1U5KA

Recombinational repair protein reco
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
243
structure length
242
Chain Sequence
RSRTANRSGIVIRRRVTPAGDIIVTLLTPQGKLKAIARGGVKGPLSSSLNLFHHVGVQVYQGPHDLASVKQAVLEGALPTLAEPERYAFAHLMAEFADALFQEGEFSEQAFDLFAASLRGVAHQPDPEWVALVMSYKLLGLAGVIPQTARCARCGAPDPEHPDPLGGQLLCSKCAALPPYPPAVLDFLRHAVRRTVRASFEQPVPSADRPALWRALEKFVTVQVGGVHSWRQLVPSGVPVLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Novel Structure of DNA Repair Protein RecO from Deinococcus radiodurans
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Recombination,replication
molecule keywords hypothetical protein
total genus 65
structure length 242
sequence length 243
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02565 RecO_C Recombination protein O C terminal
A PF11967 RecO_N Recombination protein O N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.120 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 1u5kA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1u5kA01
3.30.60.100 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1u5kA03
5IYBH 1IBML 2NZOA 2XTIA 1HZBA 3S1MH 5C0XG 3G71A 4DR6L 4YWKA 2GVAA 4A3CH 2R7FA 3AFPA 1EQRA 4A3FH 3W1BA 4DV1L 2JQOA 2VNUD 5C4JH 2RHSB 4HIDA 4A3MG 3HKZG 1SFOH 1HNXQ 3PIPA 4A93G 3RLFA 2VUMG 1SN8A 1PH2A 1Z47A 4B3TL 1VQDA 2VZAA 2CKZB 1N8RC 1MJCA 1FJGQ 1ASYA 2E5LL 1WCMG 1X6OA 3M4PA 3B6YA 3NEMA 1SMXA 3M3YH 1L2FA 4JI5L 3KLWA 4POGA 3OTOL 1DGSA 3K81C 3KF6A 3GO5A 1BBWA 4DR7L 4A3MH 3CMAA 3GD7A 1Q1EA 1HR0W 2E2HH 2UUCQ 2UXCQ 3F8TA 4DR2Q 3CP0A 1PV4A 4DPGA 4OWTB 1KC8C 4BY7G 4HJ5A 1TWAH 4LF8L 1CKNA 4P73A 1XJVA 4R4OA 4LNQA 3I4NH 4BBRG 1K8GA 4NB3A 5IYBG 1EYGA 3GTPH 4IPDA 5C0XI 4YWMA 1Q82C 2Q2TA 3S2DH 4LFBQ 2JA6G 1I5FA 5DLQE 2CWPA 4AIMA 3ULLA 3KF8B 2CCZA 4B3MQ 4X66Q 2YV5A 2EXDA 2WAQG 1A63A 2WFWA 2AMCB 3S24A 1FJGL 3DLLA 4B3ML 2Q2IA 5IP9H 3AFQA 4DUYL 2BH8A 4LF6L 4KI0A 4A76A 1GO3E 1N32Q 1J6QA 1UEBA 4O2DA 1EIFA 5FLXc 4JI4L 1G51A 2IHEA 2YTYA 4DV1Q 5FJ8H 1KRSA 3MXNB 1EOVA 1HH2P 3K0XA 3W1GA 1P16A 5AJ3Q 1X3GA 1VQMA 5JJLA 3S16H 2K4KA 1L0WA 1I94L 2FXQA 1I3QH 1K3RA 5EAYA 4A3IH 1SRUA 2JA7G 5H1SE 4A3EH 1KAWA 2HIVA 3A5UA 2VY3A 1HZ9A 2N49A 1E1TA 4NPSA 4DV5L 4MNOA 2AWNA 3U50C 3ZJYC 4JOIC 1VQBA 4DK6C 1PH4A 1HNWL 3CW2C 4PG3A 2UXBL 2UU9L 2IX1A 4IPHA 1SLJA 3JAMi 2K50A 1VQKA 4DV2Q 3MEFA 1Q81C 4R1JA 3KDFA 4JI3Q 1EUJA 3GTGH 3CCUA 1A8VA 1XPRA 1N34Q 3GTOH 1J5EQ 5M5WH 4MZ9A 3DM3A 2JA7H 1PYSB 1YEZA 4OXPA 1Q1BA 5LMNL 3S2HH 3JAMc 1C0AA 3J81j 2MFIA 3PIOA 3PO3G 2R6GA 4C3HH 4GLXA 1YZ6A 4JI8Q 4HJAA 1S72A 3WWVA 3PGZA 1WI5A 4APVA 5FLMH 3CC4A 3HOVG 1A0IA 5IYDH 1VQOA 4IO9A 3CPWA 5GAEC 2VUMH 4UP7A 1X55A 4HJ9A 1N36L 1JMCA 4DV7Q 1WYDA 2I5HA 4YY3Q 1Y14B 3FKIH 2ZTCA 1J5EL 1K73C 3RZOH 3HFZB 1XNRQ 1X3FA 4JI3L 4BBSH 4LW1A 1VQPA 1FL0A 3PUZA 4JI7Q 3HOZG 1HZCA 5C3EH 2XGTA 3ICEA 3KJPA 2QA4A 4B3SQ 5FLMG 3HOVH 2R7ZH 2ATWA 4PZ7A 1RL2A 3EN2A 4A3BH 1IYJB 3D31A 1QVCA 1XMQQ 3HOYG 1NE3A 1UE5A 2I5LX 3I2ZA 1O7IA 3AQQA 2ZM6Q 3I4MH 1E7ZA 2B63H 4DR1L 1PH5A 4DR7Q 4OX9Q 1VQLA 5IE8A 2BH2A 3UE1A 4DV5Q 1D8LA 3K7UC 4R4TA 3U4ZA 3HOWG 4DAYB 4LFAL 4B3RQ 3RR5A 1U5KA 4EQ5A 4GKJL 4GLAC 4GN4B 1Z9FA 4X62L 5C0XJ 1XPUA 4LUOA 5C44G 4AQYQ 2JEAI 1YJWA 2OCEA 2VQFL 2OTLA 3CCJA 4X65L 1EQQA 3FHWA 4GS3A 4JI2Q 3NELA 1WCMH 4DV2L 4TVAB 4GNXB 4JYAQ 4LFCQ 4FDBA 2HHHQ 1B70B 1T9HA 2YYZA 3HOXG 4IFDJ 1VQ9A 3EIVA 5J3BA 4B3SL 4DV0L 2R93H 1EWIA 4JI7L 1KL9A 1QVGA 2F4VQ 4OWWB 2BA0A 4JI1Q 2Q2UA 3Q8DA 1M1KC 4R4QA 1PH6A 4A3FG 1S40A 3PUWA 4DUYQ 1AH9A 1N36Q 1HZAA 5IP7G 2YTXA 1IZ6A 2H5XA 3RLOA 1M90C 5FJ8G 3GTKH 2PQAA 4A3JH 3HOUG 2K5NA 3PO3H 4R4IA 4YCVA 1B8AA 4GN3B 1K0RA 2JJQA 5AJ3L 4L5QA 3UDFA 4DKAC 4A3LH 2KHIA 2K52A 1Y1WH 5GAHC 5M3FH 4JG2A 1YIJA 1JE5A 3RNUA 1TWFH 2LSSA 2QGQA 3BZKA 5IP9G 3L7ZC 2VW9A 4DUZQ 1N34L 2ASBA 2IT1A 1Y1WG 3K8AA 1SR3A 1H95A 4WJ4A 2AKWB 1MKHA 3PF5A 3CMEA 4DAMA 1Q7YC 2UU9Q 4JI5Q 1N33L 4GKKQ 2JA5H 1YHQA 1Q12A 1BVSA 1GKHA 4P72A 4DK3C 1KXLA 3L0OA 2UUBQ 3K80C 3H3VH 2PQAB 3PO2H 1XTDA 4JCVE 3PSIA 2EQSA 1OXXK 3RLNA 1G6PA 4A3EG 3M9BA 2PMZE 5BR8L 4QGUA 2NN6G 1EFWA 2ID0A 1X56A 3J81i 2R93G 2RCNA 3NBHB 1X54A 3PO2G 1YVCA 1I94Q 1MIUA 1NJIC 3PV0A 1ASZA 2UUCL 5IYCG 4WJ3M 4GOPA 1OXVA 2R7DA 1GD7A 1LYLA 1WOCA 2JA5G 1RIPA 3ULPA 4Y7NH 2NVQH 4DUZL 3ER0A 1X3EA 1CSQA 3OTOQ 2N3SA 1JT8A 5IY0A 2VQFQ 4DNIA 2E2IH 3CPFA 4BXXG 4AQYL 1VQ7A 4JI4Q 1VQEA 4HIOA 3F2BA 4JBWA 4B3RL 3G4SA 1G291 2RHQB 4DV3L 1OXTA 1R9TH 2NVYH 1JJCB 2L15A 4UPAA 5K36G 1V9PA 2JK8A 4X64L 2ZM6L 4DV6Q 1IBLQ 2UXDQ 1QVFA 4IJLA 2GN5A 3TEHB 2JA8H 2JA6H 3PF4A 1W3SA 4LF5Q 2F52A 2B3GA 4UP8A 4A3JG 3HOUH 3I7FA 4A3BG 2A19A 3F1ZA 4H02A 2DUDA 4JI1L 4EX5A 2JEBI 1KHIA 4PMWA 5M5YH 1QUQA 3I4OA 4GLVB 4LF4Q 3RZDH 1HR0L 1YHAA 4IOAA 3W5OA 1KRTA 1UE6A 4QQBX 4A3DH 3F2DA 1CKOA 2WAQE 3CCSA 2VL6A 5C4XG 2MO0A 4JYAL 2NZHA 4IPGA 4X6AH 3D0FA 3E0EA 1VQJA 1SROA 2MO1A 1L1OB 1BBUA 3CF5A 3TS2A 2N8NA 2ZJPA 4JI6L 4BA2I 3RN5A 4OO1I 4DV4Q 3OYYA 4NXNL 1YJNA 2VS1A 2MQHA 3T1YQ 3S1NH 3CCEA 4LFAQ 2OQKA 3NENA 3CAMA 1X9NA 4DR1Q 4GOPC 1YHBA 3STBC 1HNZQ 2K75A 1XMQL 3ULJA 3CD6A 2DGYA 1OXSC 4A3CG 2UXBQ 1I50H 1OXUA 2CQOA 4JI0Q 3CXCA 3HOWH 1WJJA 1XNQQ 2ES2A 4GN5A 1IBKQ 4POFA 1FVIA 4IJHA 2YTVA 1PYBA 1Q46A 3H0GH 1FGUA 2IHFA 4L5TA 3G6EA 3CCMA 4QIWE 3S1RH 3M7NA 3S14H 3CCLA 5C3EG 4NXNQ 3U4VA 3GDEA 3CCQA 3FP9A 2I5MX 1E1OA 3HKZE 4OONA 1P8LA 4GKJQ 2A1AA 3TRZA 2HIXA 4A3GG 3JC66 3L2PA 3M85A 4DR3L 3J80c 1E3PA 4A3LG 1S3OA 4QY7A 5ELOA 2CWAA 5ELNA 4HIKA 4LF9L 5JEAJ 2WP8J 4JBMA 4BXXH 4IOCA 1OTCA 3CC2A 4GNXC 5IWAQ 4ME3A 4PZ6A 5M3MG 3M4QA 3UDGA 1NMFA 1PH7A 1U0LA 3KOJA 3H15A 2R92H 4DR4L 5M5XH 1PH1A 4RG1A 4OO1G 2Z0SA 1XNRL 3G48A 3VDYA 4LF6Q 1CKMA 2QEXA 4LF5L 4A3GH 4AH6A 3J7A5 4DV4L 2K14A 1VQFA 1N9WA 4X66L 4X64Q 4TQUS 2PI2E 4BY1H 2UXDL 1VQNA 1BKBA 2AWOA 3GTJH 4LFBL 2KENA 4KHZA 3HOXH 3E9IA 4JI8L 1HJPA 4OWXB 2K5HA 5JEAG 4HIMA 2Q2HA 1PH3A 1Q8KA 2NVXH 3J7ZC 1TXYA 3EBEA 4P71A 4O0AA 1YNXA 4BBRH 4LF8Q 1L1OC 5LMNQ 3PUYA 1SE8A 4BY7H 2D62A 4L5SA 1Y1VH 2KCTA 4BY1G 3IRBA 2VQEL 3BZCA 5M3FG 2HQLA 2N78A 2Z6KC 3BJUA 1PFSA 1HNWQ 1A62A 1NMGA 5BR8Q 1CUKA 4DV6L 3F2CA 1CSPA 1IBLL 3HOYH 3I4MG 2KBNA 5GAGC 4L5RC 4DV3Q 3BU2A 5M3MH 1N32L 4IFDG 1PA6A 3GTLH 3ERSX 2UUBL 2ZTDA 3TQYA 5IP7H 1E22A 4LUVA 2V1CC 3HOZH 4BBSG 4R4CA 1QZHA 4GKKL 5C4XH 2HT1A 3AEVA 3E9HA 1VQ8A 1N33Q 1C7YA 1LUZA 1JJGA 3S1QH 1E24A 3FKIG 4A3DG 5HGQA 5JJKA 5IT9c 2WB1E 5LMNW 4DR6Q 5HY6A 3CCRA 1YITA 2KHJA 3CC7A 4ALPA 1MJEA 5IYDG 4DR3Q 4HJ8A 3T1YL 3I56A 3I55A 3UDIA 1AE3A 4A75A 1PH8A 3H0GG 1VS0A 4RMFA 3TREA 4MTNA 4A3KG 2UXCL 1AE2A 2RF4A 2LXKA 4DR5Q 4IPCA 1W2BA 2ZJQA 2WB1G 2C35B 3J80i 4AYBG 5LMUL 4XIGS 2PNHA 3UE0A 1NY4A 4YHHL 2E8GA 1KD1C 5GQOA 2E2JH 2NVTH 5JJIA 4PZ8A 2LXJA 4QJFA 4J15A 5LMUQ 4B3TQ 1TWGH 2B63G 2F4VL 1LM0A 2D0OA 2EIFA 1JB7A 4DV0Q 1HNXL 4AYBE 2OWOA 1PH9A 3U58A 1VQIA 3A74A 1X65A 1TWHH 2PI2A 3A5ZB 4C2MH 2HHHL 5E7NA 2OTJA 2ZTEA 4DR2L 4JC0A 3J81c 3AYHB 4JOIA 4IFDI 2A8VA 3PUVA 1D7QA 1EIYB 4A93H 1IBMQ 3CCVA 3GTMH 4JI2L 4YCUA 2MNAA 2ZJRA 3KDFB 1VQHA 4X65Q 4GOPB 4KLKA 2UUAQ 1PVOA 2NN6I 1K83H 1Q86C 2E5LQ 3GTQH 4GNXA 1XPOA 2R92G 1YBYA 1VQCA 4A4IA 1UWVA 2BA1A 4LF7L 1I6HH 1YJ9A 4HJ7A 2JA8G 1TWCH 1L1OA 4YCWA 4NXMQ 1XNQL 4DR4Q 4P74A 4JI0L 2K5VA 2F3IA 1K8AC 5IWAL 2AHOB 1UE1A 3PCOB 1Y1VG 4NXML 1YI2A 2VQEQ 4LFCL 1JJ2A 4LF9Q 3RN2A 2Y0SG 1QZGA 3OW2A 1VQ6A 3M4OH 1B7YB 2B29A 3KJOA 1XMOQ 4JBKA 5GROA 5GADC 1QUQB 1PHJA 3UDXA 3LGJA 1NTGA 4DV7L 3KYHC 3T1HQ 3S15H 1LTLA 1CKNB 4X62Q 1KQSA 4JV5L 4BA1I 5IYCH 4JI6Q 3I4NG 2UUAL 1V1QA 4UP9A 1VQ5A 1IL2A 3K7AH 3SGIA 2YU9H 2Y0SE 4C3JH 1IBKL 4OX9L 1GM5A 3H3VI 1KIXA 4KHPQ 3T1HL 2JE6I 4A3IG 3KFUA 4YWLA 4JBJA 4K0KL 2GVBA 1WFQA 1XMOL 1K9MC 1HNZL 1HR0Q 1GVPA 2I0QA 4P75A 1VQAA 4XTCS 4LUZA 1V43A 1NBWA 4YY3L 4K0KQ 3A0JA 3PUXA 2R7ZG 2D0PA 4KHPL 2OQ0A 4YHHQ 4Y52H 5C44H 2IY5B 3HKSA 1C9OA 1UE7A 4LWCA 2ALYB 4LF7Q 3TS0A 3CQZH 3STBD 4DR5L 4UY8C 1IXRA 4JV5Q 2CFMA 3S17H 2IX0A 4A3KH 1VQ4A 1VCIA 2KCMA 4QL5A 4C3IH 1VQGA 3KF6B 2JA9A 2Z6KA 4LF4L
chains in the Genus database with same CATH superfamily
3S1MH 1E2ZA 1EY4A 2R7FA 3AFPA 4A3FH 3W1BA 1JB3A 3S2HB 5C4JH 2RHSB 3MTSA 4H7BA 3Q24A 1HNXQ 2K32A 3RLFA 4IQZA 3S16B 1WTOA 4FF3A 2FHTA 3UEJA 4Z7HA 1JWMD 2Q8RE 3AU7A 3OHXC 1MJCA 1FR3A 1FJGQ 3J7AF 1ASYA 4YZ9A 1L2FA 3NTIA 3GO5A 1GJXA 3B4VC 4DR7L 1S5DD 4RHRA 2A6EC 1Q1EA 2UUCQ 2Z1CA 2UXCQ 3CP0A 4BY7G 4OWTB 1TWAH 2OU2A 1XJVA 4LNQA 1ZXTA 1MJAA 1WTPA 2Q2TA 3QOJA 5DLQE 5T1IA 2IY5B 3ULLA 2CCZA 2YV5A 2EXDA 3BVZA 1CK1A 3S24A 1FJGL 2EY1A 1MJ9A 3Q23A 4A3KB 4LF6L 1EIFA 5FLXc 5CC4A 2UVOA 1Q8IA 3QIAA 1G51A 2YTYA 3L9AX 4DA2A 1HH2P 5C4JB 3K0XA 3W1GA 1CT0I 2JBWA 4NDXA 4GI3C 4I7AA 5IGDA 3S16H 1I94L 3NTKA 2FXQA 1I3QH 1MT1A 3BG3A 2A5HA 3OWEB 3ERQA 1KAWA 3A5UA 2VY3A 1TS4A 1I4QA 4NPSA 4DV5L 1BR9A 4IUQA 3U50C 1IYVA 3ZJYC 2IX3A 2V4DA 1X74A 3H3VC 2UU9L 2IX1A 4DGZA 4RAUC 4DV2Q 4JI3Q 1EUJA 1BDOA 1A8VA 3CCUA 1XPRA 3QB3A 1J5EQ 3DM3A 3S2HH 1YEZA 3S15B 1TURA 2JB2A 3JAMc 2QDBA 2A68D 3BVGA 3PO3G 1YZ6A 5IGFA 3TSSA 4RWSC 4HJAA 1S72A 3UI2A 2FINB 4APVA 3G7LA 1M4VA 5KNDA 2VUMH 4UP7A 1X55A 2I5HA 4YY3Q 3FKIH 1J5EL 1K73C 1CT4I 1JOKA 2FMMA 4JI3L 4BBSH 1A2TA 4JI7Q 1F2MA 2Y0SB 4ZCKA 3KJPA 2EYHA 2R7ZH 3VR3A 4A3BH 1Z7KB 5C6AA 1XMQQ 3I4MH 3I2ZA 1UE5A 1O7IA 3OMGA 5C5LA 2V1CA 4ZUIA 4J1MA 3SGBI 5IE8A 3UE1A 2O2LD 4DAYA 4GXTA 2K04A 1LTRD 4UXJA 4GKJL 1SEBD 4GN4B 4X62L 5C44G 1TBQR 2OTLA 4X65L 2KKMA 4FXDA 3K7AB 4H44C 4JI2Q 3U9OA 1CHPD 1TWGB 1BUSA 1MD2D 1HQRD 4FDBA 2ARPF 1EQVA 4CDCC 3EIVA 2JP1A 4WRDA 2GIVA 1D1IA 2RKSA 3GTMB 2L1LB 4OWWB 4JI1Q 2Q2UA 3Q8DA 3CRKC 2JXMB 1IHZA 4DUYQ 4A3IB 4OO1H 2TMPA 2WACA 1IZ6A 5CV5A 3HS0C 4C3IG 4DXFA 1M90C 1ULMA 4A3JH 4ZLTF 3TZDA 4YCVA 1B8AA 1LTGD 2JJQA 2B2TC 5AJ3L 2N17A 1Y1WH 1YIJA 1X3PA 3P1HA 2EY5A 1DM0B 4A3BB 2VW9A 2G9HD 2CWGA 1MSHA 4CDDC 1O78A 1SNOA 3K8AA 3LJ2A 1H95A 4WJ4A 4K14A 1Q3LA 4DAMA 1HXYD 3CU7A 3CMEA 2UU9Q 4QCLA 3TOAA 1YHQA 1TU2B 1GKHA 3HZXA 5FK9C 1RTNA 1KXLA 2I46A 1TKWB 3K80C 2A20A 2YU9B 3PSIA 2ODDA 1NUCA 1NSNS 2XRSD 4CDFC 5BR8L 4QGUA 5J8CA 2ID0A 3D4DA 2ERWA 2F3WA 1OO9B 1TVXA 2R93G 5C4XB 2RCNA 2CH4W 4F88A 1JOQA 4GOPA 4DAPA 2LFNA 3FVVA 5ISRA 3OTOQ 4RA8A 4MN3A 4BXXG 1JQYD 4AQYL 1VQ7A 4JI4Q 2MP1A 1NXUA 5KYIA 4HIOA 1O7ZA 4JBWA 1G291 5HI7A 2RHQB 1HRJA 4UPAA 2GA4B 2JA8H 2GN5A 2H1EA 2R3ZA 2F52A 5M3FB 4A3JG 2K9HA 1SDFA 2A19A 3F1ZA 2DUDA 5M5YH 1HPTA 1PTOH 1STBA 1QUQA 4GLVB 4LF4Q 1PJUA 3RZDH 3H6MA 1KRTA 1UE6A 1EIGA 5IT9L 5D3DA 5CORA 1KDAA 2MO0A 4V190 2NZHA 2PQ8A 4B9WA 3M4YA 4XQJA 4OIJA 4OO1I 3D4RA 3OYYA 4NXNL 1K83B 1LT3D 4PNYA 4LFAQ 3TP8A 3NENA 4Z9CB 2F0TA 5EJWA 3Q6SA 5ELCA 2F1MA 1HNZQ 1PZID 1ENCA 3MHBA 1TBNA 4J6HA 1KLGD 3MFYA 4A3CG 5CR3A 1I50B 5KIXA 3OXLA 1IBKQ 4L6TB 2YTVA 3E2IA 2IHFA 3CQZB 4NV5A 4QIWE 2RDHA 