1U5EA

Crystal structure of a n-terminal fragment of skap-hom containing both the helical dimerization domain and the ph domain
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
211
structure length
170
Chain Sequence
b'GSPEEIRNLLADVETFVADTLKGENLSKKAKEKRESLIKKIKDVKSVYLQEFQFPPIAAQDLPFVIKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYDVRMNNTLRKDGKKDCCFEICAPDKRIYQFTAASPKDAEEWVQQLKFILQDLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Src-associated adaptor protein
publication title Structural Basis for the Dimerization and Phosphoinositide Specificity of the Src Kinase-associated Phosphoproteins SKAP55 and SKAP-Hom
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 51
structure length 170
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1u5eA02
5HE3A 2DYQA 3MPXA 2LYDA 2OQBA 4A5KA 1U5DA 2MWNB 2VRWB 2DYNA 4GPTB 2D2QA 1DDVA 5FI0A 1WVHA 4HAXB 2CAYA 3GYOA 1WGUA 3PG7A 2ROZB 5LOPB 2D9WA 4ZRIA 1UNRA 3FSSA 4CHMA 5J3QA 3KZ1A 2CY4A 5KCVA 4HAUB 1LW3A 1FGZA 3SO6A 1FB8A 1MK7B 3QWMA 2YS5A 4MT7A 1GC7A 1I7AA 2N23A 2RVBB 4GXBA 1EVHA 4GZUA 2AEHA 4K2PA 2NMBA 2GCLA 3TW1A 5CLLB 4NY0A 2GJYA 3PVLA 2D9XA 2X18A 1V5UA 1V5MA 2I1KA 4HB0B 5CLQB 3X23A 2YS1A 1XR0B 2VKIA 2DHIA 2EMTA 2Y7BA 4Z2MB 2ZPYA 4K17A 1WJMA 4ZRJA 1J0WA 1H10A 4Y94A 5D27A 2J0JA 4HAYB 1FHOA 5LONB 2J0KA 2DA0A 2HTHB 3MDBC 1EF1A 5C5BA 3HW2B 1P5TA 3ODXA 1EGXA 3HQCA 4DBBA 2D11A 1PMSA 2GCJA 1U5GA 2DKPA 3A8QA 2IFSA 2COFA 1MKEA 2RUKB 3ULBA 5C79A 3NSUA 1NI2A 1MPHA 2EC1A 1UNQA 3CXBB 4KVGB 5J3YA 5FI1A 2OTXA 3BJIA 2HE7A 2I5FA 3KY9A 3A98B 3ODWA 2PZ1A 1XKEA 2W2XC 2Z0QA 1QQGA 1TXDA 2D9ZA 3ULCA 3SUZA 1W1HA 4DX90 1MIXA 1SHCA 3DXDA 2E2XA 4HATB 3V5WA 4GN1A 1V5PA 5D3YA 2LULA 2P0FA 1Y5OA 2DX5A 1X1FA 3ZDTA 1V89A 2Y8FA 2MFQA 3FM8C 1Y19B 5EFXA 3PVUA 5DI9B 2NZ8B 2LOXA 3DXCA 3ML4A 4EKUA 2COCA 3KSYA 1X05A 1E5WA 3IVFA 3O96A 1U29A 1BAKA 4HDQA 5DHAB 4EMOA 1EAZA 2YT1A 5KQ1A 1IRSA 1UPRA 2J59M 1DROA 1W1GA 2RNRB 1X86A 1M7RA 1GC6A 2Z0PA 1FHWA 2Y8GA 1KI1B 4IAPA 1MK9B 4K81A 4PNKA 2R09A 2DX1A 1FGYA 2N0YA 4GMXB 1PFJA 2VSZA 4F7UP 2L1CA 3WYFB 1ZVRA 2FJLA 1DBHA 1NTVA 4A6FA 3D8DA 1KZGA 2LG1A 3FEHA 2Q13A 1RRPB 1AWEA 2P0HA 5JHHA 1OY2A 3GYPA 3UZTA 1FHXA 4HAVB 4HAZB 1XX0A 1TQZA 3SV1A 4B6HA 1U5EA 2CODA 1TJ6A 5DH9B 1W1DA 4TYZA 1NTYA 2BCJA 2DFKA 5JLJB 1RJ2A 1XODA 2LOZA 1PLSA 5C6RA 2EJ8A 1U27A 2AL6A 2CY5A 3WA0A 4NSWA 2RSGA 4PQ0A 1ZSQA 1N3HA 4CYEA 3DXEA 3U8ZA 2D9VA 2UVMA 2MKRA 3QIJA 2H7DA 2RLOA 1DDWA 4HDOA 1XCGA 4DX8A 2K2JA 2DTCA 3AJ4A 4ZRKA 1Z87A 1H4RA 5HE1A 4H8SA 2ELBA 4HB3B 4BBKA 2G35A 3OANA 2LKOA 5L81A 3PZDA 1ZC3B 3A8PA 1DYNA 5D3VA 2DLWA 1K5DB 4WVFB 2M14A 1DDMA 3M1IB 2COAA 1WI1A 2YVCA 3TFMA 2YT0A 1SGHA 2YS3A 4KHAA 1V88A 2D10A 2KUPA 3VOQA 5HE0A 4WJ7A 3TCAA 2I1JA 1KZ7A 3G9WA 2QKMA 1U2BA 4C0AA 1OQNA 1ZM0A 2IYBA 3T06A 3TVVA 2XQNM 4MY6A 3TO1A 1X1GA 2EMSA 1V61A 5GOWB 4KHOA 3RCPA 4CHJA 2RGNB 1I2HA 3QBVB 1XD4A 3AU4A 1U5FA 4A6HA 2KCJA 5JP4A 1J19A 1K5GB 2YF0A 4F7HA 