1U5DA

Crystal structure of the ph domain of skap55
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
108
structure length
108
Chain Sequence
b'GSVIKQGYLEKKSKDHSFFGSEWQKRWCVVSRGLFYYYANEKSKQPKGTFLIKGYSVRMAPHLRRDSKKESCFELTSQDRRTYEFTATSPAEARDWVDQISFLLKDLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Src Kinase-associated Phosphoprotein of 55 kDa
publication title Structural Basis for the Dimerization and Phosphoinositide Specificity of the Src Kinase-associated Phosphoproteins SKAP55 and SKAP-Hom
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 23
structure length 108
sequence length 108
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1u5dA00
2LULA 4IAPA 2CODA 2D10A 2W2XC 2W2XD 4DXAB 1TXDA 3ML4A 4WVFB 1V61A 3V5WA 2V76A 3KRWA 1KZGA 4WSFA 3SYXA 3AU4A 2DA0A 3BJIA 1GC6A 3G9WA 2P0HA 2DTCA 2XQNM 2RVBB 2JP2A 2Y7BA 3TCAA 2KUPA 1EF1A 2DYNA 5HE3A 4K2OA 2D4QA 1SHCA 1WGUA 2J0JA 5KCVA 2RNRB 1FGYA 3N7CA 5C79A 2DHIA 2GS0A 1DBHA 2ROVA 1WVHA 1ZVRA 5GOWB 4CHMA 5CLQB 2DN6A 4XWXA 2HTHB 1W1GA 5L81A 1OY2A 4HAZB 2DKQA 1MK9B 2MDXA 3NSUA 3TW1A 2COFA 2DX5A 2E2XA 1XCGA 2I1KA 3QIJA 1NTVA 2COCA 4KHOA 5C5BB 4B6HA 1FOEA 1UPRA 4HATB 2NZ8B 2M14A 3O96A 1XODA 2UZSA 2DKPA 3KY9A 1P6SA 3SNHA 3SUZA 3TFMA 4K81A 1FAOA 1DROA 5EFXA 4TKNA 3RCPA 4HAVB 3F5RA 1BWNA 3IVFA 2EC1A 5D3WA 1DDVA 4TYZA 2IFSA 2GJYA 1J0WA 5JHGA 4KAXB 2K2UA 2RGNB 3PP2A 2GCJA 4EKUA 2EJ8A 2H7DA 3P6AA 2UZRA 3PVWA 3A8QA 4A6HA 4A6FB 3MPXA 1X86A 4HHVA 3WYFB 2R09A 3DXDA 2D2QA 5JP4A 2ZPYA 2Z0OA 2I5FA 1LB1A 1ZSQA 5C5BA 3M1IB 3OANA 5DIFB 2W2WA 4F7HA 4MT7A 1DDMA 3A98B 3D8EA 1P3RA 2AEHA 2YT0A 2CAYA 1SGHA 1UNRA 4F7UP 4GMVA 2Z0PA 4P7IA 3GYOA 1MK7B 2OTXA 1H4RA 3WA0A 5DH9B 4GZUA 2H7EA 3FEHA 1MAIA 4HDOA 4NY0A 2COAA 2K2JA 1P5TA 4IOYX 4L6EA 4DX90 3U7DA 2LOXA 2YRYA 3T06A 5HE2A 1RRPB 2D11A 2IYBA 4A6FA 2L1CA 2Y8FA 3CXBB 2I5CA 3KSYA 1B55A 5D3XA 1TJ6A 5DHFB 1DYNA 2FJLA 1BTKA 1QQGA 1X05A 2PZ1A 1WGQA 2AL6A 2D9WA 2HE7A 3ODWA 4GN1A 1OQNA 4MY6A 5J3TA 2P0DA 1WI1A 2LYDA 2I1JA 2VSZA 2EMTA 4BBKA 2CRFA 1U5EA 1XD4A 2ELAA 5D3VA 1BAKA 2YS1A 4H8SA 2DFKA 2MWNB 1QC6A 4KHAA 4YONA 2VKIA 4C0AA 1UNPA 5LOPB 1N3HA 3VIAA 5DI9B 1FHWA 2YT1A 4K17A 4KHBB 4Z2MB 3X23A 4ZRIA 1J19A 1V88A 1ISNA 1PMSA 1IRSA 2CY4A 2DYQA 1EAZA 5J3YA 3D8DA 5HE0A 3ZDTA 1NI2A 1H10A 4F7GA 4HAWB 4IFSA 3ZVRA 1M7EA 2DHKA 1MIXA 4EJNA 2RSGA 1KZ7A 3U8ZA 2ELBA 1LW3A 4DX8A 1W1HA 1PFJA 4CYEA 1DDWA 2P0FA 1V5MA 2N0YA 1V5PA 3HW2B 5FI0A 1NTYA 4D0NB 1NU2A 3HQCA 2DHJA 2YVCA 3PSCA 2YS3A 3F0WA 1FB8A 5D27A 4DBBA 1ZC3B 2DX1A 3P7ZA 1E5WA 3MDBC 2D9XA 4HAYB 4K2PA 2LG1A 1XX0A 3AU5A 2YS5A 1PLSA 1U5DA 1U5FA 4ZRJA 4CHJA 3DXCA 2YF0A 1Z87A 3ULCA 2MKRA 1KI1B 2J59M 3TO1A 1AWEA 4MK0A 4NSWA 1UNQA 2Q13A 2D9ZA 1MKEA 3GYPA 3BINA 2J0KA 3ODOA 3PVLA 1W1DA 2P8VA 1GG3A 5FI1A 2YSZA 5JLJB 4GMXB 1I2HA 3FM8C 4GXBA 4HDQA 3PEGA 1XKEA 3FSSA 2D9YA 2KCJA 1FGZA 5C6RA 1K5DB 1MPHA 1UPQA 1GC7A 5J3QA 1U27A 1X1GA 2NMBA 2N23A 3SO6A 3D8FA 