 1PR0A 1PT6A 3DJYA 3SYNA 4DG8A 3FYHA 4DXDA 1XU9A 2RHGB 3DE6X 4DXHA 2GPWA 3R44A 5D5QA 3TFWA 5FBHA 3SYLA 1QGYA 5IDWA 3VAZA 1NULA 4MYCA 5IT5A 1SCNE 4KR7A 2IPXA 1IXKA 1Z6YA 3CISA 3EMVA 4YCNA 2GPYA 2X8LA 5FXMA 5AVKA 1JI3A 2EERA 4GI1A 4K26A 3H17A 4UEWA 2ZYUX 3CNOA 1Y82A 4QT4A 1Q0TA 4OF4A 3ELWA 1JPNA 3EJWA 4GRIA 5DHRA 2GH1A 1DE0A 3O82A 4ZVRA 1B41A 1EFHA 3EIQA 3HCDA 3ONDA 4F72A 4A92A 5BOSB 3WLLA 1Q1EA 2ERXA 1GRQA 1NRXA 3BSSA 4YYZA 2XPCA 4YXWD 2VDPB 1LPBB 3OJFA 2JAWA 1ORTA 4J1SA 4FMPA 1TVMA 1PV1A 5TQJA 2PGIA 2ZQZA 2W2QA 4ZHQA 5JHHB 3PPXA 2X76A 4MV8A 3PUHA 2D5BA 4BVJA 3EAQA 2BEUA 3EWSA 4C06A 3CPSA 2Z8YM 3PQ8A 1O5IA 4PR3A 1CB7A 2PV7A 1I9GA 1NVAA 1NVUQ 3H84A 3NOXA 4XWYA 3LTEA 4ZQHA 4AMUA 4W1PA 3SEAA 5AHRA 3TI7A 4FWIB 1BDHA 1RMTA 1WSBA 5CA0A 3ZI4A 2Q5CA 2ZUTA 4ALNA 2ZRPA 1VZ2A 2JI9A 1U98A 2Z43A 2SBTA 1E3EA 1L7XA 4KYTA 521PA 3A2KA 1FFHA 2IHUA 4WTOA 2HEGA 5IYZB 3TZLA 1I5OA 4F4JA 1GAEO 1IMOA 2WV7A 3FI9A 4GMDA 4FGWA 1M2VA 4O2BB 3K0SA 1CW2B 2VP9A 4QU0A 5FOUA 3E9CA 3NDRA 3M1AA 3OC6A 1XF9A 4FI3C 5EUQB 5FULA 2Y93A 3B3JA 5GV7A 2PRJA 3UZUA 4DARA 3B2QA 2HZBA 1M6NA 1U3FA 3S2SA 3PI7A 4QQKA 3HVHA 1CCWA 3P2OA 1MT3A 5ENVA 2XZPA 7AT1A 4YQZA 3AW9A 4YP0A 1KI2A 3UCEA 4L74A 1THZA 1XD2B 1KH3A 4HJXA 4DBLE 2PUJA 3DH0A 1A8HA 1P77A 1PT9A 4AO6A 2HQ1A 1SC1A 4L8WB 1AXGA 2VT7A 3QPCA 4ZQCB 2CHUA 3O3CA 3LAWA 4FNMA 1ESZA 5TV2A 3TLZA 4E5UA 5M5BA 3U7RA 3AETB 3AHGA 3UMCA 1O8CA 1VPDA 2ZJZA 3ACDA 5LYJB 5A4AA 4WCFB 3VSEA 1GUAA 2H07A 2IUYA 3GCDA 2R7MA 3EC2A 4CL0A 1V43A 1QIIA 1YRQA 1TZCA 2QV0A 3ZCQA 3GRUA 1XAGA 3EOZA 2WOOA 1IBSA 1E9DA 2QAGC 2W2MA 3ISTA 4LY9A 4LJSA 2V4UA 4W1QA 2P1ZA 5FTMA 3RTCA 4GRAA 3EQ9A 4Q7MB 1NBOA 2QNRA 3BCUA 1A7UA 4LHYA 4RAOA 2XTNA 1D4OA 2YR0A 3GWZA 3GR6A 4Y2PA 5LWHA 2MR6A 4JXJA 3CVYA 4Q82A 4NJEB 2UDPA 3VGJA 2MTBA 3ZU6A 1QHXA 2A2ZA 1XZLA 2WWIA 3PQ6A 1LC0A 1TK2A 4RDXA 3NCTA 1G9XA 1CZOA 4PG5A 1SRRA 2OYCA 4CM9D 4XM2A 3A27A 3OEED 4FKMA 4CM7A 2J3IA 4KQJA 4R1LA 3IA7A 5EJ9A 