2ROVA 4L6EA 1X11A 3D8EA 1WGQA 5C5BB 2K00A 4P7IA 2YSZA 1UPQA 4XWXA 3N7CA 5J3TA 4GMVA 4D0NB 2D4QA 3VIAA 1UNPA 2I5CA 3CIKA 3U7DA 4HB2B 2KGXB 1WJ1A 3PSCA 4K2OA 2W2XD 3ZVRA 1B55A 3D8FA 4EJNA 2DKQA 2J0MA 4F7GA 3KRWA 2JP2A 2ELAA 2YRYA 1P3RA 3KRXA 3SYXA 4Z2NA 1BTKA 4YL8A 2V76A 3SNHA 2DHKA 2H7EA 2K2UA 3AU5A 2UZRA 5D3WA 3LJUX 1BTNA 4DXAB 3PP2A 5DHFB 3HK0A 3F0WA 1GG3A 2D9YA 2Z0OA 3ODOA 2W2WA 1Q67A 4MK0A 4KHBB 2CRFA 5KQ4A 2L2IA 4TKNA 1FAOA 2QKLA 4IOYX 5D3XA 5HE2A 1MAIA 1AQCA 1QC6A 2P8VA 2DN6A 3PEGA 4A6KA 4KAXB 2M38A 1NU2A 1BWNA 2ADZA 4IFSA 4HHVA 4HAWB 1FOEA 3P6AA 4HB4B 3F5RA 1UEFA 3PVWA 2GS0A 1P6SA 4WSFA 1OMWA 1MIZB 1LB1A 5JHGA 1WG7A 2MDXA 1M7EA 5C16A 2P0DA 2DHJA 2R0DA 4A6FB 5DIFB 1ISNA 3BINA 3P7ZA 4YONA 2UZSA 1ZC4B
chains in the Genus database with same CATH superfamily
5HE3A 2DYQA 3HIEA 2GUMA 3MPXA 2LYDA 2OQBA 4A5KA 1U5DA 2MWNB 2VRWB 2DYNA 4GPTB 2D2QA 1DDVA 5FI0A 1WVHA 4HAXB 2CAYA 3GYOA 1WGUA 3PG7A 2ROZB 5LOPB 5LG4B 2D9WA 4ZRIA 1UNRA 3FSSA 4CHMA 5J3QA 3KZ1A 2CY4A 5KCVA 4HAUB 1LW3A 1FGZA 3SO6A 1FB8A 1MK7B 3QWMA 2YS5A 4MT7A 1GC7A 1I7AA 2N23A 2RVBB 4GXBA 1EVHA 4GZUA 2AEHA 4K2PA 2NMBA 2GCLA 3TW1A 5CLLB 4NY0A 2GJYA 3PVLA 2D9XA 2X18A 3FVCA 1V5UA 1V5MA 2I1KA 4HB0B 3DCXA 5CLQB 3X23A 2K49A 2YS1A 1XR0B 2VKIA 2DHIA 2EMTA 2RRFA 4QJ5B 2Y7BA 4Z2MB 2ZPYA 3U12A 4K17A 1WJMA 4ZRJA 1J0WA 1H10A 4Y94A 5D27A 2J0JA 4HAYB 5IRSA 1FHOA 5LONB 2J0KA 2DA0A 2HTHB 4QJ4B 3MDBC 1EF1A 5C5BA 3HW2B 1P5TA 3ODXA 1EGXA 3HQCA 4DBBA 2D11A 1PMSA 2GCJA 1U5GA 2DKPA 3A8QA 2IFSA 2COFA 1MKEA 2RUKB 3ULBA 5C79A 3NSUA 1NI2A 1MPHA 2EC1A 1UNQA 3CXBB 4KVGB 5I2SA 4GOUA 5J3YA 5FI1A 2OTXA 3BJIA 2HE7A 2I5FA 3KY9A 3A98B 3ODWA 2PZ1A 3NWFA 1XKEA 2W2XC 2Z0QA 1QQGA 2Z59A 1TXDA 2D9ZA 3ULCA 3SUZA 1W1HA 4DX90 3NWDA 1MIXA 1SHCA 2Z13A 3DXDA 2E2XA 4HATB 3V5WA 4L1RA 4GN1A 1V5PA 2NBVA 5D3YA 2LULA 2P0FA 1Y5OA 2DX5A 1X1FA 3ZDTA 1V89A 2Y8FA 2MFQA 3FM8C 1Y19B 5EFXA 3PVUA 5DI9B 4KHBA 2NZ8B 2LOXA 3DXCA 3ML4A 4EKUA 2COCA 3KSYA 1X05A 1E5WA 3IVFA 3O96A 5M4YB 1U29A 1BAKA 4HDQA 5DHAB 4EMOA 1EAZA 2YT1A 5KQ1A 1IRSA 1UPRA 2J59M 1DROA 1W1GA 2RNRB 1X86A 1M7RA 1GC6A 2Z0PA 1FHWA 2R2YA 2Y8GA 1KI1B 4IAPA 1MK9B 4K81A 3B77A 2R09A 4PNKA 2DX1A 3NW8A 1FGYA 1T77A 2N0YA 4GMXB 5I2MA 1PFJA 2VSZA 4F7UP 2L1CA 3WYFB 1ZVRA 2FJLA 1DBHA 1NTVA 4A6FA 3D8DA 4DIXA 1KZGA 2LG1A 3FEHA 2Q13A 1RRPB 1AWEA 2P0HA 5JHHA 1OY2A 3GYPA 2FJUB 3UZTA 1FHXA 4HAVB 4HAZB 1XX0A 1TQZA 3SV1A 4B6HA 1U5EA 2CODA 1TJ6A 5DH9B 1ZYIA 1W1DA 4TYZA 4OT1A 4D6WA 1NTYA 2BCJA 2DFKA 5JLJB 1RJ2A 1XODA 2LOZA 4QXAB 1PLSA 5C6RA 2EJ8A 1U27A 2AL6A 2CY5A 3WA0A 4NSWA 2RSGA 4PQ0A 1ZSQA 1N3HA 4CYEA 3DXEA 3U8ZA 2D9VA 2UVMA 2MKRA 2K8EA 3QIJA 2H7DA 2RLOA 1DDWA 4HDOA 1XCGA 4DX8A 2K2JA 2DTCA 3AJ4A 4ZRKA 1Z87A 1H4RA 5HE1A 4H8SA 2ELBA 4HB3B 4BBKA 2G35A 3OANA 2LKOA 5L81A 3PZDA 1ZC3B 3A8PA 1DYNA 5D3VA 2DLWA 1K5DB 4WVFB 2M14A 2ZKMX 1DDMA 3M1IB 2COAA 1WI1A 2YVCA 3TFMA 2YT0A 1SGHA 2YS3A 4KHAA 1V88A 4CSQA 2D10A 2KUPA 3VOQA 5HE0A 4WJ7A 3TCAA 