2Z0QA 4A5KA 3PVUA 3QWMA 2BCJA 3PG7A 3KZ1A 3AJ4A 4Z2NA 1Y5OA 5D3YA 3HK0A 2D9VA 4WJ7A 2UVMA 2RUKB 1RJ2A 1ZM0A 1I7AA 4PQ0A 1ZC4B 1TQZA 1UEFA 1WJ1A 2VRWB 2L2IA 4HAXB 2KGXB 2OQBA 2CY5A 3ULBA 1X1FA 4ZRKA 4A6KA 4KVGB 1WJMA 1U2BA 4HB3B 4HB0B 3SV1A 5DHAB 2RLOA 4HB2B 4EMOA 2LOZA 1X11A 3PZDA 1BTNA 1U5GA 1MIZB 3A8PA 4YL8A 1EVHA 2Y8GA 3QBVB 3KRXA 3LJUX 2LKOA 1Y19B 3VOQA 2QKLA 1EGXA 4PNKA 2J0MA 1WG7A 2R0DA 2G35A 1Q67A 4Y94A 1V89A 1FHXA 3DXEA 3UZTA 4HAUB 5CLLB 1FHOA 1OMWA 2X18A 1V5UA 2DLWA 2K00A 4GPTB 1M7RA 2QKMA 5HE1A 2EMSA 2GCLA 1XR0B 3TVVA 2ROZB 3ODXA 5KQ1A 4HB4B 2M38A 5C16A 1K5GB 1U29A 5LONB 1AQCA 2ADZA 5KQ4A 2MFQA 5JHHA 3CIKA
chains in the Genus database with same CATH superfamily
2LULA 4IAPA 2CODA 2D10A 2W2XC 2W2XD 4DXAB 1TXDA 4L1RA 3ML4A 4WVFB 1V61A 3V5WA 2V76A 3KRWA 2KIEA 1KZGA 4WSFA 3SYXA 3AU4A 2DA0A 3BJIA 1GC6A 3G9WA 2P0HA 2DTCA 2XQNM 2RVBB 2JP2A 2Y7BA 3TCAA 2KUPA 1EF1A 2DYNA 5HE3A 4K2OA 2D4QA 1SHCA 1WGUA 2J0JA 5KCVA 3NW8A 2RNRB 1FGYA 3N7CA 5C79A 2DHIA 2GS0A 1DBHA 2ROVA 2Z59A 1WVHA 1ZVRA 5GOWB 4CHMA 2Z4DA 5CLQB 2DN6A 4XWXA 2HTHB 1W1GA 3NWFA 3B77A 1OY2A 4HAZB 5L81A 3NWDA 2DKQA 1MK9B 2MDXA 3NSUA 3TW1A 2COFA 2DX5A 2E2XA 1XCGA 2I1KA 3QIJA 1NTVA 2COCA 4KHOA 5C5BB 4B6HA 1FOEA 1UPRA 4HATB 2NZ8B 2M14A 3O96A 1XODA 4D6WA 2UZSA 2DKPA 3KY9A 1P6SA 3SNHA 3SUZA 3TFMA 4K81A 1FAOA 1DROA 5EFXA 4TKNA 3RCPA 4HAVB 3F5RA 1BWNA 3IVFA 4DIXA 2EC1A 5D3WA 1DDVA 4TYZA 2IFSA 2GJYA 2Z13A 1J0WA 5JHGA 4KAXB 4QXAB 2K2UA 2RGNB 3PP2A 2GCJA 4EKUA 2EJ8A 2H7DA 3P6AA 2UZRA 3PVWA 3A8QA 4A6HA 4A6FB 3MPXA 1X86A 4HHVA 3WYFB 2R09A 3DXDA 2D2QA 5JP4A 2ZPYA 2Z0OA 2I5FA 1LB1A 1ZSQA 5C5BA 3M1IB 3OANA 5DIFB 1MI1A 2W2WA 4QJ5B 4F7HA 4MT7A 1DDMA 3A98B 3D8EA 1P3RA 2AEHA 2YT0A 2CAYA 1SGHA 1UNRA 4F7UP 4GMVA 2Z0PA 4P7IA 3GYOA 1MK7B 2GUMA 1H4RA 2OTXA 3WA0A 5DH9B 4GZUA 2H7EA 3FEHA 1MAIA 4HDOA 4NY0A 2COAA 2K2JA 2RRFA 1P5TA 4IOYX 4L6EA 4DX90 3U7DA 4GOUA 2LOXA 2YRYA 3T06A 5HE2A 1RRPB 2D11A 3DCXA 2IYBA 4A6FA 2L1CA 2Y8FA 3CXBB 2I5CA 3KSYA 1B55A 3HIEA 5D3XA 1TJ6A 5DHFB 1DYNA 2FJLA 1BTKA 1QQGA 1X05A 2PZ1A 1WGQA 2R2YA 2AL6A 2D9WA 2HE7A 3ODWA 4GN1A 4OT1A 1OQNA 2K49A 3OHMB 4MY6A 5J3TA 2P0DA 1WI1A 2LYDA 2I1JA 4GNKB 2VSZA 2EMTA 4BBKA 2CRFA 1U5EA 3U12A 1XD4A 2ELAA 5I2SA 5D3VA 1BAKA 2YS1A 4H8SA 2DFKA 2MWNB 1QC6A 4KHAA 4YONA 2VKIA 4C0AA 1UNPA 5LOPB 1N3HA 3VIAA 5DI9B 1FHWA 2YT1A 4K17A 4KHBB 4Z2MB 4QJ4B 3X23A 4ZRIA 1J19A 1V88A 1ISNA 1PMSA 1IRSA 2CY4A 2DYQA 1EAZA 5J3YA 3D8DA 5HE0A 3ZDTA 1NI2A 1H10A 4F7GA 4HAWB 4IFSA 3ZVRA 1M7EA 2DHKA 1MIXA 4EJNA 2RSGA 1KZ7A 3U8ZA 2ELBA 1T77A 1LW3A 4DX8A 1W1HA 1PFJA 4CYEA 1DDWA 2P0FA 1V5MA 2N0YA 1V5PA 3HW2B 5FI0A 1NTYA 4D0NB 5LG4B 1NU2A 3HQCA 2DHJA 2YVCA 3HSAA 1ZYIA 3PSCA 2YS3A 3F0WA 1FB8A 5D27A 4DBBA 1ZC3B 2DX1A 3P7ZA 1E5WA 3MDBC 2D9XA 4HAYB 4K2PA 2LG1A 1XX0A 3AU5A 2YS5A 1PLSA 2ZKMX 1U5DA 1U5FA 4KHBA 4ZRJA 4CHJA 3DXCA 2YF0A 1Z87A 3ULCA 2MKRA 1KI1B 2J59M 3TO1A 1AWEA 3A58A 4MK0A 4NSWA 1UNQA 2Q13A 2D9ZA 