1U5KA

Recombinational repair protein reco
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
243
structure length
242
Chain Sequence
b'RSRTANRSGIVIRRRVTPAGDIIVTLLTPQGKLKAIARGGVKGPLSSSLNLFHHVGVQVYQGPHDLASVKQAVLEGALPTLAEPERYAFAHLMAEFADALFQEGEFSEQAFDLFAASLRGVAHQPDPEWVALVMSYKLLGLAGVIPQTARCARCGAPDPEHPDPLGGQLLCSKCAALPPYPPAVLDFLRHAVRRTVRASFEQPVPSADRPALWRALEKFVTVQVGGVHSWRQLVPSGVPVLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein
publication title A Novel Structure of DNA Repair Protein RecO from Deinococcus radiodurans
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Recombination,replication
total genus 65
structure length 242
sequence length 243
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02565 RecO_C Recombination protein O C terminal
A PF11967 RecO_N Recombination protein O N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.120 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 1u5kA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1u5kA01
3.30.60.100 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1u5kA03
3H0GH 4BY1G 4GLXA 1CUKA 3RR5A 4LFCL 3MEFA 3ICEA 3ZJYC 1YEZA 4NB3A 3B6YA 2B29A 4LF4Q 1JE5A 2LXJA 2E2JH 2K14A 3AEVA 1OXXK 5C0XJ 2WB1E 4GN3B 4BA2I 4WJ4A 2WAQG 5E7NA 2RF4A 1VQGA 1YNXA 1WOCA 5C4XH 5J3BA 4A4IA 4YWLA 1IBKL 1Q1EA 3NBHB 4OXPA 1HNZQ 3ULLA 3VDYA 1JMCA 5M3MG 5DLQE 4HJ9A 3KF8B 2BA1A 2KENA 4EQ5A 2Q2TA 2Z6KA 4LFCQ 3UDGA 1JT8A 4PZ7A 3PUVA 4DV1L 1TWGH 1PH1A 4UPAA 1YJNA 2RHQB 1E22A 3J7ZC 4DAMA 1I50H 1VQLA 2JA5H 2KHJA 1I94Q 4A3CH 2JE6I 4IFDJ 1L1OC 1AE3A 2AHOB 1FL0A 2IHFA 1IBKQ 4JOIA 4LUZA 4R4OA 2R7ZG 1A63A 4JI1L 5FLMG 4BY7G 2VL6A 2UXBL 2WB1G 5AJ3L 1Y1VH 5HY6A 5C44H 4DV1Q 4ME3A 1VQEA 4IOAA 4DR2L 2ZJPA 4B3RL 4JI0L 2IT1A 1NMFA 5GAHC 2NVXH 4NXNL 3PO3G 5IY0A 1K73C 2ZJQA 2R7FA 4JYAQ 4YWMA 3HFZB 