2I1JA 4HSIA 1KZ7A 3G9WA 3HSAA 2QKMA 1U2BA 4C0AA 1OQNA 1ZM0A 2IYBA 3T06A 3TVVA 2XQNM 4MY6A 3TO1A 2KIGA 1X1GA 2EMSA 1V61A 2KUQA 5GOWB 4KHOA 3RCPA 4CHJA 2RGNB 1I2HA 3QBVB 1XD4A 3AU4A 1U5FA 4A6HA 2KCJA 5JP4A 1J19A 1K5GB 2YF0A 4F7HA 2ROVA 3A58A 1X11A 4L6EA 3D8EA 1WGQA 5C5BB 2K00A 4P7IA 2YSZA 1UPQA 4XWXA 3N7CA 5J3TA 4GMVA 4D0NB 2D4QA 3VIAA 4QJ3B 1UNPA 2I5CA 3CIKA 3U7DA 4HB2B 2KGXB 1WJ1A 3PSCA 4K2OA 2W2XD 3ZVRA 1B55A 3D8FA 3OHMB 2KR0A 4EJNA 2DKQA 1MI1A 2J0MA 4F7GA 3KRWA 2JP2A 2ELAA 2YRYA 1P3RA 3KRXA 3SYXA 4Z2NA 1BTKA 4YL8A 2V76A 3SNHA 2Z14A 2DHKA 2H7EA 2K2UA 3AU5A 2UZRA 5D3WA 3LJUX 1BTNA 4DXAB 3PP2A 5DHFB 3HK0A 4OSNA 3F0WA 1GG3A 2D9YA 2Z0OA 3ODOA 2W2WA 1Q67A 4MK0A 4KHBB 2CRFA 5KQ4A 2KIEA 2L2IA 4TKNA 1FAOA 2QKLA 4IOYX 2YT2A 5D3XA 5HE2A 1MAIA 1AQCA 1QC6A 2P8VA 2DN6A 3PEGA 4A6KA 4KAXB 2M38A 3NWAA 4GNKB 1NU2A 1BWNA 2ADZA 4IFSA 4HHVA 4HAWB 1FOEA 3P6AA 4HB4B 2Z4DA 3F5RA 1UEFA 3PVWA 2GS0A 1P6SA 4WSFA 1OMWA 1MIZB 1LB1A 5JHGA 1WG7A 2MDXA 1M7EA 5C16A 2P0DA 2DHJA 2R0DA 4A6FB 5DIFB 1ISNA 3BINA 3P7ZA 4YONA 2UZSA 1ZC4B
chains in the Genus database with same CATH topology
5HE3A 2DYQA 3MPXA 2LYDA 2OQBA 4A5KA 1U5DA 2MWNB 2VRWB 2DYNA 4GPTB 2D2QA 1DDVA 5FI0A 1WVHA 4HAXB 2CAYA 3GYOA 1WGUA 3PG7A 2ROZB 5LOPB 2D9WA 4ZRIA 1UNRA 3FSSA 4CHMA 5J3QA 3KZ1A 2CY4A 5KCVA 4HAUB 1LW3A 1FGZA 3SO6A 1FB8A 1MK7B 3QWMA 2YS5A 4MT7A 1GC7A 1I7AA 2N23A 2RVBB 4GXBA 1EVHA 4GZUA 2AEHA 4K2PA 2NMBA 2GCLA 3TW1A 5CLLB 4NY0A 2GJYA 3PVLA 2D9XA 2X18A 1V5UA 1V5MA 2I1KA 4HB0B 5CLQB 3X23A 2YS1A 1XR0B 2VKIA 2DHIA 2EMTA 2Y7BA 4Z2MB 2ZPYA 4K17A 1WJMA 4ZRJA 1J0WA 1H10A 4Y94A 5D27A 2J0JA 4HAYB 1FHOA 5LONB 2J0KA 2DA0A 2HTHB 3MDBC 1EF1A 5C5BA 3HW2B 1P5TA 3ODXA 1EGXA 3HQCA 4DBBA 2D11A 1PMSA 2GCJA 1U5GA 2DKPA 3A8QA 2IFSA 2COFA 1MKEA 2RUKB 3ULBA 5C79A 3NSUA 1NI2A 1MPHA 2EC1A 1UNQA 3CXBB 4KVGB 5J3YA 5FI1A 2OTXA 3BJIA 2HE7A 2I5FA 3KY9A 3A98B 3ODWA 2PZ1A 1XKEA 2W2XC 2Z0QA 1QQGA 1TXDA 2D9ZA 3ULCA 3SUZA 1W1HA 4DX90 1MIXA 1SHCA 3DXDA 2E2XA 4HATB 3V5WA 4GN1A 1V5PA 5D3YA 2LULA 2P0FA 1Y5OA 2DX5A 1X1FA 3ZDTA 1V89A 2Y8FA 2MFQA 3FM8C 1Y19B 5EFXA 3PVUA 5DI9B 2NZ8B 2LOXA 3DXCA 3ML4A 4EKUA 2COCA 3KSYA 1X05A 1E5WA 3IVFA 3O96A 1U29A 1BAKA 4HDQA 5DHAB 4EMOA 1EAZA 2YT1A 5KQ1A 1IRSA 1UPRA 2J59M 1DROA 1W1GA 2RNRB 1X86A 1M7RA 1GC6A 2Z0PA 1FHWA 2Y8GA 1KI1B 4IAPA 1MK9B 4K81A 4PNKA 2R09A 2DX1A 1FGYA 2N0YA 4GMXB 1PFJA 2VSZA 4F7UP 2L1CA 3WYFB 1ZVRA 2FJLA 1DBHA 1NTVA 4A6FA 3D8DA 1KZGA 2LG1A 3FEHA 2Q13A 1RRPB 1AWEA 2P0HA 5JHHA 1OY2A 3GYPA 3UZTA 1FHXA 4HAVB 4HAZB 1XX0A 1TQZA 3SV1A 4B6HA 1U5EA 2CODA 1TJ6A 5DH9B 1W1DA 4TYZA 1NTYA 2BCJA 2DFKA 5JLJB 1RJ2A 1XODA 2LOZA 1PLSA 5C6RA 2EJ8A 1U27A 2AL6A 2CY5A 3WA0A 4NSWA 2RSGA 4PQ0A 1ZSQA 1N3HA 4CYEA 3DXEA 3U8ZA 2D9VA 2UVMA 2MKRA 3QIJA 2H7DA 2RLOA 1DDWA 4HDOA 1XCGA 4DX8A 2K2JA 2DTCA 3AJ4A 4ZRKA 1Z87A 1H4RA 5HE1A 4H8SA 2ELBA 4HB3B 4BBKA 2G35A 3OANA 2LKOA 5L81A 3PZDA 1ZC3B 3A8PA 1DYNA 5D3VA 2DLWA 1K5DB 4WVFB 2M14A 1DDMA 3M1IB 