1MKEA 3GYPA 3BINA 2J0KA 3NWAA 4HSIA 3ODOA 3PVLA 1W1DA 2P8VA 1GG3A 5FI1A 2YSZA 5JLJB 4GMXB 1I2HA 3FM8C 4GXBA 4HDQA 3PEGA 1XKEA 3FSSA 2D9YA 2KCJA 1FGZA 5C6RA 1K5DB 1MPHA 1UPQA 1GC7A 2Z14A 5J3QA 1U27A 5I2MA 1X1GA 4QJ3B 2NMBA 2N23A 3SO6A 3D8FA 2Z0QA 4A5KA 2KIGA 2KUQA 2YT2A 3PVUA 3QWMA 2BCJA 3PG7A 3KZ1A 3AJ4A 4Z2NA 1Y5OA 5D3YA 3HK0A 2D9VA 4WJ7A 2UVMA 2RUKB 5M4YB 1RJ2A 1ZM0A 1I7AA 4PQ0A 1ZC4B 1TQZA 1UEFA 1WJ1A 2VRWB 2L2IA 2NBVA 4HAXB 2FJUB 2KGXB 2OQBA 2CY5A 3ULBA 1X1FA 4ZRKA 4A6KA 4KVGB 1WJMA 1U2BA 5IRSA 4HB3B 4HB0B 3SV1A 5DHAB 2RLOA 4HB2B 3FVCA 4EMOA 2LOZA 1X11A 3PZDA 1BTNA 1U5GA 1MIZB 3A8PA 4YL8A 1EVHA 2Y8GA 4OSNA 3QBVB 3KRXA 3LJUX 2LKOA 1Y19B 3VOQA 2QKLA 1EGXA 4PNKA 2J0MA 1WG7A 2R0DA 2G35A 1Q67A 4Y94A 1V89A 1FHXA 3DXEA 3UZTA 4HAUB 5CLLB 1FHOA 1OMWA 2X18A 1V5UA 2DLWA 2K00A 4GPTB 2K8EA 1M7RA 2QKMA 5HE1A 2EMSA 2GCLA 1XR0B 3TVVA 2ROZB 4CSQA 3ODXA 5KQ1A 4HB4B 2M38A 5C16A 1K5GB 1U29A 5LONB 2KR0A 1AQCA 2ADZA 5KQ4A 2MFQA 5JHHA 3CIKA
chains in the Genus database with same CATH topology
2LULA 4IAPA 2CODA 2D10A 2W2XC 2W2XD 4DXAB 1TXDA 3ML4A 4WVFB 1V61A 3V5WA 2V76A 3KRWA 1KZGA 4WSFA 3SYXA 3AU4A 2DA0A 3BJIA 1GC6A 3G9WA 2P0HA 2DTCA 2XQNM 2RVBB 2JP2A 2Y7BA 3TCAA 2KUPA 1EF1A 2DYNA 5HE3A 4K2OA 2D4QA 1SHCA 1WGUA 2J0JA 5KCVA 2RNRB 1FGYA 3N7CA 5C79A 2DHIA 2GS0A 1DBHA 2ROVA 1WVHA 1ZVRA 5GOWB 4CHMA 5CLQB 2DN6A 4XWXA 2HTHB 1W1GA 5L81A 1OY2A 4HAZB 2DKQA 1MK9B 2MDXA 3NSUA 3TW1A 2COFA 2DX5A 2E2XA 1XCGA 2I1KA 3QIJA 1NTVA 2COCA 4KHOA 5C5BB 4B6HA 1FOEA 1UPRA 4HATB 2NZ8B 2M14A 3O96A 1XODA 2UZSA 2DKPA 3KY9A 1P6SA 3SNHA 3SUZA 3TFMA 4K81A 1FAOA 1DROA 5EFXA 4TKNA 3RCPA 4HAVB 3F5RA 1BWNA 3IVFA 2EC1A 5D3WA 1DDVA 4TYZA 2IFSA 2GJYA 1J0WA 5JHGA 4KAXB 2K2UA 2RGNB 3PP2A 2GCJA 4EKUA 2EJ8A 2H7DA 3P6AA 2UZRA 3PVWA 3A8QA 4A6HA 4A6FB 3MPXA 1X86A 4HHVA 3WYFB 2R09A 3DXDA 2D2QA 5JP4A 2ZPYA 2Z0OA 2I5FA 1LB1A 1ZSQA 5C5BA 3M1IB 3OANA 5DIFB 2W2WA 4F7HA 4MT7A 1DDMA 3A98B 3D8EA 1P3RA 2AEHA 2YT0A 2CAYA 1SGHA 1UNRA 4F7UP 4GMVA 2Z0PA 4P7IA 3GYOA 1MK7B 2OTXA 1H4RA 3WA0A 5DH9B 4GZUA 2H7EA 3FEHA 1MAIA 4HDOA 4NY0A 2COAA 2K2JA 1P5TA 4IOYX 4L6EA 4DX90 3U7DA 2LOXA 2YRYA 3T06A 5HE2A 1RRPB 2D11A 2IYBA 4A6FA 2L1CA 2Y8FA 3CXBB 2I5CA 3KSYA 1B55A 5D3XA 1TJ6A 5DHFB 1DYNA 2FJLA 1BTKA 1QQGA 1X05A 2PZ1A 1WGQA 2AL6A 2D9WA 2HE7A 3ODWA 4GN1A 1OQNA 4MY6A 5J3TA 2P0DA 1WI1A 2LYDA 2I1JA 2VSZA 2EMTA 4BBKA 2CRFA 1U5EA 1XD4A 2ELAA 5D3VA 1BAKA 2YS1A 4H8SA 2DFKA 2MWNB 1QC6A 4KHAA 4YONA 2VKIA 4C0AA 1UNPA 5LOPB 1N3HA 3VIAA 5DI9B 1FHWA 2YT1A 4K17A 4KHBB 4Z2MB 3X23A 4ZRIA 1J19A 1V88A 1ISNA 1PMSA 1IRSA 2CY4A 2DYQA 1EAZA 5J3YA 3D8DA 5HE0A 3ZDTA 1NI2A 1H10A 4F7GA 4HAWB 4IFSA 3ZVRA 1M7EA 2DHKA 1MIXA 4EJNA 2RSGA 1KZ7A 3U8ZA 2ELBA 1LW3A 4DX8A 1W1HA 1PFJA 4CYEA 1DDWA 2P0FA 1V5MA 2N0YA 1V5PA 3HW2B 5FI0A 1NTYA 4D0NB 1NU2A 3HQCA 2DHJA 2YVCA 3PSCA 2YS3A 3F0WA 1FB8A 5D27A 4DBBA 1ZC3B 2DX1A 3P7ZA 1E5WA 3MDBC 2D9XA 4HAYB 4K2PA 2LG1A 1XX0A 3AU5A 2YS5A 1PLSA 