3M7NA 3U4VA 3HKZE 1E1OA 4GKJQ 4KK7A 5I9PA 4XT1B 4A3GG 1SNQA 3PIP3 3L2PA 2FMCA 3K6OA 4QY7A 1D6EC 3GP7A 4HIKA 4IOCA 1OTCA 1VMCA 4ME3A 4A3FB 3CXLA 5IGEA 1NMFA 2JZMA 4DR4L 3KOJA 3R5DA 4RG1A 3KP9A 5I2YA 2RSOA 3NHHA 2NVQB 4O1NA 1HPCA 1N9WA 4X66L 2B2TA 4TQUS 4X64Q 2UXDL 3GTJB 2BUSA 3FSYA 2J0TD 4QF4A 3R2TA 2K5HA 3SGQI 2A68C 1Q8KA 2NVXH 2B8TA 2JA6B 4DN4M 3T4AC 4O0AA 4RKBA 1STYA 1KDCA 1SE2A 3PMFA 4DF7A 4RGMA 4L5SA 1TBOA 1K8OA 2VQEL 1SYDA 3BZCA 2JA5B 3OMCA 4XYOA 1RODA 4QUFA 3F2CA 4TSSA 5GAGC 3Q22A 2J4XA 5D65A 2BE5C 1N32L 2UUBL 1E22A 2V1CC 1IW4A 5EKIA 4R4CA 4GKKL 5C4XH 1JJGA 1N33Q 1C7YA 4K5XA 4OAVB 4K5WA 2EYOA 2ZXOA 5IT9c 2X52A 5HY6A 2KHJA 1ZEQX 1MJEA 2KCCA 3R93A 3T1YL 2R7ZB 3JSBA 5C3EB 3I55A 3I56A 4A75A 2B2VC 1ENAA 2N55A 3H0GG 5DEHA 4HN7A 2X3TA 4IPCA 2A69C 1F2YA 2ZJQA 2QQCA 1LACA 4OEMB 2RIJA 2Z4HA 2SOBA 5A2QL 1SGPI 2PNHA 1UUCA 2X6GA 1DOLA 1YU6C 3FSXA 1E2VA 1PZKD 2QGMA 4J15A 1FYBA 1SJ8A 1TWGH 2M2LA 2SDFA 1GXDC 2B63G 2EIFA 3TO6A 4PMBA 4DV0Q 3AMUA 2GSCA 4L63B 2XRQD 1X65A 1IL8A 1D5ZC 1TWHH 2RDFA 3A5ZB 4X3TA 2JN4A 4DR2L 4QMGA 2L12A 4JC0A 4AS3A 2EJMA 4JOIA 1D7QA 2RSNA 4K5VA 3CCVA 5CYUA 2MNAA 1CSOI 3KDFB 1PVOA 3LJ1A 1OVOA 2ICEC 3VYTA 2UUAQ 2LY7A 1YNND 1RFHA 2NN6I 5EX3A 1K83H 3OIPA 4FF2A 2NUCA 2R92G 4A4IA 2ZT9C 2J7ZA 1O7YA 1QG7A 4K8JA 2L0CA 2E75C 3I73A 3OW7A 4YCWA 4NXMQ 3NQTA 1TWAB 1I4RA 1FNVA 4XT3B 2PW7A 5KNCA 3KK7A 1YI2A 4ULLA 1AFPA 3RN2A 1U9RA 1QZGA 1VQ6A 4BWGB 2NU4I 3KJOA 4V0BA 1KMAA 1NTGA 4JV5L 3K57A 5FKAC 2QW7A 4JI6Q 1V1QA 4UP9A 4SGBI 2SGQI 1PZJD 1OYVI 2FU2A 2Y0SE 1IBKL 1KIXA 9WGAA 1KAAA 4KHPQ 3T1HL 2IW3A 4A3IG 3I8ZA 1JCKB 1EY8A 4YWLA 3KFUA 5IGBA 1I4GA 1HNZL 1GVPA 3I3CA 4KMUC 4RGTA 1U4LA 1TT2A 3OXFA 3KUPA 4CJ0B 1HDLA 2MJ8A 3A0JA 4X3UA 4YZDA 5CV4A 1ESRA 2VB2X 3K5OA 1PRTF 2WAQB 1UE7A 2EY6A 2KCNA 3NBHA 4UY8C 2OT2A 2CFMA 3VYSA 1VCIA 1PFMA 3KF6B 2L5TA 4HCEA 3T56B 2Z6KA 1UVGA 1Y1CA 5IYBH 1IBML 2NU2I 1HZBA 4YWKA 2Z8LA 5JPNC 1E2WA 1LT6D 3OWFA 4DV1L 4ZAIA 1SFOH 3HKZG 4A93G 1KBEA 4C3HB 1B44D 2SNSA 1SN8A 1Z47A 2XSCA 2XVSA 3HKZB 4A93B 1KDBA 4HFVA 1QE6A 5AFWA 1FAQA 1V1HA 2VZAA 2LMCB 1OMUA 3VA5A 1SYFA 3MVVA 3M4PA 5EPLA 3B6YA 1DS2I 5E3RA 2NYZD 3OTOL 3KF6A 3SK6A 1BBWA 2L55A 5DM63 3HOVB 4U68A 3F8TA 1PV4A 3DM1A 1KC8C 5E3FA 1LT5D 4P73A 4K2LA 3I4NH 1K8GA 5IYBG 3GTPH 4IPDA 3E5SA 5C0XI 4YWMA 2PZTA 4ZK9B 2JA6G 1BNZA 1SYEA 2F3CI 2CWPA 3KF8B 4FO2A 2NVTB 5EPJA 2BH8A 3BYTB 4KI0A 1GO3E 2B2WA 1KBFA 1J6QA 1NCVA 4O2DA 3MAQA 4ZUJA 1XWEA 2BDNA 1ESFA 4J8QA 5FJ8H 4DXGA 1EU3A 3R8BA 4I65A 1P16A 3SK8A 3DWQA 3SDJA 4N8FA 4HGUA 2K4KA 5IGGA 1K3RA 4HR7B 4A3IH 2JA7G 3ONAB 1BQQT 1WKXA 3UITA 4A3EH 3I72A 5KRUA 1A6XA 3DEOA 1HZ9A 4HMIA 4H13C 5CCMA 1E1TA 4DU9A 4MNOA 1II3A 2GKRI 2A73B 5KNBA 4JOIC 3DHQA 4DK6C 2OF1A 4IPHA 1F2ZA 1SLJA 4OVOA 2CW0D 4N9TA 3MEFA 5FO9B 3GTGB 1HCZA 2N71A 2JA7H 4KY6A 4DNTB 1C0AA 2L4NA 1M8AA 5FLMH 4ZQ3A 1BCPB 3CC4A 5IYDH 1VQOA 4IO9A 5JJZA 5JVG3 3JAME 5GAEC 4LAAA 2EJGC 3GTQB 3I91A 3QWPA 2PZWA 4OHJA 1WD1A 1Y14B 2F0PA 1SGDI 1HA5A 2IL8A 1XNRQ 1X3FA 2WIIB 1VDDA 3HOZG 3QG1A 5C3EH 2E2DC 4CKEA 3ICEA 2A2DA 2E2HB 2MGSA 1E0BA 4PZ7A 1RL2A 2SGFI 4AMLA 5EKKA 1QVCA 3AQQA 3BDCA 4I1TA 3HG9A 2B63H 1D2BA 1JORA 1D8LA 1STGA 4R4TA 3DA4A 2Q8TA 5C0XJ 1Z9FA 3D6WA 4WJWA 1HHVA 3BYYB 1YJWA 1CA6A 3VYRA 4TVAB 4JYAQ 2EYLA 2HCIA 1YTPA 4A24A 1DONA 2HHHQ 4OELB 4K2KA 4IZ8A 2F0QA 2R93H 3TP7A 1KL9A 1QVGA 1CZWA 2XN9C 1PH6A 1S40A 3PUWA 2A6HC 1YNJC 2CVRA 2IPKD 2YTXA 1R0RI 3X3MA 2KVMA 2PQAA 2K19A 4C3HG 2EDGA 2K5NA 2RC4A 1K0RA 3A8JE 4R8NA 3CKIB 4A3LH 5GAHC 3SR1A 4RKLA 1GHKA 2EE1A 5IP9G 5M9OA 3L7ZC 1I4HA 4M1UB 1N34L 2IT1A 1Y1WG 1C8CA 2Y0MA 3HGBA 1SR3A 2QZGA 3GTPB 4P2CB 1Y1VB 3PF5A 1N33L 1Q12A 1ET6A 2SGPI 2F0MA 4P72A 3L0OA 3PO2H 2PQAB 4QB4A 1STHA 2K05A 2BCOA 1G6PA 2HQEA 2NN6G 1EL0A 1CHQD 2NTTA 4G57A 1ASZA 1ULNA 4WJ3M 3FEWX 3AB9A 4DR7Q 1LYLA 1RIPA 2NVQH 3ER0A 2N3SA 2V6EA 2PZUA 1RKNA 3ND8A 4NKLA 2JA1A 4OAUC 3RMHA 1VDZA 4AS2A 4B3RL 4RCNA 3EQLC 4CJ2C 4DV3L 4C56C 1R9TH 5K36G 1V9PA 4DV6Q 1IBLQ 1Q9BA 4DFAA 3P20A 1QVFA 3TEHB 1H9JA 2WINB 3NUCA 4BBRB 4UP8A 5C4HA 4R8IA 1GUTA 4A3BG 2JEBI 4PMWA 1KNEA 3RD4A 3NPPA 2QSBA 2LEOA 3I4OA 3VE5A 1HR0L 2CW0C 2L11A 3GQBA 4Q0FA 3P23A 4A3DH 3F2DA 4QQBX 2JA7B 2J87A 1CKOA 1D5MC 1WTWA 4OL7A 3HOYB 3E0EA 3NP8A 2DN8A 5EX0A 1H9KA 3CF5A 2RQXA 3TS2A 4PV1C 2ZJPA 4JI6L 1LO5D 2BL7A 4PL4A 1YJNA 3NSWA 3S1NH 3NE5B 3S1NB 3C3LA 1DD2A 1WGCA 2ETDA 2NU3I 1X9NA 4HMJA 3QAHA 4GOPC 2CJSC 5CMDA 3CD6A 3A54A 2VRWB 2DGYA 1OXSC 2GKVA 2CQOA 4HEDA 5ELEA 3HOWH 2ES2A 4GN5A 5HURA 2FFKB 2KUMA 4POFA 3O13A 5M5WB 1Q46A 3H0GH 1FGUA 1ICFB 1O7LA 2BDOA 3GV3A 3CCMA 3S1RH 3CCLA 3CCQA 2I5MX 3TOBA 4KN7C 1P8LA 1MI2A 1BCPD 4WFN3 1C4QA 1FNWA 4A3LG 5FLXE 4BXXH 1Y1BA 3CC2A 4GNXC 5IWAQ 3FKIB 3UDGA 4PZ6A 2A69D 3A56A 4UXIA 4X3KA 3ITPA 3K58A 2PQEA 5CV9A 1ET9A 1I3QB 1EWHA 4LF5L 4DV4L 2K5WA 2O5JC 1H9RA 2PI2E 3SDZA 4G76A 4Q5VA 3NXWA 1LTSD 2A6ED 4JI8L 1DOMA 4OWXB 3TZUA 5JEAG 2DJGC 2Q2HA 1PH3A 4P71A 4O1OA 4LF8Q 1SGYI 4GZYC 1FD7D 4MTKA 5J1ZA 3KLSA 1SE8A 4BY7H 2MHVA 1B3QA 1ZYRD 1UAPA 1TS2A 2HQLA 2N78A 4A3DB 3E3XA 3KLRA 1EYAA 1NMGA 5BR8Q 5EBCA 4DV6L 1IBLL 1CSPA 4QUCA 3DWAA 2R61A 3BU2A 4IFDG 3GTLH 3TQYA 1A3UA 3EFXD 1JR0D 3HOZH 1LV9A 2OEOA 3E9HA 2WGCA 3WDNA 1AN1I 2OZUA 4A3DG 2V53A 4FF4A 2WB1E 5ELDA 5LMNW 1XYIA 4ALPA 2KECA 5KEEA 5IYDG 5J22A 2EJFC 3UDIA 1AE3A 2DNCA 2IJ0A 1LTTD 4MTNA 2UXCL 1ILQA 5K5PA 1W2BA 5K36H 1LR9A 2A2CA 2C35B 4AYBG 5LMUL 3HOXB 2JAEA 1UNSA 2F0FA 2MPMA 1CGJI 5JJIA 1UEAB 3LJ0A 1Y8PB 2PPBC 1Y69U 4QJFA 1SAPA 2VXWA 1PTRA 2HUGA 2F4VL 3FBVA 3V96A 2ENNA 3G6JB 2OWOA 1PH9A 3U58A 1VQIA 3A74A 4C2MB 2P22B 2FUG1 4C2MH 2OTJA 2ZTEA 3FDTA 3MWYW 3DUZA 3J81c 1EFID 4ZRZA 3JAML 4IFDI 2A8VA 1EIYB 4XXEA 2EYPA 1XX6A 2YUUA 2K5QA 1B3AA 4JI2L 4YCUA 4CJ1B 1K3BC 1CQVA 4X65Q 3GTLB 3MXPA 2E5LQ 4M8AA 1YBYA 1VQCA 3GTKB 2BA1A 2B2YC 5LNK1 4HJ7A 2JA8G 4K6DA 1PMRA 4RFBA 1K8AC 5IWAL 3J80L 1UE1A 1CE3A 4NXML 2VQEQ 1JJ2A 1DZ1A 3A8KE 1F9SA 3OW2A 3RZDB 4EQPA 2B29A 2KMRA 1BCPC 3S1RB 1LTAD 1CT2I 3H0GB 4OIKA 1PHJA 3LGJA 4ABNA 1VF7A 1XX8A 1BXTA 1PTOC 4BA1I 3I4NG 4PL3A 2UUAL 4KD4A 4K8IA 5M3MB 1VQ5A 1QWYA 2F0IA 2QKIC 5DM73 2F0OA 2F03A 2SGDI 3D6CA 1S5BD 2I0QA 1UUPA 3J81L 4XYQA 3K5LA 4LUZA 3T16A 1KLUD 1FGBD 3I4MB 1VMPA 1GUSA 1T5XD 2PNRC 5F2DA 1IKLA 1XXGA 3HKSA 3TS0A 3CQZH 3STBD 3PO3B 1IXRA 2JYYA 1B50A 2C5CA 2H4OA 3S17H 2IX0A 4A3KH 2E76C 2F0VA 4KD3A 4QL5A 1EYCA 1A15A 4C3IH 3T1YQ 3HOUB 4MPIA 2JA9A 1V1PB 3RUZA 3G71A 2GVAA 1J8IA 1EQRA 1G2TA 1GUGA 1JE4A 4FVMA 3J81E 4NV2A 1K8MA 3TO7A 1EEID 2CWHA 1PH2A 4YZCA 4B3TL 1VQDA 1KNAA 1TGSI 5FO8B 3SE0A 3I90A 2F6MB 3OOCA 1U4PA 2CKZB 3SK4A 4JK1C 1N8RC 4QIWB 5BN3A 2N52A 2Q8IB 1RD9D 4E1RA 3NEMA 1SMXA 4JI5L 4HTHA 3KLWA 4POGA 1VF5C 1NUBA 3K81C 2QCPX 4RH6A 4RCOA 2Z4IA 3R5CA 2NVXB 3GD7A 1DYQA 2E2HH 4DR2Q 2XWBB 1XBTA 4DPGA 2WB1B 1STAA 3C46A 4FF1A 1A2UA 5IODA 4BBRG 3EA6A 1EYGA 2AUKA 3FPPA 1FYCA 4LFBQ 2QF7A 1IKMA 1I5FA 1R9TB 1EY0A 4X66Q 5C5MA 2WFWA 2AMCB 1CA5A 4CHTB 3DLLA 4B3ML 1TOTA 2Q2IA 4DUYL 3S17B 4C1NK 1S4ZA 1B4OA 2FJ2A 4FKDA 2E73A 4JI4L 3IFDA 1F77A 5I6WA 1L0XB 3IKJA 1UVFA 4EVOA 3GOXA 4ID6A 1VQMA 2RDGA 1L0WA 2NN6H 5H1SE 2PCFB 2L9HA 5E3PA 2BE5D 2EVBA 1KABA 3FVQA 1SNCA 5LL6X 4B9XA 2E74C 4MHEA 3PIO3 1VQBA 1PH4A 1HNWL 4PL5A 2UXBL 1TWFB 2XNAC 3IAM1 3QOLA 4PQXA 1TIHA 3KF8A 2K50A 2ZW3A 1IW7D 3KDFA 3GTOH 2B2WC 1TWHB 5EKLA 3SXHA 5M5WH 1PYSB 5LMNL 3NWSA 3MZ5A 3KBGA 3DMUA 3J7YW 4IUNA 4C3HH 2EZVA 3PGZA 1WI5A 3HOVG 5FUWA 1A0IA 3CPWA 2LKVA 2Z6BA 2VUMB 4HJ9A 4DV7Q 2M5XA 5JHWC 3UGLA 3LWEA 4LW1A 3PUZA 1PPFI 1HZCA 2QA4A 1QOHA 1SYGA 1Y8OB 4B3SQ 3HOVH 2ATWA 5HQ8A 2DY7A 3EN2A 3A55A 1QNUA 2F3VA 3D31A 3NK9A 3RU0A 1NE3A 1G8ZD 2ZM6Q 1E7ZA 1Z6HA 4DR1L 2AQ1B 5A2QE 5COYA 2RVLA 4DV5Q 2HDLA 3K7UC 1HUMA 3U4ZA 2JSOA 4DAYB 1DS3I 3RR5A 3S2DB 1JC7A 4DK1A 4AQYQ 4NP5A 1WTJA 2VQFL 3AJFA 1JOOA 5D3IB 3NELA 2G9DA 4LFCQ 3S1MB 3D4WA 2QPOA 1B70B 1CHOI 2YYZA 1VQ9A 4B3SL 2F0DA 1EWIA 4CDEC 3GV6A 4IUPA 5I2XA 1EY6A 4IURA 4JI7L 4KY5A 2F4VQ 1M8CA 5IOCA 2BA0A 3KBXA 1U4MA 3M7GA 4UAIA 5CV6A 5G3LF 5KGUA 3E6ZX 4A3FG 4UHVA 3VDPA 4A3GB 5IP7G 1HFNA 2IP6A 1BO0A 1V8QA 1RTOA 3N52A 1CI3M 2H5XA 5FLXL 4IN3A 3RLOA 4A3JB 2KHSA 3GTKH 3HOUG 4L5QA 3UDFA 2KHIA 5M3FH 1JQOA 4JG2A 1NAPA 2QGQA 2ASBA 2ENBA 4DUZQ 3VA9A 3HP3A 2AKWB 1MKHA 1Q7YC 1I4PA 3S14B 1BBXC 4JI5Q 2A74C 2NU0I 2YFAA 2JA5H 3FMCA 1H9SA 1Z2IA 4FNFA 3DXJC 4KHVA 4DK3C 2JW6A 2BOSA 2XTRA 1GHJA 2B2VA 1EWCA 1XTDA 2EQSA 1OXXK 3P7JA 3QTLD 3CHBD 4A3EG 1SGRI 2PMZE 5E4WC 3NBHB 4DAVA 1EZ6A 1QNKA 1I94Q 3PV0A 1OXVA 5J39A 1GD7A 1WOCA 2JA5G 1WTVA 1B53A 1WD0A 1RHPA 1JT8A 2RIOA 1I6VC 2VQFQ 4DNIA 3K5NA 3CPFA 2KOLA 3VYUA 5IIFA 2FEFA 2DB6A 2SGEI 3G4SA 2WKCA 1OXTA 2NVYH 1JJCB 1I6HB 1ICWA 1IYUA 1TUSA 1V1IA 4RHSA 2ZM6L 2F0WA 4IJLA 2JA6H 4LF5Q 4C3IB 3HOUH 1PTOB 4H02A 4EX5A 5JAVA 1KHIA 2AUJD 4KTAA 2D5DA 4G7HC 4KV6A 3TP6A 1FARA 2L8EA 2D2CC 1YHAA 4IOAA 1PXUA 3W5OA 2DNEA 2O4XA 1MJBA 3R2IA 3CCSA 2VL6A 5C4XG 1SFOB 4JYAL 2K01A 1VQJA 1SROA 3SK5A 1L1OB 1BBUA 2SEBD 5L37A 4BA2I 2L7XA 5IT9E 2QQ0A 1STEA 3CCEA 1G2SA 4WORA 2VB3X 2L1BA 2B2UA 3CAMA 4LMQD 4B08A 2RLDA 1RF2D 3MXGA 4XDXA 1F9RA 1OMTA 1P9GA 2UXBQ 1I50H 1OXUA 1LTBD 4ZKBB 1WJJA 1XNQQ 3K59A 2YQPA 3M4OB 1FVIA 4DNCA 4IJHA 2ORVA 1PYBA 3G6EA 3F4MA 5G3LD 5DAUA 3FP9A 1R4PB 3JC66 3M85A 3J80c 5M5YB 1E3PA 2B2YA 2K28A 2KMPA 5ELOA 2CWAA 2M00A 5ELNA 4LF9L 5JEAJ 2WP8J 3TMEA 4JBMA 3SVMA 2Z9HA 3E0JA 5M3MG 4BS9A 1PRTD 1U0LA 3H15A 1H0ZA 1B1ZA 5M5XH 2B8GA 3TP5A 1WTRA 4OO1G 2Z0SA 3G48A 4Y7NB 1SE4A 4LF6Q 3R3OA 4A3GH 4R9WA 4AH6A 3QJYA 2K14A 2F66B 1VQNA 3NQIA 2AWOA 3GTJH 4LFBL 2KENA 3E9IA 1HJPA 1RJTA 2QILA 2KEDA 3SEBA 1TWCB 3MXNA 2JB3A 5LMNQ 1U4RA 3PUYA 2EXZA 1F9PA 2D62A 4IUUA 2KCTA 4BY1G 1PFNA 2XMXA 2OVOA 2Z6KC 3BJUA 1N13A 1PFSA 1HNWQ 3T51B 1A62A 1CUKA 2P6AC 3I4MG 3TJQA 4F87A 1PA6A 2ZTDA 5I9OA 4BBSG 1BMOA 1QZHA 3PDNA 3AEVA 3MC0B 1VQ8A 3FKIG 1JWUD 3KY9A 1YITA 4G4KA 4S3SA 4DR3Q 4HJ8A 4IFDH 1S5CD 2NBFA 4G75A 1LABA 2B0UC 1VS0A 4ME5A 3TREA 3UGIA 4KKTA 2HD3A 4KN4C 2LXKA 4DR5Q 3OSOA 5BN5A 2WB1G 2F0HA 2NVYB 2LUYA 3UE0A 2RBMA 2K33A 4YHHL 2NVTH 1IY6A 3C2PA 1TDPA 4KKSA 5LMUQ 3QO2A 2ELIA 2D0OA 2N1AB 4HAEA 3LNNA 3BZDB 2WCYA 2PI2A 3K5MA 2HHHL 5E7NA 1P9ZA 3BJIA 3PUVA 1IBMQ 2K7VA 3SEKC 4RGNA 5EGTA 4KLKA 4GOPB 2YFBA 2B2UC 2XIWA 4GNXA 1XPOA 3OIQA 3HRZC 2GVIA 4UXHA 1CFMA 5CV8A 1TWCH 4DR4Q 4P74A 3T53B 4JI0L 2K5VA 2F3IA 1PCEA 2CQAA 2AHOB 3PCOB 2PMZB 1YNNC 4LFCL 4LF9Q 3FC3A 2Y0SG 2MJFB 3M4OH 1EIHA 1H9MA 1TS3A 5GROA 5GADC 2X69A 2KEEA 2E5RA 3KYHC 3T1HQ 1LTLA 1CKNB 4X62Q 1SBBB 4NMZA 5IYCH 1WVLA 3K7AH 3OL0A 1GM5A 2G5DA 1DCZA 2JE6I 4OGQC 4K0KL 1WFQA 1ZYRC 4ZYSA 1HR0Q 5TSSA 1SGNI 1VQAA 1W6JA 3NWTA 1HFGA 1TS5A 2KMQA 4YY3L 3I4LA 4Y52H 5C44H 4EQOA 4F8MA 3T13A 2ALYB 2RA4A 4G7OC 1Z7TA 3MA2B 1PLFA 1I4XA 