1U5EA

Crystal structure of a n-terminal fragment of skap-hom containing both the helical dimerization domain and the ph domain
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
211
structure length
170
Chain Sequence
GSPEEIRNLLADVETFVADTLKGENLSKKAKEKRESLIKKIKDVKSVYLQEFQFPPIAAQDLPFVIKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYDVRMNNTLRKDGKKDCCFEICAPDKRIYQFTAASPKDAEEWVQQLKFILQDLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Dimerization and Phosphoinositide Specificity of the Src Kinase-associated Phosphoproteins SKAP55 and SKAP-Hom
rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Src-associated adaptor protein
total genus 51
structure length 170
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1u5eA02
3TCAA 1XCGA 5D3WA 1E5WA 4F7GA 4GN1A 2YSZA 1U5FA 4IOYX 4TKNA 3FSSA 2Y8FA 2P0FA 3N7CA 2J0KA 1WGQA 1V88A 3T06A 2ROZB 3V5WA 2YT0A 1N3HA 4TYZA 1U2BA 5J3QA 2RLOA 4GMVA 3SNHA 3SYXA 5LONB 4EJNA 1FB8A 1DYNA 2Q13A 4H8SA 4K17A 2L2IA 4DBBA 1PMSA 5KQ4A 1LW3A 5C6RA 2W2WA 2K2JA 3WYFB 5C16A 2CY4A 3QWMA 1DBHA 1QQGA 2Y7BA 2YF0A 2QKLA 2COFA 2YT1A 2D11A 5DHFB 4A6FA 2D9ZA 3NSUA 1ZVRA 4CYEA 4GZUA 3D8DA 5GOWB 2AEHA 3A8QA 3WA0A 1V5MA 1X05A 2W2XC 2M14A 1UNRA 3X23A 4A6FB 3CXBB 4CHJA 3SV1A 2IFSA 1IRSA 1V89A 1WJMA 4EKUA 2J59M 1MPHA 3ZVRA 3KSYA 5CLQB 3F0WA 1EF1A 2D9WA 2P8VA 3FM8C 1V61A 4KHAA 3AU5A 4HB3B 5CLLB 2D2QA 2LULA 4A6HA 1MAIA 4ZRKA 2H7EA 2D10A 2K00A 1UPRA 2KUPA 1MK9B 2X18A 5D3YA 4K2OA 2PZ1A 1PFJA 1V5UA 1WG7A 2KCJA 2GJYA 1J19A 2DFKA 1EAZA 5HE3A 3PSCA 5HE2A 3CIKA 3ODOA 2D9XA 4KHOA 1GC6A 2MDXA 1RJ2A 5FI1A 1U5GA 1OMWA 1OQNA 1MIZB 1KI1B 4WSFA 3DXEA 4HB4B 1KZ7A 4Y94A 5JLJB 4NSWA 4F7UP 2DA0A 2J0JA 1SGHA 3ULBA 2I1JA 2JP2A 4KVGB 1BTNA 4MT7A 4XWXA 1FOEA 2RSGA 5C79A 3PVLA 2DX1A 4MY6A 1XKEA 2OQBA 4HDOA 2G35A 1W1DA 3U8ZA 2UZSA 3D8FA 4KAXB 2DX5A 1NTYA 2FJLA 5LOPB 2ADZA 1U29A 2MWNB 5JHGA 2ZPYA 3GYPA 1SHCA 1EVHA 3OANA 1KZGA 1WGUA 2DKPA 4HAUB 5DH9B 1W1GA 3VIAA 1UEFA 1K5GB 1FHWA 1NI2A 2P0DA 1LB1A 2XQNM 2V76A 5C5BB 5HE1A 4WJ7A 2LG1A 3TO1A 5FI0A 1DDVA 3KZ1A 5D3XA 4HATB 4Z2MB 3M1IB 3ML4A 1WI1A 1XR0B 4PQ0A 1FAOA 2Y8GA 4GPTB 3KY9A 3BINA 3MPXA 4A6KA 4HAZB 2DLWA 2OTXA 2YRYA 2YVCA 3G9WA 1UPQA 2Z0PA 2R0DA 1NU2A 3SO6A 3PVWA 5J3YA 4BBKA 3RCPA 1X11A 1B55A 1P3RA 2VRWB 1MKEA 1M7RA 2YS3A 5J3TA 2RNRB 2MFQA 2CY5A 1AQCA 2HE7A 3FEHA 4HAYB 1GG3A 2EC1A 2CAYA 4P7IA 3ZDTA 5HE0A 1TQZA 2EMTA 5JHHA 2DN6A 2LOXA 2N23A 1UNQA 3TVVA 1XD4A 1K5DB 1Y5OA 1H4RA 3O96A 1WVHA 2I5FA 3PEGA 3GYOA 4HAWB 5JP4A 1ISNA 4L6EA 5DIFB 2Z0OA 2DYQA 1FGYA 2LKOA 3P6AA 2IYBA 5KCVA 2D9YA 2DKQA 4K2PA 2L1CA 4ZRIA 3PVUA 2GCJA 3DXCA 2I5CA 2EJ8A 3IVFA 2COCA 4D0NB 3ODXA 2W2XD 1J0WA 2ELAA 3U7DA 4IFSA 1NTVA 1WJ1A 4DXAB 1FHXA 1XX0A 2AL6A 2LYDA 2H7DA 1X1GA 1W1HA 4GMXB 1BTKA 2ROVA 1U27A 1OY2A 2UVMA 2K2UA 1DDWA 2COAA 4IAPA 1P6SA 1ZC4B 1I7AA 1PLSA 4PNKA 2DHKA 3SUZA 3TFMA 2QKMA 1XODA 2VKIA 4A5KA 3ODWA 3AJ4A 5KQ1A 3D8EA 2D4QA 2GCLA 4HB2B 3A98B 