3BCRA 1LPNA 2AQIA 2BMEA 1Z8FA 2G9RA 2I2CA 2ZT7A 3OBBA 1KDTA 4ND1A 1RQGA 1FPQA 2AW5A 3LX8A 4RH3A 1HSZA 4Y2TA 5HKKA 5DRYA 5JQWA 1RXVA 3OZDA 3OWOA 4MI1A 4B3JA 2W4MA 3C7DB 3EVDA 3P0JA 4UHHA 4W5WA 1WY7A 5SYAA 2HLPA 2M9MA 3FSEA 2NXWA 3LBYA 4BP9A 5F21A 2QUAA 1EUCB 5TGDA 2LWIA 3E8XA 3MSXA 2GEKA 2C92A 2YWCA 1H5QA 3OCJA 5C53B 1XK6A 1I6KA 2B4YA 3PYXA 5H81A 2GAOA 4Q6BA 5EIAA 4EB8A 3Q3CA 1ODSA 4LDNA 2E1RA 2AG5A 1OA0A 4QXRA 3RS8A 1N34B 4JX9A 3KEFA 3IBCA 1LDYA 5EG5A 3T34A 1SFRA 4U9IS 1BDBA 1IXYA 2PKQP 5B1SA 3UCXA 3AQIA 5FEMA 1XKXA 3IAHA 4KRYA 4FE3A 3WQQA 1QE5A 3S8YA 3WL5A 5B1HA 3U4AA 4O2RA 3ABQB 1IN4A 1XTKA 1WUKS 3DTYA 1NYTA 3EXEA 2MMCA 4I8XA 1TIPA 4H16A 2DEUA 3ETEA 3QTBA 3RYCA 1KYWA 2X40A 4JCOA 4KIUA 3TD9A 1ENOA 1G20E 2X5XA 3NTOA 1EZ4A 4P4SA 2CBGA 3PCXA 2WKPA 4CF5A 1S8NA 1NFFA 5CD9A 1D7OA 3VKHA 1OXMA 4C0SA 4M46A 1HZJA 3ZE0B 1JJ7A 2C9YA 3BA6A 4DYDA 3I73A 4NFYA 3S29A 3AF6A 1QGAA 2Q9CA 4IXMA 4FHEA 2WE7A 2ZGVA 1XEWX 3KFXA 4L7VA 3LTNC 2G7MC 4TTSA 8MHTA 10MHA 2GYYA 1M7HA 4I66A 4A1FA 2V5VA 3DCIA 4O2AA 1GZ5A 4I0WB 1DADA 1DPGA 2OMEA 2Q41A 1W36C 2FOLA 2PL1A 1NE7A 3K6SB 1ECJA 1R6VA 4ZREA 5CVJA 3UFXB 4MPDA 1DCFA 1ZAKA 4X00A 4FHGA 4MIEA 4DV5B 4UFOA 1AU9A 2I4RA 2OL4A 2QI9C 3JZIA 3OUTA 5KTPA 3E81A 4C07A 2D4AA 3LK6A 1NJGA 4PYJA 3GZNB 4JR2A 4IRMA 1W94A 2FPRA 5L53A 1WCIA 4LS3A 5IF3A 1G20A 1C1DA 1VL5A 3GLQA 3G2OA 3O75A 2I62A 3IBGA 3L02A 1A1SA 2I2DA 1J2UA 2CUNA 1MG0A 2QM0A 3BB3A 3FWZA 5DLYA 5AO9A 5AI8A 5GJVC 4LOHA 3PZRA 4PSKA 4V0RA 5DOZA 3P19A 3HRIA 3W78A 5EIXA 4B33A 4A26A 4PONA 5FHQA 2XADA 1GG9A 3L0ZA 3QYPA 1SULA 4Z9FA 4GDMA 1W8DA 2DJIA 1ZLXA 4ASUD 3LXRA 5CCDA 1AN9A 2FAXA 2ZB8A 1EG7A 3P0IA 4GP7A 4IS2A 2NYUA 3FBWA 3X1KA 3NBZC 4HMQA 1O58A 3ORFA 1QOQB 4RVGA 4YRBA 5CFRA 4ZYXA 3OZFA 2YRWA 4IVQA 2QR5A 4UVGA 2Q6VA 4LI0A 3TTWA 1H85A 2WJPA 1NFRA 2VL7A 4JN6B 2GB4A 2H2FA 2YVQA 4DMMA 5A5FA 4J1NA 3P2YA 3VI4B 1IJEA 1MGPA 1MMFB 1TZBA 1U5AA 2V3VA 2XMCA 3ICOA 4V0OA 3SOPA 5JXJA 1R0BA 3FHCB 