2JA8B 4HCSA 1HTPA 3HEJA 1VQ4A 1EU4A 2TSSA 1VQGA 1CKNA 2R7ZG 4LF4L 1X4SA 2NZOA 2XTIA 3MXUA 5C0XG 1Q90A 4DR6L 1B2TA 1WCMB 3V2TA 4A3CH 1PDQA 1EYDA 4IUVA 2JQOA 2VNUD 5IGCA 2M9VA 4HIDA 4A3MG 5LL6S 3PIPA 2VUMG 1MSGA 2DY8A 3IL8A 2E5LL 1WCMG 1X6OA 3M3YH 1SNPA 4U6RA 1LT4D 1DGSA 1A3TA 1QILA 5FO7B 4A3MB 2CWFA 3UFFA 4A3MH 2O5IC 3FNBA 3CMAA 1HR0W 1K7TA 2HGKA 3TO9A 4HJ5A 4LF8L 2PYKA 3I4NB 4R4OA 4BY7B 1O80A 4NB3A 2F0GA 3IAS1 1WGTA 1CZGA 1Q82C 3S2DH 5FOBB 4AIMA 2NWGA 1A63A 1K28A 4B3MQ 2B8FA 2WAQG 4TKOB 3DO9A 5IP9H 4N9PA 2D9UA 3AFQA 1YO7A 4A76A 1N32Q 4G7ZC 2J9RA 1UEBA 2EYMA 3HOZB 1LTID 2IHEA 4DV1Q 1KRSA 3MXNB 1EOVA 1PYWD 5JVH3 5M5XB 1DOKA 5AJ3Q 1X3GA 5JJLA 7WGAA 5EAYA 3UGDA 1TR5A 1SRUA 4ILWA 3EJIA 3K0YA 2AQ3B 2HIVA 1L0YB 1IY5A 3QWNA 2N49A 3CRLC 4TRDA 2B39A 2AWNA 1TQOA 3HH2C 2F0SA 3F2UA 4XQQA 5JEAH 3E59A 3CW2C 4PG3A 2ROWA 1EZ8A 3D8GA 5FUXA 3J7AV 3JAMi 1SYBA 1VQKA 4C1NI 1Q81C 4R1JA 5FUYA 5ELFA 3GTGH 3EVQA 1N34Q 5CBAE 1MBYA 3D00A 3A7LA 4MZ9A 4OXPA 1Q1BA 1F2LA 2EYJA 3J81j 2MFIA 3PIOA 2R6GA 3I70A 4CKCA 3VR5A 4GLXA 4JI8Q 3WWVA 3PO2B 2QQDA 1GUWA 3FPUB 1ULKA 1SJHD 1W4RA 1PTOF 1N36L 1JMCA 1HJAI 1WYDA 3U9SA 2F0KA 2ZTCA 3RZOH 3HFZB 3I9V1 3RZOB 3TBIB 1PRTB 1VQPA 1FL0A 2K1BA 4MIUA 2XGTA 1EOTA 3IFTA 5I6YA 1DJRD 5FLMG 5CV7A 5J8FA 3SHLA 5KYLA 1IYJB 3HOYG 2I5LX 4U673 2B63B 3N6RA 1PH5A 4OX9Q 1VQLA 5EBDA 2JYOA 2BH2A 3HOWG 5C4ZA 4LFAL 4B3RQ 1XTCD 1U5KA 4YIJA 4EQ5A 2PO4A 4GLAC 2JEAI 1XPUA 4LUOA 1EY7A 2OCEA 4EQNA 3CCJA 1EQQA 3FHWA 4GS3A 5HGTA 1JICA 3NBIA 1WCMH 4DV2L 4GNXB 1BF4A 1MGSA 1A3VA 1T9HA 4IFDJ 3HOXG 1GUOA 1B9NA 5J3BA 4DV0L 2ENZA 3UEYA 3FRPB 4C3JG 1M1KC 4R4QA 3A8IE 3KLSX 1AH9A 3Q0AA 1N36Q 1HZAA 1AEXA 4F7XA 5C0XH 2XWJB 3M3YB 3BS1A 1YNJD 4K6LA 5FJ8G 4Z7GA 3PO3H 4R4IA 4GN3B 1FY7A 3ZYYX 4DKAC 2K52A 4LJZC 5FUVA 5BN4A 2EPBA 1JE5A 3RNUA 1TWFH 2LSSA 3BZKA 3TDQA 1AP0A 2A6HD 2EYFA 3R5AA 2QDLA 4XQNA 1FNUA 4JPBW 3VDUA 2KMOA 3DWPA 4GKKQ 4DNRB 4HEA1 1BVSA 3MEKA 1Y8NB 1SYCA 4ODGA 4CKBA 2OD1A 2UUBQ 2GKTI 3H3VH 5C3WA 3UOEA 1TBRR 3C1EA 4JCVE 2LS01 1D5XC 2CHBD 2K03A 3RLNA 3M9BA 4FP5D 1UHAA 1EFWA 1BOSA 1X56A 4KJNA 3J81i 1X54A 3PO2G 2UZ3A 1YVCA 4PMCA 1MIUA 1NJIC 2UUCL 2R93B 1SSOA 5IYCG 3V05A 2KA7A 2R7DA 4BBSB 3ULPA 4Y7NH 1AZQA 4DUZL 3C1FA 1X3EA 1CSQA 5IY0A 3MFGA 2E2IH 1KTKA 1VQEA 2CAZB 1JWSD 3DA3A 2N88A 3F2BA 1K7VA 1LR8A 1WTXA 2XRCA 4IALA 5E1FA 2L15A 2JK8A 3LWUA 4X64L 2UXDQ 1BCPF 3W2DA 3PF4A 2DIPA 1W3SA 3J80E 1CT1D 2ICIA 4ZKCB 2B3GA 1S5FD 1EQTA 3I7FA 4AYBB 1CTMA 1H9SB 5EPKA 4JI1L 4FXKC 2FNFX 1LR7A 1D1KA 1M8BA 2QEJC 2ZXPA 1J9OA 4X3SA 1V1OA 2R92B 2WAQE 2EY2A 3H09A 5ELBA 4IPGA 5CGKA 4X6AH 3D0FA 1SXTA 2MO1A 2OXPA 1R79A 3QR8A 1G91A 3L3OC 2N8NA 1R4QB 1PFBA 3RN5A 2F4IA 4DV4Q 1HA6A 2VS1A 2MQHA 4HSVA 4E6IA 3D3RA 2OQKA 1HQMC 2NU1I 2WVJA 2NZ1D 2KCXA 4DR1Q 1K0SA 4JVZA 1NR2A 4O1PA 1YHBA 1WTHA 3STBC 2K75A 1XMQL 5JOBA 3ULJA 4JI0Q 3CXCA 2ZXRA 5C44B 1LLRD 1X3QA 4Q9VA 1AZPA 3OPOA 2DKVA 2MUYA 1S5ED 3WOFA 3R5BA 4L5TA 4N8X1 3W3AA 2AQ2B 3S14H 5C3EG 4NXNQ 3GDEA 4OONA 2XTQA 2A1AA 4FXGC 3TRZA 1G6ZA 2HIXA 2QQEA 4O42A 1S3OA 2X6LA 5E4XA 4JW0A 3M4QA 1PH7A 1TIID 2R92H 3OXGA 1PH1A 1IW7C 1XNRL 3VDYA 1EY9A 5E3QA 1CKMA 3TN2A 2QEXA 4I7ZC 3LX0A 2RCFA 3J7A5 3A7AB 1AW7A 1VQFA 1WTQA 4BY1H 4BY1B 3ND9A 3IAYA 1Y8FA 1BKBA 3H94A 4H0LC 4KHZA 1CM9A 3HOXH 2JB1A 4HIMA 5LHY1 5DNFA 3J7ZC 1TXYA 1SMYD 3EBEA 4BBRH 1YNXA 1CGII 1L1OC 1MHWC 4L8JA 3HOWB 4EGVA 1Y1VH 3IRBA 5M3FG 3VR6A 2DJFC 3HOYH 4KJOA 2KBNA 4L5RC 4DV3Q 5M3MH 3ERSX 4RGOS 2IWHA 5IP7H 2F0EA 4LUVA 2HT1A 2NB0A 1LUZA 3S1QH 1E24A 2F0NA 5HGQA 3S1QB 5JJKA 1TY0A 1ENFA 1F9QA 4DR6Q 4B6DA 3CCRA 1BUVT 3CC7A 1AN8A 1TY2A 1PH8A 2E2IB 4RMFA 2F0UA 1SNDA 1SMYC 4A3KG 1AE2A 2RF4A 1DXMA 2CH4A 3NTHA 4DK0A 4KKUA 2WV6D 3J80i 4XIGS 1K7UA 1NY4A 1KD1C 2E8GA 1RCVD 5GQOA 3VA7A 2E2JH 1SGEI 4PZ8A 2LXJA 4LK1C 1W6KA 1ONLA 4B3TQ 2SNMA 1LM0A 1SNMA 4IUTA 1JB7A 3S9WA 1HNXL 4AYBE 3DEPA 1T5EA 1ILPA 1HUNA 4WP4A 3AYHB 3P75A 4A93H 2LB7A 3X3NA 1XA6A 3GTMH 2ZJRA 1CQFA 1VQHA 1SGQI 4L9MA 1QB5D 2C9OA 1Q86C 3BVMA 5D14A 3GTQH 1ZKOA 1UWVA 1STNA 4LF7L 1I6HH 3OVOA 1YJ9A 2ORWA 1L1OA 1XNQL 1PRTC 5DAEA 3L0IA 4CGYB 2F0LA 1Y1WB 2BL8A 1S20A 1Y1VG 5NUCA 3BDLA 1NNXA 1PTOD 3BDOA 1NR4A 2F0JA 1B7YB 1XMOQ 1QCBD 3GTOB 4JBKA 1QUQB 3UDXA 4DV7L 5EQ0A 1V1PA 1PTQA 3S15H 1KQSA 2E2JB 1C48A 5A35A 1GUNA 4E1PA 3MEHA 1B9MA 2P5ZX 1ML0D 2I07B 1IL2A 1GOZA 2WKDA 3SGIA 2YU9H 4C3JH 4OX9L 5I4DA 4C3JB 2EOTA 2HCCA 3H3VI 1EEFD 2NTSA 2PW5A 3URYA 2K6AA 4JBJA 3VR2A 2GVBA 1QJOA 3WOEA 4CBVA 1XMOL 1K9MC 3PQIA 2ZRRA 3EROA 1SJED 1HEVA 4P75A 3VR4A 5CCLA 2KQ3A 2RADA 4XTCS 2K5DA 4KY7A 1V43A 2HDMA 5JPMC 1NBWA 4K0KQ 3PUXA 4A3EB 1RDPD 2D0PA 1X32A 4KHPL 1HTLD 2OQ0A 4YHHQ 2W0TA 1SE3A 4LF7Q 1C9OA 4LWCA 4HSPA 4DR5L 4FYDA 5HGIA 4NW2A 4JV5Q 5CBEE 5C3XA 4UDUC 5T1GA 2JXDA 3B55A 2KCMA 3H91A 4DWLA 2KJXA 1EY5A 4DR3L
chains in the Genus database with same CATH topology
5IYBH 1IBML 2NZOA 2XTIA 1HZBA 3S1MH 5C0XG 3G71A 4DR6L 1X4SA 4YWKA 2GVAA 4A3CH 2R7FA 3AFPA 1EQRA 4A3FH 3W1BA 4DV1L 2JQOA 2VNUD 5C4JH 2RHSB 4HIDA 4A3MG 3HKZG 1SFOH 1HNXQ 3PIPA 4A93G 1KBEA 4NV2A 3RLFA 2VUMG 1SN8A 1PH2A 4YZCA 1Z47A 4B3TL 1VQDA 1TGSI 4HFVA 3UEJA 2F6MB 4Z7HA 1V1HA 2VZAA 2CKZB 2N52A 1FAQA 1N8RC 1MJCA 1OMUA 1FJGQ 4E1RA 1ASYA 2E5LL 1WCMG 1X6OA 3M4PA 3B6YA 4YZ9A 1SMXA 3NEMA 1L2FA 4U6RA 4JI5L 3KLWA 4POGA 1DS2I 3OTOL 1NUBA 1DGSA 3K81C 3KF6A 3GO5A 1BBWA 3B4VC 4DR7L 3UFFA 4A3MH 3CMAA 3GD7A 1Q1EA 1HR0W 2E2HH 2UUCQ 2UXCQ 3F8TA 4DR2Q 3CP0A 1PV4A 4DPGA 4OWTB 1KC8C 4BY7G 1XBTA 4HJ5A 1TWAH 4LF8L 1CKNA 4P73A 1XJVA 4R4OA 4LNQA 3I4NH 4BBRG 1K8GA 4NB3A 5IYBG 1EYGA 3IAS1 4IPDA 3GTPH 5C0XI 4YWMA 1Q82C 2Q2TA 3S2DH 4LFBQ 2JA6G 1I5FA 5DLQE 2CWPA 4AIMA 3ULLA 3KF8B 2CCZA 4B3MQ 4X66Q 2YV5A 2EXDA 2WAQG 1A63A 2WFWA 2AMCB 3S24A 3DO9A 3DLLA 4B3ML 1FJGL 1TOTA 2Q2IA 5IP9H 3AFQA 4DUYL 1YO7A 2BH8A 4LF6L 4KI0A 4A76A 1GO3E 1N32Q 2J9RA 1KBFA 1J6QA 1UEBA 4O2DA 1EIFA 4FKDA 2E73A 5FLXc 4JI4L 1G51A 2IHEA 2YTYA 4DV1Q 5FJ8H 1KRSA 3MXNB 1UVFA 1EOVA 1HH2P 3GOXA 3K0XA 3W1GA 1P16A 5AJ3Q 1CT0I 1X3GA 1VQMA 4GI3C 5JJLA 3SDJA 1UVGA 4HGUA 3S16H 2K4KA 3PDNA 1L0WA 1I94L 2FXQA 1I3QH 1K3RA 5EAYA 4A3IH 1SRUA 2JA7G 3UGDA 1MT1A 5H1SE 3UITA 4A3EH 1KAWA 2HIVA 3A5UA 2VY3A 1HZ9A 1IY5A 5CCMA 2N49A 1E1TA 4NPSA 4DV5L 4MNOA 2GKRI 2AWNA 3U50C 3ZJYC 3HH2C 4JOIC 1VQBA 4DK6C 1PH4A 4PL5A 1HNWL 3CW2C 1X74A 4PG3A 3E59A 2UXBL 2ROWA 2UU9L 3IAM1 2IX1A 4IPHA 5FUXA 1SLJA 3JAMi 1TIHA 4OVOA 2K50A 1VQKA 4DV2Q 3MEFA 1Q81C 4R1JA 5FUYA 3KDFA 4JI3Q 1EUJA 3GTGH 2N71A 3CCUA 1A8VA 1XPRA 1N34Q 3GTOH 3D00A 1J5EQ 5M5WH 4MZ9A 3DM3A 2JA7H 1PYSB 1YEZA 4OXPA 1Q1BA 5LMNL 3S2HH 1TURA 2JB2A 3JAMc 1C0AA 3J81j 2MFIA 3PIOA 3PO3G 2R6GA 4C3HH 4GLXA 1YZ6A 4JI8Q 4HJAA 1S72A 3WWVA 3PGZA 1WI5A 4APVA 5FLMH 3CC4A 3HOVG 1A0IA 5IYDH 1VQOA 2QQDA 4IO9A 5FUWA 3CPWA 5GAEC 2VUMH 1W4RA 4UP7A 3QWPA 1X55A 4HJ9A 1N36L 1JMCA 4DV7Q 1HJAI 1WYDA 2I5HA 4YY3Q 2M5XA 1Y14B 3FKIH 1SGDI 2ZTCA 1J5EL 1K73C 3RZOH 3HFZB 3I9V1 1CT4I 1XNRQ 1X3FA 4JI3L 3UGLA 4BBSH 4LW1A 1VQPA 1FL0A 3PUZA 4JI7Q 3HOZG 1VDDA 1PPFI 1HZCA 5C3EH 2XGTA 3ICEA 2A2DA 3KJPA 2QA4A 5FLMG 4B3SQ 2R7ZH 2ATWA 4PZ7A 3HOVH 1RL2A 3EN2A 4A3BH 1Z7KB 2SGFI 1IYJB 3D31A 1QVCA 1XMQQ 3HOYG 1NE3A 1UE5A 2I5LX 3I2ZA 1O7IA 3AQQA 2ZM6Q 4I1TA 1E7ZA 2B63H 4DR1L 1PH5A 4DR7Q 2V1CA 4OX9Q 3SGBI 1VQLA 5IE8A 2BH2A 3UE1A 4DV5Q 1D8LA 3K7UC 4R4TA 3U4ZA 3HOWG 4GXTA 4DAYB 3DA4A 4LFAL 4B3RQ 3RR5A 1U5KA 1DS3I 4EQ5A 4UXJA 4GKJL 4GLAC 4GN4B 1Z9FA 4X62L 5C0XJ 1XPUA 4LUOA 5C44G 4AQYQ 2JEAI 1YJWA 1TBQR 2OCEA 2VQFL 3AJFA 2OTLA 3CCJA 4X65L 2KKMA 3FHWA 1EQQA 4GS3A 4JI2Q 3NELA 1WCMH 4DV2L 4TVAB 4GNXB 4JYAQ 1YTPA 4LFCQ 4A24A 5JHWC 1BUSA 2QPOA 4FDBA 2HHHQ 1B70B 1T9HA 2YYZA 3HOXG 4IFDJ 1CHOI 2ARPF 1VQ9A 3EIVA 5J3BA 4B3SL 4DV0L 2R93H 2ENZA 1EWIA 3UEYA 4JI7L 1KL9A 1QVGA 2L1LB 2F4VQ 1M8CA 4OWWB 2BA0A 4JI1Q 2Q2UA 3Q8DA 1M1KC 4R4QA 1PH6A 4A3FG 1S40A 3PUWA 4DUYQ 1AH9A 1N36Q 1HZAA 3I4MH 3VDPA 5IP7G 2YTXA 1R0RI 2IP6A 1IZ6A 1V1IA 2H5XA 3RLOA 1M90C 5FJ8G 3GTKH 2PQAA 2K19A 4Z7GA 2K5NA 4A3JH 4R4IA 4YCVA 1B8AA 3HOUG 3PO3H 4GN3B 1K0RA 2JJQA 5AJ3L 4L5QA 3UDFA 4DKAC 4A3LH 2KHIA 2K52A 1Y1WH 2N17A 5GAHC 5M3FH 4JG2A 1YIJA 5FUVA 1JE5A 3RNUA 1TWFH 2LSSA 2QGQA 3BZKA 5IP9G 3L7ZC 2VW9A 4DUZQ 1N34L 2ASBA 2IT1A 1Y1WG 3VA9A 3K8AA 3LJ2A 1SR3A 1H95A 4WJ4A 2AKWB 1MKHA 3PF5A 3CMEA 4DAMA 1Q7YC 2UU9Q 2KMOA 4JI5Q 1N33L 2NU0I 3VDUA 2YFAA 4GKKQ 2JA5H 1YHQA 1Q12A 4HEA1 1BVSA 1GKHA 2SGPI 4P72A 3MEKA 4DK3C 1KXLA 2JW6A 3L0OA 2OD1A 2UUBQ 2GKTI 2XTRA 3K80C 3H3VH 2PQAB 3PO2H 1TBRR 1XTDA 4JCVE 3PSIA 2A20A 2EQSA 2ODDA 1OXXK 3RLNA 1G6PA 4A3EG 1SGRI 3M9BA 3QTLD 2PMZE 5BR8L 4QGUA 2NN6G 1EFWA 2ID0A 2ERWA 1X56A 3J81i 2R93G 2RCNA 3NBHB 1X54A 3PO2G 2UZ3A 1YVCA 1I94Q 1MIUA 1NJIC 3PV0A 1ASZA 2UUCL 5IYCG 4WJ3M 4GOPA 1OXVA 2R7DA 1GD7A 1LYLA 1WOCA 2JA5G 1RIPA 3ULPA 4Y7NH 2NVQH 4DUZL 1X3EA 3ER0A 2RIOA 1CSQA 2N3SA 2V6EA 3OTOQ 5IY0A 2VQFQ 4DNIA 2E2IH 3CPFA 4BXXG 2JA1A 4OAUC 4AQYL 4AS2A 1VQ7A 4JI4Q 1VQEA 2DB6A 2SGEI 4HIOA 2CAZB 4JBWA 3DA3A 3F2BA 3G4SA 4B3RL 1G291 1LR8A 5HI7A 2RHQB 4DV3L 2XRCA 1OXTA 1R9TH 2NVYH 1JJCB 2L15A 4UPAA 5K36G 1TUSA 1V9PA 2JK8A 4X64L 2ZM6L 4DV6Q 1IBLQ 2UXDQ 1QVFA 4IJLA 2GN5A 3TEHB 2JA8H 2JA6H 3PF4A 1W3SA 4LF5Q 2DIPA 2F52A 2B3GA 4UP8A 4A3JG 3HOUH 2K9HA 3I7FA 4A3BG 2A19A 3F1ZA 4H02A 2DUDA 4JI1L 4EX5A 2JEBI 1KHIA 4PMWA 5M5YH 1HPTA 2FNFX 1QUQA 2LEOA 3I4OA 4GLVB 4LF4Q 1FARA 1LR7A 1M8BA 1PJUA 3RZDH 1HR0L 2L8EA 3VE5A 1YHAA 4IOAA 3W5OA 1KRTA 2J87A 1UE6A 3P23A 4A3DH 3F2DA 4QQBX 1CKOA 2WAQE 3CCSA 2VL6A 5C4XG 2MO0A 4JYAL 2NZHA 4IPGA 4X6AH 3D0FA 3E0EA 1VQJA 1SROA 2MO1A 1R79A 1L1OB 5EX0A 1BBUA 3CF5A 3TS2A 2N8NA 2ZJPA 4JI6L 4BA2I 2LUYA 2L7XA 3RN5A 4OO1I 4DV4Q 4PL4A 3OYYA 4NXNL 1YJNA 2VS1A 2MQHA 3T1YQ 3S1NH 2QQ0A 3CCEA 4LFAQ 2OQKA 3NENA 2NU1I 3CAMA 2NU3I 1X9NA 2WVJA 2KCXA 4DR1Q 4GOPC 2CJSC 4O1PA 1YHBA 3STBC 1HNZQ 2K75A 1XMQL 3ULJA 3CD6A 2DGYA 1TBNA 1OXSC 1OMTA 4A3CG 2UXBQ 2GKVA 2VRWB 1I50H 1OXUA 2CQOA 4JI0Q 3CXCA 3HOWH 1WJJA 1XNQQ 2ES2A 4GN5A 3E2IA 3OXLA 1IBKQ 4Q9VA 4POFA 1FVIA 2YQPA 4IJHA 2ORVA 2YTVA 1PYBA 1Q46A 3H0GH 1FGUA 2IHFA 4L5TA 3G6EA 4NV5A 4QIWE 3CCMA 3S1RH 3F4MA 3M7NA 3CCLA 5C3EG 4NXNQ 3S14H 3U4VA 3GDEA 3CCQA 3FP9A 2I5MX 1E1OA 3HKZE 4OONA 1P8LA 2XTQA 4GKJQ 2A1AA 3TRZA 2HIXA 4A3GG 2QQEA 3JC66 3L2PA 3M85A 4DR3L 3J80c 1E3PA 4A3LG 1S3OA 4QY7A 2KMPA 5HQ8A 5ELOA 2CWAA 5ELNA 4HIKA 4LF9L 5JEAJ 2WP8J 4JBMA 4BXXH 4IOCA 1OTCA 3CC2A 4GNXC 1Y1BA 5IWAQ 2F3CI 5JJIA 4ME3A 4PZ6A 5M3MG 3M4QA 3UDGA 3CXLA 1NMFA 1PH7A 1U0LA 3KOJA 3H15A 2R92H 4DR4L 2JZMA 4UXIA 5M5XH 3OXGA 1H0ZA 1PH1A 4RG1A 1CGII 4OO1G 3KP9A 2Z0SA 1XNRL 3G48A 3VDYA 2NU2I 4LF6Q 1CKMA 2QEXA 4LF5L 4A3GH 4AH6A 3J7A5 4DV4L 2K14A 1VQFA 1N9WA 2F66B 4X66L 4TQUS 2PI2E 4X64Q 4BY1H 2UXDL 1VQNA 4G76A 1Y8FA 1BKBA 2AWOA 3GTJH 4LFBL 