1U5EA

Crystal structure of a n-terminal fragment of skap-hom containing both the helical dimerization domain and the ph domain
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
211
structure length
170
Chain Sequence
GSPEEIRNLLADVETFVADTLKGENLSKKAKEKRESLIKKIKDVKSVYLQEFQFPPIAAQDLPFVIKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYDVRMNNTLRKDGKKDCCFEICAPDKRIYQFTAASPKDAEEWVQQLKFILQDLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Src-associated adaptor protein
publication title Structural Basis for the Dimerization and Phosphoinositide Specificity of the Src Kinase-associated Phosphoproteins SKAP55 and SKAP-Hom
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 51
structure length 170
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1u5eA02
2IFSA 3DXDA 1I2HA 1B55A 4F7HA 4A5KA 2DYNA 3HK0A 2D11A 1AWEA 2D2QA 5HE1A 2YRYA 1FHWA 2DX5A 2JP2A 2ADZA 5D3YA 1E5WA 2Z0OA 1TJ6A 1EF1A 1MKEA 3PG7A 2J0KA 1GC7A 2K00A 2D10A 2KGXB 1EGXA 1BTNA 4F7UP 2HTHB 2D9WA 3DXEA 1BAKA 2L1CA 3QWMA 1UEFA 3VOQA 1IRSA 2E2XA 1MIZB 1FGYA 2MFQA 3FEHA 2NMBA 4WJ7A 2D9VA 1QC6A 2UVMA 4CYEA 1SHCA 2GCJA 2CY4A 3TCAA 3CIKA 3FM8C 2D9XA 2P0HA 1X86A 1RRPB 1ZC4B 1U29A 1NI2A 5J3QA 5D3WA 1FGZA 1OQNA 3TFMA 4A6KA 4MK0A 3LJUX 3ODOA 1U2BA 1H4RA 4C0AA 2D9ZA 1XODA 2FJLA 2DFKA 2EMTA 4A6FA 4K2PA 5CLLB 1J19A 2HE7A 3PVWA 1KZ7A 3BJIA 5HE3A 1XR0B 2DTCA 2LOXA 3QBVB 2VKIA 4GXBA 3A8PA 4GMVA 2DHKA 4BBKA 3FSSA 4TKNA 1Y19B 2H7DA 2RGNB 4WVFB 2N0YA 4IAPA 3MDBC 3A98B 2YS1A 4EKUA 1X1GA 3D8FA 2RNRB 4D0NB 1FOEA 3BINA 4KHBB 2CY5A 5JP4A 4HAUB 4MY6A 5C5BA 2COCA 3KRWA 5FI0A 2X18A 2J59M 4HB3B 2OQBA 4HAZB 1M7RA 2GS0A 1P5TA 2GJYA 5C6RA 3PVLA 2DHIA 3U8ZA 1RJ2A 1WI1A 2DKQA 2XQNM 2Y7BA 2ZPYA 2YT1A 4B6HA 5GOWB 3KSYA 5D3XA 4KHOA 1ZSQA 4A6HA 5J3TA 1GC6A 2EC1A 3NSUA 5DH9B 2LG1A 2Q13A 4WSFA 3ULBA 3HW2B 1DROA 3F5RA 1V61A 1QQGA 4NY0A 1LW3A 2QKMA 2DKPA 5J3YA 1X11A 3ULCA 2R09A 2M38A 4CHMA 4IOYX 3X23A 4HAWB 2GCLA 4Z2MB 1BWNA 4HB0B 2YSZA 3M1IB 5C16A 2Y8FA 4PQ0A 5EFXA 3KZ1A 3AU5A 3O96A 1FHOA 1OY2A 2DYQA 1ISNA 2DN6A 1DDMA 5DI9B 4KAXB 4DX8A 1NU2A 3OANA 1P6SA 2MWNB 4HAVB 4ZRKA 2UZRA 4NSWA 5LOPB 4XWXA 4H8SA 2Y8GA 3U7DA 2KCJA 1MAIA 1X05A 2LKOA 3SV1A 1W1GA 1M7EA 1J0WA 5DHAB 1BTKA 1ZVRA 2K2UA 1MK9B 2CODA 2AL6A 4DXAB 3SYXA 4EJNA 1X1FA 3DXCA 1LB1A 3PSCA 5JLJB 1WG7A 2VSZA 2YVCA 4YL8A 3D8DA 3KY9A 3RCPA 1FAOA 1WGQA 2QKLA 1PFJA 4EMOA 1SGHA 1UNPA 1Y5OA 2I5CA 4CHJA 2LULA 2EMSA 2COAA 1NTVA 1WGUA 1WJ1A 3TVVA 5DIFB 3QIJA 5HE0A 4HAXB 1GG3A 1UPQA 2YS3A 4HHVA 5KCVA 3GYPA 4ZRJA 3SUZA 5KQ4A 2DA0A 1H10A 1XD4A 4KHAA 4YONA 3ODWA 2LOZA 3TO1A 5CLQB 1V88A 1WJMA 4A6FB 1DYNA 3V5WA 2MKRA 2I5FA 2W2WA 2W2XD 1V89A 4ZRIA 3PVUA 2RLOA 3SO6A 4HDQA 1U5DA 1DDWA 4K81A 3PEGA 1N3HA 2AEHA 3G9WA 2Z0PA 4HB4B 3ZDTA 3ZVRA 1ZM0A 5D27A 5FI1A 3HQCA 3N7CA 2DHJA 2EJ8A 4HATB 4KVGB 1XX0A 1U5GA 2YF0A 2RSGA 1TXDA 2R0DA 5C5BB 2L2IA 4K17A 2W2XC 1V5UA 3UZTA 1W1HA 1TQZA 2P0DA 2OTXA 4GN1A 2DX1A 5L81A 