2COAA 1WI1A 2YVCA 3TFMA 2YT0A 1SGHA 2YS3A 4KHAA 1V88A 2D10A 2KUPA 3VOQA 5HE0A 4WJ7A 3TCAA 2I1JA 1KZ7A 3G9WA 2QKMA 1U2BA 4C0AA 1OQNA 1ZM0A 2IYBA 3T06A 3TVVA 2XQNM 4MY6A 3TO1A 1X1GA 2EMSA 1V61A 5GOWB 4KHOA 3RCPA 4CHJA 2RGNB 1I2HA 3QBVB 1XD4A 3AU4A 1U5FA 4A6HA 2KCJA 5JP4A 1J19A 1K5GB 2YF0A 4F7HA 2ROVA 4L6EA 1X11A 3D8EA 1WGQA 5C5BB 2K00A 4P7IA 2YSZA 1UPQA 4XWXA 3N7CA 5J3TA 4GMVA 4D0NB 2D4QA 3VIAA 1UNPA 2I5CA 3CIKA 3U7DA 4HB2B 2KGXB 1WJ1A 3PSCA 4K2OA 2W2XD 3ZVRA 1B55A 3D8FA 4EJNA 2DKQA 2J0MA 4F7GA 3KRWA 2JP2A 2ELAA 2YRYA 1P3RA 3KRXA 3SYXA 4Z2NA 1BTKA 4YL8A 2V76A 3SNHA 2DHKA 2H7EA 2K2UA 3AU5A 2UZRA 5D3WA 3LJUX 1BTNA 4DXAB 3PP2A 5DHFB 3HK0A 3F0WA 1GG3A 2D9YA 2Z0OA 3ODOA 2W2WA 1Q67A 4MK0A 4KHBB 2CRFA 5KQ4A 2L2IA 4TKNA 1FAOA 2QKLA 4IOYX 5D3XA 5HE2A 1MAIA 1AQCA 1QC6A 2P8VA 2DN6A 3PEGA 4A6KA 4KAXB 2M38A 1NU2A 1BWNA 2ADZA 4IFSA 4HHVA 4HAWB 1FOEA 3P6AA 4HB4B 3F5RA 1UEFA 3PVWA 2GS0A 1P6SA 4WSFA 1OMWA 1MIZB 1LB1A 5JHGA 1WG7A 2MDXA 1M7EA 5C16A 2P0DA 2DHJA 2R0DA 4A6FB 5DIFB 1ISNA 3BINA 3P7ZA 4YONA 2UZSA 1ZC4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HE3 A;  2DYQ A;  3MPX A;  2LYD A;  2OQB A;  4A5K A;  1U5D A;  2MWN B;  2VRW B;  2DYN A;  4GPT B;  2D2Q A;  1DDV A;  5FI0 A;  1WVH A;  4HAX B;  2CAY A;  3GYO A;  1WGU A;  3PG7 A;  2ROZ B;  5LOP B;  2D9W A;  4ZRI A;  1UNR A;  3FSS A;  4CHM A;  5J3Q A;  3KZ1 A;  2CY4 A;  5KCV A;  4HAU B;  1LW3 A;  1FGZ A;  3SO6 A;  1FB8 A;  1MK7 B;  3QWM A;  2YS5 A;  4MT7 A;  1GC7 A;  1I7A A;  2N23 A;  2RVB B;  4GXB A;  1EVH A;  4GZU A;  2AEH A;  4K2P A;  2NMB A;  2GCL A;  3TW1 A;  5CLL B;  4NY0 A;  2GJY A;  3PVL A;  2D9X A;  2X18 A;  1V5U A;  1V5M A;  2I1K A;  4HB0 B;  5CLQ B;  3X23 A;  2YS1 A;  1XR0 B;  2VKI A;  2DHI A;  2EMT A;  2Y7B A;  4Z2M B;  2ZPY A;  4K17 A;  1WJM A;  4ZRJ A;  1J0W A;  1H10 A;  4Y94 A;  5D27 A;  2J0J A;  4HAY B;  1FHO A;  5LON B;  2J0K A;  2DA0 A;  2HTH B;  3MDB C;  1EF1 A;  5C5B A;  3HW2 B;  1P5T A;  3ODX A;  1EGX A;  3HQC A;  4DBB A;  2D11 A;  1PMS A;  2GCJ A;  1U5G A;  2DKP A;  3A8Q A;  2IFS A;  2COF A;  1MKE A;  2RUK B;  3ULB A;  5C79 A;  3NSU A;  1NI2 A;  1MPH A;  2EC1 A;  1UNQ A;  3CXB B;  4KVG B;  5J3Y A;  5FI1 A;  2OTX A;  3BJI A;  2HE7 A;  2I5F A;  3KY9 A;  3A98 B;  3ODW A;  2PZ1 A;  1XKE A;  2W2X C;  2Z0Q A;  1QQG A;  1TXD A;  2D9Z A;  3ULC A;  3SUZ A;  1W1H A;  4DX9 0;  1MIX A;  1SHC A;  3DXD A;  2E2X A;  4HAT B;  3V5W A;  4GN1 A;  1V5P A;  5D3Y A;  2LUL A;  2P0F A;  1Y5O A;  2DX5 A;  1X1F A;  3ZDT A;  1V89 A;  2Y8F A;  2MFQ A;  3FM8 C;  1Y19 B;  5EFX A;  3PVU A;  5DI9 B;  2NZ8 B;  2LOX A;  3DXC A;  3ML4 A;  4EKU A;  2COC A;  3KSY A;  1X05 A;  1E5W A;  3IVF A;  3O96 A;  1U29 A;  1BAK A;  4HDQ A;  5DHA B;  4EMO A;  1EAZ A;  2YT1 A;  5KQ1 A;  1IRS A;  1UPR A;  2J59 M;  1DRO A;  1W1G A;  2RNR B;  1X86 A;  1M7R A;  1GC6 A;  2Z0P A;  1FHW A;  2Y8G A;  1KI1 B;  4IAP A;  1MK9 B;  4K81 A;  4PNK A;  2R09 A;  2DX1 A;  