3I4NH 3S1QH 4JI1Q 1X55A 2K5NA 4MZ9A 2PMZE 4A3MH 3M3YH 4FDBA 1PH7A 3G48A 2NZHA 1PYBA 4DV3L 4DV5L 2A19A 2D0OA 4DR2Q 1VQOA 4B3RQ 1HNWL 2VY3A 3CCRA 4BXXG 1EIYB 4DV6L 1X3GA 4YCWA 4NXNQ 3GD7A 1VS0A 4OWTB 3RLNA 1NJIC 1Q8KA 2HQLA 3RN5A 2AWNA 1YJWA 3OYYA 3UE1A 3L7ZC 5FLXc 1TWCH 3CC2A 3KJOA 4TQUS 1QZGA 1YHBA 3CC4A 4LWCA 4L5RC 1OXVA 2OQ0A 2RCNA 3U4VA 1V9PA 4HJ8A 4A3JH 1KRTA 2E8GA 1SLJA 2EXDA 4B3SL 4WJ3M 3G6EA 4AIMA 1C7YA 1IZ6A 3FKIH 5IE8A 1Z9FA 1Q82C 1ASYA 4A3LG 2R93H 4DK3C 1N9WA 4IPHA 4LF7L 1UWVA 5JEAG 5GADC 1KD1C 5FJ8H 3K8AA 2ZTDA 2D62A 4A3DG 1CKOA 2UUCQ 1VQNA 4OWWB 1NMGA 3PUWA 4LUOA 4L5TA 4A3FG 2BH8A 5M5YH 1YI2A 1QUQA 4B3SQ 5JJLA 1X56A 4YCUA 3T1YQ 1CSQA 1X54A 3M4PA 4P73A 1B8AA 2R93G 3HOXG 5IWAL 3CAMA 3J81i 4IOCA 3RZOH 5IYDG 5GAEC 2EIFA 1RL2A 1E24A 1YIJA 2A8VA 4JI4L 4HJAA 3IRBA 5H1SE 1OXTA 3ERSX 2JA9A 2ALYB 2JJQA 4A3IH 5IYCG 1N8RC 3GTQH 4OX9L 3GTOH 5HGQA 1FVIA 3E0EA 5IWAQ 3PCOB 5JJKA 2V1CC 3OW2A 2K5VA 4LF5L 2ID0A 3I4MH 5C4JH 3CMEA 4JI4Q 1T9HA 3D0FA 3EN2A 3PO2H 2AKWB 1VQ5A 4DUYL 4A3EH 2UUBL 3HOWG 3TREA 4QJFA 4NXML 4Y52H 3T1HL 1LM0A 1PFSA 1C9OA 4DUZL 1U0LA 1VQPA 4X66Q 2I0QA 1XTDA 3KOJA 3OTOQ 4HJ7A 4PZ6A 4DR1L 3S15H 2RHSB 3HOZG 4BBSH 2K5HA 4LF5Q 4A3KG 4LFBQ 3RN2A 1Z47A 2UXCL 3CCSA 4R4IA 4LF4L 4DK6C 1IBLQ 2K4KA 3W1BA 4JG2A 4DUYQ 1QVFA 2PI2A 3TRZA 2N78A 2UUBQ 1PVOA 1AH9A 3T1HQ 1X9NA 5M3MH 1FGUA 4P75A 4DUZQ 4GNXC 3KDFA 5GQOA 1HNZL 1IYJB 1VQBA 2PQAA 4DKAC 4DR1Q 3RNUA 2F4VQ 1E1TA 4JI3L 2I5MX 4A76A 1YZ6A 3BJUA 3GDEA 4HIDA 1PH5A 4LNQA 2N49A 3HOVH 4A93G 2UXCQ 1TWHH 1VQHA 4GN4B 3UE0A 2VQEL 4GOPB 2KHIA 1KHIA 4BBRG 2JEAI 2R7ZH 2R92H 2K75A 1I94L 4PZ8A 4BY7H 1UE1A 2CFMA 4IPDA 3M85A 2KCTA 4GS3A 2VUMG 2VNUD 5C3EG 4JI3Q 4HIKA 1WFQA 2JA7G 1QZHA 2FXQA 5C0XG 2VS1A 3ULJA 2VQEQ 1YBYA 2Y0SE 3PO3H 3M4OH 3S2HH 4XTCS 1PYSB 2NVYH 1EQQA 3GTGH 3PUXA 1NE3A 1ASZA 