3VIAA 3P6AA 3MPXA 1MPHA 2RVBB 4DBBA 2ELAA 5JHHA 2M14A 3D8EA 1U5FA 1WVHA 4IFSA 3AJ4A 2I1JA 5LONB 2ROVA 3WYFB 4MT7A 1FHXA 3PP2A 1PLSA 3ML4A 1Z87A 2RUKB 4TYZA 2D4QA 4Z2NA 1UNRA 2D9YA 4L6EA 4GPTB 4K2OA 2BCJA 3PZDA 5D3VA 2J0JA 2VRWB 5HE2A 4PNKA 4P7IA 1V5MA 1NTYA 2P0FA 1I7AA 2KUPA 2ELBA 3T06A 2H7EA 5DHFB 1XCGA 2J0MA 2PZ1A 1FB8A 3A8QA 1KI1B 2I1KA 2LYDA 2ROZB 4GZUA 2Z0QA 2CAYA 4HAYB 4F7GA 2YS5A 2COFA 3AU4A 1K5GB 3WA0A 1U5EA 3GYOA 1V5PA 1EAZA 3SNHA 1K5DB 2MDXA 1Q67A 1UPRA 1DDVA 1W1DA 1EVHA 2N23A 2P8VA 1MK7B 5JHGA 2K2JA 1U27A 4DX90 4HDOA 3IVFA 3CXBB 1OMWA 1PMSA 3P7ZA 2UZSA 2V76A 4Y94A 3TW1A 3KRXA 2G35A 1AQCA 4GMXB 1P3RA 1ZC3B 5C79A 2NZ8B 2DLWA 3ODXA 1DBHA 4HB2B 1KZGA 1UNQA 2YT0A 2IYBA 1MIXA 3F0WA 2CRFA 1XKEA 5KQ1A
chains in the Genus database with same CATH superfamily
2IFSA 3DXDA 1I2HA 1B55A 4F7HA 2RRFA 4A5KA 2DYNA 3HK0A 2D11A 1AWEA 2D2QA 5HE1A 2YRYA 1FHWA 2DX5A 2JP2A 2ADZA 5D3YA 1E5WA 2Z0OA 1TJ6A 1EF1A 1MKEA 3NWAA 3PG7A 2J0KA 1GC7A 2K00A 2D10A 2KGXB 1EGXA 1BTNA 4F7UP 2HTHB 2D9WA 3DXEA 1BAKA 2L1CA 3QWMA 1UEFA 3VOQA 1IRSA 2E2XA 1MIZB 1FGYA 2MFQA 3FEHA 2NMBA 4WJ7A 2D9VA 1QC6A 2UVMA 4CYEA 1SHCA 3NWDA 2GCJA 2CY4A 3TCAA 3CIKA 3FM8C 2D9XA 2P0HA 1X86A 1RRPB 1ZC4B 1U29A 1NI2A 5J3QA 5D3WA 1FGZA 1OQNA 4OSNA 3TFMA 4A6KA 4MK0A 4L1RA 3LJUX 3ODOA 1U2BA 1H4RA 4C0AA 2D9ZA 1XODA 2FJLA 2DFKA 2EMTA 4A6FA 5M4YB 4K2PA 5CLLB 1J19A 2HE7A 3PVWA 1KZ7A 3BJIA 5HE3A 1XR0B 2DTCA 2LOXA 3QBVB 2VKIA 4GXBA 3A8PA 4GMVA 4QJ3B 4DIXA 2DHKA 4BBKA 3FSSA 3U12A 4TKNA 1Y19B 4QJ5B 2H7DA 2YT2A 2RGNB 4WVFB 2N0YA 4IAPA 3MDBC 3A98B 2YS1A 4EKUA 1X1GA 3D8FA 2RNRB 4D0NB 1FOEA 3BINA 4KHBB 2CY5A 5JP4A 4HAUB 2Z4DA 4MY6A 5C5BA 2COCA 3KRWA 5FI0A 3NWFA 2X18A 2J59M 4HB3B 2OQBA 4HAZB 1M7RA 2GS0A 2KUQA 1P5TA 2GJYA 5C6RA 3PVLA 2DHIA 3U8ZA 1RJ2A 1WI1A 2DKQA 2XQNM 2Y7BA 1ZYIA 2ZPYA 2YT1A 4B6HA 5GOWB 2K8EA 3KSYA 5D3XA 4KHOA 1ZSQA 2FJUB 4A6HA 5J3TA 2NBVA 1GC6A 2EC1A 3NSUA 5DH9B 2LG1A 3FVCA 2Q13A 4WSFA 3ULBA 3HW2B 1DROA 3F5RA 1V61A 1QQGA 4NY0A 1LW3A 2QKMA 2DKPA 5J3YA 1X11A 3ULCA 2R09A 2M38A 4CHMA 4IOYX 3X23A 4HAWB 2GCLA 4Z2MB 1BWNA 4HB0B 2YSZA 3M1IB 5C16A 2Y8FA 4PQ0A 5EFXA 3KZ1A 3AU5A 3O96A 1FHOA 1OY2A 2DYQA 1ISNA 2DN6A 1DDMA 5DI9B 4KAXB 4DX8A 1NU2A 3OANA 1P6SA 1XKEA 2MWNB 4HAVB 4ZRKA 2UZRA 4NSWA 5LOPB 4XWXA 4H8SA 2Y8GA 3U7DA 2KCJA 1MAIA 1X05A 2LKOA 3SV1A 1T77A 1W1GA 1M7EA 1J0WA 3HSAA 5DHAB 1BTKA 1ZVRA 2K2UA 4HSIA 1MK9B 2CODA 2AL6A 4DXAB 4QXAB 3SYXA 4EJNA 1X1FA 3DXCA 1LB1A 3PSCA 5JLJB 1WG7A 2VSZA 2YVCA 4YL8A 3D8DA 3KY9A 3RCPA 1FAOA 1WGQA 2QKLA 1PFJA 3DCXA 4EMOA 1SGHA 1UNPA 1Y5OA 2I5CA 4CHJA 2LULA 2EMSA 2COAA 1NTVA 1WGUA 1WJ1A 3TVVA 5DIFB 3QIJA 5HE0A 4HAXB 1GG3A 1UPQA 2YS3A 4HHVA 5KCVA 3GYPA 4ZRJA 3SUZA 5KQ4A 2DA0A 4D6WA 1H10A 1XD4A 4KHAA 4YONA 3ODWA 2KIGA 2LOZA 2Z59A 3TO1A 5CLQB 1V88A 1WJMA 4A6FB 1DYNA 3V5WA 3OHMB 2MKRA 2KR0A 5I2SA 3B77A 2I5FA 2W2WA 2W2XD 3A58A 1V89A 4ZRIA 3PVUA 2RLOA 3SO6A 4HDQA 1U5DA 1DDWA 4K81A 3PEGA 1N3HA 2AEHA 3G9WA 