5EFXA 2DYNA 1FGZA 4YL8A 4NY0A 1U5DA 1X1FA 3P7ZA 4DX8A 1BAKA 3A8PA 1UNPA 2HTHB 1H10A 3HW2B 4KHBB 2YS5A 1EGXA 1U5EA 4HAVB 1ZC3B 2RUKB 3MDBC 2CRFA 2MKRA 2EMSA 1Y19B 5D27A 1AWEA 2LOZA 1Z87A 3LJUX 1BWNA 4HDQA 1GC7A 5L81A 2R09A 2CODA 2J0MA 1MK7B 2BCJA 1ZM0A 4MK0A 4YONA 3QBVB 3F5RA 1M7EA 3TW1A 1X86A 4ZRJA 2D9VA 3QIJA 3UZTA 2DHIA 5D3VA 5DHAB 3ULCA 3BJIA 1TXDA 2GS0A 3HQCA 2UZRA 4HB0B 5DI9B 1Q67A 3KRWA 1P5TA 3KRXA 2DTCA 1RRPB 3PZDA 2I1KA 4EMOA 3PG7A 2NMBA 5C5BA 3PP2A 2E2XA 4DX90 1QC6A 4CHMA 4Z2NA 2P0HA 2M38A 2NZ8B 4HAXB 4C0AA 2VSZA 2RGNB 2KGXB 1V5PA 2RVBB 3HK0A 1TJ6A 1FHOA 2Z0QA 4WVFB 2ELBA 2N0YA 3AU4A 1ZSQA 2DHJA 1MIXA 1DDMA 4HHVA 1I2HA 4K81A 3VOQA 3DXDA 1DROA 4B6HA 4F7HA 4GXBA 2YS1A
chains in the Genus database with same CATH superfamily
4HSIA 3TCAA 1XCGA 5D3WA 1E5WA 4F7GA 4GN1A 2YSZA 1U5FA 4IOYX 4TKNA 3FSSA 2Y8FA 5IRSA 2P0FA 3N7CA 2NBVA 2J0KA 1WGQA 1V88A 3T06A 2ROZB 3V5WA 2YT0A 1N3HA 3DCXA 4TYZA 1U2BA 5J3QA 2RLOA 4GMVA 3SNHA 3SYXA 5LONB 4EJNA 1FB8A 2K49A 1DYNA 2Q13A 4H8SA 4K17A 2L2IA 4DBBA 1PMSA 5KQ4A 1LW3A 5C6RA 2W2WA 2K2JA 3WYFB 5C16A 2KUQA 2CY4A 3QWMA 1DBHA 1QQGA 2Y7BA 2YF0A 2QKLA 2COFA 2YT1A 2D11A 5DHFB 4A6FA 2D9ZA 3NSUA 1ZVRA 4CYEA 4GZUA 3D8DA 5GOWB 2AEHA 3A8QA 3WA0A 1V5MA 1X05A 2W2XC 2M14A 2FJUB 1UNRA 3X23A 4A6FB 3CXBB 4CHJA 3SV1A 2IFSA 1IRSA 1V89A 1WJMA 2ZKMX 4EKUA 2J59M 4OSNA 1MPHA 3ZVRA 3KSYA 5CLQB 3F0WA 1EF1A 2D9WA 2P8VA 3FM8C 1V61A 4QXAB 4KHAA 3AU5A 4HB3B 5CLLB 2D2QA 2LULA 4A6HA 1MAIA 2Z59A 4GNKB 4ZRKA 2H7EA 2D10A 2K00A 1UPRA 2KUPA 1MK9B 2X18A 5D3YA 4K2OA 2PZ1A 1PFJA 1V5UA 1WG7A 2KCJA 2GJYA 1J19A 2DFKA 1EAZA 5HE3A 3PSCA 5HE2A 3CIKA 3ODOA 2D9XA 4KHOA 1GC6A 2MDXA 1RJ2A 3B77A 5FI1A 1U5GA 1OMWA 1OQNA 1MIZB 3FVCA 1KI1B 4WSFA 3DXEA 4HB4B 1KZ7A 4Y94A 5JLJB 4NSWA 4F7UP 2DA0A 2J0JA 1SGHA 3ULBA 2I1JA 2JP2A 4KVGB 1BTNA 4MT7A 4XWXA 1FOEA 2RSGA 5C79A 3PVLA 2DX1A 4MY6A 4QJ5B 1XKEA 2OQBA 4HDOA 2G35A 1W1DA 3U8ZA 2UZSA 3D8FA 4KAXB 2DX5A 1NTYA 2FJLA 5LOPB 3NWDA 2ADZA 1U29A 2MWNB 5JHGA 2ZPYA 3GYPA 3HIEA 1SHCA 1EVHA 3OANA 1KZGA 1WGUA 2DKPA 4HAUB 3NWFA 5DH9B 1W1GA 2YT2A 1UEFA 3VIAA 1K5GB 1FHWA 3HSAA 1NI2A 2P0DA 1LB1A 2R2YA 2XQNM 2V76A 5C5BB 5HE1A 4WJ7A 2LG1A 3TO1A 5FI0A 1DDVA 3KZ1A 5D3XA 4HATB 4Z2MB 3M1IB 3ML4A 1WI1A 1XR0B 4PQ0A 1FAOA 2Y8GA 4GPTB 3KY9A 3BINA 3MPXA 4A6KA 4HAZB 2DLWA 2OTXA 2YRYA 2YVCA 2K8EA 3G9WA 1UPQA 2Z0PA 2R0DA 4GOUA 1NU2A 3SO6A 3PVWA 5J3YA 4BBKA 3RCPA 1X11A 1B55A 1P3RA 2VRWB 4QJ3B 2Z4DA 1MKEA 1M7RA 2YS3A 5M4YB 5J3TA 2RNRB 2MFQA 2CY5A 1AQCA 2HE7A 3FEHA 4HAYB 1GG3A 2EC1A 2CAYA 4P7IA 3ZDTA 5HE0A 1TQZA 2EMTA 5JHHA 2DN6A 2LOXA 2N23A 1UNQA 3TVVA 1XD4A 1K5DB 1Y5OA 1H4RA 3O96A 1WVHA 2I5FA 3PEGA 3GYOA 3NW8A 4DIXA 4HAWB 1T77A 5JP4A 1ISNA 4L6EA 5DIFB 2Z0OA 2DYQA 1FGYA 2Z13A 2LKOA 3P6AA 2IYBA 5KCVA 2D9YA 2DKQA 4K2PA 2L1CA 4ZRIA 3PVUA 2GCJA 4KHBA 3DXCA 2I5CA 2EJ8A 3IVFA 2COCA 4D0NB 3ODXA 2W2XD 1J0WA 2ELAA 2KIGA 2RRFA 3U7DA 4IFSA 1NTVA 1WJ1A 4DXAB 1FHXA 1XX0A 2AL6A 2LYDA 