1FGY A;  2N0Y A;  4GMX B;  1PFJ A;  2VSZ A;  4F7U P;  2L1C A;  3WYF B;  1ZVR A;  2FJL A;  1DBH A;  1NTV A;  4A6F A;  3D8D A;  1KZG A;  2LG1 A;  3FEH A;  2Q13 A;  1RRP B;  1AWE A;  2P0H A;  5JHH A;  1OY2 A;  3GYP A;  3UZT A;  1FHX A;  4HAV B;  4HAZ B;  1XX0 A;  1TQZ A;  3SV1 A;  4B6H A;  1U5E A;  2COD A;  1TJ6 A;  5DH9 B;  1W1D A;  4TYZ A;  1NTY A;  2BCJ A;  2DFK A;  5JLJ B;  1RJ2 A;  1XOD A;  2LOZ A;  1PLS A;  5C6R A;  2EJ8 A;  1U27 A;  2AL6 A;  2CY5 A;  3WA0 A;  4NSW A;  2RSG A;  4PQ0 A;  1ZSQ A;  1N3H A;  4CYE A;  3DXE A;  3U8Z A;  2D9V A;  2UVM A;  2MKR A;  3QIJ A;  2H7D A;  2RLO A;  1DDW A;  4HDO A;  1XCG A;  4DX8 A;  2K2J A;  2DTC A;  3AJ4 A;  4ZRK A;  1Z87 A;  1H4R A;  5HE1 A;  4H8S A;  2ELB A;  4HB3 B;  4BBK A;  2G35 A;  3OAN A;  2LKO A;  5L81 A;  3PZD A;  1ZC3 B;  3A8P A;  1DYN A;  5D3V A;  2DLW A;  1K5D B;  4WVF B;  2M14 A;  1DDM A;  3M1I B;  2COA A;  1WI1 A;  2YVC A;  3TFM A;  2YT0 A;  1SGH A;  2YS3 A;  4KHA A;  1V88 A;  2D10 A;  2KUP A;  3VOQ A;  5HE0 A;  4WJ7 A;  3TCA A;  2I1J A;  1KZ7 A;  3G9W A;  2QKM A;  1U2B A;  4C0A A;  1OQN A;  1ZM0 A;  2IYB A;  3T06 A;  3TVV A;  2XQN M;  4MY6 A;  3TO1 A;  1X1G A;  2EMS A;  1V61 A;  5GOW B;  4KHO A;  3RCP A;  4CHJ A;  2RGN B;  1I2H A;  3QBV B;  1XD4 A;  3AU4 A;  1U5F A;  4A6H A;  2KCJ A;  5JP4 A;  1J19 A;  1K5G B;  2YF0 A;  4F7H A;  2ROV A;  4L6E A;  1X11 A;  3D8E A;  1WGQ A;  5C5B B;  2K00 A;  4P7I A;  2YSZ A;  1UPQ A;  4XWX A;  3N7C A;  5J3T A;  4GMV A;  4D0N B;  2D4Q A;  3VIA A;  1UNP A;  2I5C A;  3CIK A;  3U7D A;  4HB2 B;  2KGX B;  1WJ1 A;  3PSC A;  4K2O A;  2W2X D;  3ZVR A;  1B55 A;  3D8F A;  4EJN A;  2DKQ A;  2J0M A;  4F7G A;  3KRW A;  2JP2 A;  2ELA A;  2YRY A;  1P3R A;  3KRX A;  3SYX A;  4Z2N A;  1BTK A;  4YL8 A;  2V76 A;  3SNH A;  2DHK A;  2H7E A;  2K2U A;  3AU5 A;  2UZR A;  5D3W A;  3LJU X;  1BTN A;  4DXA B;  3PP2 A;  5DHF B;  3HK0 A;  3F0W A;  1GG3 A;  2D9Y A;  2Z0O A;  3ODO A;  2W2W A;  1Q67 A;  4MK0 A;  4KHB B;  2CRF A;  5KQ4 A;  2L2I A;  4TKN A;  1FAO A;  2QKL A;  4IOY X;  5D3X A;  5HE2 A;  1MAI A;  1AQC A;  1QC6 A;  2P8V A;  2DN6 A;  3PEG A;  4A6K A;  4KAX B;  2M38 A;  1NU2 A;  1BWN A;  2ADZ A;  4IFS A;  4HHV A;  4HAW B;  1FOE A;  3P6A A;  4HB4 B;  3F5R A;  1UEF A;  3PVW A;  2GS0 A;  1P6S A;  4WSF A;  1OMW A;  1MIZ B;  1LB1 A;  5JHG A;  1WG7 A;  2MDX A;  1M7E A;  5C16 A;  2P0D A;  2DHJ A;  2R0D A;  4A6F B;  5DIF B;  1ISN A;  3BIN A;  3P7Z A;  4YON A;  2UZS A;  1ZC4 B; 
#chains in the Genus database with same CATH topology