2Z0PA 4HB4B 3ZDTA 3ZVRA 4GOUA 1ZM0A 5D27A 5FI1A 3HQCA 3N7CA 2DHJA 2EJ8A 4HATB 4KVGB 1XX0A 1U5GA 2YF0A 2RSGA 1TXDA 2R0DA 5C5BB 2L2IA 4K17A 2W2XC 1V5UA 3UZTA 1W1HA 1TQZA 4GNKB 2P0DA 2OTXA 4GN1A 2DX1A 5L81A 2KIEA 3VIAA 3P6AA 3MPXA 4OT1A 1MPHA 2RVBB 4DBBA 1MI1A 2ELAA 3NW8A 5JHHA 2M14A 3D8EA 1U5FA 1WVHA 4IFSA 3AJ4A 2I1JA 5LONB 2ROVA 3WYFB 4MT7A 1FHXA 3PP2A 1PLSA 3ML4A 1Z87A 4CSQA 2RUKB 5I2MA 4TYZA 2D4QA 4Z2NA 1UNRA 2D9YA 4L6EA 4GPTB 4K2OA 2BCJA 3PZDA 5D3VA 2J0JA 2K49A 2VRWB 5HE2A 4KHBA 4PNKA 4P7IA 1V5MA 1NTYA 2P0FA 1I7AA 2KUPA 2ELBA 3T06A 2H7EA 5DHFB 1XCGA 2J0MA 2PZ1A 1FB8A 3A8QA 1KI1B 2I1KA 2LYDA 2ROZB 4GZUA 2GUMA 2Z0QA 5IRSA 2CAYA 4HAYB 4QJ4B 4F7GA 2YS5A 2COFA 3AU4A 1K5GB 3WA0A 1U5EA 5LG4B 3GYOA 2Z13A 1V5PA 1EAZA 3SNHA 1K5DB 2MDXA 1Q67A 1UPRA 1DDVA 1W1DA 1EVHA 2N23A 2P8VA 1MK7B 5JHGA 2K2JA 1U27A 4DX90 4HDOA 3IVFA 3CXBB 1OMWA 3HIEA 1PMSA 3P7ZA 2UZSA 2V76A 2ZKMX 4Y94A 3TW1A 3KRXA 2G35A 1AQCA 4GMXB 1P3RA 1ZC3B 2Z14A 5C79A 2NZ8B 2DLWA 3ODXA 1DBHA 4HB2B 1KZGA 1UNQA 2YT0A 2IYBA 1MIXA 3F0WA 2CRFA 2R2YA 5KQ1A
chains in the Genus database with same CATH topology
2IFSA 3DXDA 1I2HA 1B55A 4F7HA 4A5KA 2DYNA 3HK0A 2D11A 1AWEA 2D2QA 5HE1A 2YRYA 1FHWA 2DX5A 2JP2A 2ADZA 5D3YA 1E5WA 2Z0OA 1TJ6A 1EF1A 1MKEA 3PG7A 2J0KA 1GC7A 2K00A 2D10A 2KGXB 1EGXA 1BTNA 4F7UP 2HTHB 2D9WA 3DXEA 1BAKA 2L1CA 3QWMA 1UEFA 3VOQA 1IRSA 2E2XA 1MIZB 1FGYA 2MFQA 3FEHA 2NMBA 4WJ7A 2D9VA 1QC6A 2UVMA 4CYEA 1SHCA 2GCJA 2CY4A 3TCAA 3CIKA 3FM8C 2D9XA 2P0HA 1X86A 1RRPB 1ZC4B 1U29A 1NI2A 5J3QA 5D3WA 1FGZA 1OQNA 3TFMA 4A6KA 4MK0A 3LJUX 3ODOA 1U2BA 1H4RA 4C0AA 2D9ZA 1XODA 2FJLA 2DFKA 2EMTA 4A6FA 4K2PA 5CLLB 1J19A 2HE7A 3PVWA 1KZ7A 3BJIA 5HE3A 1XR0B 2DTCA 2LOXA 3QBVB 2VKIA 4GXBA 3A8PA 4GMVA 2DHKA 4BBKA 3FSSA 4TKNA 1Y19B 2H7DA 2RGNB 4WVFB 2N0YA 4IAPA 3MDBC 3A98B 2YS1A 4EKUA 1X1GA 3D8FA 2RNRB 4D0NB 1FOEA 3BINA 4KHBB 2CY5A 5JP4A 4HAUB 4MY6A 5C5BA 2COCA 3KRWA 5FI0A 2X18A 2J59M 4HB3B 2OQBA 4HAZB 1M7RA 2GS0A 1P5TA 2GJYA 5C6RA 3PVLA 2DHIA 3U8ZA 1RJ2A 1WI1A 2DKQA 2XQNM 2Y7BA 2ZPYA 2YT1A 4B6HA 5GOWB 3KSYA 5D3XA 4KHOA 1ZSQA 4A6HA 5J3TA 1GC6A 2EC1A 3NSUA 5DH9B 2LG1A 2Q13A 4WSFA 3ULBA 3HW2B 1DROA 3F5RA 1V61A 1QQGA 4NY0A 1LW3A 2QKMA 2DKPA 5J3YA 1X11A 3ULCA 2R09A 2M38A 4CHMA 4IOYX 3X23A 4HAWB 2GCLA 4Z2MB 1BWNA 4HB0B 2YSZA 3M1IB 5C16A 2Y8FA 4PQ0A 5EFXA 3KZ1A 3AU5A 3O96A 1FHOA 1OY2A 2DYQA 1ISNA 2DN6A 1DDMA 5DI9B 4KAXB 4DX8A 1NU2A 3OANA 1P6SA 2MWNB 4HAVB 4ZRKA 2UZRA 4NSWA 5LOPB 4XWXA 4H8SA 2Y8GA 3U7DA 2KCJA 1MAIA 1X05A 2LKOA 3SV1A 1W1GA 1M7EA 1J0WA 5DHAB 1BTKA 1ZVRA 2K2UA 1MK9B 2CODA 2AL6A 4DXAB 3SYXA 4EJNA 1X1FA 3DXCA 1LB1A 3PSCA 5JLJB 1WG7A 2VSZA 2YVCA 4YL8A 3D8DA 3KY9A 3RCPA 1FAOA 1WGQA 2QKLA 1PFJA 4EMOA 1SGHA 1UNPA 1Y5OA 2I5CA 4CHJA 2LULA 2EMSA 2COAA 1NTVA 1WGUA 1WJ1A 3TVVA 5DIFB 3QIJA 5HE0A 4HAXB 1GG3A 1UPQA 2YS3A 4HHVA 5KCVA 3GYPA 4ZRJA 3SUZA 5KQ4A 2DA0A 1H10A 1XD4A 4KHAA 4YONA 3ODWA 2LOZA 3TO1A 5CLQB 1V88A 1WJMA 4A6FB 1DYNA 3V5WA 