3I2KA 5LKAA 3V8BA 2FVYA 3V55A 1J97A 1HTTA 2AMYA 1VPLA 4URVR 1J8MF 5CIWA 1FUUA 1PJBA 3GL9A 5IAOA 4TMKA 5EXPA 3D02A 1TJ5A 1BCRA 3O4IA 1G5IA 3E6AA 3DL0A 3CKLA 3E70C 4NS4A 4Q4LA 3B7WA 2QMHA 2HZ7A 3KOOA 2BFNA 2YFYA 3EZYA 5FNVB 3UHFA 1NP3A 2VCYA 4JI2B 1UDCA 3DXXA 4AZTA 2ECFA 4X8HA 5JEDA 5DX1A 3N7UA 2X9QA 2XUAA 5FRDA 3U7QA 3ZS8A 4BX0A 1DC6A 4RGBA 4MMZB 3WWEA 1NNUA 2BE7A 3UKJA 2X6RA 2NU8A 3KQYA 4Z86A 3NMUF 4H17A 1CZHA 4F06A 4I2VA 5JC8A 1ZX1A 3KSZO 1GG5A 2WP8J 2VRBA 4F84A 4QAQA 3G2IA 3E1SA 3OKCA 4DKXA 1A8QA 2RGGA 3OIWA 2BBOA 2IODA 2D3WA 3BEOA 4KR0A 5G0SA 4ZOAA 3TQQA 1U0FA 2IVFA 1BQEA 1P6QA 2GEBA 4RK1A 4YP1A 1NE2A 3RR2A 4G65A 3ZGLA 4RTLA 5B6PA 1JKMA 2GXUA 3H75A 4II2A 4UMVA 1JHRA 1M5UA 4OGFA 3U81A 1VP9A 1F5NA 4OHPA 3WQHA 4BC0A 1N78A 1E64A 3EVGA 1MLDA 4I1YA 3H8JA 1SURA 4PRYA 3V1LA 1W85B 2EFHB 4LQLA 5E3JA 2BKAA 3RRJA 3IJ5A 3N8NA 4H7KA 1THGA 3U39A 3IEPA 5G4KA 1C4XA 2QW0X 5EWJA 3USZA 5IWCA 1EEHA 4BNZA 2FN4A 4F45A 2WIGA 3E1GA 3M33A 3OMWA 4B75A 1I30A 1NVEA 4HTFB 4UNIA 4ZEXA 2N0SA 4RFSA 2PD4A 5DEOA 2I8LA 3K4HA 3G7NA 4DLTA 3UA3A 2EX1A 3WB2A 4RE5A 3P2KA 5ALQA 2QGFA 3NXSA 4Q9NA 4YXWA 1BXKA 1AF4A 2IFTA 3GLRA 3KD3A 3OQVA 3A4MA 4WUTA 2ZE6A 4R8VA 4AJJA 3P27A 1VSBA 4FFBA 1ZNYA 2RCYA 1FEZA 3NM4A 1IATA 4UOQA 3I0MA 3ZVRA 5L3QB 2P5YA 4MPPA 3IB6A 3EGDB 5FTJA 4CKCB 4GM1A 3DTTA 2Q62A 2WT9A 4P4TA 3WJ2A 4IZHA 4ZCIA 4K2AA 3IBYA 2NPOA 2A6PA 3M81A 2H6EA 5B1YA 1E2NA 2Y76A 1N92A 1WPXA 2QJFA 1FQOA 4KE9A 3K8YA 1ZD8A 1MABA 3ZZTA 3SQOA 3OMXA 4L02A 3G2NA 2F59A 3DYIA 2O19A 1M34B 2I1QA 2KYRA 2PRZA 4PC3A 4R0NA 5BQ5A 4RTMA 2V6MA 3ILSA 1ZN7A 3NXKA 4EJSB 2AFHB 3MHTA 3P0FA 4PXYA 4X1KB 2NXCA 5J5VA 1U9IC 1D6MA 1DC5A 1ZGCA 2H2WA 5BY2A 5TF4A 3FTFA 1SBHA 1GVHA 4MI9A 1IZZA 1IHDA 1O57A 1T4CB 2VP0A 3B89A 4NYJQ 4AQDA 4YPOA 1IY8A 2XUZA 3NRCA 5L7TA 5IM4F 1B8OA 1MZVA 5BSEA 4URHA 1KMMA 2GBIA 2I6FA 2XUIA 1COWD 3ELYA 4EA7A 4JJFA 3OO0A 3HSKA 1XNRB 3MUOA 1C7FA 3N05A 1ZEJA 1DAGA 1CJKC 1EFVA 1LTQA 4DLZA 