2KENA 4KHZA 2BUSA 3HOXH 3E9IA 4JI8L 2JB1A 1HJPA 4OWXB 2K5HA 5JEAG 4HIMA 3SGQI 2Q2HA 1PH3A 1Q8KA 2NVXH 2B8TA 3J7ZC 1TXYA 3EBEA 4O1OA 4O0AA 1YNXA 4P71A 4BBRH 2JB3A 1L1OC 4LF8Q 5LMNQ 1SGYI 3PUYA 1SE8A 4BY7H 2D62A 4L5SA 1Y1VH 2KCTA 4BY1G 1TBOA 3IRBA 2VQEL 3BZCA 2XMXA 5M3FG 2HQLA 2N78A 2OVOA 2Z6KC 3BJUA 1N13A 1PFSA 1HNWQ 1JT8A 1A62A 1NMGA 5BR8Q 1CUKA 4DV6L 3F2CA 1CSPA 1IBLL 2P6AC 3HOYH 3I4MG 2KBNA 5GAGC 4L5RC 4DV3Q 3TJQA 3BU2A 5M3MH 1N32L 4IFDG 1PA6A 3GTLH 3ERSX 2UUBL 2ZTDA 3TQYA 5IP7H 1E22A 4LUVA 2V1CC 3HOZH 1IW4A 4BBSG 4R4CA 1QZHA 4GKKL 5C4XH 2HT1A 3AEVA 3E9HA 1VQ8A 1N33Q 1C7YA 1LUZA 1JJGA 3S1QH 4OAVB 1E24A 3FKIG 5HGQA 4A3DG 1AN1I 2V53A 5JJKA 5IT9c 2WB1E 3KY9A 5LMNW 4DR6Q 5HY6A 4B6DA 3CCRA 1YITA 2KHJA 3CC7A 4ALPA 1MJEA 5IYDG 4DR3Q 4HJ8A 3T1YL 3JSBA 3I56A 3I55A 3UDIA 1AE3A 4A75A 4G75A 1PH8A 3H0GG 2B0UC 1VS0A 4RMFA 3TREA 4MTNA 3UGIA 4A3KG 2UXCL 1AE2A 2RF4A 2LXKA 4DR5Q 4IPCA 1W2BA 2ZJQA 1LR9A 2QQCA 2WB1G 2A2CA 2C35B 3J80i 4AYBG 5LMUL 4XIGS 2JAEA 3RU0A 1CGJI 1SGPI 2PNHA 3UE0A 1NY4A 4YHHL 2E8GA 1KD1C 5GQOA 2E2JH 3LJ0A 2NVTH 1SGEI 1YU6C 1IY6A 4PZ8A 2LXJA 4QJFA 4J15A 5LMUQ 1FYBA 1SJ8A 4B3TQ 1TWGH 2B63G 2F4VL 3FBVA 1LM0A 2D0OA 2EIFA 1PTRA 2ELIA 2N1AB 2ENNA 1JB7A 4DV0Q 1HNXL 4AYBE 2OWOA 1PH9A 3U58A 1VQIA 3A74A 1X65A 1TWHH 2PI2A 2WCYA 2P22B 3A5ZB 2FUG1 4C2MH 2HHHL 5E7NA 2OTJA 2ZTEA 4DR2L 3BJIA 4JC0A 3J81c 3AYHB 4AS3A 4JOIA 4IFDI 2A8VA 3PUVA 1D7QA 1EIYB 4A93H 1IBMQ 1XA6A 3CCVA 3GTMH 1XX6A 2YUUA 4JI2L 4YCUA 2MNAA 2ZJRA 1CSOI 3SEKC 3KDFB 1VQHA 3LJ1A 4X65Q 4KLKA 4GOPB 2UUAQ 1PVOA 2YFBA 1OVOA 1RFHA 1SGQI 2NN6I 4L9MA 1UUCA 1K83H 1Q86C 2E5LQ 5EX3A 3GTQH 4GNXA 1XPOA 2R92G 1YBYA 1VQCA 4A4IA 1UWVA 2GVIA 2BA1A 5LNK1 4LF7L 1I6HH 1YJ9A 3OVOA 4HJ7A 4UXHA 2JA8G 2ORWA 1TWCH 1L1OA 4YCWA 4NXMQ 1XNQL 4DR4Q 4P74A 5DAEA 4JI0L 3L0IA 2K5VA 2F3IA 1PCEA 1K8AC 5IWAL 2AHOB 1UE1A 1CE3A 3PCOB 1Y1VG 4NXML 1YI2A 2VQEQ 4LFCL 1JJ2A 4LF9Q 3RN2A 3FC3A 2Y0SG 1QZGA 3OW2A 2MJFB 1VQ6A 1BMOA 3M4OH 1B7YB 2B29A 3KJOA 2KMRA 1XMOQ 1CT2I 2NU4I 4JBKA 5GROA 5GADC 1QUQB 1PHJA 1KMAA 3UDXA 3LGJA 1NTGA 4DV7L 1PTQA 3KYHC 3T1HQ 3S15H 1LTLA 1CKNB 4X62Q 1KQSA 4JV5L 2E5RA 4E1PA 4BA1I 5IYCH 4JI6Q 4PL3A 2UUAL 3I4NG 1V1QA 4UP9A 4SGBI 1VQ5A 2SGQI 1IL2A 3K7AH 3SGIA 1OYVI 2YU9H 2Y0SE 4C3JH 1IBKL 4OX9L 3OL0A 1GM5A 3H3VI 1KIXA 2SGDI 4KHPQ 3T1HL 2JE6I 4A3IG 3KFUA 4YWLA 4JBJA 4K0KL 2GVBA 1WFQA 1XMOL 1K9MC 1HNZL 1HR0Q 2ZRRA 1GVPA 2I0QA 3M3YH 1SGNI 4P75A 5CCLA 1VQAA 3OXFA 1HDLA 4XTCS 4LUZA 1V43A 2KMQA 1NBWA 4YY3L 4K0KQ 3A0JA 4YZDA 3PUXA 2R7ZG 2D0PA 4KHPL 2OQ0A 4YHHQ 4Y52H 5C44H 2W0TA 2IY5B 3HKSA 1C9OA 1UE7A 4LWCA 2ALYB 4LF7Q 3TS0A 3CQZH 3STBD 4DR5L 4UY8C 1IXRA 2JYYA 5HGIA 4JV5Q 2CFMA 3S17H 2IX0A 4A3KH 1VQ4A 2JXDA 1VCIA 2KCMA 4QL5A 4DWLA 4C3IH 1VQGA 3KF6B 1Y1CA 2JA9A 2Z6KA 4LF4L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYB H;  1IBM L;  2NZO A;  2XTI A;  1HZB A;  3S1M H;  5C0X G;  3G71 A;  4DR6 L;  4YWK A;  2GVA A;  4A3C H;  2R7F A;  3AFP A;  1EQR A;  4A3F H;  3W1B A;  4DV1 L;  2JQO A;  2VNU D;  5C4J H;  2RHS B;  4HID A;  4A3M G;  3HKZ G;  1SFO H;  1HNX Q;  3PIP A;  4A93 G;  3RLF A;  2VUM G;  1SN8 A;  1PH2 A;  1Z47 A;  4B3T L;  1VQD A;  2VZA A;  2CKZ B;  1N8R C;  1MJC A;  1FJG Q;  1ASY A;  2E5L L;  1WCM G;  1X6O A;  3M4P A;  3B6Y A;  3NEM A;  1SMX A;  3M3Y H;  1L2F A;  4JI5 L;  3KLW A;  4POG A;  3OTO L;  1DGS A;  3K81 C;  3KF6 A;  3GO5 A;  1BBW A;  4DR7 L;  4A3M H;  3CMA A;  3GD7 A;  1Q1E A;  1HR0 W;  2E2H H;  2UUC Q;  2UXC Q;  3F8T A;  4DR2 Q;  3CP0 A;  1PV4 A;  4DPG A;  4OWT B;  1KC8 C;  4BY7 G;  4HJ5 A;  1TWA H;  4LF8 L;  1CKN A;  4P73 A;  1XJV A;  4R4O A;  4LNQ A;  3I4N H;  4BBR G;  1K8G A;  4NB3 A;  5IYB G;  1EYG A;  3GTP H;  4IPD A;  5C0X I;  4YWM A;  1Q82 C;  2Q2T A;  3S2D H;  4LFB Q;  2JA6 G;  1I5F A;  5DLQ E;  2CWP A;  4AIM A;  3ULL A;  3KF8 B;  2CCZ A;  4B3M Q;  4X66 Q;  2YV5 A;  2EXD A;  2WAQ G;  1A63 A;  2WFW A;  2AMC B;  3S24 A;  1FJG L;  3DLL A;  4B3M L;  2Q2I A;  5IP9 H;  3AFQ A;  4DUY L;  2BH8 A;  4LF6 L;  4KI0 A;  4A76 A;  1GO3 E;  1N32 Q;  1J6Q A;  1UEB A;  4O2D A;  1EIF A;  5FLX c;  4JI4 L;  1G51 A;  2IHE A;  2YTY A;  4DV1 Q;  5FJ8 H;  1KRS A;  3MXN B;  1EOV A;  1HH2 P;  3K0X A;  3W1G A;  1P16 A;  5AJ3 Q;  1X3G A;  1VQM A;  5JJL A;  3S16 H;  2K4K A;  1L0W A;  1I94 L;  2FXQ A;  1I3Q H;  1K3R A;  5EAY A;  4A3I H;  1SRU A;  2JA7 G;  5H1S E;  4A3E H;  1KAW A;  2HIV A;  3A5U A;  2VY3 A;  1HZ9 A;  2N49 A;  1E1T A;  4NPS A;  4DV5 L;  4MNO A;  2AWN A;  3U50 C;  3ZJY C;  4JOI C;  1VQB A;  4DK6 C;  1PH4 A;  1HNW L;  3CW2 C;  4PG3 A;  2UXB L;  2UU9 L;  2IX1 A;  4IPH A;  1SLJ A;  3JAM i;  2K50 A;  1VQK A;  4DV2 Q;  3MEF A;  1Q81 C;  4R1J A;  3KDF A;  4JI3 Q;  1EUJ A;  3GTG H;  3CCU A;  1A8V A;  1XPR A;  1N34 Q;  3GTO H;  1J5E Q;  5M5W H;  4MZ9 A;  3DM3 A;  2JA7 H;  1PYS B;  1YEZ A;  4OXP A;  1Q1B A;  5LMN L;  3S2H H;  3JAM c;  1C0A A;  3J81 j;  2MFI A;  3PIO A;  3PO3 G;  2R6G A;  4C3H H;  4GLX A;  1YZ6 A;  4JI8 Q;  4HJA A;  1S72 A;  3WWV A;  3PGZ A;  1WI5 A;  4APV A;  5FLM H;  3CC4 A;  3HOV G;  1A0I A;  5IYD H;  1VQO A;  4IO9 A;  3CPW A;  5GAE C;  2VUM H;  4UP7 A;  1X55 A;  4HJ9 A;  1N36 L;  1JMC A;  4DV7 Q;  1WYD A;  2I5H A;  4YY3 Q;  1Y14 B;  3FKI H;  2ZTC A;  1J5E L;  1K73 C;  3RZO H;  3HFZ B;  1XNR Q;  1X3F A;  4JI3 L;  4BBS H;  4LW1 A;  1VQP A;  1FL0 A;  3PUZ A;  4JI7 Q;  3HOZ G;  1HZC A;  5C3E H;  2XGT A;  3ICE A;  3KJP A;  2QA4 A;  4B3S Q;  5FLM G;  3HOV H;  2R7Z H;  2ATW A;  4PZ7 A;  1RL2 A;  3EN2 A;  4A3B H;  1IYJ B;  3D31 A;  1QVC A;  1XMQ Q;  3HOY G;  1NE3 A;  1UE5 A;  2I5L X;  3I2Z A;  1O7I A;  3AQQ A;  2ZM6 Q;  3I4M H;  1E7Z A;  2B63 H;  4DR1 L;  1PH5 A;  4DR7 Q;  4OX9 Q;  1VQL A;  5IE8 A;  2BH2 A;  3UE1 A;  4DV5 Q;  1D8L A;  3K7U C;  4R4T A;  3U4Z A;  3HOW G;  4DAY B;  4LFA L;  4B3R Q;  3RR5 A;  1U5K A;  4EQ5 A;  4GKJ L;  4GLA C;  4GN4 B;  1Z9F A;  4X62 L;  5C0X J;  1XPU A;  4LUO A;  5C44 G;  4AQY Q;  2JEA I;  1YJW A;  2OCE A;  2VQF L;  2OTL A;  3CCJ A;  4X65 L;  1EQQ A;  3FHW A;  4GS3 A;  4JI2 Q;  3NEL A;  1WCM H;  4DV2 L;  4TVA B;  4GNX B;  4JYA Q;  4LFC Q;  4FDB A;  2HHH Q;  1B70 B;  1T9H A;  2YYZ A;  3HOX G;  4IFD J;  1VQ9 A;  3EIV A;  5J3B A;  4B3S L;  4DV0 L;  2R93 H;  1EWI A;  4JI7 L;  1KL9 A;  1QVG A;  2F4V Q;  4OWW B;  2BA0 A;  4JI1 Q;  2Q2U A;  3Q8D A;  1M1K C;  4R4Q A;  1PH6 A;  4A3F G;  1S40 A;  3PUW A;  4DUY Q;  1AH9 A;  1N36 Q;  1HZA A;  5IP7 G;  2YTX A;  1IZ6 A;  2H5X A;  3RLO A;  1M90 C;  5FJ8 G;  3GTK H;  2PQA A;  4A3J H;  3HOU G;  2K5N A;  3PO3 H;  4R4I A;  4YCV A;  1B8A A;  4GN3 B;  1K0R A;  2JJQ A;  5AJ3 L;  4L5Q A;  3UDF A;  4DKA C;  4A3L H;  2KHI A;  2K52 A;  1Y1W H;  5GAH C;  5M3F H;  4JG2 A;  1YIJ A;  1JE5 A;  3RNU A;  1TWF H;  2LSS A;  2QGQ A;  3BZK A;  5IP9 G;  3L7Z C;  2VW9 A;  4DUZ Q;  1N34 L;  2ASB A;  2IT1 A;  1Y1W G;  3K8A A;  1SR3 A;  1H95 A;  4WJ4 A;  2AKW B;  1MKH A;  3PF5 A;  3CME A;  4DAM A;  1Q7Y C;  2UU9 Q;  4JI5 Q;  1N33 L;  4GKK Q;  2JA5 H;  1YHQ A;  1Q12 A;  1BVS A;  1GKH A;  4P72 A;  4DK3 C;  1KXL A;  3L0O A;  2UUB Q;  3K80 C;  3H3V H;  2PQA B;  3PO2 H;  1XTD A;  4JCV E;  3PSI A;  2EQS A;  1OXX K;  3RLN A;  1G6P A;  4A3E G;  3M9B A;  2PMZ E;  5BR8 L;  4QGU A;  2NN6 G;  1EFW A;  2ID0 A;  1X56 A;  3J81 i;  2R93 G;  2RCN A;  3NBH B;  1X54 A;  3PO2 G;  1YVC A;  1I94 Q;  1MIU A;  1NJI C;  3PV0 A;  1ASZ A;  2UUC L;  5IYC G;  4WJ3 M;  4GOP A;  1OXV A;  2R7D A;  1GD7 A;  1LYL A;  1WOC A;  2JA5 G;  1RIP A;  3ULP A;  4Y7N H;  2NVQ H;  4DUZ L;  3ER0 A;  1X3E A;  1CSQ A;  3OTO Q;  2N3S A;  1JT8 A;  5IY0 A;  2VQF Q;  4DNI A;  2E2I H;  3CPF A;  4BXX G;  4AQY L;  1VQ7 A;  4JI4 Q;  1VQE A;  4HIO A;  3F2B A;  4JBW A;  4B3R L;  3G4S A;  1G29 1;  2RHQ B;  4DV3 L;  1OXT A;  1R9T H;  2NVY H;  1JJC B;  2L15 A;  4UPA A;  5K36 G;  1V9P A;  2JK8 A;  4X64 L;  2ZM6 L;  4DV6 Q;  1IBL Q;  2UXD Q;  1QVF A;  4IJL A;  2GN5 A;  3TEH B;  2JA8 H;  2JA6 H;  3PF4 A;  1W3S A;  4LF5 Q;  2F52 A;  2B3G A;  4UP8 A;  4A3J G;  3HOU H;  3I7F A;  4A3B G;  2A19 A;  3F1Z A;  4H02 A;  2DUD A;  4JI1 L;  4EX5 A;  2JEB I;  1KHI A;  4PMW A;  5M5Y H;  1QUQ A;  3I4O A;  4GLV B;  4LF4 Q;  3RZD H;  1HR0 L;  1YHA A;  4IOA A;  3W5O A;  1KRT A;  1UE6 A;  4QQB X;  4A3D H;  3F2D A;  1CKO A;  2WAQ E;  3CCS A;  2VL6 A;  5C4X G;  2MO0 A;  4JYA L;  2NZH A;  4IPG A;  4X6A H;  3D0F A;  3E0E A;  1VQJ A;  1SRO A;  2MO1 A;  1L1O B;  1BBU A;  3CF5 A;  3TS2 A;  2N8N A;  2ZJP A;  4JI6 L;  4BA2 I;  3RN5 A;  4OO1 I;  4DV4 Q;  3OYY A;  4NXN L;  1YJN A;  2VS1 A;  2MQH A;  3T1Y Q;  3S1N H;  3CCE A;  4LFA Q;  2OQK A;  3NEN A;  3CAM A;  1X9N A;  4DR1 Q;  4GOP C;  1YHB A;  3STB C;  1HNZ Q;  2K75 A;  1XMQ L;  3ULJ A;  3CD6 A;  2DGY A;  1OXS C;  4A3C G;  2UXB Q;  1I50 H;  1OXU A;  2CQO A;  4JI0 Q;  3CXC A;  3HOW H;  1WJJ A;  1XNQ Q;  2ES2 A;  4GN5 A;  1IBK Q;  4POF A;  1FVI A;  4IJH A;  2YTV A;  1PYB A;  1Q46 A;  3H0G H;  1FGU A;  2IHF A;  4L5T A;  3G6E A;  3CCM A;  4QIW E;  3S1R H;  3M7N A;  3S14 H;  3CCL A;  5C3E G;  4NXN Q;  3U4V A;  3GDE A;  3CCQ A;  3FP9 A;  2I5M X;  1E1O A;  3HKZ E;  4OON A;  1P8L A;  4GKJ Q;  2A1A A;  3TRZ A;  2HIX A;  4A3G G;  3JC6 6;  3L2P A;  3M85 A;  4DR3 L;  3J80 c;  1E3P A;  4A3L G;  1S3O A;  4QY7 A;  5ELO A;  2CWA A;  5ELN A;  4HIK A;  4LF9 L;  5JEA J;  2WP8 J;  4JBM A;  4BXX H;  4IOC A;  1OTC A;  3CC2 A;  4GNX C;  5IWA Q;  4ME3 A;  4PZ6 A;  5M3M G;  3M4Q A;  3UDG A;  1NMF A;  1PH7 A;  1U0L A;  3KOJ A;  3H15 A;  2R92 H;  4DR4 L;  5M5X H;  1PH1 A;  4RG1 A;  4OO1 G;  2Z0S A;  1XNR L;  3G48 A;  3VDY A;  4LF6 Q;  1CKM A;  2QEX A;  4LF5 L;  4A3G H;  4AH6 A;  3J7A 5;  4DV4 L;  2K14 A;  1VQF A;  1N9W A;  4X66 L;  4X64 Q;  4TQU S;  2PI2 E;  4BY1 H;  2UXD L;  1VQN A;  1BKB A;  2AWO A;  3GTJ H;  4LFB L;  2KEN A;  4KHZ A;  3HOX H;  3E9I A;  4JI8 L;  1HJP A;  4OWX B;  2K5H A;  5JEA G;  4HIM A;  2Q2H A;  1PH3 A;  1Q8K A;  2NVX H;  3J7Z C;  1TXY A;  3EBE A;  4P71 A;  4O0A A;  1YNX A;  4BBR H;  4LF8 Q;  1L1O C;  5LMN Q;  3PUY A;  1SE8 A;  4BY7 H;  2D62 A;  4L5S A;  1Y1V H;  2KCT A;  4BY1 G;  3IRB A;  2VQE L;  3BZC A;  5M3F G;  2HQL A;  2N78 A;  2Z6K C;  3BJU A;  1PFS A;  1HNW Q;  1A62 A;  1NMG A;  5BR8 Q;  1CUK A;  4DV6 L;  3F2C A;  1CSP A;  1IBL L;  3HOY H;  3I4M G;  2KBN A;  5GAG C;  4L5R C;  4DV3 Q;  3BU2 A;  5M3M H;  1N32 L;  4IFD G;  1PA6 A;  3GTL H;  3ERS X;  2UUB L;  2ZTD A;  3TQY A;  5IP7 H;  1E22 A;  4LUV A;  2V1C C;  3HOZ H;  4BBS G;  4R4C A;  1QZH A;  4GKK L;  5C4X H;  2HT1 A;  3AEV A;  3E9H A;  1VQ8 A;  1N33 Q;  1C7Y A;  1LUZ A;  1JJG A;  3S1Q H;  1E24 A;  3FKI G;  4A3D G;  5HGQ A;  5JJK A;  