2MKRA 2I5FA 2W2WA 2W2XD 1V89A 4ZRIA 3PVUA 2RLOA 3SO6A 4HDQA 1U5DA 1DDWA 4K81A 3PEGA 1N3HA 2AEHA 3G9WA 2Z0PA 4HB4B 3ZDTA 3ZVRA 1ZM0A 5D27A 5FI1A 3HQCA 3N7CA 2DHJA 2EJ8A 4HATB 4KVGB 1XX0A 1U5GA 2YF0A 2RSGA 1TXDA 2R0DA 5C5BB 2L2IA 4K17A 2W2XC 1V5UA 3UZTA 1W1HA 1TQZA 2P0DA 2OTXA 4GN1A 2DX1A 5L81A 3VIAA 3P6AA 3MPXA 1MPHA 2RVBB 4DBBA 2ELAA 5JHHA 2M14A 3D8EA 1U5FA 1WVHA 4IFSA 3AJ4A 2I1JA 5LONB 2ROVA 3WYFB 4MT7A 1FHXA 3PP2A 1PLSA 3ML4A 1Z87A 2RUKB 4TYZA 2D4QA 4Z2NA 1UNRA 2D9YA 4L6EA 4GPTB 4K2OA 2BCJA 3PZDA 5D3VA 2J0JA 2VRWB 5HE2A 4PNKA 4P7IA 1V5MA 1NTYA 2P0FA 1I7AA 2KUPA 2ELBA 3T06A 2H7EA 5DHFB 1XCGA 2J0MA 2PZ1A 1FB8A 3A8QA 1KI1B 2I1KA 2LYDA 2ROZB 4GZUA 2Z0QA 2CAYA 4HAYB 4F7GA 2YS5A 2COFA 3AU4A 1K5GB 3WA0A 1U5EA 3GYOA 1V5PA 1EAZA 3SNHA 1K5DB 2MDXA 1Q67A 1UPRA 1DDVA 1W1DA 1EVHA 2N23A 2P8VA 1MK7B 5JHGA 2K2JA 1U27A 4DX90 4HDOA 3IVFA 3CXBB 1OMWA 1PMSA 3P7ZA 2UZSA 2V76A 4Y94A 3TW1A 3KRXA 2G35A 1AQCA 4GMXB 1P3RA 1ZC3B 5C79A 2NZ8B 2DLWA 3ODXA 1DBHA 4HB2B 1KZGA 1UNQA 2YT0A 2IYBA 1MIXA 3F0WA 2CRFA 1XKEA 5KQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IFS A;  3DXD A;  1I2H A;  1B55 A;  4F7H A;  4A5K A;  2DYN A;  3HK0 A;  2D11 A;  1AWE A;  2D2Q A;  5HE1 A;  2YRY A;  1FHW A;  2DX5 A;  2JP2 A;  2ADZ A;  5D3Y A;  1E5W A;  2Z0O A;  1TJ6 A;  1EF1 A;  1MKE A;  3PG7 A;  2J0K A;  1GC7 A;  2K00 A;  2D10 A;  2KGX B;  1EGX A;  1BTN A;  4F7U P;  2HTH B;  2D9W A;  3DXE A;  1BAK A;  2L1C A;  3QWM A;  1UEF A;  3VOQ A;  1IRS A;  2E2X A;  1MIZ B;  1FGY A;  2MFQ A;  3FEH A;  2NMB A;  4WJ7 A;  2D9V A;  1QC6 A;  2UVM A;  4CYE A;  1SHC A;  2GCJ A;  2CY4 A;  3TCA A;  3CIK A;  3FM8 C;  2D9X A;  2P0H A;  1X86 A;  1RRP B;  1ZC4 B;  1U29 A;  1NI2 A;  5J3Q A;  5D3W A;  1FGZ A;  1OQN A;  3TFM A;  4A6K A;  4MK0 A;  3LJU X;  3ODO A;  1U2B A;  1H4R A;  4C0A A;  2D9Z A;  1XOD A;  2FJL A;  2DFK A;  2EMT A;  4A6F A;  4K2P A;  5CLL B;  1J19 A;  2HE7 A;  3PVW A;  1KZ7 A;  3BJI A;  5HE3 A;  1XR0 B;  2DTC A;  2LOX A;  3QBV B;  2VKI A;  4GXB A;  3A8P A;  4GMV A;  2DHK A;  4BBK A;  3FSS A;  4TKN A;  1Y19 B;  2H7D A;  2RGN B;  4WVF B;  2N0Y A;  4IAP A;  3MDB C;  3A98 B;  2YS1 A;  4EKU A;  1X1G A;  3D8F A;  2RNR B;  4D0N B;  1FOE A;  3BIN A;  4KHB B;  2CY5 A;  5JP4 A;  4HAU B;  4MY6 A;  5C5B A;  2COC A;  3KRW A;  5FI0 A;  2X18 A;  2J59 M;  4HB3 B;  2OQB A;  4HAZ B;  1M7R A;  2GS0 A;  1P5T A;  2GJY A;  5C6R A;  3PVL A;  2DHI A;  3U8Z A;  1RJ2 A;  1WI1 A;  2DKQ A;  2XQN M;  2Y7B A;  2ZPY A;  2YT1 A;  4B6H A;  5GOW B;  3KSY A;  5D3X A;  4KHO A;  1ZSQ A;  4A6H A;  5J3T A;  1GC6 A;  2EC1 A;  3NSU A;  5DH9 B;  2LG1 A;  2Q13 A;  4WSF A;  3ULB A;  3HW2 B;  1DRO A;  3F5R A;  1V61 A;  1QQG A;  4NY0 A;  1LW3 A;  2QKM A;  2DKP A;  5J3Y A;  1X11 A;  3ULC A;  2R09 A;  2M38 A;  4CHM A;  4IOY X;  3X23 A;  4HAW B;  2GCL A;  4Z2M B;  1BWN A;  4HB0 B;  2YSZ A;  3M1I B;  5C16 A;  2Y8F A;  4PQ0 A;  5EFX A;  3KZ1 A;  3AU5 A;  3O96 A;  