 5HE3 A;  2DYQ A;  3HIE A;  2GUM A;  3MPX A;  2LYD A;  2OQB A;  4A5K A;  1U5D A;  2MWN B;  2VRW B;  2DYN A;  4GPT B;  2D2Q A;  1DDV A;  5FI0 A;  1WVH A;  4HAX B;  2CAY A;  3GYO A;  1WGU A;  3PG7 A;  2ROZ B;  5LOP B;  5LG4 B;  2D9W A;  4ZRI A;  1UNR A;  3FSS A;  4CHM A;  5J3Q A;  3KZ1 A;  2CY4 A;  5KCV A;  4HAU B;  1LW3 A;  1FGZ A;  3SO6 A;  1FB8 A;  1MK7 B;  3QWM A;  2YS5 A;  4MT7 A;  1GC7 A;  1I7A A;  2N23 A;  2RVB B;  4GXB A;  1EVH A;  4GZU A;  2AEH A;  4K2P A;  2NMB A;  2GCL A;  3TW1 A;  5CLL B;  4NY0 A;  2GJY A;  3PVL A;  2D9X A;  2X18 A;  3FVC A;  1V5U A;  1V5M A;  2I1K A;  4HB0 B;  3DCX A;  5CLQ B;  3X23 A;  2K49 A;  2YS1 A;  1XR0 B;  2VKI A;  2DHI A;  2EMT A;  2RRF A;  4QJ5 B;  2Y7B A;  4Z2M B;  2ZPY A;  3U12 A;  4K17 A;  1WJM A;  4ZRJ A;  1J0W A;  1H10 A;  4Y94 A;  5D27 A;  2J0J A;  4HAY B;  5IRS A;  1FHO A;  5LON B;  2J0K A;  2DA0 A;  2HTH B;  4QJ4 B;  3MDB C;  1EF1 A;  5C5B A;  3HW2 B;  1P5T A;  3ODX A;  1EGX A;  3HQC A;  4DBB A;  2D11 A;  1PMS A;  2GCJ A;  1U5G A;  2DKP A;  3A8Q A;  2IFS A;  2COF A;  1MKE A;  2RUK B;  3ULB A;  5C79 A;  3NSU A;  1NI2 A;  1MPH A;  2EC1 A;  1UNQ A;  3CXB B;  4KVG B;  5I2S A;  4GOU A;  5J3Y A;  5FI1 A;  2OTX A;  3BJI A;  2HE7 A;  2I5F A;  3KY9 A;  3A98 B;  3ODW A;  2PZ1 A;  3NWF A;  1XKE A;  2W2X C;  2Z0Q A;  1QQG A;  2Z59 A;  1TXD A;  2D9Z A;  3ULC A;  3SUZ A;  1W1H A;  4DX9 0;  3NWD A;  1MIX A;  1SHC A;  2Z13 A;  3DXD A;  2E2X A;  4HAT B;  3V5W A;  4L1R A;  4GN1 A;  1V5P A;  2NBV A;  5D3Y A;  2LUL A;  2P0F A;  1Y5O A;  2DX5 A;  1X1F A;  3ZDT A;  1V89 A;  2Y8F A;  2MFQ A;  3FM8 C;  1Y19 B;  5EFX A;  3PVU A;  5DI9 B;  4KHB A;  2NZ8 B;  2LOX A;  3DXC A;  3ML4 A;  4EKU A;  2COC A;  3KSY A;  1X05 A;  1E5W A;  3IVF A;  3O96 A;  5M4Y B;  1U29 A;  1BAK A;  4HDQ A;  5DHA B;  4EMO A;  1EAZ A;  2YT1 A;  5KQ1 A;  1IRS A;  1UPR A;  2J59 M;  1DRO A;  1W1G A;  2RNR B;  1X86 A;  1M7R A;  1GC6 A;  2Z0P A;  1FHW A;  2R2Y A;  2Y8G A;  1KI1 B;  4IAP A;  1MK9 B;  4K81 A;  3B77 A;  2R09 A;  4PNK A;  2DX1 A;  3NW8 A;  1FGY A;  1T77 A;  2N0Y A;  4GMX B;  5I2M A;  1PFJ A;  2VSZ A;  4F7U P;  2L1C A;  3WYF B;  1ZVR A;  2FJL A;  1DBH A;  1NTV A;  4A6F A;  3D8D A;  4DIX A;  1KZG A;  2LG1 A;  3FEH A;  2Q13 A;  1RRP B;  1AWE A;  2P0H A;  5JHH A;  1OY2 A;  3GYP A;  2FJU B;  3UZT A;  1FHX A;  4HAV B;  4HAZ B;  1XX0 A;  1TQZ A;  3SV1 A;  4B6H A;  1U5E A;  2COD A;  1TJ6 A;  5DH9 B;  1ZYI A;  1W1D A;  4TYZ A;  4OT1 A;  4D6W A;  1NTY A;  2BCJ A;  2DFK A;  5JLJ B;  1RJ2 A;  1XOD A;  2LOZ A;  4QXA B;  1PLS A;  5C6R A;  2EJ8 A;  1U27 A;  2AL6 A;  2CY5 A;  3WA0 A;  4NSW A;  2RSG A;  4PQ0 A;  1ZSQ A;  1N3H A;  4CYE A;  3DXE A;  3U8Z A;  2D9V A;  2UVM A;  2MKR A;  2K8E A;  3QIJ A;  2H7D A;  2RLO A;  1DDW A;  4HDO A;  1XCG A;  4DX8 A;  2K2J A;  2DTC A;  3AJ4 A;  4ZRK A;  1Z87 A;  1H4R A;  5HE1 A;  4H8S A;  2ELB A;  4HB3 B;  4BBK A;  2G35 A;  3OAN A;  2LKO A;  5L81 A;  3PZD A;  1ZC3 B;  3A8P A;  1DYN A;  5D3V A;  2DLW A;  1K5D B;  4WVF B;  2M14 A;  2ZKM X;  1DDM A;  3M1I B;  2COA A;  1WI1 A;  2YVC A;  3TFM A;  2YT0 A;  1SGH A;  2YS3 A;  4KHA A;  1V88 A;  4CSQ A;  2D10 A;  2KUP A;  3VOQ A;  5HE0 A;  4WJ7 A;  3TCA A;  2I1J A;  4HSI A;  1KZ7 A;  3G9W A;  3HSA A;  2QKM A;  1U2B A;  4C0A A;  1OQN A;  1ZM0 A;  2IYB A;  3T06 A;  3TVV A;  2XQN M;  4MY6 