2H7DA 1X1GA 1W1HA 4GMXB 1BTKA 2ROVA 1U27A 1OY2A 2UVMA 2K2UA 1DDWA 2COAA 3OHMB 1P6SA 1ZC4B 4IAPA 1I7AA 1PLSA 4PNKA 2DHKA 3SUZA 3TFMA 2QKMA 1XODA 2VKIA 4A5KA 3ODWA 3AJ4A 5KQ1A 1ZYIA 3D8EA 2D4QA 2GCLA 4HB2B 3A98B 5EFXA 3U12A 2DYNA 1FGZA 4YL8A 4NY0A 1U5DA 1X1FA 3P7ZA 4DX8A 1BAKA 3A8PA 1UNPA 2HTHB 1H10A 3HW2B 4KHBB 2YS5A 1EGXA 1U5EA 4HAVB 1ZC3B 2RUKB 3MDBC 2Z14A 2CRFA 2MKRA 2EMSA 1Y19B 5D27A 1AWEA 2LOZA 1Z87A 5I2SA 3LJUX 1BWNA 4HDQA 1GC7A 5L81A 2R09A 2CODA 2J0MA 1MK7B 2BCJA 1ZM0A 2GUMA 4MK0A 4L1RA 4YONA 4OT1A 3QBVB 3F5RA 1M7EA 3TW1A 1X86A 4ZRJA 2D9VA 3QIJA 3UZTA 2DHIA 5D3VA 5DHAB 3ULCA 3BJIA 1MI1A 1TXDA 2GS0A 3HQCA 2UZRA 4HB0B 5DI9B 1Q67A 3KRWA 1P5TA 2KIEA 3KRXA 2DTCA 1RRPB 2KR0A 3PZDA 2I1KA 4EMOA 3PG7A 5LG4B 2NMBA 5C5BA 3PP2A 2E2XA 4DX90 1QC6A 4CHMA 4Z2NA 2P0HA 2M38A 3A58A 2NZ8B 4HAXB 4C0AA 2VSZA 2RGNB 2KGXB 1V5PA 4QJ4B 2RVBB 3HK0A 1TJ6A 5I2MA 1FHOA 2Z0QA 4WVFB 4D6WA 2ELBA 2N0YA 3AU4A 1ZSQA 2DHJA 1MIXA 1DDMA 4HHVA 2YS1A 1I2HA 4K81A 3VOQA 3DXDA 1DROA 4B6HA 4F7HA 4GXBA 3NWAA 4CSQA
chains in the Genus database with same CATH topology
3TCAA 1XCGA 5D3WA 1E5WA 4F7GA 4GN1A 2YSZA 1U5FA 4IOYX 4TKNA 3FSSA 2Y8FA 2P0FA 3N7CA 2J0KA 1WGQA 1V88A 3T06A 2ROZB 3V5WA 2YT0A 1N3HA 4TYZA 1U2BA 5J3QA 2RLOA 4GMVA 3SNHA 3SYXA 5LONB 4EJNA 1FB8A 1DYNA 2Q13A 4H8SA 4K17A 2L2IA 4DBBA 1PMSA 5KQ4A 1LW3A 5C6RA 2W2WA 2K2JA 3WYFB 5C16A 2CY4A 3QWMA 1DBHA 1QQGA 2Y7BA 2YF0A 2QKLA 2COFA 2YT1A 2D11A 5DHFB 4A6FA 2D9ZA 3NSUA 1ZVRA 4CYEA 4GZUA 3D8DA 5GOWB 2AEHA 3A8QA 3WA0A 1V5MA 1X05A 2W2XC 2M14A 1UNRA 3X23A 4A6FB 3CXBB 4CHJA 3SV1A 2IFSA 1IRSA 1V89A 1WJMA 4EKUA 2J59M 1MPHA 3ZVRA 3KSYA 5CLQB 3F0WA 1EF1A 2D9WA 2P8VA 3FM8C 1V61A 4KHAA 3AU5A 4HB3B 5CLLB 2D2QA 2LULA 4A6HA 1MAIA 4ZRKA 2H7EA 2D10A 2K00A 1UPRA 2KUPA 1MK9B 2X18A 5D3YA 4K2OA 2PZ1A 1PFJA 1V5UA 1WG7A 2KCJA 2GJYA 1J19A 2DFKA 1EAZA 5HE3A 3PSCA 5HE2A 3CIKA 3ODOA 2D9XA 4KHOA 1GC6A 2MDXA 1RJ2A 5FI1A 1U5GA 1OMWA 1OQNA 1MIZB 1KI1B 4WSFA 3DXEA 4HB4B 1KZ7A 4Y94A 5JLJB 4NSWA 4F7UP 2DA0A 2J0JA 1SGHA 3ULBA 2I1JA 2JP2A 4KVGB 1BTNA 4MT7A 4XWXA 1FOEA 2RSGA 5C79A 3PVLA 2DX1A 4MY6A 1XKEA 2OQBA 4HDOA 2G35A 1W1DA 3U8ZA 2UZSA 3D8FA 4KAXB 2DX5A 1NTYA 2FJLA 5LOPB 2ADZA 1U29A 2MWNB 5JHGA 2ZPYA 3GYPA 1SHCA 1EVHA 3OANA 1KZGA 1WGUA 2DKPA 4HAUB 5DH9B 1W1GA 3VIAA 1UEFA 1K5GB 1FHWA 1NI2A 2P0DA 1LB1A 2XQNM 2V76A 5C5BB 5HE1A 4WJ7A 2LG1A 3TO1A 5FI0A 1DDVA 3KZ1A 5D3XA 4HATB 4Z2MB 3M1IB 3ML4A 1WI1A 1XR0B 4PQ0A 1FAOA 2Y8GA 4GPTB 3KY9A 3BINA 3MPXA 4A6KA 4HAZB 2DLWA 2OTXA 2YRYA 2YVCA 3G9WA 1UPQA 2Z0PA 2R0DA 1NU2A 3SO6A 3PVWA 5J3YA 4BBKA 3RCPA 1X11A 1B55A 1P3RA 2VRWB 1MKEA 1M7RA 2YS3A 5J3TA 2RNRB 2MFQA 2CY5A 1AQCA 2HE7A 3FEHA 4HAYB 1GG3A 2EC1A 2CAYA 4P7IA 3ZDTA 5HE0A 1TQZA 2EMTA 5JHHA 2DN6A 2LOXA 2N23A 1UNQA 3TVVA 1XD4A 1K5DB 1Y5OA 1H4RA 3O96A 1WVHA 2I5FA 3PEGA 3GYOA 4HAWB 5JP4A 1ISNA 4L6EA 5DIFB 2Z0OA 2DYQA 1FGYA 2LKOA 3P6AA 2IYBA 5KCVA 2D9YA 2DKQA 4K2PA 2L1CA 4ZRIA 3PVUA 2GCJA 3DXCA 