1FHO A;  1OY2 A;  2DYQ A;  1ISN A;  2DN6 A;  1DDM A;  5DI9 B;  4KAX B;  4DX8 A;  1NU2 A;  3OAN A;  1P6S A;  2MWN B;  4HAV B;  4ZRK A;  2UZR A;  4NSW A;  5LOP B;  4XWX A;  4H8S A;  2Y8G A;  3U7D A;  2KCJ A;  1MAI A;  1X05 A;  2LKO A;  3SV1 A;  1W1G A;  1M7E A;  1J0W A;  5DHA B;  1BTK A;  1ZVR A;  2K2U A;  1MK9 B;  2COD A;  2AL6 A;  4DXA B;  3SYX A;  4EJN A;  1X1F A;  3DXC A;  1LB1 A;  3PSC A;  5JLJ B;  1WG7 A;  2VSZ A;  2YVC A;  4YL8 A;  3D8D A;  3KY9 A;  3RCP A;  1FAO A;  1WGQ A;  2QKL A;  1PFJ A;  4EMO A;  1SGH A;  1UNP A;  1Y5O A;  2I5C A;  4CHJ A;  2LUL A;  2EMS A;  2COA A;  1NTV A;  1WGU A;  1WJ1 A;  3TVV A;  5DIF B;  3QIJ A;  5HE0 A;  4HAX B;  1GG3 A;  1UPQ A;  2YS3 A;  4HHV A;  5KCV A;  3GYP A;  4ZRJ A;  3SUZ A;  5KQ4 A;  2DA0 A;  1H10 A;  1XD4 A;  4KHA A;  4YON A;  3ODW A;  2LOZ A;  3TO1 A;  5CLQ B;  1V88 A;  1WJM A;  4A6F B;  1DYN A;  3V5W A;  2MKR A;  2I5F A;  2W2W A;  2W2X D;  1V89 A;  4ZRI A;  3PVU A;  2RLO A;  3SO6 A;  4HDQ A;  1U5D A;  1DDW A;  4K81 A;  3PEG A;  1N3H A;  2AEH A;  3G9W A;  2Z0P A;  4HB4 B;  3ZDT A;  3ZVR A;  1ZM0 A;  5D27 A;  5FI1 A;  3HQC A;  3N7C A;  2DHJ A;  2EJ8 A;  4HAT B;  4KVG B;  1XX0 A;  1U5G A;  2YF0 A;  2RSG A;  1TXD A;  2R0D A;  5C5B B;  2L2I A;  4K17 A;  2W2X C;  1V5U A;  3UZT A;  1W1H A;  1TQZ A;  2P0D A;  2OTX A;  4GN1 A;  2DX1 A;  5L81 A;  3VIA A;  3P6A A;  3MPX A;  1MPH A;  2RVB B;  4DBB A;  2ELA A;  5JHH A;  2M14 A;  3D8E A;  1U5F A;  1WVH A;  4IFS A;  3AJ4 A;  2I1J A;  5LON B;  2ROV A;  3WYF B;  4MT7 A;  1FHX A;  3PP2 A;  1PLS A;  3ML4 A;  1Z87 A;  2RUK B;  4TYZ A;  2D4Q A;  4Z2N A;  1UNR A;  2D9Y A;  4L6E A;  4GPT B;  4K2O A;  2BCJ A;  3PZD A;  5D3V A;  2J0J A;  2VRW B;  5HE2 A;  4PNK A;  4P7I A;  1V5M A;  1NTY A;  2P0F A;  1I7A A;  2KUP A;  2ELB A;  3T06 A;  2H7E A;  5DHF B;  1XCG A;  2J0M A;  2PZ1 A;  1FB8 A;  3A8Q A;  1KI1 B;  2I1K A;  2LYD A;  2ROZ B;  4GZU A;  2Z0Q A;  2CAY A;  4HAY B;  4F7G A;  2YS5 A;  2COF A;  3AU4 A;  1K5G B;  3WA0 A;  1U5E A;  3GYO A;  1V5P A;  1EAZ A;  3SNH A;  1K5D B;  2MDX A;  1Q67 A;  1UPR A;  1DDV A;  1W1D A;  1EVH A;  2N23 A;  2P8V A;  1MK7 B;  5JHG A;  2K2J A;  1U27 A;  4DX9 0;  4HDO A;  3IVF A;  3CXB B;  1OMW A;  1PMS A;  3P7Z A;  2UZS A;  2V76 A;  4Y94 A;  3TW1 A;  3KRX A;  2G35 A;  1AQC A;  4GMX B;  1P3R A;  1ZC3 B;  5C79 A;  2NZ8 B;  2DLW A;  3ODX A;  1DBH A;  4HB2 B;  1KZG A;  1UNQ A;  2YT0 A;  2IYB A;  1MIX A;  3F0W A;  2CRF A;  1XKE A;  5KQ1 A; 
#chains in the Genus database with same CATH topology