1BVSA 4POGA 5IP7G 2NVTH 4JYAL 1V1QA 1BKBA 4O2DA 3UDIA 2MNAA 3ULPA 2JA8H 1VQMA 1I5FA 4BXXH 3NENA 1SRUA 3S1MH 4MTNA 3CCUA 1W2BA 4GNXA 3W5OA 1OTCA 4TVAB 4LW1A 2ZM6Q 1PHJA 3CD6A 4IFDG 1Q46A 1WCMH 2R6GA 1X6OA 4Y7NH 4A3MG 1UEBA 4H02A 3H0GG 4JV5L 3HKSA 4AYBE 5IT9c 1CKNB 1LTLA 3CPFA 2Y0SG 1W3SA 4OO1G 2HIXA 1K83H 4QIWE 3W1GA 4R4QA 2VQFL 4JBWA 1SN8A 3S14H 2CKZB 1G6PA 1KAWA 4JCVE 1X3EA 3E9HA 1O7IA 1IL2A 3STBD 1EOVA 4A3LH 1K0RA 3U50C 3L2PA 3HOYG 4JV5Q 4KI0A 4PMWA 3GTJH 3K0XA 3S16H 5JJIA 1N36Q 1PA6A 2D0PA 3S1NH 1A0IA 1L1OA 3NEMA 2VQFQ 1L0WA 4JI7Q 2JEBI 4AYBG 1WI5A 4DV7L 3CCEA 2UUCL 4DR3L 1MJEA 1FJGL 3PF4A 1GVPA 2GN5A 3KFUA 2WP8J 1B7YB 3DM3A 2B63G 4C3JH 4RG1A 1YJ9A 1XMOQ 1NY4A 2JA6G 3HOXH 1HZBA 2Q2HA 1BBWA 3FP9A 3CXCA 3CMAA 1K9MC 1QVCA 1SE8A 3MXNB 3UDXA 1HZ9A 4IO9A 2QA4A 5C44G 3T1YL 4IJHA 1Y14B 3BZCA 1VQ4A 1PV4A 1TXYA 1N32L 2ASBA 2H5XA 2ZTEA 1E1OA 3PIOA 4DV7Q 5IYCH 4DR3Q 1FJGQ 1XPUA 2Q2IA 1HZAA 3HOUG 3J81j 4OWXB 2HT1A 3BZKA 4A75A 1N34Q 3STBC 1N33L 1AE2A 1S3OA 1PH2A 4R4TA 2KCMA 2OQKA 1PH6A 1YHQA 3F2BA 1N32Q 4X65L 3M4QA 1WYDA 3PUYA 4IPGA 3HOWH 2UXDL 1JB7A 4C3HH 3TQYA 1E7ZA 1QUQB 2XGTA 1Y1WG 4JC0A 1N33Q 1R9TH 1LUZA 3HOZH 5EAYA 4A3GH 4A3KH 1JJCB 2GVBA 4X66L 4JBMA 3OTOL 4DAYB 4X65Q 3FHWA 4LFBL 3TEHB 1MKHA 1UE7A 2GVAA 4J15A 4JI8Q 1SROA 4B3TL 2UXDQ 4P74A 1IBLL 4UY8C 3WWVA 4DV4L 4GOPC 1X3FA 2B3GA 5GAGC 4X62Q 4UP8A 1KQSA 1HZCA 4BY1H 1VQDA 5C0XI 1TWAH 2F3IA 1PH3A 2LSSA 4YY3L 4HIOA 3JC66 1E3PA 2OWOA 3GTLH 1M1KC 2F4VL 3SGIA 3DLLA 1DGSA 4PG3A 1KIXA 3PUZA 4KLKA 1VQ7A 2XTIA 4A3BG 1HR0Q 4BBRH 2PNHA 5LMNL 1S40A 4B3TQ 4O0AA 4DV2Q 1XPRA 4DV4Q 2QEXA 2R7DA 1BBUA 4NPSA 1VQAA 5BR8L 3G71A 4JI6Q 5K36G 2IHEA 3GO5A 1KRSA 3TS0A 2DGYA 2NN6G 5C3EH 1PH4A 4YHHL 1VQKA 1XJVA 4IFDI 4YY3Q 3CP0A 2CQOA 4XIGS 2AMCB 2N8NA 5IYBG 4MNOA 3CPWA 5M3FG 4QY7A 5LMNQ 2NZOA 2JQOA 3L0OA 