1U5DA 1U5FA 4ZRJA 4CHJA 3DXCA 2YF0A 1Z87A 3ULCA 2MKRA 1KI1B 2J59M 3TO1A 1AWEA 4MK0A 4NSWA 1UNQA 2Q13A 2D9ZA 1MKEA 3GYPA 3BINA 2J0KA 3ODOA 3PVLA 1W1DA 2P8VA 1GG3A 5FI1A 2YSZA 5JLJB 4GMXB 1I2HA 3FM8C 4GXBA 4HDQA 3PEGA 1XKEA 3FSSA 2D9YA 2KCJA 1FGZA 5C6RA 1K5DB 1MPHA 1UPQA 1GC7A 5J3QA 1U27A 1X1GA 2NMBA 2N23A 3SO6A 3D8FA 2Z0QA 4A5KA 3PVUA 3QWMA 2BCJA 3PG7A 3KZ1A 3AJ4A 4Z2NA 1Y5OA 5D3YA 3HK0A 2D9VA 4WJ7A 2UVMA 2RUKB 1RJ2A 1ZM0A 1I7AA 4PQ0A 1ZC4B 1TQZA 1UEFA 1WJ1A 2VRWB 2L2IA 4HAXB 2KGXB 2OQBA 2CY5A 3ULBA 1X1FA 4ZRKA 4A6KA 4KVGB 1WJMA 1U2BA 4HB3B 4HB0B 3SV1A 5DHAB 2RLOA 4HB2B 4EMOA 2LOZA 1X11A 3PZDA 1BTNA 1U5GA 1MIZB 3A8PA 4YL8A 1EVHA 2Y8GA 3QBVB 3KRXA 3LJUX 2LKOA 1Y19B 3VOQA 2QKLA 1EGXA 4PNKA 2J0MA 1WG7A 2R0DA 2G35A 1Q67A 4Y94A 1V89A 1FHXA 3DXEA 3UZTA 4HAUB 5CLLB 1FHOA 1OMWA 2X18A 1V5UA 2DLWA 2K00A 4GPTB 1M7RA 2QKMA 5HE1A 2EMSA 2GCLA 1XR0B 3TVVA 2ROZB 3ODXA 5KQ1A 4HB4B 2M38A 5C16A 1K5GB 1U29A 5LONB 1AQCA 2ADZA 5KQ4A 2MFQA 5JHHA 3CIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LUL A;  4IAP A;  2COD A;  2D10 A;  2W2X C;  2W2X D;  4DXA B;  1TXD A;  3ML4 A;  4WVF B;  1V61 A;  3V5W A;  2V76 A;  3KRW A;  1KZG A;  4WSF A;  3SYX A;  3AU4 A;  2DA0 A;  3BJI A;  1GC6 A;  3G9W A;  2P0H A;  2DTC A;  2XQN M;  2RVB B;  2JP2 A;  2Y7B A;  3TCA A;  2KUP A;  1EF1 A;  2DYN A;  5HE3 A;  4K2O A;  2D4Q A;  1SHC A;  1WGU A;  2J0J A;  5KCV A;  2RNR B;  1FGY A;  3N7C A;  5C79 A;  2DHI A;  2GS0 A;  1DBH A;  2ROV A;  1WVH A;  1ZVR A;  5GOW B;  4CHM A;  5CLQ B;  2DN6 A;  4XWX A;  2HTH B;  1W1G A;  5L81 A;  1OY2 A;  4HAZ B;  2DKQ A;  1MK9 B;  2MDX A;  3NSU A;  3TW1 A;  2COF A;  2DX5 A;  2E2X A;  1XCG A;  2I1K A;  3QIJ A;  1NTV A;  2COC A;  4KHO A;  5C5B B;  4B6H A;  1FOE A;  1UPR A;  4HAT B;  2NZ8 B;  2M14 A;  3O96 A;  1XOD A;  2UZS A;  2DKP A;  3KY9 A;  1P6S A;  3SNH A;  3SUZ A;  3TFM A;  4K81 A;  1FAO A;  1DRO A;  5EFX A;  4TKN A;  3RCP A;  4HAV B;  3F5R A;  1BWN A;  3IVF A;  2EC1 A;  5D3W A;  1DDV A;  4TYZ A;  2IFS A;  2GJY A;  1J0W A;  5JHG A;  4KAX B;  2K2U A;  2RGN B;  3PP2 A;  2GCJ A;  4EKU A;  2EJ8 A;  2H7D A;  3P6A A;  2UZR A;  3PVW A;  3A8Q A;  4A6H A;  4A6F B;  3MPX A;  1X86 A;  4HHV A;  3WYF B;  2R09 A;  3DXD A;  2D2Q A;  5JP4 A;  2ZPY A;  2Z0O A;  2I5F A;  1LB1 A;  1ZSQ A;  5C5B A;  3M1I B;  3OAN A;  5DIF B;  2W2W A;  4F7H A;  4MT7 A;  1DDM A;  3A98 B;  3D8E A;  1P3R A;  2AEH A;  2YT0 A;  2CAY A;  1SGH A;  1UNR A;  4F7U P;  4GMV A;  2Z0P A;  4P7I A;  3GYO A;  1MK7 B;  2OTX A;  1H4R A;  3WA0 A;  5DH9 B;  4GZU A;  2H7E A;  3FEH A;  1MAI A;  4HDO A;  4NY0 A;  2COA A;  2K2J A;  1P5T A;  4IOY X;  4L6E A;  4DX9 0;  3U7D A;  2LOX A;  2YRY A;  3T06 A;  5HE2 A;  1RRP B;  2D11 A;  2IYB A;  4A6F A;  2L1C A;  2Y8F A;  3CXB B;  2I5C A;  3KSY A;  1B55 A;  5D3X A;  1TJ6 A;  5DHF B;  1DYN A;  2FJL A;  1BTK A;  1QQG A;  1X05 A;  2PZ1 A;  1WGQ A;  2AL6 A;  2D9W A;  2HE7 A;  3ODW A;  