 2IFS A;  3DXD A;  1I2H A;  1B55 A;  4F7H A;  2RRF A;  4A5K A;  2DYN A;  3HK0 A;  2D11 A;  1AWE A;  2D2Q A;  5HE1 A;  2YRY A;  1FHW A;  2DX5 A;  2JP2 A;  2ADZ A;  5D3Y A;  1E5W A;  2Z0O A;  1TJ6 A;  1EF1 A;  1MKE A;  3NWA A;  3PG7 A;  2J0K A;  1GC7 A;  2K00 A;  2D10 A;  2KGX B;  1EGX A;  1BTN A;  4F7U P;  2HTH B;  2D9W A;  3DXE A;  1BAK A;  2L1C A;  3QWM A;  1UEF A;  3VOQ A;  1IRS A;  2E2X A;  1MIZ B;  1FGY A;  2MFQ A;  3FEH A;  2NMB A;  4WJ7 A;  2D9V A;  1QC6 A;  2UVM A;  4CYE A;  1SHC A;  3NWD A;  2GCJ A;  2CY4 A;  3TCA A;  3CIK A;  3FM8 C;  2D9X A;  2P0H A;  1X86 A;  1RRP B;  1ZC4 B;  1U29 A;  1NI2 A;  5J3Q A;  5D3W A;  1FGZ A;  1OQN A;  4OSN A;  3TFM A;  4A6K A;  4MK0 A;  4L1R A;  3LJU X;  3ODO A;  1U2B A;  1H4R A;  4C0A A;  2D9Z A;  1XOD A;  2FJL A;  2DFK A;  2EMT A;  4A6F A;  5M4Y B;  4K2P A;  5CLL B;  1J19 A;  2HE7 A;  3PVW A;  1KZ7 A;  3BJI A;  5HE3 A;  1XR0 B;  2DTC A;  2LOX A;  3QBV B;  2VKI A;  4GXB A;  3A8P A;  4GMV A;  4QJ3 B;  4DIX A;  2DHK A;  4BBK A;  3FSS A;  3U12 A;  4TKN A;  1Y19 B;  4QJ5 B;  2H7D A;  2YT2 A;  2RGN B;  4WVF B;  2N0Y A;  4IAP A;  3MDB C;  3A98 B;  2YS1 A;  4EKU A;  1X1G A;  3D8F A;  2RNR B;  4D0N B;  1FOE A;  3BIN A;  4KHB B;  2CY5 A;  5JP4 A;  4HAU B;  2Z4D A;  4MY6 A;  5C5B A;  2COC A;  3KRW A;  5FI0 A;  3NWF A;  2X18 A;  2J59 M;  4HB3 B;  2OQB A;  4HAZ B;  1M7R A;  2GS0 A;  2KUQ A;  1P5T A;  2GJY A;  5C6R A;  3PVL A;  2DHI A;  3U8Z A;  1RJ2 A;  1WI1 A;  2DKQ A;  2XQN M;  2Y7B A;  1ZYI A;  2ZPY A;  2YT1 A;  4B6H A;  5GOW B;  2K8E A;  3KSY A;  5D3X A;  4KHO A;  1ZSQ A;  2FJU B;  4A6H A;  5J3T A;  2NBV A;  1GC6 A;  2EC1 A;  3NSU A;  5DH9 B;  2LG1 A;  3FVC A;  2Q13 A;  4WSF A;  3ULB A;  3HW2 B;  1DRO A;  3F5R A;  1V61 A;  1QQG A;  4NY0 A;  1LW3 A;  2QKM A;  2DKP A;  5J3Y A;  1X11 A;  3ULC A;  2R09 A;  2M38 A;  4CHM A;  4IOY X;  3X23 A;  4HAW B;  2GCL A;  4Z2M B;  1BWN A;  4HB0 B;  2YSZ A;  3M1I B;  5C16 A;  2Y8F A;  4PQ0 A;  5EFX A;  3KZ1 A;  3AU5 A;  3O96 A;  1FHO A;  1OY2 A;  2DYQ A;  1ISN A;  2DN6 A;  1DDM A;  5DI9 B;  4KAX B;  4DX8 A;  1NU2 A;  3OAN A;  1P6S A;  1XKE A;  2MWN B;  4HAV B;  4ZRK A;  2UZR A;  4NSW A;  5LOP B;  4XWX A;  4H8S A;  2Y8G A;  3U7D A;  2KCJ A;  1MAI A;  1X05 A;  2LKO A;  3SV1 A;  1T77 A;  1W1G A;  1M7E A;  1J0W A;  3HSA A;  5DHA B;  1BTK A;  1ZVR A;  2K2U A;  4HSI A;  1MK9 B;  2COD A;  2AL6 A;  4DXA B;  4QXA B;  3SYX A;  4EJN A;  1X1F A;  3DXC A;  1LB1 A;  3PSC A;  5JLJ B;  1WG7 A;  2VSZ A;  2YVC A;  4YL8 A;  3D8D A;  3KY9 A;  3RCP A;  1FAO A;  1WGQ A;  2QKL A;  1PFJ A;  3DCX A;  4EMO A;  1SGH A;  1UNP A;  1Y5O A;  2I5C A;  4CHJ A;  2LUL A;  2EMS A;  2COA A;  1NTV A;  1WGU A;  1WJ1 A;  3TVV A;  5DIF B;  3QIJ A;  5HE0 A;  4HAX B;  1GG3 A;  1UPQ A;  2YS3 A;  4HHV A;  5KCV A;  3GYP A;  4ZRJ A;  3SUZ A;  5KQ4 A;  2DA0 A;  4D6W A;  1H10 A;  1XD4 A;  4KHA A;  4YON A;  3ODW A;  2KIG A;  2LOZ A;  2Z59 A;  3TO1 A;  5CLQ B;  1V88 A;  1WJM A;  4A6F B;  1DYN A;  3V5W A;  3OHM B;  2MKR A;  2KR0 A;  5I2S A;  3B77 A;  2I5F A;  2W2W A;  2W2X D;  3A58 A;  1V89 A;  4ZRI A;  3PVU A;  2RLO A;  3SO6 A;  4HDQ A;  1U5D A;  1DDW A;  4K81 A;  3PEG A;  1N3H A;  2AEH A;  3G9W A;  2Z0P A;  4HB4 B;  3ZDT A;  3ZVR A;  4GOU A;  1ZM0 A;  5D27 A;  5FI1 A;  3HQC A;  3N7C A;  2DHJ A;  2EJ8 A;  4HAT B;  4KVG B;  1XX0 