1NTGA 3KF6A 3AFPA 1K8AC 2ZJRA 2UU9L 4OO1I 2K50A 1VQIA 5IP7H 1QVGA 5BR8Q 4QQBX 4AQYL 4JI2Q 1TWFH 1G291 2WAQE 3F1ZA 4C3IH 5FLMH 3A5ZB 4LFAL 1HJPA 3K7UC 4YHHQ 1IBMQ 3KDFB 4DNIA 4R1JA 2PQAB 3BU2A 3NELA 4DV0L 2HHHQ 4B3MQ 1XNRL 1MJCA 1VQCA 3S24A 5M5XH 2YU9H 3EIVA 3GTMH 4K0KL 1M90C 1LYLA 2UU9Q 2UXBQ 3RLFA 5IP9G 4POFA 2VW9A 2ZM6L 4AQYQ 2YTXA 1Q81C 3AYHB 4LFAQ 1Q12A 3F8TA 3I56A 3CF5A 3CCJA 1KC8C 4GLAC 4P72A 3CCVA 2MFIA 4AH6A 3PF5A 4DV0Q 1EYGA 4BBSG 2YTYA 3E9IA 4UP7A 2UUAL 1NBWA 1XNRQ 3F2DA 1KXLA 4K0KQ 2AWOA 4DPGA 4YCVA 1XNQL 1IXRA 3HOYH 1XPOA 1CSPA 2YTVA 5LMUL 4QL5A 3EBEA 4IPCA 4RMFA 3M7NA 2IX0A 1GD7A 3HOVG 2I5LX 1N36L 2UUAQ 1P8LA 1UE5A 1K3RA 4JI7L 4GNXB 1XNQQ 4HJ5A 1GM5A 2B63H 2CWPA 2R92G 3TS2A 1CKNA 1VQFA 3ER0A 3I2ZA 1J5EL 4JBKA 2JA6H 1WJJA 5LMUQ 3J7A5 4X6AH 5C4XG 4HIMA 1GKHA 1XMOL 3PIPA 2E2HH 2E2IH 4JI5L 3U4ZA 3CCMA 4A3DH 2ES2A 1EIFA 1H95A 1HH2P 1J6QA 4IJLA 3HOUH 4ALPA 3PGZA 2IX1A 4A3FH 2JA5G 4UP9A 2I5HA 3CQZH 4X64L 4DR5L 3RZDH 1J5EQ 4A3CG 5AJ3Q 1SR3A 2HIVA 3A0JA 3M9BA 3PSIA 3S2DH 4GKKL 2K52A 3HKZE 3K80C 1I3QH 1N34L 4LF8L 2JA8G 3KLWA 1Y1VG 2F52A 4JI0Q 4JI5Q 3Q8DA 2PI2E 5IYDH 1U5KA 4LUVA 1P16A 1L1OB 4L5SA 3I4OA 3JAMi 2Z0SA 1D8LA 1WCMG 5ELOA 2QGQA 3LGJA 4X64Q 1B70B 4GLVB 3A74A 4DR5Q 1Y1WH 3CC7A 1MIUA 2MO1A 4EX5A 2BH2A 4DV3Q 2EQSA 4DV5Q 3I4NG 4GKJL 1KL9A 1HR0W 5JEAJ 1VQ8A 4GKKQ 4LF8Q 1HNWQ 2A1AA 4OONA 4DR7L 1YHAA 4DV6Q 1CKMA 1G51A 2YYZA 3S17H 1OXUA 3HKZG 3K81C 1A8VA 2LXKA 2NN6I 4JI8L 3J80i 4R4CA 1EQRA 2MO0A 2C35B 1RIPA 2OCEA 3K7AH 1YITA 4GKJQ 5LMNW 4X62L 5GROA 3A5UA 1EWIA 4GN5A 1JJ2A 2KBNA 4A3BH 4DR7Q 2YV5A 1YVCA 2JK8A 2WFWA 2MQHA 3S1RH 4LF9L 3KYHC 1HR0L 1PH9A 3GTKH 4A3JG 3H3VI 4DR4L 4LF7Q 4KHPL 3JAMc 4DV2L 3F2CA 4LF6L 3CCLA 4JI6L 3FKIG 2DUDA 3PV0A 2N3SA 1Q86C 5IYBH 1PH8A 1Q1BA 1GO3E 5M3FH 5FJ8G 1XMQL 2Q2UA 3AQQA 1A62A 5ELNA 4A93H 