4GN1 A;  1OQN A;  4MY6 A;  5J3T A;  2P0D A;  1WI1 A;  2LYD A;  2I1J A;  2VSZ A;  2EMT A;  4BBK A;  2CRF A;  1U5E A;  1XD4 A;  2ELA A;  5D3V A;  1BAK A;  2YS1 A;  4H8S A;  2DFK A;  2MWN B;  1QC6 A;  4KHA A;  4YON A;  2VKI A;  4C0A A;  1UNP A;  5LOP B;  1N3H A;  3VIA A;  5DI9 B;  1FHW A;  2YT1 A;  4K17 A;  4KHB B;  4Z2M B;  3X23 A;  4ZRI A;  1J19 A;  1V88 A;  1ISN A;  1PMS A;  1IRS A;  2CY4 A;  2DYQ A;  1EAZ A;  5J3Y A;  3D8D A;  5HE0 A;  3ZDT A;  1NI2 A;  1H10 A;  4F7G A;  4HAW B;  4IFS A;  3ZVR A;  1M7E A;  2DHK A;  1MIX A;  4EJN A;  2RSG A;  1KZ7 A;  3U8Z A;  2ELB A;  1LW3 A;  4DX8 A;  1W1H A;  1PFJ A;  4CYE A;  1DDW A;  2P0F A;  1V5M A;  2N0Y A;  1V5P A;  3HW2 B;  5FI0 A;  1NTY A;  4D0N B;  1NU2 A;  3HQC A;  2DHJ A;  2YVC A;  3PSC A;  2YS3 A;  3F0W A;  1FB8 A;  5D27 A;  4DBB A;  1ZC3 B;  2DX1 A;  3P7Z A;  1E5W A;  3MDB C;  2D9X A;  4HAY B;  4K2P A;  2LG1 A;  1XX0 A;  3AU5 A;  2YS5 A;  1PLS A;  1U5D A;  1U5F A;  4ZRJ A;  4CHJ A;  3DXC A;  2YF0 A;  1Z87 A;  3ULC A;  2MKR A;  1KI1 B;  2J59 M;  3TO1 A;  1AWE A;  4MK0 A;  4NSW A;  1UNQ A;  2Q13 A;  2D9Z A;  1MKE A;  3GYP A;  3BIN A;  2J0K A;  3ODO A;  3PVL A;  1W1D A;  2P8V A;  1GG3 A;  5FI1 A;  2YSZ A;  5JLJ B;  4GMX B;  1I2H A;  3FM8 C;  4GXB A;  4HDQ A;  3PEG A;  1XKE A;  3FSS A;  2D9Y A;  2KCJ A;  1FGZ A;  5C6R A;  1K5D B;  1MPH A;  1UPQ A;  1GC7 A;  5J3Q A;  1U27 A;  1X1G A;  2NMB A;  2N23 A;  3SO6 A;  3D8F A;  2Z0Q A;  4A5K A;  3PVU A;  3QWM A;  2BCJ A;  3PG7 A;  3KZ1 A;  3AJ4 A;  4Z2N A;  1Y5O A;  5D3Y A;  3HK0 A;  2D9V A;  4WJ7 A;  2UVM A;  2RUK B;  1RJ2 A;  1ZM0 A;  1I7A A;  4PQ0 A;  1ZC4 B;  1TQZ A;  1UEF A;  1WJ1 A;  2VRW B;  2L2I A;  4HAX B;  2KGX B;  2OQB A;  2CY5 A;  3ULB A;  1X1F A;  4ZRK A;  4A6K A;  4KVG B;  1WJM A;  1U2B A;  4HB3 B;  4HB0 B;  3SV1 A;  5DHA B;  2RLO A;  4HB2 B;  4EMO A;  2LOZ A;  1X11 A;  3PZD A;  1BTN A;  1U5G A;  1MIZ B;  3A8P A;  4YL8 A;  1EVH A;  2Y8G A;  3QBV B;  3KRX A;  3LJU X;  2LKO A;  1Y19 B;  3VOQ A;  2QKL A;  1EGX A;  4PNK A;  2J0M A;  1WG7 A;  2R0D A;  2G35 A;  1Q67 A;  4Y94 A;  1V89 A;  1FHX A;  3DXE A;  3UZT A;  4HAU B;  5CLL B;  1FHO A;  1OMW A;  2X18 A;  1V5U A;  2DLW A;  2K00 A;  4GPT B;  1M7R A;  2QKM A;  5HE1 A;  2EMS A;  2GCL A;  1XR0 B;  3TVV A;  2ROZ B;  3ODX A;  5KQ1 A;  4HB4 B;  2M38 A;  5C16 A;  1K5G B;  1U29 A;  5LON B;  1AQC A;  2ADZ A;  5KQ4 A;  2MFQ A;  5JHH A;  3CIK A; 
#chains in the Genus database with same CATH topology
 2LUL A;  4IAP A;  2COD A;  2D10 A;  2W2X C;  2W2X D;  4DXA B;  1TXD A;  4L1R A;  3ML4 A;  4WVF B;  1V61 A;  3V5W A;  2V76 A;  3KRW A;  2KIE A;  1KZG A;  4WSF A;  3SYX A;  3AU4 A;  2DA0 A;  3BJI A;  1GC6 A;  3G9W A;  2P0H A;  2DTC A;  2XQN M;  2RVB B;  2JP2 A;  2Y7B A;  3TCA A;  2KUP A;  1EF1 A;  2DYN A;  5HE3 A;  4K2O A;  2D4Q A;  1SHC A;  1WGU A;  2J0J A;  5KCV A;  3NW8 A;  2RNR B;  1FGY A;  3N7C A;  5C79 A;  2DHI A;  