A;  3TO1 A;  2KIG A;  1X1G A;  2EMS A;  1V61 A;  2KUQ A;  5GOW B;  4KHO A;  3RCP A;  4CHJ A;  2RGN B;  1I2H A;  3QBV B;  1XD4 A;  3AU4 A;  1U5F A;  4A6H A;  2KCJ A;  5JP4 A;  1J19 A;  1K5G B;  2YF0 A;  4F7H A;  2ROV A;  3A58 A;  1X11 A;  4L6E A;  3D8E A;  1WGQ A;  5C5B B;  2K00 A;  4P7I A;  2YSZ A;  1UPQ A;  4XWX A;  3N7C A;  5J3T A;  4GMV A;  4D0N B;  2D4Q A;  3VIA A;  4QJ3 B;  1UNP A;  2I5C A;  3CIK A;  3U7D A;  4HB2 B;  2KGX B;  1WJ1 A;  3PSC A;  4K2O A;  2W2X D;  3ZVR A;  1B55 A;  3D8F A;  3OHM B;  2KR0 A;  4EJN A;  2DKQ A;  1MI1 A;  2J0M A;  4F7G A;  3KRW A;  2JP2 A;  2ELA A;  2YRY A;  1P3R A;  3KRX A;  3SYX A;  4Z2N A;  1BTK A;  4YL8 A;  2V76 A;  3SNH A;  2Z14 A;  2DHK A;  2H7E A;  2K2U A;  3AU5 A;  2UZR A;  5D3W A;  3LJU X;  1BTN A;  4DXA B;  3PP2 A;  5DHF B;  3HK0 A;  4OSN A;  3F0W A;  1GG3 A;  2D9Y A;  2Z0O A;  3ODO A;  2W2W A;  1Q67 A;  4MK0 A;  4KHB B;  2CRF A;  5KQ4 A;  2KIE A;  2L2I A;  4TKN A;  1FAO A;  2QKL A;  4IOY X;  2YT2 A;  5D3X A;  5HE2 A;  1MAI A;  1AQC A;  1QC6 A;  2P8V A;  2DN6 A;  3PEG A;  4A6K A;  4KAX B;  2M38 A;  3NWA A;  4GNK B;  1NU2 A;  1BWN A;  2ADZ A;  4IFS A;  4HHV A;  4HAW B;  1FOE A;  3P6A A;  4HB4 B;  2Z4D A;  3F5R A;  1UEF A;  3PVW A;  2GS0 A;  1P6S A;  4WSF A;  1OMW A;  1MIZ B;  1LB1 A;  5JHG A;  1WG7 A;  2MDX A;  1M7E A;  5C16 A;  2P0D A;  2DHJ A;  2R0D A;  4A6F B;  5DIF B;  1ISN A;  3BIN A;  3P7Z A;  4YON A;  2UZS A;  1ZC4 B; 
#chains in the Genus database with same CATH homology
 5HE3 A;  2DYQ A;  3MPX A;  2LYD A;  2OQB A;  4A5K A;  1U5D A;  2MWN B;  2VRW B;  2DYN A;  4GPT B;  2D2Q A;  1DDV A;  5FI0 A;  1WVH A;  4HAX B;  2CAY A;  3GYO A;  1WGU A;  3PG7 A;  2ROZ B;  5LOP B;  2D9W A;  4ZRI A;  1UNR A;  3FSS A;  4CHM A;  5J3Q A;  3KZ1 A;  2CY4 A;  5KCV A;  4HAU B;  1LW3 A;  1FGZ A;  3SO6 A;  1FB8 A;  1MK7 B;  3QWM A;  2YS5 A;  4MT7 A;  1GC7 A;  1I7A A;  2N23 A;  2RVB B;  4GXB A;  1EVH A;  4GZU A;  2AEH A;  4K2P A;  2NMB A;  2GCL A;  3TW1 A;  5CLL B;  4NY0 A;  2GJY A;  3PVL A;  2D9X A;  2X18 A;  1V5U A;  1V5M A;  2I1K A;  4HB0 B;  5CLQ B;  3X23 A;  2YS1 A;  1XR0 B;  2VKI A;  2DHI A;  2EMT A;  2Y7B A;  4Z2M B;  2ZPY A;  4K17 A;  1WJM A;  4ZRJ A;  1J0W A;  1H10 A;  4Y94 A;  5D27 A;  2J0J A;  4HAY B;  1FHO A;  5LON B;  2J0K A;  2DA0 A;  2HTH B;  3MDB C;  1EF1 A;  5C5B A;  3HW2 B;  1P5T A;  3ODX A;  1EGX A;  3HQC A;  4DBB A;  2D11 A;  1PMS A;  2GCJ A;  1U5G A;  2DKP A;  3A8Q A;  2IFS A;  2COF A;  1MKE A;  2RUK B;  3ULB A;  5C79 A;  3NSU A;  1NI2 A;  1MPH A;  2EC1 A;  1UNQ A;  3CXB B;  4KVG B;  5J3Y A;  5FI1 A;  2OTX A;  3BJI A;  2HE7 A;  2I5F A;  3KY9 A;  3A98 B;  3ODW A;  2PZ1 A;  1XKE A;  2W2X C;  2Z0Q A;  1QQG A;  1TXD A;  2D9Z A;  3ULC A;  3SUZ A;  1W1H A;  4DX9 0;  1MIX A;  1SHC A;  3DXD A;  2E2X A;  4HAT B;  3V5W A;  4GN1 A;  1V5P A;  5D3Y A;  2LUL A;  2P0F A;  1Y5O A;  2DX5 A;  1X1F A;  3ZDT A;  1V89 A;  2Y8F A;  2MFQ A;  