5IT9 c;  2WB1 E;  5LMN W;  4DR6 Q;  5HY6 A;  3CCR A;  1YIT A;  2KHJ A;  3CC7 A;  4ALP A;  1MJE A;  5IYD G;  4DR3 Q;  4HJ8 A;  3T1Y L;  3I56 A;  3I55 A;  3UDI A;  1AE3 A;  4A75 A;  1PH8 A;  3H0G G;  1VS0 A;  4RMF A;  3TRE A;  4MTN A;  4A3K G;  2UXC L;  1AE2 A;  2RF4 A;  2LXK A;  4DR5 Q;  4IPC A;  1W2B A;  2ZJQ A;  2WB1 G;  2C35 B;  3J80 i;  4AYB G;  5LMU L;  4XIG S;  2PNH A;  3UE0 A;  1NY4 A;  4YHH L;  2E8G A;  1KD1 C;  5GQO A;  2E2J H;  2NVT H;  5JJI A;  4PZ8 A;  2LXJ A;  4QJF A;  4J15 A;  5LMU Q;  4B3T Q;  1TWG H;  2B63 G;  2F4V L;  1LM0 A;  2D0O A;  2EIF A;  1JB7 A;  4DV0 Q;  1HNX L;  4AYB E;  2OWO A;  1PH9 A;  3U58 A;  1VQI A;  3A74 A;  1X65 A;  1TWH H;  2PI2 A;  3A5Z B;  4C2M H;  2HHH L;  5E7N A;  2OTJ A;  2ZTE A;  4DR2 L;  4JC0 A;  3J81 c;  3AYH B;  4JOI A;  4IFD I;  2A8V A;  3PUV A;  1D7Q A;  1EIY B;  4A93 H;  1IBM Q;  3CCV A;  3GTM H;  4JI2 L;  4YCU A;  2MNA A;  2ZJR A;  3KDF B;  1VQH A;  4X65 Q;  4GOP B;  4KLK A;  2UUA Q;  1PVO A;  2NN6 I;  1K83 H;  1Q86 C;  2E5L Q;  3GTQ H;  4GNX A;  1XPO A;  2R92 G;  1YBY A;  1VQC A;  4A4I A;  1UWV A;  2BA1 A;  4LF7 L;  1I6H H;  1YJ9 A;  4HJ7 A;  2JA8 G;  1TWC H;  1L1O A;  4YCW A;  4NXM Q;  1XNQ L;  4DR4 Q;  4P74 A;  4JI0 L;  2K5V A;  2F3I A;  1K8A C;  5IWA L;  2AHO B;  1UE1 A;  3PCO B;  1Y1V G;  4NXM L;  1YI2 A;  2VQE Q;  4LFC L;  1JJ2 A;  4LF9 Q;  3RN2 A;  2Y0S G;  1QZG A;  3OW2 A;  1VQ6 A;  3M4O H;  1B7Y B;  2B29 A;  3KJO A;  1XMO Q;  4JBK A;  5GRO A;  5GAD C;  1QUQ B;  1PHJ A;  3UDX A;  3LGJ A;  1NTG A;  4DV7 L;  3KYH C;  3T1H Q;  3S15 H;  1LTL A;  1CKN B;  4X62 Q;  1KQS A;  4JV5 L;  4BA1 I;  5IYC H;  4JI6 Q;  3I4N G;  2UUA L;  1V1Q A;  4UP9 A;  1VQ5 A;  1IL2 A;  3K7A H;  3SGI A;  2YU9 H;  2Y0S E;  4C3J H;  1IBK L;  4OX9 L;  1GM5 A;  3H3V I;  1KIX A;  4KHP Q;  3T1H L;  2JE6 I;  4A3I G;  3KFU A;  4YWL A;  4JBJ A;  4K0K L;  2GVB A;  1WFQ A;  1XMO L;  1K9M C;  1HNZ L;  1HR0 Q;  1GVP A;  2I0Q A;  4P75 A;  1VQA A;  4XTC S;  4LUZ A;  1V43 A;  1NBW A;  4YY3 L;  4K0K Q;  3A0J A;  3PUX A;  2R7Z G;  2D0P A;  4KHP L;  2OQ0 A;  4YHH Q;  4Y52 H;  5C44 H;  2IY5 B;  3HKS A;  1C9O A;  1UE7 A;  4LWC A;  2ALY B;  4LF7 Q;  3TS0 A;  3CQZ H;  3STB D;  4DR5 L;  4UY8 C;  1IXR A;  4JV5 Q;  2CFM A;  3S17 H;  2IX0 A;  4A3K H;  1VQ4 A;  1VCI A;  2KCM A;  4QL5 A;  4C3I H;  1VQG A;  3KF6 B;  2JA9 A;  2Z6K A;  4LF4 L; 
#chains in the Genus database with same CATH topology
 3S1M H;  1E2Z A;  1EY4 A;  2R7F A;  3AFP A;  4A3F H;  3W1B A;  1JB3 A;  3S2H B;  5C4J H;  2RHS B;  3MTS A;  4H7B A;  3Q24 A;  1HNX Q;  2K32 A;  3RLF A;  4IQZ A;  3S16 B;  1WTO A;  4FF3 A;  2FHT A;  3UEJ A;  4Z7H A;  1JWM D;  2Q8R E;  3AU7 A;  3OHX C;  1MJC A;  1FR3 A;  1FJG Q;  3J7A F;  1ASY A;  4YZ9 A;  1L2F A;  3NTI A;  3GO5 A;  1GJX A;  3B4V C;  4DR7 L;  1S5D D;  4RHR A;  2A6E C;  1Q1E A;  2UUC Q;  2Z1C A;  2UXC Q;  3CP0 A;  4BY7 G;  4OWT B;  1TWA H;  2OU2 A;  1XJV A;  4LNQ A;  1ZXT A;  1MJA A;  1WTP A;  2Q2T A;  3QOJ A;  5DLQ E;  5T1I A;  2IY5 B;  3ULL A;  2CCZ A;  2YV5 A;  2EXD A;  3BVZ A;  1CK1 A;  3S24 A;  1FJG L;  2EY1 A;  1MJ9 A;  3Q23 A;  4A3K B;  4LF6 L;  1EIF A;  5FLX c;  5CC4 A;  2UVO A;  1Q8I A;  3QIA A;  1G51 A;  2YTY A;  3L9A X;  4DA2 A;  1HH2 P;  5C4J B;  3K0X A;  3W1G A;  1CT0 I;  2JBW A;  4NDX A;  4GI3 C;  4I7A A;  5IGD A;  3S16 H;  1I94 L;  3NTK A;  2FXQ A;  1I3Q H;  1MT1 A;  3BG3 A;  2A5H A;  3OWE B;  3ERQ A;  1KAW A;  3A5U A;  2VY3 A;  1TS4 A;  1I4Q A;  4NPS A;  4DV5 L;  1BR9 A;  4IUQ A;  3U50 C;  1IYV A;  3ZJY C;  2IX3 A;  2V4D A;  1X74 A;  3H3V C;  2UU9 L;  2IX1 A;  4DGZ A;  4RAU C;  4DV2 Q;  4JI3 Q;  1EUJ A;  1BDO A;  1A8V A;  3CCU A;  1XPR A;  3QB3 A;  1J5E Q;  3DM3 A;  3S2H H;  1YEZ A;  3S15 B;  1TUR A;  2JB2 A;  3JAM c;  2QDB A;  2A68 D;  3BVG A;  3PO3 G;  1YZ6 A;  5IGF A;  3TSS A;  4RWS C;  4HJA A;  1S72 A;  3UI2 A;  2FIN B;  4APV A;  3G7L A;  1M4V A;  5KND A;  2VUM H;  4UP7 A;  1X55 A;  2I5H A;  4YY3 Q;  3FKI H;  1J5E L;  1K73 C;  1CT4 I;  1JOK A;  2FMM A;  4JI3 L;  4BBS H;  1A2T A;  4JI7 Q;  1F2M A;  2Y0S B;  4ZCK A;  3KJP A;  2EYH A;  2R7Z H;  3VR3 A;  4A3B H;  1Z7K B;  5C6A A;  1XMQ Q;  3I4M H;  3I2Z A;  1UE5 A;  1O7I A;  3OMG A;  5C5L A;  2V1C A;  4ZUI A;  4J1M A;  3SGB I;  5IE8 A;  3UE1 A;  2O2L D;  4DAY A;  4GXT A;  2K04 A;  1LTR D;  4UXJ A;  4GKJ L;  1SEB D;  4GN4 B;  4X62 L;  5C44 G;  1TBQ R;  2OTL A;  4X65 L;  2KKM A;  4FXD A;  3K7A B;  4H44 C;  4JI2 Q;  3U9O A;  1CHP D;  1TWG B;  1BUS A;  1MD2 D;  1HQR D;  4FDB A;  2ARP F;  1EQV A;  4CDC C;  3EIV A;  2JP1 A;  4WRD A;  2GIV A;  1D1I A;  2RKS A;  3GTM B;  2L1L B;  4OWW B;  4JI1 Q;  2Q2U A;  3Q8D A;  3CRK C;  2JXM B;  1IHZ A;  4DUY Q;  4A3I B;  4OO1 H;  2TMP A;  2WAC A;  1IZ6 A;  5CV5 A;  3HS0 C;  4C3I G;  4DXF A;  1M90 C;  1ULM A;  4A3J H;  4ZLT F;  3TZD A;  4YCV A;  1B8A A;  1LTG D;  2JJQ A;  2B2T C;  5AJ3 L;  2N17 A;  1Y1W H;  1YIJ A;  1X3P A;  3P1H A;  2EY5 A;  1DM0 B;  4A3B B;  2VW9 A;  2G9H D;  2CWG A;  1MSH A;  4CDD C;  1O78 A;  1SNO A;  3K8A A;  3LJ2 A;  1H95 A;  4WJ4 A;  4K14 A;  1Q3L A;  4DAM A;  1HXY D;  3CU7 A;  3CME A;  2UU9 Q;  4QCL A;  3TOA A;  1YHQ A;  1TU2 B;  1GKH A;  3HZX A;  5FK9 C;  1RTN A;  1KXL A;  2I46 A;  1TKW B;  3K80 C;  2A20 A;  2YU9 B;  3PSI A;  2ODD A;  1NUC A;  1NSN S;  2XRS D;  4CDF C;  5BR8 L;  4QGU A;  5J8C A;  2ID0 A;  3D4D A;  2ERW A;  2F3W A;  1OO9 B;  1TVX A;  2R93 G;  5C4X B;  2RCN A;  2CH4 W;  4F88 A;  1JOQ A;  4GOP A;  4DAP A;  2LFN A;  3FVV A;  5ISR A;  3OTO Q;  4RA8 A;  4MN3 A;  4BXX G;  1JQY D;  4AQY L;  1VQ7 A;  4JI4 Q;  2MP1 A;  1NXU A;  5KYI A;  4HIO A;  1O7Z A;  4JBW A;  1G29 1;  5HI7 A;  2RHQ B;  1HRJ A;  4UPA A;  2GA4 B;  2JA8 H;  2GN5 A;  2H1E A;  2R3Z A;  2F52 A;  5M3F B;  4A3J G;  2K9H A;  1SDF A;  2A19 A;  3F1Z A;  2DUD A;  5M5Y H;  1HPT A;  1PTO H;  1STB A;  1QUQ A;  4GLV B;  4LF4 Q;  1PJU A;  3RZD H;  3H6M A;  1KRT A;  1UE6 A;  1EIG A;  5IT9 L;  5D3D A;  5COR A;  1KDA A;  2MO0 A;  4V19 0;  2NZH A;  2PQ8 A;  4B9W A;  3M4Y A;  4XQJ A;  4OIJ A;  4OO1 I;  3D4R A;  3OYY A;  4NXN L;  1K83 B;  1LT3 D;  4PNY A;  4LFA Q;  3TP8 A;  3NEN A;  4Z9C B;  2F0T A;  5EJW A;  3Q6S A;  5ELC A;  2F1M A;  1HNZ Q;  1PZI D;  1ENC A;  3MHB A;  1TBN A;  4J6H A;  1KLG D;  3MFY A;  4A3C G;  5CR3 A;  1I50 B;  5KIX A;  3OXL A;  1IBK Q;  4L6T B;  2YTV A;  3E2I A;  2IHF A;  3CQZ B;  4NV5 A;  4QIW E;  2RDH A;  3M7N A;  3U4V A;  3HKZ E;  1E1O A;  4GKJ Q;  4KK7 A;  5I9P A;  4XT1 B;  4A3G G;  1SNQ A;  3PIP 3;  3L2P A;  2FMC A;  3K6O A;  4QY7 A;  1D6E C;  3GP7 A;  4HIK A;  4IOC A;  1OTC A;  1VMC A;  4ME3 A;  4A3F B;  3CXL A;  5IGE A;  1NMF A;  2JZM A;  4DR4 L;  3KOJ A;  3R5D A;  4RG1 A;  3KP9 A;  5I2Y A;  2RSO A;  3NHH A;  2NVQ B;  4O1N A;  1HPC A;  1N9W A;  4X66 L;  2B2T A;  4TQU S;  4X64 Q;  2UXD L;  3GTJ B;  2BUS A;  3FSY A;  2J0T D;  4QF4 A;  3R2T A;  2K5H A;  3SGQ I;  2A68 C;  1Q8K A;  2NVX H;  2B8T A;  2JA6 B;  4DN4 M;  3T4A C;  4O0A A;  4RKB A;  1STY A;  1KDC A;  1SE2 A;  3PMF A;  4DF7 A;  4RGM A;  4L5S A;  1TBO A;  1K8O A;  2VQE L;  1SYD A;  3BZC A;  2JA5 B;  3OMC A;  4XYO A;  1ROD A;  4QUF A;  3F2C A;  4TSS A;  5GAG C;  3Q22 A;  2J4X A;  5D65 A;  2BE5 C;  1N32 L;  2UUB L;  1E22 A;  2V1C C;  1IW4 A;  5EKI A;  4R4C A;  4GKK L;  5C4X H;  1JJG A;  1N33 Q;  1C7Y A;  4K5X A;  4OAV B;  4K5W A;  2EYO A;  2ZXO A;  5IT9 c;  2X52 A;  5HY6 A;  2KHJ A;  1ZEQ X;  1MJE A;  2KCC A;  3R93 A;  3T1Y L;  2R7Z B;  3JSB A;  5C3E B;  3I55 A;  3I56 A;  4A75 A;  2B2V C;  1ENA A;  2N55 A;  3H0G G;  5DEH A;  4HN7 A;  2X3T A;  4IPC A;  2A69 C;  1F2Y A;  2ZJQ A;  2QQC A;  1LAC A;  4OEM B;  2RIJ A;  2Z4H A;  2SOB A;  5A2Q L;  1SGP I;  2PNH A;  1UUC A;  2X6G A;  1DOL A;  1YU6 C;  3FSX A;  1E2V A;  1PZK D;  2QGM A;  4J15 A;  1FYB A;  1SJ8 A;  1TWG H;  2M2L A;  2SDF A;  1GXD C;  2B63 G;  2EIF A;  3TO6 A;  4PMB A;  4DV0 Q;  3AMU A;  2GSC A;  4L63 B;  2XRQ D;  1X65 A;  1IL8 A;  1D5Z C;  1TWH H;  2RDF A;  3A5Z B;  4X3T A;  2JN4 A;  4DR2 L;  4QMG A;  2L12 A;  4JC0 A;  4AS3 A;  2EJM A;  4JOI A;  1D7Q A;  2RSN A;  4K5V A;  3CCV A;  5CYU A;  2MNA A;  1CSO I;  3KDF B;  1PVO A;  3LJ1 A;  1OVO A;  2ICE C;  3VYT A;  2UUA Q;  2LY7 A;  1YNN D;  1RFH A;  2NN6 I;  5EX3 A;  1K83 H;  3OIP A;  4FF2 A;  2NUC A;  2R92 G;  4A4I A;  2ZT9 C;  2J7Z A;  1O7Y A;  1QG7 A;  4K8J A;  2L0C A;  2E75 C;  3I73 A;  3OW7 A;  4YCW A;  4NXM Q;  3NQT A;  1TWA B;  1I4R A;  1FNV A;  4XT3 B;  2PW7 A;  5KNC A;  3KK7 A;  1YI2 A;  4ULL A;  1AFP A;  3RN2 A;  1U9R A;  1QZG A;  1VQ6 A;  4BWG B;  2NU4 I;  3KJO A;  4V0B A;  1KMA A;  1NTG A;  4JV5 L;  3K57 A;  5FKA C;  2QW7 A;  4JI6 Q;  1V1Q A;  4UP9 A;  4SGB I;  2SGQ I;  1PZJ D;  1OYV I;  2FU2 A;  2Y0S E;  1IBK L;  1KIX A;  9WGA A;  1KAA A;  4KHP Q;  3T1H L;  2IW3 A;  4A3I G;  3I8Z A;  1JCK B;  1EY8 A;  4YWL A;  3KFU A;  5IGB A;  1I4G A;  1HNZ L;  1GVP A;  3I3C A;  4KMU C;  4RGT A;  1U4L A;  1TT2 A;  3OXF A;  3KUP A;  4CJ0 B;  1HDL A;  2MJ8 A;  3A0J A;  4X3U A;  4YZD A;  5CV4 A;  1ESR A;  2VB2 X;  3K5O A;  1PRT F;  2WAQ B;  1UE7 A;  2EY6 A;  2KCN A;  3NBH A;  4UY8 C;  2OT2 A;  2CFM A;  3VYS A;  1VCI A;  1PFM A;  3KF6 B;  2L5T A;  4HCE A;  3T56 B;  2Z6K A;  1UVG A;  1Y1C A;  5IYB H;  1IBM L;  2NU2 I;  1HZB A;  4YWK A;  2Z8L A;  5JPN C;  1E2W A;  1LT6 D;  3OWF A;  4DV1 L;  4ZAI A;  1SFO H;  3HKZ G;  4A93 G;  1KBE A;  4C3H B;  1B44 D;  2SNS A;  1SN8 A;  1Z47 A;  2XSC A;  2XVS A;  3HKZ B;  4A93 B;  1KDB A;  4HFV A;  1QE6 A;  5AFW A;  1FAQ A;  1V1H A;  2VZA A;  2LMC B;  1OMU A;  3VA5 A;  1SYF A;  3MVV A;  3M4P A;  5EPL A;  3B6Y A;  1DS2 I;  5E3R A;  2NYZ D;  3OTO L;  3KF6 A;  3SK6 A;  1BBW A;  2L55 A;  5DM6 3;  3HOV B;  4U68 A;  3F8T A;  1PV4 A;  3DM1 A;  1KC8 C;  5E3F A;  1LT5 D;  4P73 A;  4K2L A;  3I4N H;  1K8G A;  5IYB G;  3GTP H;  4IPD A;  3E5S A;  5C0X I;  4YWM A;  2PZT A;  4ZK9 B;  2JA6 G;  1BNZ A;  1SYE A;  2F3C I;  2CWP A;  3KF8 B;  4FO2 A;  2NVT B;  5EPJ A;  2BH8 A;  3BYT B;  4KI0 A;  1GO3 E;  2B2W A;  1KBF A;  1J6Q A;  1NCV A;  4O2D A;  3MAQ A;  4ZUJ A;  1XWE A;  2BDN A;  1ESF A;  4J8Q A;  5FJ8 H;  4DXG A;  1EU3 A;  3R8B A;  4I65 A;  1P16 A;  3SK8 A;  3DWQ A;  3SDJ A;  4N8F A;  4HGU A;  2K4K A;  5IGG A;  1K3R A;  4HR7 B;  4A3I H;  2JA7 G;  3ONA B;  1BQQ T;  1WKX A;  3UIT A;  4A3E H;  3I72 A;  5KRU A;  1A6X A;  3DEO A;  1HZ9 A;  4HMI A;  4H13 C;  5CCM A;  1E1T A;  4DU9 A;  4MNO A;  1II3 A;  2GKR I;  2A73 B;  5KNB A;  4JOI C;  3DHQ A;  4DK6 C;  2OF1 A;  4IPH A;  1F2Z A;  1SLJ A;  4OVO A;  2CW0 D;  4N9T A;  3MEF A;  5FO9 B;  3GTG B;  1HCZ A;  2N71 A;  2JA7 