2I5CA 2EJ8A 3IVFA 2COCA 4D0NB 3ODXA 2W2XD 1J0WA 2ELAA 3U7DA 4IFSA 1NTVA 1WJ1A 4DXAB 1FHXA 1XX0A 2AL6A 2LYDA 2H7DA 1X1GA 1W1HA 4GMXB 1BTKA 2ROVA 1U27A 1OY2A 2UVMA 2K2UA 1DDWA 2COAA 4IAPA 1P6SA 1ZC4B 1I7AA 1PLSA 4PNKA 2DHKA 3SUZA 3TFMA 2QKMA 1XODA 2VKIA 4A5KA 3ODWA 3AJ4A 5KQ1A 3D8EA 2D4QA 2GCLA 4HB2B 3A98B 5EFXA 2DYNA 1FGZA 4YL8A 4NY0A 1U5DA 1X1FA 3P7ZA 4DX8A 1BAKA 3A8PA 1UNPA 2HTHB 1H10A 3HW2B 4KHBB 2YS5A 1EGXA 1U5EA 4HAVB 1ZC3B 2RUKB 3MDBC 2CRFA 2MKRA 2EMSA 1Y19B 5D27A 1AWEA 2LOZA 1Z87A 3LJUX 1BWNA 4HDQA 1GC7A 5L81A 2R09A 2CODA 2J0MA 1MK7B 2BCJA 1ZM0A 4MK0A 4YONA 3QBVB 3F5RA 1M7EA 3TW1A 1X86A 4ZRJA 2D9VA 3QIJA 3UZTA 2DHIA 5D3VA 5DHAB 3ULCA 3BJIA 1TXDA 2GS0A 3HQCA 2UZRA 4HB0B 5DI9B 1Q67A 3KRWA 1P5TA 3KRXA 2DTCA 1RRPB 3PZDA 2I1KA 4EMOA 3PG7A 2NMBA 5C5BA 3PP2A 2E2XA 4DX90 1QC6A 4CHMA 4Z2NA 2P0HA 2M38A 2NZ8B 4HAXB 4C0AA 2VSZA 2RGNB 2KGXB 1V5PA 2RVBB 3HK0A 1TJ6A 1FHOA 2Z0QA 4WVFB 2ELBA 2N0YA 3AU4A 1ZSQA 2DHJA 1MIXA 1DDMA 4HHVA 1I2HA 4K81A 3VOQA 3DXDA 1DROA 4B6HA 4F7HA 4GXBA 2YS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TCA A;  1XCG A;  5D3W A;  1E5W A;  4F7G A;  4GN1 A;  2YSZ A;  1U5F A;  4IOY X;  4TKN A;  3FSS A;  2Y8F A;  2P0F A;  3N7C A;  2J0K A;  1WGQ A;  1V88 A;  3T06 A;  2ROZ B;  3V5W A;  2YT0 A;  1N3H A;  4TYZ A;  1U2B A;  5J3Q A;  2RLO A;  4GMV A;  3SNH A;  3SYX A;  5LON B;  4EJN A;  1FB8 A;  1DYN A;  2Q13 A;  4H8S A;  4K17 A;  2L2I A;  4DBB A;  1PMS A;  5KQ4 A;  1LW3 A;  5C6R A;  2W2W A;  2K2J A;  3WYF B;  5C16 A;  2CY4 A;  3QWM A;  1DBH A;  1QQG A;  2Y7B A;  2YF0 A;  2QKL A;  2COF A;  2YT1 A;  2D11 A;  5DHF B;  4A6F A;  2D9Z A;  3NSU A;  1ZVR A;  4CYE A;  4GZU A;  3D8D A;  5GOW B;  2AEH A;  3A8Q A;  3WA0 A;  1V5M A;  1X05 A;  2W2X C;  2M14 A;  1UNR A;  3X23 A;  4A6F B;  3CXB B;  4CHJ A;  3SV1 A;  2IFS A;  1IRS A;  1V89 A;  1WJM A;  4EKU A;  2J59 M;  1MPH A;  3ZVR A;  3KSY A;  5CLQ B;  3F0W A;  1EF1 A;  2D9W A;  2P8V A;  3FM8 C;  1V61 A;  4KHA A;  3AU5 A;  4HB3 B;  5CLL B;  2D2Q A;  2LUL A;  4A6H A;  1MAI A;  4ZRK A;  2H7E A;  2D10 A;  2K00 A;  1UPR A;  2KUP A;  1MK9 B;  2X18 A;  5D3Y A;  4K2O A;  2PZ1 A;  1PFJ A;  1V5U A;  1WG7 A;  2KCJ A;  2GJY A;  1J19 A;  2DFK A;  1EAZ A;  5HE3 A;  3PSC A;  5HE2 A;  3CIK A;  3ODO A;  2D9X A;  4KHO A;  1GC6 A;  2MDX A;  1RJ2 A;  5FI1 A;  1U5G A;  1OMW A;  1OQN A;  1MIZ B;  1KI1 B;  4WSF A;  3DXE A;  4HB4 B;  1KZ7 A;  4Y94 A;  5JLJ B;  4NSW A;  4F7U P;  2DA0 A;  2J0J A;  1SGH A;  3ULB A;  2I1J A;  2JP2 A;  4KVG B;  1BTN A;  4MT7 A;  4XWX A;  1FOE A;  2RSG A;  5C79 A;  3PVL A;  2DX1 A;  4MY6 A;  1XKE A;  2OQB A;  4HDO A;  2G35 A;  1W1D A;  3U8Z A;  2UZS A;  3D8F A;  4KAX B;  2DX5 A;  1NTY A;  2FJL A;  5LOP B;  2ADZ A;  1U29 A;  2MWN B;  5JHG A;  2ZPY A;  3GYP A;  1SHC A;  1EVH A;  3OAN A;  1KZG A;  1WGU A;  2DKP A;  4HAU B;  5DH9 B;  1W1G A;  3VIA A;  1UEF A;  1K5G B;  1FHW A;  1NI2 A;  2P0D A;  1LB1 A;  2XQN M;  