2GS0 A;  1DBH A;  2ROV A;  2Z59 A;  1WVH A;  1ZVR A;  5GOW B;  4CHM A;  2Z4D A;  5CLQ B;  2DN6 A;  4XWX A;  2HTH B;  1W1G A;  3NWF A;  3B77 A;  1OY2 A;  4HAZ B;  5L81 A;  3NWD A;  2DKQ A;  1MK9 B;  2MDX A;  3NSU A;  3TW1 A;  2COF A;  2DX5 A;  2E2X A;  1XCG A;  2I1K A;  3QIJ A;  1NTV A;  2COC A;  4KHO A;  5C5B B;  4B6H A;  1FOE A;  1UPR A;  4HAT B;  2NZ8 B;  2M14 A;  3O96 A;  1XOD A;  4D6W A;  2UZS A;  2DKP A;  3KY9 A;  1P6S A;  3SNH A;  3SUZ A;  3TFM A;  4K81 A;  1FAO A;  1DRO A;  5EFX A;  4TKN A;  3RCP A;  4HAV B;  3F5R A;  1BWN A;  3IVF A;  4DIX A;  2EC1 A;  5D3W A;  1DDV A;  4TYZ A;  2IFS A;  2GJY A;  2Z13 A;  1J0W A;  5JHG A;  4KAX B;  4QXA B;  2K2U A;  2RGN B;  3PP2 A;  2GCJ A;  4EKU A;  2EJ8 A;  2H7D A;  3P6A A;  2UZR A;  3PVW A;  3A8Q A;  4A6H A;  4A6F B;  3MPX A;  1X86 A;  4HHV A;  3WYF B;  2R09 A;  3DXD A;  2D2Q A;  5JP4 A;  2ZPY A;  2Z0O A;  2I5F A;  1LB1 A;  1ZSQ A;  5C5B A;  3M1I B;  3OAN A;  5DIF B;  1MI1 A;  2W2W A;  4QJ5 B;  4F7H A;  4MT7 A;  1DDM A;  3A98 B;  3D8E A;  1P3R A;  2AEH A;  2YT0 A;  2CAY A;  1SGH A;  1UNR A;  4F7U P;  4GMV A;  2Z0P A;  4P7I A;  3GYO A;  1MK7 B;  2GUM A;  1H4R A;  2OTX A;  3WA0 A;  5DH9 B;  4GZU A;  2H7E A;  3FEH A;  1MAI A;  4HDO A;  4NY0 A;  2COA A;  2K2J A;  2RRF A;  1P5T A;  4IOY X;  4L6E A;  4DX9 0;  3U7D A;  4GOU A;  2LOX A;  2YRY A;  3T06 A;  5HE2 A;  1RRP B;  2D11 A;  3DCX A;  2IYB A;  4A6F A;  2L1C A;  2Y8F A;  3CXB B;  2I5C A;  3KSY A;  1B55 A;  3HIE A;  5D3X A;  1TJ6 A;  5DHF B;  1DYN A;  2FJL A;  1BTK A;  1QQG A;  1X05 A;  2PZ1 A;  1WGQ A;  2R2Y A;  2AL6 A;  2D9W A;  2HE7 A;  3ODW A;  4GN1 A;  4OT1 A;  1OQN A;  2K49 A;  3OHM B;  4MY6 A;  5J3T A;  2P0D A;  1WI1 A;  2LYD A;  2I1J A;  4GNK B;  2VSZ A;  2EMT A;  4BBK A;  2CRF A;  1U5E A;  3U12 A;  1XD4 A;  2ELA A;  5I2S A;  5D3V A;  1BAK A;  2YS1 A;  4H8S A;  2DFK A;  2MWN B;  1QC6 A;  4KHA A;  4YON A;  2VKI A;  4C0A A;  1UNP A;  5LOP B;  1N3H A;  3VIA A;  5DI9 B;  1FHW A;  2YT1 A;  4K17 A;  4KHB B;  4Z2M B;  4QJ4 B;  3X23 A;  4ZRI A;  1J19 A;  1V88 A;  1ISN A;  1PMS A;  1IRS A;  2CY4 A;  2DYQ A;  1EAZ A;  5J3Y A;  3D8D A;  5HE0 A;  3ZDT A;  1NI2 A;  1H10 A;  4F7G A;  4HAW B;  4IFS A;  3ZVR A;  1M7E A;  2DHK A;  1MIX A;  4EJN A;  2RSG A;  1KZ7 A;  3U8Z A;  2ELB A;  1T77 A;  1LW3 A;  4DX8 A;  1W1H A;  1PFJ A;  4CYE A;  1DDW A;  2P0F A;  1V5M A;  2N0Y A;  1V5P A;  3HW2 B;  5FI0 A;  1NTY A;  4D0N B;  5LG4 B;  1NU2 A;  3HQC A;  2DHJ A;  2YVC A;  3HSA A;  1ZYI A;  3PSC A;  2YS3 A;  3F0W A;  1FB8 A;  5D27 A;  4DBB A;  1ZC3 B;  2DX1 A;  3P7Z A;  1E5W A;  3MDB C;  2D9X A;  4HAY B;  4K2P A;  2LG1 A;  1XX0 A;  3AU5 A;  2YS5 A;  1PLS A;  2ZKM X;  1U5D A;  1U5F A;  4KHB A;  4ZRJ A;  4CHJ A;  3DXC A;  2YF0 A;  1Z87 A;  3ULC A;  2MKR A;  1KI1 B;  2J59 M;  3TO1 A;  1AWE A;  3A58 A;  4MK0 A;  4NSW A;  1UNQ A;  2Q13 A;  2D9Z A;  1MKE A;  3GYP A;  3BIN A;  2J0K A;  