A;  1U5G A;  2YF0 A;  2RSG A;  1TXD A;  2R0D A;  5C5B B;  2L2I A;  4K17 A;  2W2X C;  1V5U A;  3UZT A;  1W1H A;  1TQZ A;  4GNK B;  2P0D A;  2OTX A;  4GN1 A;  2DX1 A;  5L81 A;  2KIE A;  3VIA A;  3P6A A;  3MPX A;  4OT1 A;  1MPH A;  2RVB B;  4DBB A;  1MI1 A;  2ELA A;  3NW8 A;  5JHH A;  2M14 A;  3D8E A;  1U5F A;  1WVH A;  4IFS A;  3AJ4 A;  2I1J A;  5LON B;  2ROV A;  3WYF B;  4MT7 A;  1FHX A;  3PP2 A;  1PLS A;  3ML4 A;  1Z87 A;  4CSQ A;  2RUK B;  5I2M A;  4TYZ A;  2D4Q A;  4Z2N A;  1UNR A;  2D9Y A;  4L6E A;  4GPT B;  4K2O A;  2BCJ A;  3PZD A;  5D3V A;  2J0J A;  2K49 A;  2VRW B;  5HE2 A;  4KHB A;  4PNK A;  4P7I A;  1V5M A;  1NTY A;  2P0F A;  1I7A A;  2KUP A;  2ELB A;  3T06 A;  2H7E A;  5DHF B;  1XCG A;  2J0M A;  2PZ1 A;  1FB8 A;  3A8Q A;  1KI1 B;  2I1K A;  2LYD A;  2ROZ B;  4GZU A;  2GUM A;  2Z0Q A;  5IRS A;  2CAY A;  4HAY B;  4QJ4 B;  4F7G A;  2YS5 A;  2COF A;  3AU4 A;  1K5G B;  3WA0 A;  1U5E A;  5LG4 B;  3GYO A;  2Z13 A;  1V5P A;  1EAZ A;  3SNH A;  1K5D B;  2MDX A;  1Q67 A;  1UPR A;  1DDV A;  1W1D A;  1EVH A;  2N23 A;  2P8V A;  1MK7 B;  5JHG A;  2K2J A;  1U27 A;  4DX9 0;  4HDO A;  3IVF A;  3CXB B;  1OMW A;  3HIE A;  1PMS A;  3P7Z A;  2UZS A;  2V76 A;  2ZKM X;  4Y94 A;  3TW1 A;  3KRX A;  2G35 A;  1AQC A;  4GMX B;  1P3R A;  1ZC3 B;  2Z14 A;  5C79 A;  2NZ8 B;  2DLW A;  3ODX A;  1DBH A;  4HB2 B;  1KZG A;  1UNQ A;  2YT0 A;  2IYB A;  1MIX A;  3F0W A;  2CRF A;  2R2Y A;  5KQ1 A; 
#chains in the Genus database with same CATH homology
 2IFS A;  3DXD A;  1I2H A;  1B55 A;  4F7H A;  4A5K A;  2DYN A;  3HK0 A;  2D11 A;  1AWE A;  2D2Q A;  5HE1 A;  2YRY A;  1FHW A;  2DX5 A;  2JP2 A;  2ADZ A;  5D3Y A;  1E5W A;  2Z0O A;  1TJ6 A;  1EF1 A;  1MKE A;  3PG7 A;  2J0K A;  1GC7 A;  2K00 A;  2D10 A;  2KGX B;  1EGX A;  1BTN A;  4F7U P;  2HTH B;  2D9W A;  3DXE A;  1BAK A;  2L1C A;  3QWM A;  1UEF A;  3VOQ A;  1IRS A;  2E2X A;  1MIZ B;  1FGY A;  2MFQ A;  3FEH A;  2NMB A;  4WJ7 A;  2D9V A;  1QC6 A;  2UVM A;  4CYE A;  1SHC A;  2GCJ A;  2CY4 A;  3TCA A;  3CIK A;  3FM8 C;  2D9X A;  2P0H A;  1X86 A;  1RRP B;  1ZC4 B;  1U29 A;  1NI2 A;  5J3Q A;  5D3W A;  1FGZ A;  1OQN A;  3TFM A;  4A6K A;  4MK0 A;  3LJU X;  3ODO A;  1U2B A;  1H4R A;  4C0A A;  2D9Z A;  1XOD A;  2FJL A;  2DFK A;  2EMT A;  4A6F A;  4K2P A;  5CLL B;  1J19 A;  2HE7 A;  3PVW A;  1KZ7 A;  3BJI A;  5HE3 A;  1XR0 B;  2DTC A;  2LOX A;  3QBV B;  2VKI A;  4GXB A;  3A8P A;  4GMV A;  2DHK A;  4BBK A;  3FSS A;  4TKN A;  1Y19 B;  2H7D A;  2RGN B;  4WVF B;  2N0Y A;  4IAP A;  3MDB C;  3A98 B;  2YS1 A;  4EKU A;  1X1G A;  3D8F A;  2RNR B;  4D0N B;  1FOE A;  3BIN A;  4KHB B;  2CY5 A;  5JP4 A;  4HAU B;  4MY6 A;  5C5B A;  2COC A;  3KRW A;  5FI0 A;  2X18 A;  2J59 M;  4HB3 B;  2OQB A;  4HAZ B;  1M7R A;  2GS0 A;  1P5T A;  2GJY A;  5C6R A;  3PVL A;  2DHI A;  3U8Z A;  1RJ2 A;  1WI1 A;  2DKQ A;  2XQN M;  2Y7B A;  2ZPY A;  2YT1 A;  4B6H A;  5GOW B;  3KSY A;  5D3X A;  