2V76 A;  5C5B B;  5HE1 A;  4WJ7 A;  2LG1 A;  3TO1 A;  5FI0 A;  1DDV A;  3KZ1 A;  5D3X A;  4HAT B;  4Z2M B;  3M1I B;  3ML4 A;  1WI1 A;  1XR0 B;  4PQ0 A;  1FAO A;  2Y8G A;  4GPT B;  3KY9 A;  3BIN A;  3MPX A;  4A6K A;  4HAZ B;  2DLW A;  2OTX A;  2YRY A;  2YVC A;  3G9W A;  1UPQ A;  2Z0P A;  2R0D A;  1NU2 A;  3SO6 A;  3PVW A;  5J3Y A;  4BBK A;  3RCP A;  1X11 A;  1B55 A;  1P3R A;  2VRW B;  1MKE A;  1M7R A;  2YS3 A;  5J3T A;  2RNR B;  2MFQ A;  2CY5 A;  1AQC A;  2HE7 A;  3FEH A;  4HAY B;  1GG3 A;  2EC1 A;  2CAY A;  4P7I A;  3ZDT A;  5HE0 A;  1TQZ A;  2EMT A;  5JHH A;  2DN6 A;  2LOX A;  2N23 A;  1UNQ A;  3TVV A;  1XD4 A;  1K5D B;  1Y5O A;  1H4R A;  3O96 A;  1WVH A;  2I5F A;  3PEG A;  3GYO A;  4HAW B;  5JP4 A;  1ISN A;  4L6E A;  5DIF B;  2Z0O A;  2DYQ A;  1FGY A;  2LKO A;  3P6A A;  2IYB A;  5KCV A;  2D9Y A;  2DKQ A;  4K2P A;  2L1C A;  4ZRI A;  3PVU A;  2GCJ A;  3DXC A;  2I5C A;  2EJ8 A;  3IVF A;  2COC A;  4D0N B;  3ODX A;  2W2X D;  1J0W A;  2ELA A;  3U7D A;  4IFS A;  1NTV A;  1WJ1 A;  4DXA B;  1FHX A;  1XX0 A;  2AL6 A;  2LYD A;  2H7D A;  1X1G A;  1W1H A;  4GMX B;  1BTK A;  2ROV A;  1U27 A;  1OY2 A;  2UVM A;  2K2U A;  1DDW A;  2COA A;  4IAP A;  1P6S A;  1ZC4 B;  1I7A A;  1PLS A;  4PNK A;  2DHK A;  3SUZ A;  3TFM A;  2QKM A;  1XOD A;  2VKI A;  4A5K A;  3ODW A;  3AJ4 A;  5KQ1 A;  3D8E A;  2D4Q A;  2GCL A;  4HB2 B;  3A98 B;  5EFX A;  2DYN A;  1FGZ A;  4YL8 A;  4NY0 A;  1U5D A;  1X1F A;  3P7Z A;  4DX8 A;  1BAK A;  3A8P A;  1UNP A;  2HTH B;  1H10 A;  3HW2 B;  4KHB B;  2YS5 A;  1EGX A;  1U5E A;  4HAV B;  1ZC3 B;  2RUK B;  3MDB C;  2CRF A;  2MKR A;  2EMS A;  1Y19 B;  5D27 A;  1AWE A;  2LOZ A;  1Z87 A;  3LJU X;  1BWN A;  4HDQ A;  1GC7 A;  5L81 A;  2R09 A;  2COD A;  2J0M A;  1MK7 B;  2BCJ A;  1ZM0 A;  4MK0 A;  4YON A;  3QBV B;  3F5R A;  1M7E A;  3TW1 A;  1X86 A;  4ZRJ A;  2D9V A;  3QIJ A;  3UZT A;  2DHI A;  5D3V A;  5DHA B;  3ULC A;  3BJI A;  1TXD A;  2GS0 A;  3HQC A;  2UZR A;  4HB0 B;  5DI9 B;  1Q67 A;  3KRW A;  1P5T A;  3KRX A;  2DTC A;  1RRP B;  3PZD A;  2I1K A;  4EMO A;  3PG7 A;  2NMB A;  5C5B A;  3PP2 A;  2E2X A;  4DX9 0;  1QC6 A;  4CHM A;  4Z2N A;  2P0H A;  2M38 A;  2NZ8 B;  4HAX B;  4C0A A;  2VSZ A;  2RGN B;  2KGX B;  1V5P A;  2RVB B;  3HK0 A;  1TJ6 A;  1FHO A;  2Z0Q A;  4WVF B;  2ELB A;  2N0Y A;  3AU4 A;  1ZSQ A;  2DHJ A;  1MIX A;  1DDM A;  4HHV A;  1I2H A;  4K81 A;  3VOQ A;  3DXD A;  1DRO A;  4B6H A;  4F7H A;  4GXB A;  2YS1 A; 
#chains in the Genus database with same CATH topology