3NWA A;  4HSI A;  3ODO A;  3PVL A;  1W1D A;  2P8V A;  1GG3 A;  5FI1 A;  2YSZ A;  5JLJ B;  4GMX B;  1I2H A;  3FM8 C;  4GXB A;  4HDQ A;  3PEG A;  1XKE A;  3FSS A;  2D9Y A;  2KCJ A;  1FGZ A;  5C6R A;  1K5D B;  1MPH A;  1UPQ A;  1GC7 A;  2Z14 A;  5J3Q A;  1U27 A;  5I2M A;  1X1G A;  4QJ3 B;  2NMB A;  2N23 A;  3SO6 A;  3D8F A;  2Z0Q A;  4A5K A;  2KIG A;  2KUQ A;  2YT2 A;  3PVU A;  3QWM A;  2BCJ A;  3PG7 A;  3KZ1 A;  3AJ4 A;  4Z2N A;  1Y5O A;  5D3Y A;  3HK0 A;  2D9V A;  4WJ7 A;  2UVM A;  2RUK B;  5M4Y B;  1RJ2 A;  1ZM0 A;  1I7A A;  4PQ0 A;  1ZC4 B;  1TQZ A;  1UEF A;  1WJ1 A;  2VRW B;  2L2I A;  2NBV A;  4HAX B;  2FJU B;  2KGX B;  2OQB A;  2CY5 A;  3ULB A;  1X1F A;  4ZRK A;  4A6K A;  4KVG B;  1WJM A;  1U2B A;  5IRS A;  4HB3 B;  4HB0 B;  3SV1 A;  5DHA B;  2RLO A;  4HB2 B;  3FVC A;  4EMO A;  2LOZ A;  1X11 A;  3PZD A;  1BTN A;  1U5G A;  1MIZ B;  3A8P A;  4YL8 A;  1EVH A;  2Y8G A;  4OSN A;  3QBV B;  3KRX A;  3LJU X;  2LKO A;  1Y19 B;  3VOQ A;  2QKL A;  1EGX A;  4PNK A;  2J0M A;  1WG7 A;  2R0D A;  2G35 A;  1Q67 A;  4Y94 A;  1V89 A;  1FHX A;  3DXE A;  3UZT A;  4HAU B;  5CLL B;  1FHO A;  1OMW A;  2X18 A;  1V5U A;  2DLW A;  2K00 A;  4GPT B;  2K8E A;  1M7R A;  2QKM A;  5HE1 A;  2EMS A;  2GCL A;  1XR0 B;  3TVV A;  2ROZ B;  4CSQ A;  3ODX A;  5KQ1 A;  4HB4 B;  2M38 A;  5C16 A;  1K5G B;  1U29 A;  5LON B;  2KR0 A;  1AQC A;  2ADZ A;  5KQ4 A;  2MFQ A;  5JHH A;  3CIK A; 
#chains in the Genus database with same CATH homology
 2LUL A;  4IAP A;  2COD A;  2D10 A;  2W2X C;  2W2X D;  4DXA B;  1TXD A;  3ML4 A;  4WVF B;  1V61 A;  3V5W A;  2V76 A;  3KRW A;  1KZG A;  4WSF A;  3SYX A;  3AU4 A;  2DA0 A;  3BJI A;  1GC6 A;  3G9W A;  2P0H A;  2DTC A;  2XQN M;  2RVB B;  2JP2 A;  2Y7B A;  3TCA A;  2KUP A;  1EF1 A;  2DYN A;  5HE3 A;  4K2O A;  2D4Q A;  1SHC A;  1WGU A;  2J0J A;  5KCV A;  2RNR B;  1FGY A;  3N7C A;  5C79 A;  2DHI A;  2GS0 A;  1DBH A;  2ROV A;  1WVH A;  1ZVR A;  5GOW B;  4CHM A;  5CLQ B;  2DN6 A;  4XWX A;  2HTH B;  1W1G A;  5L81 A;  1OY2 A;  4HAZ B;  2DKQ A;  1MK9 B;  2MDX A;  3NSU A;  3TW1 A;  2COF A;  2DX5 A;  2E2X A;  1XCG A;  2I1K A;  3QIJ A;  1NTV A;  2COC A;  4KHO A;  5C5B B;  4B6H A;  1FOE A;  1UPR A;  4HAT B;  2NZ8 B;  2M14 A;  3O96 A;  1XOD A;  2UZS A;  2DKP A;  3KY9 A;  1P6S A;  3SNH A;  3SUZ A;  3TFM A;  4K81 A;  1FAO A;  1DRO A;  5EFX A;  4TKN A;  3RCP A;  4HAV B;  3F5R A;  1BWN A;  3IVF A;  2EC1 A;  5D3W A;  1DDV A;  4TYZ A;  2IFS A;  2GJY A;  1J0W A;  5JHG A;  4KAX B;  2K2U A;  2RGN B;  3PP2 A;  2GCJ A;  4EKU A;  2EJ8 A;  2H7D A;  3P6A A;  2UZR A;  3PVW A;  3A8Q A;  4A6H A;  4A6F B;  3MPX A;  1X86 A;  4HHV A;  3WYF B;  2R09 A;  3DXD A;  2D2Q A;  5JP4 A;  2ZPY A;  2Z0O A;  2I5F A;  1LB1 A;  1ZSQ A;  5C5B A;  3M1I B;  3OAN A;  5DIF B;  2W2W A;  4F7H A;  4MT7 A;  1DDM A;  3A98 B;  3D8E A;  1P3R A;  2AEH A;  2YT0 A;  2CAY A;  1SGH A;  1UNR A;  4F7U P;  4GMV A;  2Z0P A;  4P7I