3C3PA 3PFWO 3QFSA 2MSCB 5TGZA 1M5RA 4KDFA 1NP7A 5BR1A 2I03A 4LA4A 2FLKA 3R3JA 3S1AA 5JBNA 1C2YA 2PSEA 1ZFNA 5JADA 5TGTA 5CLLA 5JTUA 4WDQA 2QVXX 4HSEA 1Z4QA 3KHTA 2V7TA 4BNKA 5DRTA 3GRCA 3WL8A 3NORA 1V8PA 4JQYA 5REQB 3DZIA 2VPWA 2OQVA 4DCSA 1MG5A 4KH1A 5IDQA 1TW2A 2J09A 4FMCB 5IK2D 1RQRA 1CRLA 2OQIA 4ML3A 2VJPA 4PYOA 3OKPA 7REQA 3VV2A 3C3BA 4KXVA 1ACMA 1DEHA 1TM2A 4FK8A 2CFIA 4G63A 4MVYA 4WK0B 4XEHA 2CFTA 3OM0A 4PYKA 4Z99A 1W1UA 4ZYLA 4IHQA 5CAEB 1H2HA 4QUBA 4TLEA 2QN7A 3C8UA 3NR2A 3GDFA 1YRWA 5A6SB 5FH9A 3WKEA 5I8WA 4PXSA 3LP5A 1HT3A 3ZHXA 2VJQA 5ITZB 1J2YA 4TVBA 2AKAB 2BR4A 2DX7A 4YXFA 1TVKA 3G5UA 2BFBB 2QXTA 4OFXA 4CM9A 5PNTA 1VPWA 3OEEA 1FFBA 2WTEA 2AFRA 4M9SA 5D84A 4UNNA 1WSWA 3A58B 4RKYA 4BAUA 4DRYA 2VKTA 1Z07A 4U6NA 5I9NA 2OHJA 1TEVA 3CA8A 4OSEA 2CWWA 4QNRA 4WY2A 2OK8A 4XCQA 2QL6A 3A1CA 3Q1KA 4UTOA 1ZPDA 4EEZA 2I3ZA 1AUPA 3AFMA 2BGUA 3S2FA 3MAGA 3TECE 3CCBA 1WF3A 4MUAA 2GNPA 4FR0A 3THOA 3IVCA 2AXQA 2BJHA 4KC0A 1GCIA 1I1QB 1HXHA 1O77A 4AF7A 3JVUA 4TN5A 3SXUB 1G16A 1RMQA 1JNYA 3FDIA 2HQRA 2NN3C 3KSDO 3ZY6A 3NHYA 5SZIA 3TZCA 3B3FA 4X71A 1AZTA 1MD9A 3O4RA 1FE8A 1RXYA 2BBWA 2REBA 1VL6A 4EG1A 2Z2ZA 3SM9A 1HE8B 3PT9A 3VO8A 3HYSA 1JFTA 1ULBA 3THYB 4JT4A 2Z9BA 3KKQA 3RV3A 1DFHA 1XIVA 4GWGA 4DV2B 3NHFA 4FBMA 3RUEA 5C8YF 5F3WB 2H4HA 2QYHA 3AHCA 2DFPA 3JAKB 4I2NA 1P61B 1NR1A 2H11A 3A4VA 1W96A 1EP1B 4FB5A 3I5XA 1EFDN 5CFMA 2Q3MA 4CIBA 1GFZA 1W47A 4A6XA 3AFGA 5GMOA 1H4SA 4MKGA 1QRDA 5GTDA 2FWNA 3NHBA 1ZSNA 4BEJA 4N82A 2YCLA 1T2UA 8ATCA 5JCJD 2R47A 1JJIA 4BL5A 2EWWA 2P75A 3UAVA 4HLDA 4R3NA 2V6IA 3ZEIA 4E12A 3TFQA 1U3CA 1PHRA 2Y05A 4L8YA 3W2IA 4BYMA 1K68A 2ZRDA 2QHXA 3AEQB 3ER6A 2WYHA 1VIVA 2XUJA 3GEHA 3KPVA 1O1YA 3TSZA 4BMVA 4DZZA 1A7KA 2O8CB 3C8MA 2FKNA 1DXOA 3L7DA 3O38A 4MWOA 4X97A 3CE6A 4OGGA 1IVYA 2V7PA 3MIIA 2CJPA 3I9V1 4YT5A 2QD4A 4FD3A 1RWVA 1R4ZA 2C82A 4XVUA 5AUOB 1K3FA 1NPYA 2GJ9A 3SR3A 4KVZA 1W4BA 2CLLB 3FRJA 3UGJA 1PKEA 3R20A 3V33A 1D0SA 