H;  4KY6 A;  4DNT B;  1C0A A;  2L4N A;  1M8A A;  5FLM H;  4ZQ3 A;  1BCP B;  3CC4 A;  5IYD H;  1VQO A;  4IO9 A;  5JJZ A;  5JVG 3;  3JAM E;  5GAE C;  4LAA A;  2EJG C;  3GTQ B;  3I91 A;  3QWP A;  2PZW A;  4OHJ A;  1WD1 A;  1Y14 B;  2F0P A;  1SGD I;  1HA5 A;  2IL8 A;  1XNR Q;  1X3F A;  2WII B;  1VDD A;  3HOZ G;  3QG1 A;  5C3E H;  2E2D C;  4CKE A;  3ICE A;  2A2D A;  2E2H B;  2MGS A;  1E0B A;  4PZ7 A;  1RL2 A;  2SGF I;  4AML A;  5EKK A;  1QVC A;  3AQQ A;  3BDC A;  4I1T A;  3HG9 A;  2B63 H;  1D2B A;  1JOR A;  1D8L A;  1STG A;  4R4T A;  3DA4 A;  2Q8T A;  5C0X J;  1Z9F A;  3D6W A;  4WJW A;  1HHV A;  3BYY B;  1YJW A;  1CA6 A;  3VYR A;  4TVA B;  4JYA Q;  2EYL A;  2HCI A;  1YTP A;  4A24 A;  1DON A;  2HHH Q;  4OEL B;  4K2K A;  4IZ8 A;  2F0Q A;  2R93 H;  3TP7 A;  1KL9 A;  1QVG A;  1CZW A;  2XN9 C;  1PH6 A;  1S40 A;  3PUW A;  2A6H C;  1YNJ C;  2CVR A;  2IPK D;  2YTX A;  1R0R I;  3X3M A;  2KVM A;  2PQA A;  2K19 A;  4C3H G;  2EDG A;  2K5N A;  2RC4 A;  1K0R A;  3A8J E;  4R8N A;  3CKI B;  4A3L H;  5GAH C;  3SR1 A;  4RKL A;  1GHK A;  2EE1 A;  5IP9 G;  5M9O A;  3L7Z C;  1I4H A;  4M1U B;  1N34 L;  2IT1 A;  1Y1W G;  1C8C A;  2Y0M A;  3HGB A;  1SR3 A;  2QZG A;  3GTP B;  4P2C B;  1Y1V B;  3PF5 A;  1N33 L;  1Q12 A;  1ET6 A;  2SGP I;  2F0M A;  4P72 A;  3L0O A;  3PO2 H;  2PQA B;  4QB4 A;  1STH A;  2K05 A;  2BCO A;  1G6P A;  2HQE A;  2NN6 G;  1EL0 A;  1CHQ D;  2NTT A;  4G57 A;  1ASZ A;  1ULN A;  4WJ3 M;  3FEW X;  3AB9 A;  4DR7 Q;  1LYL A;  1RIP A;  2NVQ H;  3ER0 A;  2N3S A;  2V6E A;  2PZU A;  1RKN A;  3ND8 A;  4NKL A;  2JA1 A;  4OAU C;  3RMH A;  1VDZ A;  4AS2 A;  4B3R L;  4RCN A;  3EQL C;  4CJ2 C;  4DV3 L;  4C56 C;  1R9T H;  5K36 G;  1V9P A;  4DV6 Q;  1IBL Q;  1Q9B A;  4DFA A;  3P20 A;  1QVF A;  3TEH B;  1H9J A;  2WIN B;  3NUC A;  4BBR B;  4UP8 A;  5C4H A;  4R8I A;  1GUT A;  4A3B G;  2JEB I;  4PMW A;  1KNE A;  3RD4 A;  3NPP A;  2QSB A;  2LEO A;  3I4O A;  3VE5 A;  1HR0 L;  2CW0 C;  2L11 A;  3GQB A;  4Q0F A;  3P23 A;  4A3D H;  3F2D A;  4QQB X;  2JA7 B;  2J87 A;  1CKO A;  1D5M C;  1WTW A;  4OL7 A;  3HOY B;  3E0E A;  3NP8 A;  2DN8 A;  5EX0 A;  1H9K A;  3CF5 A;  2RQX A;  3TS2 A;  4PV1 C;  2ZJP A;  4JI6 L;  1LO5 D;  2BL7 A;  4PL4 A;  1YJN A;  3NSW A;  3S1N H;  3NE5 B;  3S1N B;  3C3L A;  1DD2 A;  1WGC A;  2ETD A;  2NU3 I;  1X9N A;  4HMJ A;  3QAH A;  4GOP C;  2CJS C;  5CMD A;  3CD6 A;  3A54 A;  2VRW B;  2DGY A;  1OXS C;  2GKV A;  2CQO A;  4HED A;  5ELE A;  3HOW H;  2ES2 A;  4GN5 A;  5HUR A;  2FFK B;  2KUM A;  4POF A;  3O13 A;  5M5W B;  1Q46 A;  3H0G H;  1FGU A;  1ICF B;  1O7L A;  2BDO A;  3GV3 A;  3CCM A;  3S1R H;  3CCL A;  3CCQ A;  2I5M X;  3TOB A;  4KN7 C;  1P8L A;  1MI2 A;  1BCP D;  4WFN 3;  1C4Q A;  1FNW A;  4A3L G;  5FLX E;  4BXX H;  1Y1B A;  3CC2 A;  4GNX C;  5IWA Q;  3FKI B;  3UDG A;  4PZ6 A;  2A69 D;  3A56 A;  4UXI A;  4X3K A;  3ITP A;  3K58 A;  2PQE A;  5CV9 A;  1ET9 A;  1I3Q B;  1EWH A;  4LF5 L;  4DV4 L;  2K5W A;  2O5J C;  1H9R A;  2PI2 E;  3SDZ A;  4G76 A;  4Q5V A;  3NXW A;  1LTS D;  2A6E D;  4JI8 L;  1DOM A;  4OWX B;  3TZU A;  5JEA G;  2DJG C;  2Q2H A;  1PH3 A;  4P71 A;  4O1O A;  4LF8 Q;  1SGY I;  4GZY C;  1FD7 D;  4MTK A;  5J1Z A;  3KLS A;  1SE8 A;  4BY7 H;  2MHV A;  1B3Q A;  1ZYR D;  1UAP A;  1TS2 A;  2HQL A;  2N78 A;  4A3D B;  3E3X A;  3KLR A;  1EYA A;  1NMG A;  5BR8 Q;  5EBC A;  4DV6 L;  1IBL L;  1CSP A;  4QUC A;  3DWA A;  2R61 A;  3BU2 A;  4IFD G;  3GTL H;  3TQY A;  1A3U A;  3EFX D;  1JR0 D;  3HOZ H;  1LV9 A;  2OEO A;  3E9H A;  2WGC A;  3WDN A;  1AN1 I;  2OZU A;  4A3D G;  2V53 A;  4FF4 A;  2WB1 E;  5ELD A;  5LMN W;  1XYI A;  4ALP A;  2KEC A;  5KEE A;  5IYD G;  5J22 A;  2EJF C;  3UDI A;  1AE3 A;  2DNC A;  2IJ0 A;  1LTT D;  4MTN A;  2UXC L;  1ILQ A;  5K5P A;  1W2B A;  5K36 H;  1LR9 A;  2A2C A;  2C35 B;  4AYB G;  5LMU L;  3HOX B;  2JAE A;  1UNS A;  2F0F A;  2MPM A;  1CGJ I;  5JJI A;  1UEA B;  3LJ0 A;  1Y8P B;  2PPB C;  1Y69 U;  4QJF A;  1SAP A;  2VXW A;  1PTR A;  2HUG A;  2F4V L;  3FBV A;  3V96 A;  2ENN A;  3G6J B;  2OWO A;  1PH9 A;  3U58 A;  1VQI A;  3A74 A;  4C2M B;  2P22 B;  2FUG 1;  4C2M H;  2OTJ A;  2ZTE A;  3FDT A;  3MWY W;  3DUZ A;  3J81 c;  1EFI D;  4ZRZ A;  3JAM L;  4IFD I;  2A8V A;  1EIY B;  4XXE A;  2EYP A;  1XX6 A;  2YUU A;  2K5Q A;  1B3A A;  4JI2 L;  4YCU A;  4CJ1 B;  1K3B C;  1CQV A;  4X65 Q;  3GTL B;  3MXP A;  2E5L Q;  4M8A A;  1YBY A;  1VQC A;  3GTK B;  2BA1 A;  2B2Y C;  5LNK 1;  4HJ7 A;  2JA8 G;  4K6D A;  1PMR A;  4RFB A;  1K8A C;  5IWA L;  3J80 L;  1UE1 A;  1CE3 A;  4NXM L;  2VQE Q;  1JJ2 A;  1DZ1 A;  3A8K E;  1F9S A;  3OW2 A;  3RZD B;  4EQP A;  2B29 A;  2KMR A;  1BCP C;  3S1R B;  1LTA D;  1CT2 I;  3H0G B;  4OIK A;  1PHJ A;  3LGJ A;  4ABN A;  1VF7 A;  1XX8 A;  1BXT A;  1PTO C;  4BA1 I;  3I4N G;  4PL3 A;  2UUA L;  4KD4 A;  4K8I A;  5M3M B;  1VQ5 A;  1QWY A;  2F0I A;  2QKI C;  5DM7 3;  2F0O A;  2F03 A;  2SGD I;  3D6C A;  1S5B D;  2I0Q A;  1UUP A;  3J81 L;  4XYQ A;  3K5L A;  4LUZ A;  3T16 A;  1KLU D;  1FGB D;  3I4M B;  1VMP A;  1GUS A;  1T5X D;  2PNR C;  5F2D A;  1IKL A;  1XXG A;  3HKS A;  3TS0 A;  3CQZ H;  3STB D;  3PO3 B;  1IXR A;  2JYY A;  1B50 A;  2C5C A;  2H4O A;  3S17 H;  2IX0 A;  4A3K H;  2E76 C;  2F0V A;  4KD3 A;  4QL5 A;  1EYC A;  1A15 A;  4C3I H;  3T1Y Q;  3HOU B;  4MPI A;  2JA9 A;  1V1P B;  3RUZ A;  3G71 A;  2GVA A;  1J8I A;  1EQR A;  1G2T A;  1GUG A;  1JE4 A;  4FVM A;  3J81 E;  4NV2 A;  1K8M A;  3TO7 A;  1EEI D;  2CWH A;  1PH2 A;  4YZC A;  4B3T L;  1VQD A;  1KNA A;  1TGS I;  5FO8 B;  3SE0 A;  3I90 A;  2F6M B;  3OOC A;  1U4P A;  2CKZ B;  3SK4 A;  4JK1 C;  1N8R C;  4QIW B;  5BN3 A;  2N52 A;  2Q8I B;  1RD9 D;  4E1R A;  3NEM A;  1SMX A;  4JI5 L;  4HTH A;  3KLW A;  4POG A;  1VF5 C;  1NUB A;  3K81 C;  2QCP X;  4RH6 A;  4RCO A;  2Z4I A;  3R5C A;  2NVX B;  3GD7 A;  1DYQ A;  2E2H H;  4DR2 Q;  2XWB B;  1XBT A;  4DPG A;  2WB1 B;  1STA A;  3C46 A;  4FF1 A;  1A2U A;  5IOD A;  4BBR G;  3EA6 A;  1EYG A;  2AUK A;  3FPP A;  1FYC A;  4LFB Q;  2QF7 A;  1IKM A;  1I5F A;  1R9T B;  1EY0 A;  4X66 Q;  5C5M A;  2WFW A;  2AMC B;  1CA5 A;  4CHT B;  3DLL A;  4B3M L;  1TOT A;  2Q2I A;  4DUY L;  3S17 B;  4C1N K;  1S4Z A;  1B4O A;  2FJ2 A;  4FKD A;  2E73 A;  4JI4 L;  3IFD A;  1F77 A;  5I6W A;  1L0X B;  3IKJ A;  1UVF A;  4EVO A;  3GOX A;  4ID6 A;  1VQM A;  2RDG A;  1L0W A;  2NN6 H;  5H1S E;  2PCF B;  2L9H A;  5E3P A;  2BE5 D;  2EVB A;  1KAB A;  3FVQ A;  1SNC A;  5LL6 X;  4B9X A;  2E74 C;  4MHE A;  3PIO 3;  1VQB A;  1PH4 A;  1HNW L;  4PL5 A;  2UXB L;  1TWF B;  2XNA C;  3IAM 1;  3QOL A;  4PQX A;  1TIH A;  3KF8 A;  2K50 A;  2ZW3 A;  1IW7 D;  3KDF A;  3GTO H;  2B2W C;  1TWH B;  5EKL A;  3SXH A;  5M5W H;  1PYS B;  5LMN L;  3NWS A;  3MZ5 A;  3KBG A;  3DMU A;  3J7Y W;  4IUN A;  4C3H H;  2EZV A;  3PGZ A;  1WI5 A;  3HOV G;  5FUW A;  1A0I A;  3CPW A;  2LKV A;  2Z6B A;  2VUM B;  4HJ9 A;  4DV7 Q;  2M5X A;  5JHW C;  3UGL A;  3LWE A;  4LW1 A;  3PUZ A;  1PPF I;  1HZC A;  2QA4 A;  1QOH A;  1SYG A;  1Y8O B;  4B3S Q;  3HOV H;  2ATW A;  5HQ8 A;  2DY7 A;  3EN2 A;  3A55 A;  1QNU A;  2F3V A;  3D31 A;  3NK9 A;  3RU0 A;  1NE3 A;  1G8Z D;  2ZM6 Q;  1E7Z A;  1Z6H A;  4DR1 L;  2AQ1 B;  5A2Q E;  5COY A;  2RVL A;  4DV5 Q;  2HDL A;  3K7U C;  1HUM A;  3U4Z A;  2JSO A;  4DAY B;  1DS3 I;  3RR5 A;  3S2D B;  1JC7 A;  4DK1 A;  4AQY Q;  4NP5 A;  1WTJ A;  2VQF L;  3AJF A;  1JOO A;  5D3I B;  3NEL A;  2G9D A;  4LFC Q;  3S1M B;  3D4W A;  2QPO A;  1B70 B;  1CHO I;  2YYZ A;  1VQ9 A;  4B3S L;  2F0D A;  1EWI A;  4CDE C;  3GV6 A;  4IUP A;  5I2X A;  1EY6 A;  4IUR A;  4JI7 L;  4KY5 A;  2F4V Q;  1M8C A;  5IOC A;  2BA0 A;  3KBX A;  1U4M A;  3M7G A;  4UAI A;  5CV6 A;  5G3L F;  5KGU A;  3E6Z X;  4A3F G;  4UHV A;  3VDP A;  4A3G B;  5IP7 G;  1HFN A;  2IP6 A;  1BO0 A;  1V8Q A;  1RTO A;  3N52 A;  1CI3 M;  2H5X A;  5FLX L;  4IN3 A;  3RLO A;  4A3J B;  2KHS A;  3GTK H;  3HOU G;  4L5Q A;  3UDF A;  2KHI A;  5M3F H;  1JQO A;  4JG2 A;  1NAP A;  2QGQ A;  2ASB A;  2ENB A;  4DUZ Q;  3VA9 A;  3HP3 A;  2AKW B;  1MKH A;  1Q7Y C;  1I4P A;  3S14 B;  1BBX C;  4JI5 Q;  2A74 C;  2NU0 I;  2YFA A;  2JA5 H;  3FMC A;  1H9S A;  1Z2I A;  4FNF A;  3DXJ C;  4KHV A;  4DK3 C;  2JW6 A;  2BOS A;  2XTR A;  1GHJ A;  2B2V A;  1EWC A;  1XTD A;  2EQS A;  1OXX K;  3P7J A;  3QTL D;  3CHB D;  4A3E G;  1SGR I;  2PMZ E;  5E4W C;  3NBH B;  4DAV A;  1EZ6 A;  1QNK A;  1I94 Q;  3PV0 A;  1OXV A;  5J39 A;  1GD7 A;  1WOC A;  2JA5 G;  1WTV A;  1B53 A;  1WD0 A;  1RHP A;  1JT8 A;  2RIO A;  1I6V C;  2VQF Q;  4DNI A;  3K5N A;  3CPF A;  2KOL A;  3VYU A;  5IIF A;  2FEF A;  2DB6 A;  2SGE I;  3G4S A;  2WKC A;  1OXT A;  2NVY H;  1JJC B;  1I6H B;  1ICW A;  1IYU A;  1TUS A;  1V1I A;  4RHS A;  2ZM6 L;  2F0W A;  4IJL A;  2JA6 H;  4LF5 Q;  4C3I B;  3HOU H;  1PTO B;  4H02 A;  4EX5 A;  5JAV A;  1KHI A;  2AUJ D;  4KTA A;  2D5D A;  4G7H C;  4KV6 A;  3TP6 A;  1FAR A;  2L8E A;  2D2C C;  1YHA A;  4IOA A;  1PXU A;  3W5O A;  2DNE A;  2O4X A;  1MJB A;  3R2I A;  3CCS A;  2VL6 A;  5C4X G;  1SFO B;  4JYA L;  2K01 A;  1VQJ A;  1SRO A;  3SK5 A;  1L1O B;  1BBU A;  2SEB D;  5L37 A;  4BA2 I;  2L7X A;  5IT9 E;  2QQ0 A;  1STE A;  3CCE A;  1G2S A;  4WOR A;  2VB3 X;  2L1B A;  2B2U A;  3CAM A;  4LMQ D;  4B08 A;  2RLD A;  1RF2 D;  3MXG A;  4XDX A;  1F9R A;  1OMT A;  1P9G A;  2UXB Q;  1I50 H;  1OXU A;  1LTB D;  4ZKB B;  1WJJ A;  1XNQ Q;  3K59 A;  2YQP A;  3M4O B;  1FVI A;  4DNC A;  4IJH A;  2ORV A;  1PYB A;  3G6E A;  3F4M A;  5G3L D;  5DAU A;  3FP9 A;  1R4P B;  3JC6 6;  3M85 A;  3J80 c;  5M5Y B;  1E3P A;  2B2Y A;  2K28 A;  2KMP A;  5ELO A;  2CWA A;  2M00 A;  5ELN A;  4LF9 L;  5JEA J;  2WP8 J;  3TME A;  4JBM A;  3SVM A;  2Z9H A;  3E0J A;  5M3M G;  4BS9 A;  1PRT D;  1U0L A;  3H15 A;  1H0Z A;  1B1Z A;  5M5X H;  2B8G A;  3TP5 A;  1WTR A;  4OO1 G;  2Z0S A;  3G48 A;  4Y7N B;  1SE4 A;  4LF6 Q;  3R3O A;  4A3G H;  4R9W A;  4AH6 A;  3QJY A;  2K14 A;  2F66 B;  1VQN A;  3NQI A;  2AWO A;  3GTJ H;  4LFB L;  2KEN A;  3E9I A;  1HJP A;  1RJT A;  2QIL A;  2KED A;  3SEB A;  1TWC B;  3MXN A;  2JB3 A;  5LMN Q;  1U4R A;  3PUY A;  2EXZ A;  1F9P A;  2D62 A;  4IUU A;  2KCT A;  4BY1 G;  1PFN A;  2XMX A;  2OVO A;  2Z6K C;  3BJU A;  1N13 A;  1PFS A;  1HNW Q;  3T51 B;  1A62 A;  1CUK A;  2P6A C;  3I4M G;  3TJQ A;  4F87 A;  1PA6 A;  2ZTD A;  5I9O A;  4BBS G;  1BMO A;  1QZH A;  3PDN A;  3AEV A;  3MC0 B;  1VQ8 A;  3FKI G;  1JWU D;  3KY9 A;  1YIT A;  4G4K A;  4S3S A;  4DR3 Q;  4HJ8 A;  4IFD H;  1S5C D;  2NBF A;  4G75 A;  1LAB A;  2B0U C;  1VS0 A;  4ME5 A;  3TRE A;  3UGI A;  4KKT A;  2HD3 A;  4KN4 C;  2LXK A;  4DR5 Q;  3OSO A;  5BN5 