A;  3GYO A;  1MK7 B;  2OTX A;  1H4R A;  3WA0 A;  5DH9 B;  4GZU A;  2H7E A;  3FEH A;  1MAI A;  4HDO A;  4NY0 A;  2COA A;  2K2J A;  1P5T A;  4IOY X;  4L6E A;  4DX9 0;  3U7D A;  2LOX A;  2YRY A;  3T06 A;  5HE2 A;  1RRP B;  2D11 A;  2IYB A;  4A6F A;  2L1C A;  2Y8F A;  3CXB B;  2I5C A;  3KSY A;  1B55 A;  5D3X A;  1TJ6 A;  5DHF B;  1DYN A;  2FJL A;  1BTK A;  1QQG A;  1X05 A;  2PZ1 A;  1WGQ A;  2AL6 A;  2D9W A;  2HE7 A;  3ODW A;  4GN1 A;  1OQN A;  4MY6 A;  5J3T A;  2P0D A;  1WI1 A;  2LYD A;  2I1J A;  2VSZ A;  2EMT A;  4BBK A;  2CRF A;  1U5E A;  1XD4 A;  2ELA A;  5D3V A;  1BAK A;  2YS1 A;  4H8S A;  2DFK A;  2MWN B;  1QC6 A;  4KHA A;  4YON A;  2VKI A;  4C0A A;  1UNP A;  5LOP B;  1N3H A;  3VIA A;  5DI9 B;  1FHW A;  2YT1 A;  4K17 A;  4KHB B;  4Z2M B;  3X23 A;  4ZRI A;  1J19 A;  1V88 A;  1ISN A;  1PMS A;  1IRS A;  2CY4 A;  2DYQ A;  1EAZ A;  5J3Y A;  3D8D A;  5HE0 A;  3ZDT A;  1NI2 A;  1H10 A;  4F7G A;  4HAW B;  4IFS A;  3ZVR A;  1M7E A;  2DHK A;  1MIX A;  4EJN A;  2RSG A;  1KZ7 A;  3U8Z A;  2ELB A;  1LW3 A;  4DX8 A;  1W1H A;  1PFJ A;  4CYE A;  1DDW A;  2P0F A;  1V5M A;  2N0Y A;  1V5P A;  3HW2 B;  5FI0 A;  1NTY A;  4D0N B;  1NU2 A;  3HQC A;  2DHJ A;  2YVC A;  3PSC A;  2YS3 A;  3F0W A;  1FB8 A;  5D27 A;  4DBB A;  1ZC3 B;  2DX1 A;  3P7Z A;  1E5W A;  3MDB C;  2D9X A;  4HAY B;  4K2P A;  2LG1 A;  1XX0 A;  3AU5 A;  2YS5 A;  1PLS A;  1U5D A;  1U5F A;  4ZRJ A;  4CHJ A;  3DXC A;  2YF0 A;  1Z87 A;  3ULC A;  2MKR A;  1KI1 B;  2J59 M;  3TO1 A;  1AWE A;  4MK0 A;  4NSW A;  1UNQ A;  2Q13 A;  2D9Z A;  1MKE A;  3GYP A;  3BIN A;  2J0K A;  3ODO A;  3PVL A;  1W1D A;  2P8V A;  1GG3 A;  5FI1 A;  2YSZ A;  5JLJ B;  4GMX B;  1I2H A;  3FM8 C;  4GXB A;  4HDQ A;  3PEG A;  1XKE A;  3FSS A;  2D9Y A;  2KCJ A;  1FGZ A;  5C6R A;  1K5D B;  1MPH A;  1UPQ A;  1GC7 A;  5J3Q A;  1U27 A;  1X1G A;  2NMB A;  2N23 A;  3SO6 A;  3D8F A;  2Z0Q A;  4A5K A;  3PVU A;  3QWM A;  2BCJ A;  3PG7 A;  3KZ1 A;  3AJ4 A;  4Z2N A;  1Y5O A;  5D3Y A;  3HK0 A;  2D9V A;  4WJ7 A;  2UVM A;  2RUK B;  1RJ2 A;  1ZM0 A;  1I7A A;  4PQ0 A;  1ZC4 B;  1TQZ A;  1UEF A;  1WJ1 A;  2VRW B;  2L2I A;  4HAX B;  2KGX B;  2OQB A;  2CY5 A;  3ULB A;  1X1F A;  4ZRK A;  4A6K A;  4KVG B;  1WJM A;  1U2B A;  4HB3 B;  4HB0 B;  3SV1 A;  5DHA B;  2RLO A;  4HB2 B;  4EMO A;  2LOZ A;  1X11 A;  3PZD A;  1BTN A;  1U5G A;  1MIZ B;  3A8P A;  4YL8 A;  1EVH A;  2Y8G A;  3QBV B;  3KRX A;  3LJU X;  2LKO A;  1Y19 B;  3VOQ A;  2QKL A;  1EGX A;  4PNK A;  2J0M A;  1WG7 A;  2R0D A;  2G35 A;  1Q67 A;  4Y94 A;  1V89 A;  1FHX A;  3DXE A;  3UZT A;  4HAU B;  5CLL B;  1FHO A;  1OMW A;  2X18 A;  1V5U A;  2DLW A;  2K00 A;  4GPT B;  1M7R A;  2QKM A;  5HE1 A;  2EMS A;  2GCL A;  1XR0 B;  3TVV A;  2ROZ B;  3ODX A;  5KQ1 A;  4HB4 B;  2M38 A;  5C16 A;  1K5G B;  1U29 A;  5LON B;  1AQC A;  2ADZ A;  5KQ4 A;  2MFQ A;  5JHH A;  3CIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...