5CR9A 4ZCMA 1DMRA 3EH2A 1EQ2A 4UULA 1U7WA 8GPBA 3H87A 3HVJA 2GJKA 1X1SA 2G1UA 1FS6A 1WMBA 1NUHA 2AK2A 1VDZA 2WLTA 3KFLA 1ST3A 1SHLA 3M1YA 5C1BA 5A3VA 1S3SA 2C4VA 4GE0A 4GSYA 5E9WA 3BK2A 1L5RA 5KX5B 3U44A 1C7RA 1EUYA 3RFTA 2V9CA 1BFDA 1RKBA 2BUCA 5EHGA 2ZATA 3A6KA 3PDHA 1ZY2A 1TMOA 3PQ4A 2JH9A 3EISA 2GPSA 3MCAA 2DMRA 2FZKA 1L5KA 4HUTA 3DZGA 1C9JA 2B0JA 1VCHA 3PXAA 2OG2A 3O4JA 4EKGA 2HNAA 4EFKA 1I4DD 2DR2A 4ASUA 4K03A 4HQOA 1KSJA 3TS1A 3KWFA 5EE9A 4C6TB 1NY6A 3ZD8A 1FXWF 3VO9A 1LK0A 2GGSA 3NYIA 3GP3A 1BS1A 3ESBA 1E96A 1B3BA 2JLSA 2QY6A 4R1TA 4CUKA 2C1XA 2VPTA 3GXOA 3W4IA 3G0IA 1E2MA 3LK7A 4HVTA 5I9MA 3TOZA 4HZGA 2O3UA 1LK5A 2YJ3A 3OZ7A 4NV3A 5IJ9B 4IOJA 4OUKX 5HQ3B 2UV8A 1EUDA 1L6RA 3LMKA 4JBYA 4LC9A 3CT6A 4F3TA 1E3MA 1GFIA 3ADBA 3N0WA 4U7TB 1IY9A 4MPJA 4YC7A 1OD6A 4YK7A 3PXGA 3DO6A 4Y6OA 3KPJA 1N2CB 3Q5GA 4FGJA 2R62A 4RV4A 2PH3A 3WX0A 5DSXA 5JD3A 5FOSA 3O4VA 1JEEA 2JGMA 2P9GA 4HY3A 1U31A 1M2NA 3KSRA 3PPVA 4OBBA 1XMOB 4YB8A 1GGKA 5G02A 3JVVA 3NTQA 4O8CA 5DTIA 5JT1A 1ISFA 2WHXA 4Q5IA 2YOHA 2VBIA 4FQ7A 4C0LA 5TMPA 1U5BA 5ICGA 4P31A 4WZZA 1KI4A 3HU2A 4F5ZA 1M0SA 3IBTA 4EW1A 2C5HA 3TIXB 5THXA 4J9VA 3U4DA 2D3TA 3V7UA 4MS1B 2JLYA 3PLAE 1J70A 1EWTA 1UPBA 4DJTA 4UCXA 4TQUS 3DL2A 4XZ3A 4E08A 2GR9A 3UJNA 1X7WB 1NWHA 1ZZEA 4URXR 5ADWA 3QEBZ 1DV1A 1KK3A 1A5AB 2C3YA 2ZWOA 2Q3FA 4DF3A 1JBEA 4FDAA 2P7IA 1P19A 5L51A 4NCJA 1Z4MA 2O5VA 2ZR9A 3BF8A 3OKAA 4MA0A 2G28A 1GQYA 5FLYA 4HK4A 3K6JA 3E05A 4YQYA 5F98A 5EIOA 3T7IA 2JI8A 1UKEA 3N2KB 1ZD5A 1Q14A 4AVYA 1JH8A 1HLFA 2WHPA 2FSPA 1JVBA 3EK2A 4HQFA 1L7EA 2I1VB 3QVTA 4MB6A 3KXDA 1L3BA 1PJRA 4RGVA 2FFQA 4YDRA 5L6LB 3V1UA 2GLUA 1ACJA 4GEGA 1PNOA 2BHLA 3ERCA 1B2RA 5JH7F 4A8TA 2C5SA 4ETIA 1QB7A 4DSAA 3QFHA 1VCMA 3QNUA 3MCWA 3PC7A 4HAUA 3ABIA 4XW2A 4CTJA 2C4TA 3OCZA 2A1IA 2IC5A 5AFSA 1UKZA 2O05A 2Z0MA 1QHHA 1SR8A 2GO1A 4HWGA 2IBTA 4X6YA 3UKDA 2K4MA 3LS2A 1U7XA 2QT0A 3A9UA 2IUTA 2J5KA 1SC9A 3G5TA 5FQOA 4WOCA 2C2KA 