A;  2WB1 G;  2F0H A;  2NVY B;  2LUY A;  3UE0 A;  2RBM A;  2K33 A;  4YHH L;  2NVT H;  1IY6 A;  3C2P A;  1TDP A;  4KKS A;  5LMU Q;  3QO2 A;  2ELI A;  2D0O A;  2N1A B;  4HAE A;  3LNN A;  3BZD B;  2WCY A;  2PI2 A;  3K5M A;  2HHH L;  5E7N A;  1P9Z A;  3BJI A;  3PUV A;  1IBM Q;  2K7V A;  3SEK C;  4RGN A;  5EGT A;  4KLK A;  4GOP B;  2YFB A;  2B2U C;  2XIW A;  4GNX A;  1XPO A;  3OIQ A;  3HRZ C;  2GVI A;  4UXH A;  1CFM A;  5CV8 A;  1TWC H;  4DR4 Q;  4P74 A;  3T53 B;  4JI0 L;  2K5V A;  2F3I A;  1PCE A;  2CQA A;  2AHO B;  3PCO B;  2PMZ B;  1YNN C;  4LFC L;  4LF9 Q;  3FC3 A;  2Y0S G;  2MJF B;  3M4O H;  1EIH A;  1H9M A;  1TS3 A;  5GRO A;  5GAD C;  2X69 A;  2KEE A;  2E5R A;  3KYH C;  3T1H Q;  1LTL A;  1CKN B;  4X62 Q;  1SBB B;  4NMZ A;  5IYC H;  1WVL A;  3K7A H;  3OL0 A;  1GM5 A;  2G5D A;  1DCZ A;  2JE6 I;  4OGQ C;  4K0K L;  1WFQ A;  1ZYR C;  4ZYS A;  1HR0 Q;  5TSS A;  1SGN I;  1VQA A;  1W6J A;  3NWT A;  1HFG A;  1TS5 A;  2KMQ A;  4YY3 L;  3I4L A;  4Y52 H;  5C44 H;  4EQO A;  4F8M A;  3T13 A;  2ALY B;  2RA4 A;  4G7O C;  1Z7T A;  3MA2 B;  1PLF A;  1I4X A;  2JA8 B;  4HCS A;  1HTP A;  3HEJ A;  1VQ4 A;  1EU4 A;  2TSS A;  1VQG A;  1CKN A;  2R7Z G;  4LF4 L;  1X4S A;  2NZO A;  2XTI A;  3MXU A;  5C0X G;  1Q90 A;  4DR6 L;  1B2T A;  1WCM B;  3V2T A;  4A3C H;  1PDQ A;  1EYD A;  4IUV A;  2JQO A;  2VNU D;  5IGC A;  2M9V A;  4HID A;  4A3M G;  5LL6 S;  3PIP A;  2VUM G;  1MSG A;  2DY8 A;  3IL8 A;  2E5L L;  1WCM G;  1X6O A;  3M3Y H;  1SNP A;  4U6R A;  1LT4 D;  1DGS A;  1A3T A;  1QIL A;  5FO7 B;  4A3M B;  2CWF A;  3UFF A;  4A3M H;  2O5I C;  3FNB A;  3CMA A;  1HR0 W;  1K7T A;  2HGK A;  3TO9 A;  4HJ5 A;  4LF8 L;  2PYK A;  3I4N B;  4R4O A;  4BY7 B;  1O80 A;  4NB3 A;  2F0G A;  3IAS 1;  1WGT A;  1CZG A;  1Q82 C;  3S2D H;  5FOB B;  4AIM A;  2NWG A;  1A63 A;  1K28 A;  4B3M Q;  2B8F A;  2WAQ G;  4TKO B;  3DO9 A;  5IP9 H;  4N9P A;  2D9U A;  3AFQ A;  1YO7 A;  4A76 A;  1N32 Q;  4G7Z C;  2J9R A;  1UEB A;  2EYM A;  3HOZ B;  1LTI D;  2IHE A;  4DV1 Q;  1KRS A;  3MXN B;  1EOV A;  1PYW D;  5JVH 3;  5M5X B;  1DOK A;  5AJ3 Q;  1X3G A;  5JJL A;  7WGA A;  5EAY A;  3UGD A;  1TR5 A;  1SRU A;  4ILW A;  3EJI A;  3K0Y A;  2AQ3 B;  2HIV A;  1L0Y B;  1IY5 A;  3QWN A;  2N49 A;  3CRL C;  4TRD A;  2B39 A;  2AWN A;  1TQO A;  3HH2 C;  2F0S A;  3F2U A;  4XQQ A;  5JEA H;  3E59 A;  3CW2 C;  4PG3 A;  2ROW A;  1EZ8 A;  3D8G A;  5FUX A;  3J7A V;  3JAM i;  1SYB A;  1VQK A;  4C1N I;  1Q81 C;  4R1J A;  5FUY A;  5ELF A;  3GTG H;  3EVQ A;  1N34 Q;  5CBA E;  1MBY A;  3D00 A;  3A7L A;  4MZ9 A;  4OXP A;  1Q1B A;  1F2L A;  2EYJ A;  3J81 j;  2MFI A;  3PIO A;  2R6G A;  3I70 A;  4CKC A;  3VR5 A;  4GLX A;  4JI8 Q;  3WWV A;  3PO2 B;  2QQD A;  1GUW A;  3FPU B;  1ULK A;  1SJH D;  1W4R A;  1PTO F;  1N36 L;  1JMC A;  1HJA I;  1WYD A;  3U9S A;  2F0K A;  2ZTC A;  3RZO H;  3HFZ B;  3I9V 1;  3RZO B;  3TBI B;  1PRT B;  1VQP A;  1FL0 A;  2K1B A;  4MIU A;  2XGT A;  1EOT A;  3IFT A;  5I6Y A;  1DJR D;  5FLM G;  5CV7 A;  5J8F A;  3SHL A;  5KYL A;  1IYJ B;  3HOY G;  2I5L X;  4U67 3;  2B63 B;  3N6R A;  1PH5 A;  4OX9 Q;  1VQL A;  5EBD A;  2JYO A;  2BH2 A;  3HOW G;  5C4Z A;  4LFA L;  4B3R Q;  1XTC D;  1U5K A;  4YIJ A;  4EQ5 A;  2PO4 A;  4GLA C;  2JEA I;  1XPU A;  4LUO A;  1EY7 A;  2OCE A;  4EQN A;  3CCJ A;  1EQQ A;  3FHW A;  4GS3 A;  5HGT A;  1JIC A;  3NBI A;  1WCM H;  4DV2 L;  4GNX B;  1BF4 A;  1MGS A;  1A3V A;  1T9H A;  4IFD J;  3HOX G;  1GUO A;  1B9N A;  5J3B A;  4DV0 L;  2ENZ A;  3UEY A;  3FRP B;  4C3J G;  1M1K C;  4R4Q A;  3A8I E;  3KLS X;  1AH9 A;  3Q0A A;  1N36 Q;  1HZA A;  1AEX A;  4F7X A;  5C0X H;  2XWJ B;  3M3Y B;  3BS1 A;  1YNJ D;  4K6L A;  5FJ8 G;  4Z7G A;  3PO3 H;  4R4I A;  4GN3 B;  1FY7 A;  3ZYY X;  4DKA C;  2K52 A;  4LJZ C;  5FUV A;  5BN4 A;  2EPB A;  1JE5 A;  3RNU A;  1TWF H;  2LSS A;  3BZK A;  3TDQ A;  1AP0 A;  2A6H D;  2EYF A;  3R5A A;  2QDL A;  4XQN A;  1FNU A;  4JPB W;  3VDU A;  2KMO A;  3DWP A;  4GKK Q;  4DNR B;  4HEA 1;  1BVS A;  3MEK A;  1Y8N B;  1SYC A;  4ODG A;  4CKB A;  2OD1 A;  2UUB Q;  2GKT I;  3H3V H;  5C3W A;  3UOE A;  1TBR R;  3C1E A;  4JCV E;  2LS0 1;  1D5X C;  2CHB D;  2K03 A;  3RLN A;  3M9B A;  4FP5 D;  1UHA A;  1EFW A;  1BOS A;  1X56 A;  4KJN A;  3J81 i;  1X54 A;  3PO2 G;  2UZ3 A;  1YVC A;  4PMC A;  1MIU A;  1NJI C;  2UUC L;  2R93 B;  1SSO A;  5IYC G;  3V05 A;  2KA7 A;  2R7D A;  4BBS B;  3ULP A;  4Y7N H;  1AZQ A;  4DUZ L;  3C1F A;  1X3E A;  1CSQ A;  5IY0 A;  3MFG A;  2E2I H;  1KTK A;  1VQE A;  2CAZ B;  1JWS D;  3DA3 A;  2N88 A;  3F2B A;  1K7V A;  1LR8 A;  1WTX A;  2XRC A;  4IAL A;  5E1F A;  2L15 A;  2JK8 A;  3LWU A;  4X64 L;  2UXD Q;  1BCP F;  3W2D A;  3PF4 A;  2DIP A;  1W3S A;  3J80 E;  1CT1 D;  2ICI A;  4ZKC B;  2B3G A;  1S5F D;  1EQT A;  3I7F A;  4AYB B;  1CTM A;  1H9S B;  5EPK A;  4JI1 L;  4FXK C;  2FNF X;  1LR7 A;  1D1K A;  1M8B A;  2QEJ C;  2ZXP A;  1J9O A;  4X3S A;  1V1O A;  2R92 B;  2WAQ E;  2EY2 A;  3H09 A;  5ELB A;  4IPG A;  5CGK A;  4X6A H;  3D0F A;  1SXT A;  2MO1 A;  2OXP A;  1R79 A;  3QR8 A;  1G91 A;  3L3O C;  2N8N A;  1R4Q B;  1PFB A;  3RN5 A;  2F4I A;  4DV4 Q;  1HA6 A;  2VS1 A;  2MQH A;  4HSV A;  4E6I A;  3D3R A;  2OQK A;  1HQM C;  2NU1 I;  2WVJ A;  2NZ1 D;  2KCX A;  4DR1 Q;  1K0S A;  4JVZ A;  1NR2 A;  4O1P A;  1YHB A;  1WTH A;  3STB C;  2K75 A;  1XMQ L;  5JOB A;  3ULJ A;  4JI0 Q;  3CXC A;  2ZXR A;  5C44 B;  1LLR D;  1X3Q A;  4Q9V A;  1AZP A;  3OPO A;  2DKV A;  2MUY A;  1S5E D;  3WOF A;  3R5B A;  4L5T A;  4N8X 1;  3W3A A;  2AQ2 B;  3S14 H;  5C3E G;  4NXN Q;  3GDE A;  4OON A;  2XTQ A;  2A1A A;  4FXG C;  3TRZ A;  1G6Z A;  2HIX A;  2QQE A;  4O42 A;  1S3O A;  2X6L A;  5E4X A;  4JW0 A;  3M4Q A;  1PH7 A;  1TII D;  2R92 H;  3OXG A;  1PH1 A;  1IW7 C;  1XNR L;  3VDY A;  1EY9 A;  5E3Q A;  1CKM A;  3TN2 A;  2QEX A;  4I7Z C;  3LX0 A;  2RCF A;  3J7A 5;  3A7A B;  1AW7 A;  1VQF A;  1WTQ A;  4BY1 H;  4BY1 B;  3ND9 A;  3IAY A;  1Y8F A;  1BKB A;  3H94 A;  4H0L C;  4KHZ A;  1CM9 A;  3HOX H;  2JB1 A;  4HIM A;  5LHY 1;  5DNF A;  3J7Z C;  1TXY A;  1SMY D;  3EBE A;  4BBR H;  1YNX A;  1CGI I;  1L1O C;  1MHW C;  4L8J A;  3HOW B;  4EGV A;  1Y1V H;  3IRB A;  5M3F G;  3VR6 A;  2DJF C;  3HOY H;  4KJO A;  2KBN A;  4L5R C;  4DV3 Q;  5M3M H;  3ERS X;  4RGO S;  2IWH A;  5IP7 H;  2F0E A;  4LUV A;  2HT1 A;  2NB0 A;  1LUZ A;  3S1Q H;  1E24 A;  2F0N A;  5HGQ A;  3S1Q B;  5JJK A;  1TY0 A;  1ENF A;  1F9Q A;  4DR6 Q;  4B6D A;  3CCR A;  1BUV T;  3CC7 A;  1AN8 A;  1TY2 A;  1PH8 A;  2E2I B;  4RMF A;  2F0U A;  1SND A;  1SMY C;  4A3K G;  1AE2 A;  2RF4 A;  1DXM A;  2CH4 A;  3NTH A;  4DK0 A;  4KKU A;  2WV6 D;  3J80 i;  4XIG S;  1K7U A;  1NY4 A;  1KD1 C;  2E8G A;  1RCV D;  5GQO A;  3VA7 A;  2E2J H;  1SGE I;  4PZ8 A;  2LXJ A;  4LK1 C;  1W6K A;  1ONL A;  4B3T Q;  2SNM A;  1LM0 A;  1SNM A;  4IUT A;  1JB7 A;  3S9W A;  1HNX L;  4AYB E;  3DEP A;  1T5E A;  1ILP A;  1HUN A;  4WP4 A;  3AYH B;  3P75 A;  4A93 H;  2LB7 A;  3X3N A;  1XA6 A;  3GTM H;  2ZJR A;  1CQF A;  1VQH A;  1SGQ I;  4L9M A;  1QB5 D;  2C9O A;  1Q86 C;  3BVM A;  5D14 A;  3GTQ H;  1ZKO A;  1UWV A;  1STN A;  4LF7 L;  1I6H H;  3OVO A;  1YJ9 A;  2ORW A;  1L1O A;  1XNQ L;  1PRT C;  5DAE A;  3L0I A;  4CGY B;  2F0L A;  1Y1W B;  2BL8 A;  1S20 A;  1Y1V G;  5NUC A;  3BDL A;  1NNX A;  1PTO D;  3BDO A;  1NR4 A;  2F0J A;  1B7Y B;  1XMO Q;  1QCB D;  3GTO B;  4JBK A;  1QUQ B;  3UDX A;  4DV7 L;  5EQ0 A;  1V1P A;  1PTQ A;  3S15 H;  1KQS A;  2E2J B;  1C48 A;  5A35 A;  1GUN A;  4E1P A;  3MEH A;  1B9M A;  2P5Z X;  1ML0 D;  2I07 B;  1IL2 A;  1GOZ A;  2WKD A;  3SGI A;  2YU9 H;  4C3J H;  4OX9 L;  5I4D A;  4C3J B;  2EOT A;  2HCC A;  3H3V I;  1EEF D;  2NTS A;  2PW5 A;  3URY A;  2K6A A;  4JBJ A;  3VR2 A;  2GVB A;  1QJO A;  3WOE A;  4CBV A;  1XMO L;  1K9M C;  3PQI A;  2ZRR A;  3ERO A;  1SJE D;  1HEV A;  4P75 A;  3VR4 A;  5CCL A;  2KQ3 A;  2RAD A;  4XTC S;  2K5D A;  4KY7 A;  1V43 A;  2HDM A;  5JPM C;  1NBW A;  4K0K Q;  3PUX A;  4A3E B;  1RDP D;  2D0P A;  1X32 A;  4KHP L;  1HTL D;  2OQ0 A;  4YHH Q;  2W0T A;  1SE3 A;  4LF7 Q;  1C9O A;  4LWC A;  4HSP A;  4DR5 L;  4FYD A;  5HGI A;  4NW2 A;  4JV5 Q;  5CBE E;  5C3X A;  4UDU C;  5T1G A;  2JXD A;  3B55 A;  2KCM A;  3H91 A;  4DWL A;  2KJX A;  1EY5 A;  4DR3 L; 
#chains in the Genus database with same CATH homology
 5IYB H;  1IBM L;  2NZO A;  2XTI A;  1HZB A;  3S1M H;  5C0X G;  3G71 A;  4DR6 L;  1X4S A;  4YWK A;  2GVA A;  4A3C H;  2R7F A;  3AFP A;  1EQR A;  4A3F H;  3W1B A;  4DV1 L;  2JQO A;  2VNU D;  5C4J H;  2RHS B;  4HID A;  4A3M G;  3HKZ G;  1SFO H;  1HNX Q;  3PIP A;  4A93 G;  1KBE A;  4NV2 A;  3RLF A;  2VUM G;  1SN8 A;  1PH2 A;  4YZC A;  1Z47 A;  4B3T L;  1VQD A;  1TGS I;  4HFV A;  3UEJ A;  2F6M B;  4Z7H A;  1V1H A;  2VZA A;  2CKZ B;  2N52 A;  1FAQ A;  1N8R C;  1MJC A;  1OMU A;  1FJG Q;  4E1R A;  1ASY A;  2E5L L;  1WCM G;  1X6O A;  3M4P A;  3B6Y A;  4YZ9 A;  1SMX A;  3NEM A;  1L2F A;  4U6R A;  4JI5 L;  3KLW A;  4POG A;  1DS2 I;  3OTO L;  1NUB A;  1DGS A;  3K81 C;  3KF6 A;  3GO5 A;  1BBW A;  3B4V C;  4DR7 L;  3UFF A;  4A3M H;  3CMA A;  3GD7 A;  1Q1E A;  1HR0 W;  2E2H H;  2UUC Q;  2UXC Q;  3F8T A;  4DR2 Q;  3CP0 A;  1PV4 A;  4DPG A;  4OWT B;  1KC8 C;  4BY7 G;  1XBT A;  4HJ5 A;  1TWA H;  4LF8 L;  1CKN A;  4P73 A;  1XJV A;  4R4O A;  4LNQ A;  3I4N H;  4BBR G;  1K8G A;  4NB3 A;  5IYB G;  1EYG A;  3IAS 1;  4IPD A;  3GTP H;  5C0X I;  4YWM A;  1Q82 C;  2Q2T A;  3S2D H;  4LFB Q;  2JA6 G;  1I5F A;  5DLQ E;  2CWP A;  4AIM A;  3ULL A;  3KF8 B;  2CCZ A;  4B3M Q;  4X66 Q;  2YV5 A;  2EXD A;  2WAQ G;  1A63 A;  2WFW A;  2AMC B;  3S24 A;  3DO9 A;  3DLL A;  4B3M L;  1FJG L;  1TOT A;  2Q2I A;  5IP9 H;  3AFQ A;  4DUY L;  1YO7 A;  2BH8 A;  4LF6 L;  4KI0 A;  4A76 A;  1GO3 E;  1N32 Q;  2J9R A;  1KBF A;  1J6Q A;  1UEB A;  4O2D A;  1EIF A;  4FKD A;  2E73 A;  5FLX c;  4JI4 L;  1G51 A;  2IHE A;  2YTY A;  4DV1 Q;  5FJ8 H;  1KRS A;  3MXN B;  1UVF A;  1EOV A;  1HH2 P;  3GOX A;  3K0X A;  3W1G A;  1P16 A;  5AJ3 Q;  1CT0 I;  1X3G A;  1VQM A;  4GI3 C;  5JJL A;  3SDJ A;  1UVG A;  4HGU A;  3S16 H;  2K4K A;  3PDN A;  1L0W A;  1I94 L;  2FXQ A;  1I3Q H;  1K3R A;  5EAY A;  4A3I H;  1SRU A;  2JA7 G;  3UGD A;  1MT1 A;  5H1S E;  3UIT A;  4A3E H;  1KAW A;  2HIV A;  3A5U A;  2VY3 A;  1HZ9 A;  1IY5 A;  5CCM A;  2N49 A;  1E1T A;  4NPS A;  4DV5 L;  4MNO A;  2GKR I;  2AWN A;  3U50 C;  3ZJY C;  3HH2 C;  4JOI C;  1VQB A;  4DK6 C;  1PH4 A;  4PL5 A;  1HNW L;  3CW2 C;  1X74 A;  4PG3 A;  3E59 A;  2UXB L;  2ROW A;  2UU9 L;  3IAM 1;  2IX1 A;  4IPH A;  5FUX A;  1SLJ A;  3JAM i;  1TIH A;  4OVO A;  2K50 A;  1VQK A;  