3FM8 C;  1Y19 B;  5EFX A;  3PVU A;  5DI9 B;  2NZ8 B;  2LOX A;  3DXC A;  3ML4 A;  4EKU A;  2COC A;  3KSY A;  1X05 A;  1E5W A;  3IVF A;  3O96 A;  1U29 A;  1BAK A;  4HDQ A;  5DHA B;  4EMO A;  1EAZ A;  2YT1 A;  5KQ1 A;  1IRS A;  1UPR A;  2J59 M;  1DRO A;  1W1G A;  2RNR B;  1X86 A;  1M7R A;  1GC6 A;  2Z0P A;  1FHW A;  2Y8G A;  1KI1 B;  4IAP A;  1MK9 B;  4K81 A;  4PNK A;  2R09 A;  2DX1 A;  1FGY A;  2N0Y A;  4GMX B;  1PFJ A;  2VSZ A;  4F7U P;  2L1C A;  3WYF B;  1ZVR A;  2FJL A;  1DBH A;  1NTV A;  4A6F A;  3D8D A;  1KZG A;  2LG1 A;  3FEH A;  2Q13 A;  1RRP B;  1AWE A;  2P0H A;  5JHH A;  1OY2 A;  3GYP A;  3UZT A;  1FHX A;  4HAV B;  4HAZ B;  1XX0 A;  1TQZ A;  3SV1 A;  4B6H A;  1U5E A;  2COD A;  1TJ6 A;  5DH9 B;  1W1D A;  4TYZ A;  1NTY A;  2BCJ A;  2DFK A;  5JLJ B;  1RJ2 A;  1XOD A;  2LOZ A;  1PLS A;  5C6R A;  2EJ8 A;  1U27 A;  2AL6 A;  2CY5 A;  3WA0 A;  4NSW A;  2RSG A;  4PQ0 A;  1ZSQ A;  1N3H A;  4CYE A;  3DXE A;  3U8Z A;  2D9V A;  2UVM A;  2MKR A;  3QIJ A;  2H7D A;  2RLO A;  1DDW A;  4HDO A;  1XCG A;  4DX8 A;  2K2J A;  2DTC A;  3AJ4 A;  4ZRK A;  1Z87 A;  1H4R A;  5HE1 A;  4H8S A;  2ELB A;  4HB3 B;  4BBK A;  2G35 A;  3OAN A;  2LKO A;  5L81 A;  3PZD A;  1ZC3 B;  3A8P A;  1DYN A;  5D3V A;  2DLW A;  1K5D B;  4WVF B;  2M14 A;  1DDM A;  3M1I B;  2COA A;  1WI1 A;  2YVC A;  3TFM A;  2YT0 A;  1SGH A;  2YS3 A;  4KHA A;  1V88 A;  2D10 A;  2KUP A;  3VOQ A;  5HE0 A;  4WJ7 A;  3TCA A;  2I1J A;  1KZ7 A;  3G9W A;  2QKM A;  1U2B A;  4C0A A;  1OQN A;  1ZM0 A;  2IYB A;  3T06 A;  3TVV A;  2XQN M;  4MY6 A;  3TO1 A;  1X1G A;  2EMS A;  1V61 A;  5GOW B;  4KHO A;  3RCP A;  4CHJ A;  2RGN B;  1I2H A;  3QBV B;  1XD4 A;  3AU4 A;  1U5F A;  4A6H A;  2KCJ A;  5JP4 A;  1J19 A;  1K5G B;  2YF0 A;  4F7H A;  2ROV A;  4L6E A;  1X11 A;  3D8E A;  1WGQ A;  5C5B B;  2K00 A;  4P7I A;  2YSZ A;  1UPQ A;  4XWX A;  3N7C A;  5J3T A;  4GMV A;  4D0N B;  2D4Q A;  3VIA A;  1UNP A;  2I5C A;  3CIK A;  3U7D A;  4HB2 B;  2KGX B;  1WJ1 A;  3PSC A;  4K2O A;  2W2X D;  3ZVR A;  1B55 A;  3D8F A;  4EJN A;  2DKQ A;  2J0M A;  4F7G A;  3KRW A;  2JP2 A;  2ELA A;  2YRY A;  1P3R A;  3KRX A;  3SYX A;  4Z2N A;  1BTK A;  4YL8 A;  2V76 A;  3SNH A;  2DHK A;  2H7E A;  2K2U A;  3AU5 A;  2UZR A;  5D3W A;  3LJU X;  1BTN A;  4DXA B;  3PP2 A;  5DHF B;  3HK0 A;  3F0W A;  1GG3 A;  2D9Y A;  2Z0O A;  3ODO A;  2W2W A;  1Q67 A;  4MK0 A;  4KHB B;  2CRF A;  5KQ4 A;  2L2I A;  4TKN A;  1FAO A;  2QKL A;  4IOY X;  5D3X A;  5HE2 A;  1MAI A;  1AQC A;  1QC6 A;  2P8V A;  2DN6 A;  3PEG A;  4A6K A;  4KAX B;  2M38 A;  1NU2 A;  1BWN A;  2ADZ A;  4IFS A;  4HHV A;  4HAW B;  1FOE A;  3P6A A;  4HB4 B;  3F5R A;  1UEF A;  3PVW A;  2GS0 A;  1P6S A;  4WSF A;  1OMW A;  1MIZ B;  1LB1 A;  5JHG A;  1WG7 A;  2MDX A;  1M7E A;  5C16 A;  2P0D A;  2DHJ A;  2R0D A;  4A6F B;  5DIF B;  1ISN A;  3BIN A;  3P7Z A;  4YON A;  2UZS A;  1ZC4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...