 4HSI A;  3TCA A;  1XCG A;  5D3W A;  1E5W A;  4F7G A;  4GN1 A;  2YSZ A;  1U5F A;  4IOY X;  4TKN A;  3FSS A;  2Y8F A;  5IRS A;  2P0F A;  3N7C A;  2NBV A;  2J0K A;  1WGQ A;  1V88 A;  3T06 A;  2ROZ B;  3V5W A;  2YT0 A;  1N3H A;  3DCX A;  4TYZ A;  1U2B A;  5J3Q A;  2RLO A;  4GMV A;  3SNH A;  3SYX A;  5LON B;  4EJN A;  1FB8 A;  2K49 A;  1DYN A;  2Q13 A;  4H8S A;  4K17 A;  2L2I A;  4DBB A;  1PMS A;  5KQ4 A;  1LW3 A;  5C6R A;  2W2W A;  2K2J A;  3WYF B;  5C16 A;  2KUQ A;  2CY4 A;  3QWM A;  1DBH A;  1QQG A;  2Y7B A;  2YF0 A;  2QKL A;  2COF A;  2YT1 A;  2D11 A;  5DHF B;  4A6F A;  2D9Z A;  3NSU A;  1ZVR A;  4CYE A;  4GZU A;  3D8D A;  5GOW B;  2AEH A;  3A8Q A;  3WA0 A;  1V5M A;  1X05 A;  2W2X C;  2M14 A;  2FJU B;  1UNR A;  3X23 A;  4A6F B;  3CXB B;  4CHJ A;  3SV1 A;  2IFS A;  1IRS A;  1V89 A;  1WJM A;  2ZKM X;  4EKU A;  2J59 M;  4OSN A;  1MPH A;  3ZVR A;  3KSY A;  5CLQ B;  3F0W A;  1EF1 A;  2D9W A;  2P8V A;  3FM8 C;  1V61 A;  4QXA B;  4KHA A;  3AU5 A;  4HB3 B;  5CLL B;  2D2Q A;  2LUL A;  4A6H A;  1MAI A;  2Z59 A;  4GNK B;  4ZRK A;  2H7E A;  2D10 A;  2K00 A;  1UPR A;  2KUP A;  1MK9 B;  2X18 A;  5D3Y A;  4K2O A;  2PZ1 A;  1PFJ A;  1V5U A;  1WG7 A;  2KCJ A;  2GJY A;  1J19 A;  2DFK A;  1EAZ A;  5HE3 A;  3PSC A;  5HE2 A;  3CIK A;  3ODO A;  2D9X A;  4KHO A;  1GC6 A;  2MDX A;  1RJ2 A;  3B77 A;  5FI1 A;  1U5G A;  1OMW A;  1OQN A;  1MIZ B;  3FVC A;  1KI1 B;  4WSF A;  3DXE A;  4HB4 B;  1KZ7 A;  4Y94 A;  5JLJ B;  4NSW A;  4F7U P;  2DA0 A;  2J0J A;  1SGH A;  3ULB A;  2I1J A;  2JP2 A;  4KVG B;  1BTN A;  4MT7 A;  4XWX A;  1FOE A;  2RSG A;  5C79 A;  3PVL A;  2DX1 A;  4MY6 A;  4QJ5 B;  1XKE A;  2OQB A;  4HDO A;  2G35 A;  1W1D A;  3U8Z A;  2UZS A;  3D8F A;  4KAX B;  2DX5 A;  1NTY A;  2FJL A;  5LOP B;  3NWD A;  2ADZ A;  1U29 A;  2MWN B;  5JHG A;  2ZPY A;  3GYP A;  3HIE A;  1SHC A;  1EVH A;  3OAN A;  1KZG A;  1WGU A;  2DKP A;  4HAU B;  3NWF A;  5DH9 B;  1W1G A;  2YT2 A;  1UEF A;  3VIA A;  1K5G B;  1FHW A;  3HSA A;  1NI2 A;  2P0D A;  1LB1 A;  2R2Y A;  2XQN M;  2V76 A;  5C5B B;  5HE1 A;  4WJ7 A;  2LG1 A;  3TO1 A;  5FI0 A;  1DDV A;  3KZ1 A;  5D3X A;  4HAT B;  4Z2M B;  3M1I B;  3ML4 A;  1WI1 A;  1XR0 B;  4PQ0 A;  1FAO A;  2Y8G A;  4GPT B;  3KY9 A;  3BIN A;  3MPX A;  4A6K A;  4HAZ B;  2DLW A;  2OTX A;  2YRY A;  2YVC A;  2K8E A;  3G9W A;  1UPQ A;  2Z0P A;  2R0D A;  4GOU A;  1NU2 A;  3SO6 A;  3PVW A;  5J3Y A;  4BBK A;  3RCP A;  1X11 A;  1B55 A;  1P3R A;  2VRW B;  4QJ3 B;  2Z4D A;  1MKE A;  1M7R A;  2YS3 A;  5M4Y B;  5J3T A;  2RNR B;  2MFQ A;  2CY5 A;  1AQC A;  2HE7 A;  3FEH A;  4HAY B;  1GG3 A;  2EC1 A;  2CAY A;  4P7I A;  3ZDT A;  5HE0 A;  1TQZ A;  2EMT A;  5JHH A;  2DN6 A;  2LOX A;  2N23 A;  1UNQ A;  3TVV A;  1XD4 A;  1K5D B;  1Y5O A;  1H4R A;  3O96 A;  1WVH A;  2I5F A;  3PEG A;  3GYO A;  3NW8 A;  4DIX A;  4HAW B;  1T77 A;  5JP4 A;  1ISN A;  4L6E A;  5DIF B;  2Z0O A;  2DYQ A;  1FGY A;  2Z13 A;  2LKO A;  3P6A A;  2IYB A;  5KCV A;  2D9Y A;  2DKQ A;  4K2P A;  2L1C A;  4ZRI A;  3PVU A;  2GCJ A;  4KHB A;  3DXC A;  2I5C A;  2EJ8 A;  3IVF A;  2COC A;  4D0N B;  3ODX A;  2W2X D;  1J0W A;  2ELA A;  2KIG A;  2RRF A;  3U7D A;  4IFS A;  1NTV A;  1WJ1 A;  4DXA B;  1FHX A;  1XX0 A;  2AL6 A;  2LYD A;  2H7D A;  1X1G A;  1W1H A;  4GMX B;  1BTK A;  2ROV A;  1U27 A;  1OY2 A;  2UVM A;  2K2U A;  1DDW A;  