5HE9A 1NFQA 3L0IB 1X2BA 2AMJA 5CX1B 3UBMA 1IB6A 4OHZA 2AX3A 1DIGA 1OCEA 1P75A 2GARA 2ZPTX 3BTSA 3W5HA 3ZWYA 5B1EA 2P2GA 1O6GA 2Z2JA 3EA5A 4XQ0A 5LOVB 1GITA 2JDIA 4U6QA 3ZDFA 2ZIVB 1L0BA 1SO8A 2TYSB 1YF3A 2I6QA 2AQKA 2NVUA 2WU3A 3KJQA 3OPYB 1WXQA 4NCXA 5F3RA 1RWNA 2OQ2A 4ME6A 1JPJA 2W93A 2VXYA 3RHTA 3V7FA 4L9SA 4YRSA 4Y2VA 1XL1A 3ZWCA 3K09C 3L05A 4JZYA 3D8BA 3ITKA 1NUPA 1WD7A 2AZ4A 3OD1A 3DEJA 3IODA 3WAKA 4ENSA 5EA2A 5FBQB 4NX2A 4PNZA 4U2KA 2C2ZA 1US8A 2V3CC 3M5CA 4BZXA 2JFYA 1O2DA 3CH7A 4N5LA 2B4KA 3GPDG 3RUPA 1R0XA 3WSWA 1Q1BA 3AVTA 1RJEA 5CNMA 5B53A 5KNCD 4U7PB 1QTIA 4DLXA 3HKEB 1CUAA 4X1IA 4B6JA 5IT4A 2WJZB 1ZISA 5JZ9A 4TMWA 1Y6QA 5JAMA 4WKOA 3MUFA 4D1YA 5DHAA 1SMKA 4K0RA 2VTBA 3NI2A 1U2SA 2OTCA 3QELA 5SY4A 1J0BA 4AKTA 2R8EA 3FYUB 1L4YA 1COWA 3RKSA 3OEYA 1HKHA 2PX2A 3OTIA 4FMBB 3UJDA 2R751 2RH9B 4E0BA 4MITA 2ZRCA 4EFMA 3EQ8A 1G0NA 4GNKA 2VUTA 4RIHA 3WK5A 1D1QA 4PX3A 1V35A 4EY5A 2W8BB 2EKQA 2KQUA 4O4HA 3MELA 3GEEA 4LWPA 1ZUIA 1Y4ZA 3IS3A 5FX2A 3C1AA 1QBGA 1UKVY 1Z0ZA 1YRAA 1EP9A 1PGJA 3IP3A 3C5VA 3MGCA 4QX6A 4CKZA 4DR1B 4AKIA 2IYEA 4GC5A 2OSBA 3DONA 4KQXA 1N4AA 3V8QA 3P45A 5DV9A 4BCDA 5GZ3A 3AR4A 4LC0A 1HGXA 3SF8A 2X15A 4Y6RA 1GSAA 3ZWQA 1DHTA 3H2ZA 4AUEA 2GZSA 2HCRA 1JVSA 4G01B 5IK2A 4Q7JB 1GNPA 2ONYA 2QRUA 4FX2A 3AZQA 4EZEA 2XX3A 2X4LA 4URFA 3FTDA 3U62A 3N8GA 2ZJ7A 4NAHA 2FMUA 5F7OA 3OOEA 4X41A 4PFJA 3NDBB 1Y3DE 4UM5A 2G7ZA 2ARKA 3JZDA 4HN4B 1R6DA 4YLYA 4PZAA 1PFYA 4NIMA 1PUXA 1Z9BA 2GN1A 4X3OA 1G38A 1A98A 1QU2A 1I14A 1WCWA 4MR8B 3DEYX 1Z7EA 2B69A 3MCUA 3GPBA 3T12A 1K8RA 3HTXA 1RR6A 1VG0B 4E94A 2QN3A 1UJ5A 2DTDA 1X1BA 2GCPA 3GEGA 3PGVA 4PYLA 5TR9A 3ZV5A 4LN1A 4PN3A 3FLEA 3DF7A 1RWXA 3IQFA 2GVNA 1PR5A 3C87A 3E23A 3FROA 4D46A 2HQSA 2EOAA 4H0CA 5G0UA 2AUNA 3IKLA 3R9XB 3UMMA 1MEOA 3FVTA 4YJ3F 3EPHA 4NENA 5EUBA 1CUZA 2VP4A 2ZVQX 3GUHA 3MEQA 4DJDC 1SCUB 1N6HA 3CS3A 3IH5A 3K09A 4K1LA 1KKUA 3FWHA 5G4LA 3WY9A 4CCYA 2BTQB 221PA 2BUBA 1L7BA 3CLRC 