4KHO A;  1ZSQ A;  4A6H A;  5J3T A;  1GC6 A;  2EC1 A;  3NSU A;  5DH9 B;  2LG1 A;  2Q13 A;  4WSF A;  3ULB A;  3HW2 B;  1DRO A;  3F5R A;  1V61 A;  1QQG A;  4NY0 A;  1LW3 A;  2QKM A;  2DKP A;  5J3Y A;  1X11 A;  3ULC A;  2R09 A;  2M38 A;  4CHM A;  4IOY X;  3X23 A;  4HAW B;  2GCL A;  4Z2M B;  1BWN A;  4HB0 B;  2YSZ A;  3M1I B;  5C16 A;  2Y8F A;  4PQ0 A;  5EFX A;  3KZ1 A;  3AU5 A;  3O96 A;  1FHO A;  1OY2 A;  2DYQ A;  1ISN A;  2DN6 A;  1DDM A;  5DI9 B;  4KAX B;  4DX8 A;  1NU2 A;  3OAN A;  1P6S A;  2MWN B;  4HAV B;  4ZRK A;  2UZR A;  4NSW A;  5LOP B;  4XWX A;  4H8S A;  2Y8G A;  3U7D A;  2KCJ A;  1MAI A;  1X05 A;  2LKO A;  3SV1 A;  1W1G A;  1M7E A;  1J0W A;  5DHA B;  1BTK A;  1ZVR A;  2K2U A;  1MK9 B;  2COD A;  2AL6 A;  4DXA B;  3SYX A;  4EJN A;  1X1F A;  3DXC A;  1LB1 A;  3PSC A;  5JLJ B;  1WG7 A;  2VSZ A;  2YVC A;  4YL8 A;  3D8D A;  3KY9 A;  3RCP A;  1FAO A;  1WGQ A;  2QKL A;  1PFJ A;  4EMO A;  1SGH A;  1UNP A;  1Y5O A;  2I5C A;  4CHJ A;  2LUL A;  2EMS A;  2COA A;  1NTV A;  1WGU A;  1WJ1 A;  3TVV A;  5DIF B;  3QIJ A;  5HE0 A;  4HAX B;  1GG3 A;  1UPQ A;  2YS3 A;  4HHV A;  5KCV A;  3GYP A;  4ZRJ A;  3SUZ A;  5KQ4 A;  2DA0 A;  1H10 A;  1XD4 A;  4KHA A;  4YON A;  3ODW A;  2LOZ A;  3TO1 A;  5CLQ B;  1V88 A;  1WJM A;  4A6F B;  1DYN A;  3V5W A;  2MKR A;  2I5F A;  2W2W A;  2W2X D;  1V89 A;  4ZRI A;  3PVU A;  2RLO A;  3SO6 A;  4HDQ A;  1U5D A;  1DDW A;  4K81 A;  3PEG A;  1N3H A;  2AEH A;  3G9W A;  2Z0P A;  4HB4 B;  3ZDT A;  3ZVR A;  1ZM0 A;  5D27 A;  5FI1 A;  3HQC A;  3N7C A;  2DHJ A;  2EJ8 A;  4HAT B;  4KVG B;  1XX0 A;  1U5G A;  2YF0 A;  2RSG A;  1TXD A;  2R0D A;  5C5B B;  2L2I A;  4K17 A;  2W2X C;  1V5U A;  3UZT A;  1W1H A;  1TQZ A;  2P0D A;  2OTX A;  4GN1 A;  2DX1 A;  5L81 A;  3VIA A;  3P6A A;  3MPX A;  1MPH A;  2RVB B;  4DBB A;  2ELA A;  5JHH A;  2M14 A;  3D8E A;  1U5F A;  1WVH A;  4IFS A;  3AJ4 A;  2I1J A;  5LON B;  2ROV A;  3WYF B;  4MT7 A;  1FHX A;  3PP2 A;  1PLS A;  3ML4 A;  1Z87 A;  2RUK B;  4TYZ A;  2D4Q A;  4Z2N A;  1UNR A;  2D9Y A;  4L6E A;  4GPT B;  4K2O A;  2BCJ A;  3PZD A;  5D3V A;  2J0J A;  2VRW B;  5HE2 A;  4PNK A;  4P7I A;  1V5M A;  1NTY A;  2P0F A;  1I7A A;  2KUP A;  2ELB A;  3T06 A;  2H7E A;  5DHF B;  1XCG A;  2J0M A;  2PZ1 A;  1FB8 A;  3A8Q A;  1KI1 B;  2I1K A;  2LYD A;  2ROZ B;  4GZU A;  2Z0Q A;  2CAY A;  4HAY B;  4F7G A;  2YS5 A;  2COF A;  3AU4 A;  1K5G B;  3WA0 A;  1U5E A;  3GYO A;  1V5P A;  1EAZ A;  3SNH A;  1K5D B;  2MDX A;  1Q67 A;  1UPR A;  1DDV A;  1W1D A;  1EVH A;  2N23 A;  2P8V A;  1MK7 B;  5JHG A;  2K2J A;  1U27 A;  4DX9 0;  4HDO A;  3IVF A;  3CXB B;  1OMW A;  1PMS A;  3P7Z A;  2UZS A;  2V76 A;  4Y94 A;  3TW1 A;  3KRX A;  2G35 A;  1AQC A;  4GMX B;  1P3R A;  1ZC3 B;  5C79 A;  2NZ8 B;  2DLW A;  3ODX A;  1DBH A;  4HB2 B;  1KZG A;  1UNQ A;  2YT0 A;  2IYB A;  1MIX A;  3F0W A;  2CRF A;  1XKE A;  5KQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...