2COA A;  3OHM B;  1P6S A;  1ZC4 B;  4IAP A;  1I7A A;  1PLS A;  4PNK A;  2DHK A;  3SUZ A;  3TFM A;  2QKM A;  1XOD A;  2VKI A;  4A5K A;  3ODW A;  3AJ4 A;  5KQ1 A;  1ZYI A;  3D8E A;  2D4Q A;  2GCL A;  4HB2 B;  3A98 B;  5EFX A;  3U12 A;  2DYN A;  1FGZ A;  4YL8 A;  4NY0 A;  1U5D A;  1X1F A;  3P7Z A;  4DX8 A;  1BAK A;  3A8P A;  1UNP A;  2HTH B;  1H10 A;  3HW2 B;  4KHB B;  2YS5 A;  1EGX A;  1U5E A;  4HAV B;  1ZC3 B;  2RUK B;  3MDB C;  2Z14 A;  2CRF A;  2MKR A;  2EMS A;  1Y19 B;  5D27 A;  1AWE A;  2LOZ A;  1Z87 A;  5I2S A;  3LJU X;  1BWN A;  4HDQ A;  1GC7 A;  5L81 A;  2R09 A;  2COD A;  2J0M A;  1MK7 B;  2BCJ A;  1ZM0 A;  2GUM A;  4MK0 A;  4L1R A;  4YON A;  4OT1 A;  3QBV B;  3F5R A;  1M7E A;  3TW1 A;  1X86 A;  4ZRJ A;  2D9V A;  3QIJ A;  3UZT A;  2DHI A;  5D3V A;  5DHA B;  3ULC A;  3BJI A;  1MI1 A;  1TXD A;  2GS0 A;  3HQC A;  2UZR A;  4HB0 B;  5DI9 B;  1Q67 A;  3KRW A;  1P5T A;  2KIE A;  3KRX A;  2DTC A;  1RRP B;  2KR0 A;  3PZD A;  2I1K A;  4EMO A;  3PG7 A;  5LG4 B;  2NMB A;  5C5B A;  3PP2 A;  2E2X A;  4DX9 0;  1QC6 A;  4CHM A;  4Z2N A;  2P0H A;  2M38 A;  3A58 A;  2NZ8 B;  4HAX B;  4C0A A;  2VSZ A;  2RGN B;  2KGX B;  1V5P A;  4QJ4 B;  2RVB B;  3HK0 A;  1TJ6 A;  5I2M A;  1FHO A;  2Z0Q A;  4WVF B;  4D6W A;  2ELB A;  2N0Y A;  3AU4 A;  1ZSQ A;  2DHJ A;  1MIX A;  1DDM A;  4HHV A;  2YS1 A;  1I2H A;  4K81 A;  3VOQ A;  3DXD A;  1DRO A;  4B6H A;  4F7H A;  4GXB A;  3NWA A;  4CSQ A; 
#chains in the Genus database with same CATH homology
 3TCA A;  1XCG A;  5D3W A;  1E5W A;  4F7G A;  4GN1 A;  2YSZ A;  1U5F A;  4IOY X;  4TKN A;  3FSS A;  2Y8F A;  2P0F A;  3N7C A;  2J0K A;  1WGQ A;  1V88 A;  3T06 A;  2ROZ B;  3V5W A;  2YT0 A;  1N3H A;  4TYZ A;  1U2B A;  5J3Q A;  2RLO A;  4GMV A;  3SNH A;  3SYX A;  5LON B;  4EJN A;  1FB8 A;  1DYN A;  2Q13 A;  4H8S A;  4K17 A;  2L2I A;  4DBB A;  1PMS A;  5KQ4 A;  1LW3 A;  5C6R A;  2W2W A;  2K2J A;  3WYF B;  5C16 A;  2CY4 A;  3QWM A;  1DBH A;  1QQG A;  2Y7B A;  2YF0 A;  2QKL A;  2COF A;  2YT1 A;  2D11 A;  5DHF B;  4A6F A;  2D9Z A;  3NSU A;  1ZVR A;  4CYE A;  4GZU A;  3D8D A;  5GOW B;  2AEH A;  3A8Q A;  3WA0 A;  1V5M A;  1X05 A;  2W2X C;  2M14 A;  1UNR A;  3X23 A;  4A6F B;  3CXB B;  4CHJ A;  3SV1 A;  2IFS A;  1IRS A;  1V89 A;  1WJM A;  4EKU A;  2J59 M;  1MPH A;  3ZVR A;  3KSY A;  5CLQ B;  3F0W A;  1EF1 A;  2D9W A;  2P8V A;  3FM8 C;  1V61 A;  4KHA A;  3AU5 A;  4HB3 B;  5CLL B;  2D2Q A;  2LUL A;  4A6H A;  1MAI A;  4ZRK A;  2H7E A;  2D10 A;  2K00 A;  1UPR A;  2KUP A;  1MK9 B;  2X18 A;  5D3Y A;  4K2O A;  2PZ1 A;  1PFJ A;  1V5U A;  1WG7 A;  2KCJ A;  2GJY A;  1J19 A;  2DFK A;  1EAZ A;  5HE3 A;  3PSC A;  5HE2 A;  3CIK A;  3ODO A;  2D9X A;  4KHO A;  1GC6 A;  2MDX A;  1RJ2 A;  5FI1 A;  1U5G A;  1OMW A;  1OQN A;  1MIZ B;  1KI1 B;  4WSF A;  3DXE A;  4HB4 B;  1KZ7 A;  4Y94 A;  5JLJ B;  4NSW A;  4F7U P;  2DA0 A;  2J0J A;  1SGH A;  3ULB A;  2I1J A;  2JP2 A;  4KVG B;  1BTN