4DV2 Q;  3MEF A;  1Q81 C;  4R1J A;  5FUY A;  3KDF A;  4JI3 Q;  1EUJ A;  3GTG H;  2N71 A;  3CCU A;  1A8V A;  1XPR A;  1N34 Q;  3GTO H;  3D00 A;  1J5E Q;  5M5W H;  4MZ9 A;  3DM3 A;  2JA7 H;  1PYS B;  1YEZ A;  4OXP A;  1Q1B A;  5LMN L;  3S2H H;  1TUR A;  2JB2 A;  3JAM c;  1C0A A;  3J81 j;  2MFI A;  3PIO A;  3PO3 G;  2R6G A;  4C3H H;  4GLX A;  1YZ6 A;  4JI8 Q;  4HJA A;  1S72 A;  3WWV A;  3PGZ A;  1WI5 A;  4APV A;  5FLM H;  3CC4 A;  3HOV G;  1A0I A;  5IYD H;  1VQO A;  2QQD A;  4IO9 A;  5FUW A;  3CPW A;  5GAE C;  2VUM H;  1W4R A;  4UP7 A;  3QWP A;  1X55 A;  4HJ9 A;  1N36 L;  1JMC A;  4DV7 Q;  1HJA I;  1WYD A;  2I5H A;  4YY3 Q;  2M5X A;  1Y14 B;  3FKI H;  1SGD I;  2ZTC A;  1J5E L;  1K73 C;  3RZO H;  3HFZ B;  3I9V 1;  1CT4 I;  1XNR Q;  1X3F A;  4JI3 L;  3UGL A;  4BBS H;  4LW1 A;  1VQP A;  1FL0 A;  3PUZ A;  4JI7 Q;  3HOZ G;  1VDD A;  1PPF I;  1HZC A;  5C3E H;  2XGT A;  3ICE A;  2A2D A;  3KJP A;  2QA4 A;  5FLM G;  4B3S Q;  2R7Z H;  2ATW A;  4PZ7 A;  3HOV H;  1RL2 A;  3EN2 A;  4A3B H;  1Z7K B;  2SGF I;  1IYJ B;  3D31 A;  1QVC A;  1XMQ Q;  3HOY G;  1NE3 A;  1UE5 A;  2I5L X;  3I2Z A;  1O7I A;  3AQQ A;  2ZM6 Q;  4I1T A;  1E7Z A;  2B63 H;  4DR1 L;  1PH5 A;  4DR7 Q;  2V1C A;  4OX9 Q;  3SGB I;  1VQL A;  5IE8 A;  2BH2 A;  3UE1 A;  4DV5 Q;  1D8L A;  3K7U C;  4R4T A;  3U4Z A;  3HOW G;  4GXT A;  4DAY B;  3DA4 A;  4LFA L;  4B3R Q;  3RR5 A;  1U5K A;  1DS3 I;  4EQ5 A;  4UXJ A;  4GKJ L;  4GLA C;  4GN4 B;  1Z9F A;  4X62 L;  5C0X J;  1XPU A;  4LUO A;  5C44 G;  4AQY Q;  2JEA I;  1YJW A;  1TBQ R;  2OCE A;  2VQF L;  3AJF A;  2OTL A;  3CCJ A;  4X65 L;  2KKM A;  3FHW A;  1EQQ A;  4GS3 A;  4JI2 Q;  3NEL A;  1WCM H;  4DV2 L;  4TVA B;  4GNX B;  4JYA Q;  1YTP A;  4LFC Q;  4A24 A;  5JHW C;  1BUS A;  2QPO A;  4FDB A;  2HHH Q;  1B70 B;  1T9H A;  2YYZ A;  3HOX G;  4IFD J;  1CHO I;  2ARP F;  1VQ9 A;  3EIV A;  5J3B A;  4B3S L;  4DV0 L;  2R93 H;  2ENZ A;  1EWI A;  3UEY A;  4JI7 L;  1KL9 A;  1QVG A;  2L1L B;  2F4V Q;  1M8C A;  4OWW B;  2BA0 A;  4JI1 Q;  2Q2U A;  3Q8D A;  1M1K C;  4R4Q A;  1PH6 A;  4A3F G;  1S40 A;  3PUW A;  4DUY Q;  1AH9 A;  1N36 Q;  1HZA A;  3I4M H;  3VDP A;  5IP7 G;  2YTX A;  1R0R I;  2IP6 A;  1IZ6 A;  1V1I A;  2H5X A;  3RLO A;  1M90 C;  5FJ8 G;  3GTK H;  2PQA A;  2K19 A;  4Z7G A;  2K5N A;  4A3J H;  4R4I A;  4YCV A;  1B8A A;  3HOU G;  3PO3 H;  4GN3 B;  1K0R A;  2JJQ A;  5AJ3 L;  4L5Q A;  3UDF A;  4DKA C;  4A3L H;  2KHI A;  2K52 A;  1Y1W H;  2N17 A;  5GAH C;  5M3F H;  4JG2 A;  1YIJ A;  5FUV A;  1JE5 A;  3RNU A;  1TWF H;  2LSS A;  2QGQ A;  3BZK A;  5IP9 G;  3L7Z C;  2VW9 A;  4DUZ Q;  1N34 L;  2ASB A;  2IT1 A;  1Y1W G;  3VA9 A;  3K8A A;  3LJ2 A;  1SR3 A;  1H95 A;  4WJ4 A;  2AKW B;  1MKH A;  3PF5 A;  3CME A;  4DAM A;  1Q7Y C;  2UU9 Q;  2KMO A;  4JI5 Q;  1N33 L;  2NU0 I;  3VDU A;  2YFA A;  4GKK Q;  2JA5 H;  1YHQ A;  1Q12 A;  4HEA 1;  1BVS A;  1GKH A;  2SGP I;  4P72 A;  3MEK A;  4DK3 C;  1KXL A;  2JW6 A;  3L0O A;  2OD1 A;  2UUB Q;  2GKT I;  2XTR A;  3K80 C;  3H3V H;  2PQA B;  3PO2 H;  1TBR R;  1XTD A;  4JCV E;  3PSI A;  2A20 A;  2EQS A;  2ODD A;  1OXX K;  3RLN A;  1G6P A;  4A3E G;  1SGR I;  3M9B A;  3QTL D;  2PMZ E;  5BR8 L;  4QGU A;  2NN6 G;  1EFW A;  2ID0 A;  2ERW A;  1X56 A;  3J81 i;  2R93 G;  2RCN A;  3NBH B;  1X54 A;  3PO2 G;  2UZ3 A;  1YVC A;  1I94 Q;  1MIU A;  1NJI C;  3PV0 A;  1ASZ A;  2UUC L;  5IYC G;  4WJ3 M;  4GOP A;  1OXV A;  2R7D A;  1GD7 A;  1LYL A;  1WOC A;  2JA5 G;  1RIP A;  3ULP A;  4Y7N H;  2NVQ H;  4DUZ L;  1X3E A;  3ER0 A;  2RIO A;  1CSQ A;  2N3S A;  2V6E A;  3OTO Q;  5IY0 A;  2VQF Q;  4DNI A;  2E2I H;  3CPF A;  4BXX G;  2JA1 A;  4OAU C;  4AQY L;  4AS2 A;  1VQ7 A;  4JI4 Q;  1VQE A;  2DB6 A;  2SGE I;  4HIO A;  2CAZ B;  4JBW A;  3DA3 A;  3F2B A;  3G4S A;  4B3R L;  1G29 1;  1LR8 A;  5HI7 A;  2RHQ B;  4DV3 L;  2XRC A;  1OXT A;  1R9T H;  2NVY H;  1JJC B;  2L15 A;  4UPA A;  5K36 G;  1TUS A;  1V9P A;  2JK8 A;  4X64 L;  2ZM6 L;  4DV6 Q;  1IBL Q;  2UXD Q;  1QVF A;  4IJL A;  2GN5 A;  3TEH B;  2JA8 H;  2JA6 H;  3PF4 A;  1W3S A;  4LF5 Q;  2DIP A;  2F52 A;  2B3G A;  4UP8 A;  4A3J G;  3HOU H;  2K9H A;  3I7F A;  4A3B G;  2A19 A;  3F1Z A;  4H02 A;  2DUD A;  4JI1 L;  4EX5 A;  2JEB I;  1KHI A;  4PMW A;  5M5Y H;  1HPT A;  2FNF X;  1QUQ A;  2LEO A;  3I4O A;  4GLV B;  4LF4 Q;  1FAR A;  1LR7 A;  1M8B A;  1PJU A;  3RZD H;  1HR0 L;  2L8E A;  3VE5 A;  1YHA A;  4IOA A;  3W5O A;  1KRT A;  2J87 A;  1UE6 A;  3P23 A;  4A3D H;  3F2D A;  4QQB X;  1CKO A;  2WAQ E;  3CCS A;  2VL6 A;  5C4X G;  2MO0 A;  4JYA L;  2NZH A;  4IPG A;  4X6A H;  3D0F A;  3E0E A;  1VQJ A;  1SRO A;  2MO1 A;  1R79 A;  1L1O B;  5EX0 A;  1BBU A;  3CF5 A;  3TS2 A;  2N8N A;  2ZJP A;  4JI6 L;  4BA2 I;  2LUY A;  2L7X A;  3RN5 A;  4OO1 I;  4DV4 Q;  4PL4 A;  3OYY A;  4NXN L;  1YJN A;  2VS1 A;  2MQH A;  3T1Y Q;  3S1N H;  2QQ0 A;  3CCE A;  4LFA Q;  2OQK A;  3NEN A;  2NU1 I;  3CAM A;  2NU3 I;  1X9N A;  2WVJ A;  2KCX A;  4DR1 Q;  4GOP C;  2CJS C;  4O1P A;  1YHB A;  3STB C;  1HNZ Q;  2K75 A;  1XMQ L;  3ULJ A;  3CD6 A;  2DGY A;  1TBN A;  1OXS C;  1OMT A;  4A3C G;  2UXB Q;  2GKV A;  2VRW B;  1I50 H;  1OXU A;  2CQO A;  4JI0 Q;  3CXC A;  3HOW H;  1WJJ A;  1XNQ Q;  2ES2 A;  4GN5 A;  3E2I A;  3OXL A;  1IBK Q;  4Q9V A;  4POF A;  1FVI A;  2YQP A;  4IJH A;  2ORV A;  2YTV A;  1PYB A;  1Q46 A;  3H0G H;  1FGU A;  2IHF A;  4L5T A;  3G6E A;  4NV5 A;  4QIW E;  3CCM A;  3S1R H;  3F4M A;  3M7N A;  3CCL A;  5C3E G;  4NXN Q;  3S14 H;  3U4V A;  3GDE A;  3CCQ A;  3FP9 A;  2I5M X;  1E1O A;  3HKZ E;  4OON A;  1P8L A;  2XTQ A;  4GKJ Q;  2A1A A;  3TRZ A;  2HIX A;  4A3G G;  2QQE A;  3JC6 6;  3L2P A;  3M85 A;  4DR3 L;  3J80 c;  1E3P A;  4A3L G;  1S3O A;  4QY7 A;  2KMP A;  5HQ8 A;  5ELO A;  2CWA A;  5ELN A;  4HIK A;  4LF9 L;  5JEA J;  2WP8 J;  4JBM A;  4BXX H;  4IOC A;  1OTC A;  3CC2 A;  4GNX C;  1Y1B A;  5IWA Q;  2F3C I;  5JJI A;  4ME3 A;  4PZ6 A;  5M3M G;  3M4Q A;  3UDG A;  3CXL A;  1NMF A;  1PH7 A;  1U0L A;  3KOJ A;  3H15 A;  2R92 H;  4DR4 L;  2JZM A;  4UXI A;  5M5X H;  3OXG A;  1H0Z A;  1PH1 A;  4RG1 A;  1CGI I;  4OO1 G;  3KP9 A;  2Z0S A;  1XNR L;  3G48 A;  3VDY A;  2NU2 I;  4LF6 Q;  1CKM A;  2QEX A;  4LF5 L;  4A3G H;  4AH6 A;  3J7A 5;  4DV4 L;  2K14 A;  1VQF A;  1N9W A;  2F66 B;  4X66 L;  4TQU S;  2PI2 E;  4X64 Q;  4BY1 H;  2UXD L;  1VQN A;  4G76 A;  1Y8F A;  1BKB A;  2AWO A;  3GTJ H;  4LFB L;  2KEN A;  4KHZ A;  2BUS A;  3HOX H;  3E9I A;  4JI8 L;  2JB1 A;  1HJP A;  4OWX B;  2K5H A;  5JEA G;  4HIM A;  3SGQ I;  2Q2H A;  1PH3 A;  1Q8K A;  2NVX H;  2B8T A;  3J7Z C;  1TXY A;  3EBE A;  4O1O A;  4O0A A;  1YNX A;  4P71 A;  4BBR H;  2JB3 A;  1L1O C;  4LF8 Q;  5LMN Q;  1SGY I;  3PUY A;  1SE8 A;  4BY7 H;  2D62 A;  4L5S A;  1Y1V H;  2KCT A;  4BY1 G;  1TBO A;  3IRB A;  2VQE L;  3BZC A;  2XMX A;  5M3F G;  2HQL A;  2N78 A;  2OVO A;  2Z6K C;  3BJU A;  1N13 A;  1PFS A;  1HNW Q;  1JT8 A;  1A62 A;  1NMG A;  5BR8 Q;  1CUK A;  4DV6 L;  3F2C A;  1CSP A;  1IBL L;  2P6A C;  3HOY H;  3I4M G;  2KBN A;  5GAG C;  4L5R C;  4DV3 Q;  3TJQ A;  3BU2 A;  5M3M H;  1N32 L;  4IFD G;  1PA6 A;  3GTL H;  3ERS X;  2UUB L;  2ZTD A;  3TQY A;  5IP7 H;  1E22 A;  4LUV A;  2V1C C;  3HOZ H;  1IW4 A;  4BBS G;  4R4C A;  1QZH A;  4GKK L;  5C4X H;  2HT1 A;  3AEV A;  3E9H A;  1VQ8 A;  1N33 Q;  1C7Y A;  1LUZ A;  1JJG A;  3S1Q H;  4OAV B;  1E24 A;  3FKI G;  5HGQ A;  4A3D G;  1AN1 I;  2V53 A;  5JJK A;  5IT9 c;  2WB1 E;  3KY9 A;  5LMN W;  4DR6 Q;  5HY6 A;  4B6D A;  3CCR A;  1YIT A;  2KHJ A;  3CC7 A;  4ALP A;  1MJE A;  5IYD G;  4DR3 Q;  4HJ8 A;  3T1Y L;  3JSB A;  3I56 A;  3I55 A;  3UDI A;  1AE3 A;  4A75 A;  4G75 A;  1PH8 A;  3H0G G;  2B0U C;  1VS0 A;  4RMF A;  3TRE A;  4MTN A;  3UGI A;  4A3K G;  2UXC L;  1AE2 A;  2RF4 A;  2LXK A;  4DR5 Q;  4IPC A;  1W2B A;  2ZJQ A;  1LR9 A;  2QQC A;  2WB1 G;  2A2C A;  2C35 B;  3J80 i;  4AYB G;  5LMU L;  4XIG S;  2JAE A;  3RU0 A;  1CGJ I;  1SGP I;  2PNH A;  3UE0 A;  1NY4 A;  4YHH L;  2E8G A;  1KD1 C;  5GQO A;  2E2J H;  3LJ0 A;  2NVT H;  1SGE I;  1YU6 C;  1IY6 A;  4PZ8 A;  2LXJ A;  4QJF A;  4J15 A;  5LMU Q;  1FYB A;  1SJ8 A;  4B3T Q;  1TWG H;  2B63 G;  2F4V L;  3FBV A;  1LM0 A;  2D0O A;  2EIF A;  1PTR A;  2ELI A;  2N1A B;  2ENN A;  1JB7 A;  4DV0 Q;  1HNX L;  4AYB E;  2OWO A;  1PH9 A;  3U58 A;  1VQI A;  3A74 A;  1X65 A;  1TWH H;  2PI2 A;  2WCY A;  2P22 B;  3A5Z B;  2FUG 1;  4C2M H;  2HHH L;  5E7N A;  2OTJ A;  2ZTE A;  4DR2 L;  3BJI A;  4JC0 A;  3J81 c;  3AYH B;  4AS3 A;  4JOI A;  4IFD I;  2A8V A;  3PUV A;  1D7Q A;  1EIY B;  4A93 H;  1IBM Q;  1XA6 A;  3CCV A;  3GTM H;  1XX6 A;  2YUU A;  4JI2 L;  4YCU A;  2MNA A;  2ZJR A;  1CSO I;  3SEK C;  3KDF B;  1VQH A;  3LJ1 A;  4X65 Q;  4KLK A;  4GOP B;  2UUA Q;  1PVO A;  2YFB A;  1OVO A;  1RFH A;  1SGQ I;  2NN6 I;  4L9M A;  1UUC A;  1K83 H;  1Q86 C;  2E5L Q;  5EX3 A;  3GTQ H;  4GNX A;  1XPO A;  2R92 G;  1YBY A;  1VQC A;  4A4I A;  1UWV A;  2GVI A;  2BA1 A;  5LNK 1;  4LF7 L;  1I6H H;  1YJ9 A;  3OVO A;  4HJ7 A;  4UXH A;  2JA8 G;  2ORW A;  1TWC H;  1L1O A;  4YCW A;  4NXM Q;  1XNQ L;  4DR4 Q;  4P74 A;  5DAE A;  4JI0 L;  3L0I A;  2K5V A;  2F3I A;  1PCE A;  1K8A C;  5IWA L;  2AHO B;  1UE1 A;  1CE3 A;  3PCO B;  1Y1V G;  4NXM L;  1YI2 A;  2VQE Q;  4LFC L;  1JJ2 A;  4LF9 Q;  3RN2 A;  3FC3 A;  2Y0S G;  1QZG A;  3OW2 A;  2MJF B;  1VQ6 A;  1BMO A;  3M4O H;  1B7Y B;  2B29 A;  3KJO A;  2KMR A;  1XMO Q;  1CT2 I;  2NU4 I;  4JBK A;  5GRO A;  5GAD C;  1QUQ B;  1PHJ A;  1KMA A;  3UDX A;  3LGJ A;  1NTG A;  4DV7 L;  1PTQ A;  3KYH C;  3T1H Q;  3S15 H;  1LTL A;  1CKN B;  4X62 Q;  1KQS A;  4JV5 L;  2E5R A;  4E1P A;  4BA1 I;  5IYC H;  4JI6 Q;  4PL3 A;  2UUA L;  3I4N G;  1V1Q A;  4UP9 A;  4SGB I;  1VQ5 A;  2SGQ I;  1IL2 A;  3K7A H;  3SGI A;  1OYV I;  2YU9 H;  2Y0S E;  4C3J H;  1IBK L;  4OX9 L;  3OL0 A;  1GM5 A;  3H3V I;  1KIX A;  2SGD I;  4KHP Q;  3T1H L;  2JE6 I;  4A3I G;  3KFU A;  4YWL A;  4JBJ A;  4K0K L;  2GVB A;  1WFQ A;  1XMO L;  1K9M C;  1HNZ L;  1HR0 Q;  2ZRR A;  1GVP A;  2I0Q A;  3M3Y H;  1SGN I;  4P75 A;  5CCL A;  1VQA A;  3OXF A;  1HDL A;  4XTC S;  4LUZ A;  1V43 A;  2KMQ A;  1NBW A;  4YY3 L;  4K0K Q;  3A0J A;  4YZD A;  3PUX A;  2R7Z G;  2D0P A;  4KHP L;  2OQ0 A;  4YHH Q;  4Y52 H;  5C44 H;  2W0T A;  2IY5 B;  3HKS A;  1C9O A;  1UE7 A;  4LWC A;  2ALY B;  4LF7 Q;  3TS0 A;  3CQZ H;  3STB D;  4DR5 L;  4UY8 C;  1IXR A;  2JYY A;  5HGI A;  4JV5 Q;  2CFM A;  3S17 H;  2IX0 A;  4A3K H;  1VQ4 A;  2JXD A;  1VCI A;  2KCM A;  4QL5 A;  4DWL A;  4C3I H;  1VQG A;  3KF6 B;  1Y1C A;  2JA9 A;  2Z6K A;  4LF4 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...