3DW1X 4AZWA 2IS6A 2W8ZA 3OZSA 1QYCA 3CXUA 3ZC3A 2GM4A 1E9EA 1J0AA 3TL3A 4A03A 4QPDA 1TM3E 5J2UA 3ILVA 1M6VB 1N0VC 1X7GA 3ZIUA 1G1AA 5EP2A 5ICCA 4OHMA 3V5NA 3KR9A 4MVWA 3ZOKA 4JXXA 4RM2A 1GEGA 4YMIA 3HUFA 5CNJA 4B3XA 1N25A 1DS6A 1GA4A 4LRSB 5JCJA 5KYUA 1U1DA 1CLEA 1MUUA 1IJFA 1A77A 3DMTC 4C0AC 5H4GA 2R6R1 1I2DA 2RK4A 1RIFA 1AKWA 2FWPA 2IZ1A 2JA1A 3UGKA 1IWPB 2O0JA 3NAMA 3PDCA 4CG1A 1U4SA 2BEKA 1U1EA 3E53A 2HA6A 1OWPA 2A14A 3QXSA 3UENA 1WDLA 5HFAA 3BGOS 1JIUA 4ERXA 2W6PA 3ANNA 1ZAYA 2O8BA 5JS2A 2DSNA 3VU1A 5I9LA 4GH5A 3EGVA 4O4IF 1ZIDA 1RKVA 3D0OA 1UT5A 2WSLA 2ZJBA 4YLEA 1OSNA 1JXQA 4ENPA 3Q9UA 5J58A 3Q2KA 1O03A 1IVSA 1KI6A 1ZJ5A 2QTGA 3RHSA 1NC1A 3AVYA 1RAHA 1UXOA 1O8BA 3CW8X 4KMMA 3R7NA 5CDGA 4AO7A 2YQ4A 4OUDB 2UUAB 3KOZA 4IW3B 1HDYA 3HDHA 1UM9A 3A04A 4GRDA 1DO2A 1KK2A 1V41E 2PZLA 3CZAA 3E8MA 3MGGA 3Q11A 3EXG1 4I7EA 4F6CA 1PT7A 5JBIA 2GSDA 3SJBA 1C30B 4HZUA 4V0SA 2XAAA 4ZPXA 5HUHA 1L7OA 1AK2A 3EMBA 4OXNA 2A5LA 1UEJA 1FMJA 1WPQA 2I8AA 1E62A 3EGIA 3MGAA 2GEJA 2L69A 2WWWA 4J76A 1HR0B 4G0VA 4XWWA 2N9UA 4RDHA 2CF5A 1EZZA 3SZUA 3UNXA 4LV8B 2NACA 4DMHA 1WSAA 4RJKA 3JAWA 1A3CA 4HRAA 1A5ZA 3Q7TA 5I5EA 1TM4E 1H9AA 1OFGA 4MV0A 5KKAA 2X23A 5AVUA 2QR3A 4KQMA 3E5RA 1H6BA 1ZC3A 4A0GA 5ER6A 3GMDA 5D85A 4FHDA 1VJ5A 2ACKA 3K73O 2HC9A 5DK6A 2WDZA 1XMJA 3WLMA 4DPKA 2FWJA 1DOHA 4ZTBA 1QYDA 2ZSEA 1L4EA 1JEOA 1XDWA 2XNJA 5ALKA 1RJFA 3BXFA 1GZSA 2XJ4A 1MORA 1CERA 1FU8A 4P4LA 2DOKA 2PKRA 3K5IA 1Z45A 2AQ8A 1MOZA 1YOBA 5AKEA 3RANA 1XJ5A 3R6DA 1XL0A 1YJ8A 5L3ZA 3KVNA 2WHQA 2VAWA 3QXCA 3VNQA 1V47A 3C3EA 2WG2A 5DLPA 1KGSA 1VBMA 2PWZA 4XGIA 4ZJZA 4EUHA 4RK7A 1EVLA 2A30A 3KV3O 3VPFA 1WCYA 1EH5A 4HD8A 2WFLA 3T0IA 1P6XA 3FUXA 3NG1A 1E1QA 3V46A 4IZ6A 4R2XA 4Q9LA 1T3HA 3RS2A 4F1KA 1F8GA 3ZTTA 5KS2A 3EOBI 4KJZA 1WVIA 4LG1A 3T6KA 4KO3S 3BA1A 3KUXA 3QUCA 4RZ3A 4M1KA 5LQUA 3L6CA 2WU0A 3DMTA 3PXUA 4MRMA 2FZLA 1LJ8A 4RHYA 3KLOA 5F5NA 4CKEB 4MVCA 1VB5A 4PX5A 4MW4A 1J2TA 1JAYA 