A;  4MT7 A;  4XWX A;  1FOE A;  2RSG A;  5C79 A;  3PVL A;  2DX1 A;  4MY6 A;  1XKE A;  2OQB A;  4HDO A;  2G35 A;  1W1D A;  3U8Z A;  2UZS A;  3D8F A;  4KAX B;  2DX5 A;  1NTY A;  2FJL A;  5LOP B;  2ADZ A;  1U29 A;  2MWN B;  5JHG A;  2ZPY A;  3GYP A;  1SHC A;  1EVH A;  3OAN A;  1KZG A;  1WGU A;  2DKP A;  4HAU B;  5DH9 B;  1W1G A;  3VIA A;  1UEF A;  1K5G B;  1FHW A;  1NI2 A;  2P0D A;  1LB1 A;  2XQN M;  2V76 A;  5C5B B;  5HE1 A;  4WJ7 A;  2LG1 A;  3TO1 A;  5FI0 A;  1DDV A;  3KZ1 A;  5D3X A;  4HAT B;  4Z2M B;  3M1I B;  3ML4 A;  1WI1 A;  1XR0 B;  4PQ0 A;  1FAO A;  2Y8G A;  4GPT B;  3KY9 A;  3BIN A;  3MPX A;  4A6K A;  4HAZ B;  2DLW A;  2OTX A;  2YRY A;  2YVC A;  3G9W A;  1UPQ A;  2Z0P A;  2R0D A;  1NU2 A;  3SO6 A;  3PVW A;  5J3Y A;  4BBK A;  3RCP A;  1X11 A;  1B55 A;  1P3R A;  2VRW B;  1MKE A;  1M7R A;  2YS3 A;  5J3T A;  2RNR B;  2MFQ A;  2CY5 A;  1AQC A;  2HE7 A;  3FEH A;  4HAY B;  1GG3 A;  2EC1 A;  2CAY A;  4P7I A;  3ZDT A;  5HE0 A;  1TQZ A;  2EMT A;  5JHH A;  2DN6 A;  2LOX A;  2N23 A;  1UNQ A;  3TVV A;  1XD4 A;  1K5D B;  1Y5O A;  1H4R A;  3O96 A;  1WVH A;  2I5F A;  3PEG A;  3GYO A;  4HAW B;  5JP4 A;  1ISN A;  4L6E A;  5DIF B;  2Z0O A;  2DYQ A;  1FGY A;  2LKO A;  3P6A A;  2IYB A;  5KCV A;  2D9Y A;  2DKQ A;  4K2P A;  2L1C A;  4ZRI A;  3PVU A;  2GCJ A;  3DXC A;  2I5C A;  2EJ8 A;  3IVF A;  2COC A;  4D0N B;  3ODX A;  2W2X D;  1J0W A;  2ELA A;  3U7D A;  4IFS A;  1NTV A;  1WJ1 A;  4DXA B;  1FHX A;  1XX0 A;  2AL6 A;  2LYD A;  2H7D A;  1X1G A;  1W1H A;  4GMX B;  1BTK A;  2ROV A;  1U27 A;  1OY2 A;  2UVM A;  2K2U A;  1DDW A;  2COA A;  4IAP A;  1P6S A;  1ZC4 B;  1I7A A;  1PLS A;  4PNK A;  2DHK A;  3SUZ A;  3TFM A;  2QKM A;  1XOD A;  2VKI A;  4A5K A;  3ODW A;  3AJ4 A;  5KQ1 A;  3D8E A;  2D4Q A;  2GCL A;  4HB2 B;  3A98 B;  5EFX A;  2DYN A;  1FGZ A;  4YL8 A;  4NY0 A;  1U5D A;  1X1F A;  3P7Z A;  4DX8 A;  1BAK A;  3A8P A;  1UNP A;  2HTH B;  1H10 A;  3HW2 B;  4KHB B;  2YS5 A;  1EGX A;  1U5E A;  4HAV B;  1ZC3 B;  2RUK B;  3MDB C;  2CRF A;  2MKR A;  2EMS A;  1Y19 B;  5D27 A;  1AWE A;  2LOZ A;  1Z87 A;  3LJU X;  1BWN A;  4HDQ A;  1GC7 A;  5L81 A;  2R09 A;  2COD A;  2J0M A;  1MK7 B;  2BCJ A;  1ZM0 A;  4MK0 A;  4YON A;  3QBV B;  3F5R A;  1M7E A;  3TW1 A;  1X86 A;  4ZRJ A;  2D9V A;  3QIJ A;  3UZT A;  2DHI A;  5D3V A;  5DHA B;  3ULC A;  3BJI A;  1TXD A;  2GS0 A;  3HQC A;  2UZR A;  4HB0 B;  5DI9 B;  1Q67 A;  3KRW A;  1P5T A;  3KRX A;  2DTC A;  1RRP B;  3PZD A;  2I1K A;  4EMO A;  3PG7 A;  2NMB A;  5C5B A;  3PP2 A;  2E2X A;  4DX9 0;  1QC6 A;  4CHM A;  4Z2N A;  2P0H A;  2M38 A;  2NZ8 B;  4HAX B;  4C0A A;  2VSZ A;  2RGN B;  2KGX B;  1V5P A;  2RVB B;  3HK0 A;  1TJ6 A;  1FHO A;  2Z0Q A;  4WVF B;  2ELB A;  2N0Y A;  3AU4 A;  1ZSQ A;  2DHJ A;  1MIX A;  1DDM A;  4HHV A;  1I2H A;  4K81 A;  3VOQ A;  3DXD A;  1DRO A;  4B6H A;  4F7H A;  4GXB A;  2YS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...