3NEYA 4QUDA 3W6ZA 4BMNA 5A9RA 3SHOA 3L92A 4CEJA 2WM3A 4M1WA 2J7PD 3ESZA 3UAZA 1QR6A 2HDHA 4TKZA 4JA2A 3OY7A 2F43A 2V03A 2QXUA 3UGQA 3N8IA 3WYBA 4E5NA 2A3NA 1F0KA 4DUYB 4DT1B 3IR7A 1VMEA 2FPMA 5EJ4A 5F78A 1PQWA 1OIWA 2VTEA 4QU9A 3HVRA 1WA5A 4E4TA 2PMKA 4KLRA 5SY9A 1Q12A 4A8JC 3O0TA 4QM6A 1JN0A 4P5DA 3HGQA 4LYJA 3RK0A 1IQRA 3AP3A 5I8ZA 2B8WA 3DTVD 4FZRA 4G5GA 1O3YA 5DGIA 2FF5A 1V7CA 2OHGA 2QORA 4QWMA 4W8HA 1A2QA 1JU4A 2SKDA 4L0QA 4R0VA 3T7JA 4YRJA 4DIBA 6CHYA 4EW6A 5K2MA 1ZH4A 3SX2A 4B3TB 2XDQA 4I9NA 3IHKA 2C7GA 4J2HA 2YMPA 1NF2A 3LF1A 3MNFA 3QI7A 2QSJA 5CW2A 3UATA 3QU4A 2QRZA 4RDCA 4DNPA 1F4PA 3A37A 4PYMA 1U0OC 4DS3A 3BIWA 4W9MC 1FDSA 1KI3A 1P5ZB 1P72A 4QE3A 3V8MA 3FCSB 4IGIA 5TEWA 1UBLS 2EEPA 4OB8A 5CYGA 2JCBA 2DCMA 1QORA 1WTCA 5DMXA 1V3UA 1OASA 2AFIB 3B3AA 4H7IA 3SK0A 2UZ0A 3I28A 2QYTA 4LHZA 4Z49A 3A2LA 4G3XA 1THMA 4D0RA 5FOQA 1FFCA 3SAJA 5BN4A 1I8TA 1P91A 2EWMA 3I1YA 3F5MA 2JLZA 2BYTA 1OC4A 4CLOA 3MSCA 5IBRA 1YV9A 5JI2E 1DC8A 1L4KA 2PIAA 2ONZA 3M6IA 3PUYA 1N0WA 4C4RA 2RKBA 6NULA 2EG5A 1ZGAA 2IPLA 3C3CA 3MTAA 3FGOA 3RIGA 3VPSA 1U3DA 5KNCA 2WJ4A 3N0TA 3SD7A 3ZVKA 1HLGA 3EDCA 3MUEA 1NJ2A 3PVZA 2PSFA 3T4UA 3WOHA 5DBFA 9GPBA 4R54A 3V80A 1ZLYA 3QITA 4HNSA 4DADA 4KLNA 1Y6RA 4P38A 2C84A 2VS1A 3E3MA 2J3HA 2QLMA 3W3AH 3TG8A 4PSCA 3Q8KA 4A4DA 1E60A 4YRRA 1Y8RA 2AUMA 3ANLA 3P20A 2ZSFA 4WERA 2Q7OE 4B79A 2Q5LA 2YXEA 4R2HA 5EXTA 4D9JA 3BSFA 2Q29A 2Y66A 1RT9A 2M6LA 2EF0A 2WILA 3HWWA 2QRQA 1V3QE 3G5AA 1WHTB 3IUPA 4HDMA 5FWYA 1G8YA 4QOJA 2OCPA 4OJNA 3DMRA 2WWVD 3VH4A 1KA9H 2BFDA 4EZBA 3AF4A 3QF4B 1Y4DE 4G2TA 4XYEA 1XP5A 3GFFA 2NPFA 1H4QA 1OI4A 3AIMA 4R2LA 4XWKA 1U99A 4H3SA 1R3DA 4MVJM 4V39A 5DB4A 4X7BA 4WBNB 2JCSA 3FOAA 4UU7A 3UHJA 1EU1A 3G2QA 3K0EA 5TMDA 2PAAA 1M74A 1BE0A 1XCJA 2XMGA 3NWOA 5FHRA 2O8DB 3VZCA 2PVCA 1N3IA 2FG5A 1SKBA 3LJKA 3R7DA 1UK7A 1YH3A 2B21A 4G1UC 4N49A 3PXXA 4NG4A 2DUNA 4RK0A 4ZOLA 3ZE8A 4D81A 2E1PA 2V65A 1H3NA 3STYA 1ICIA 1R0CA 5EXDA