1SFOH 3RLOA 4LF9Q 4DR6L 3GTPH 2IY5B 3UDFA 1Q7YC 4DR4Q 4KHPQ 1VQ9A 4LF6Q 1I6HH 3I7FA 3G4SA 2CCZA 4JBJA 4JI2L 2ATWA 3J80c 1C0AA 1JJGA 3H3VH 1VCIA 3I55A 2VUMH 1HNXL 2OTLA 1IBML 1XMQQ 2JA7H 4B3ML 2HHHL 1K8GA 4DR6Q 4YWKA 2Z6KC 2E5LL 5IP9H 4OX9Q 3CCQA 4A3IG 1S72A 4BA1I 1OXSC 3AFQA 2NVQH 4C2MH 3U58A 4A3GG 2CWAA 4KHZA 3H15A 4P71A 3CW2C 1HNXQ 2ZTCA 4APVA 3J81c 1EUJA 4JOIC 2BA0A 3KJPA 3D31A 1X65A 3I4MG 2L15A 4GOPA 1V43A 4QGUA 1L2FA 2E5LQ 4NXMQ 2OTJA 3PO2G 4L5QA 1EFWA 5M5WH 1UE6A 1VQ6A 3KF6B 4A3EG 1SMXA 2VZAA 1VQJA 1D7QA
chains in the Genus database with same CATH superfamily
4C3JB 2EVBA 4GLXA 3RR5A 3HOXB 4LFCL 3E5SA 3ICEA 2Q8IB 4NB3A 3UOEA 3B6YA 5IOCA 1MD2D 2ZW3A 3UGIA 5E7NA 1UAPA 4GI3C 5HGIA 1VQGA 5KGUA 1Q1EA 4YIJA 1HNZQ 5M3MG 4HJ9A 2GKVA 2KENA 3OIPA 3NPPA 3DWPA 2DIPA 1TWGH 2RSNA 2RHQB 1EU3A 4GZYC 4DAMA 1VQLA 2KHJA 3FEWX 2JE6I 3NBIA 3SHLA 2D2CC 1A63A 2L9HA 3FVVA 2E76C 2VL6A 2X6LA 1R9TB 2PQ8A 4A3KB 2ZJPA 4ZKBB 4JI0L 1SGPI 1JICA 1K73C 2ZJQA 1WTXA 3D00A 3I4NH 2K5NA 3DMUA 2PMZE 3M3YH 4FDBA 1EY6A 3TJQA 2NZHA 1SAPA 4RCNA 3VR2A 3DA3A 1JR0D 1TWAB 3QR8A 5IIFA 4B3RQ 4A93B 4G76A 1EIYB 5JJZA 5FLXE 1X3GA 4DWLA 4YCWA 3C2PA 3VR4A 4BBRB 3BS1A 4OWTB 1EU4A 3OOCA 2XIWA 3AU7A 1BF4A 2AWNA 3MXNA 1ICWA 3DM1A 3CC2A 2R61A 5G3LD 5E1FA 3CC4A 2IJ0A 4L5RC 1KMAA 1Y8NB 2RCNA 3U4VA 1V9PA 2IPKD 4QUCA 3TDQA 2E8GA 5EPKA 2KUMA 1YO7A 4XQJA 5IE8A 3FKIH 3G6EA 1C7YA 3I70A 4CDCC 1KD1C 2LFNA 2L1BA 4K14A 4ULLA 2B2YA 2UUCQ 2LUYA 3PUWA 3NP8A 4FXGC 3KY9A 3D4RA 4A3FG 5M5WB 5E3QA 1STHA 2D5DA 2KA7A 2MHVA 1X56A 3M4PA 4O1PA 4V0BA 1H9SB 5IYDG 4DAYA 2F03A 1OO9B 2O5JC 2EIFA 2XNAC 1PRTC 1I4HA 1EIGA 2OEOA 2F0KA 2F0WA 1OXTA 4DA2A 1PLFA 1N8RC 1CFMA 3HOYB 4I7ZC 4NW2A 2Y0MA 5IWAQ 2A2CA 5JJKA 3NK9A 2K5VA 4LF5L 3CMEA 1T5XD 4XT3B 4LK1C 3EN2A 1VQ5A 2UUBL 2B63B 2P22B 4C3HG 4H0LC 1V1PA 4X66Q 2EY1A 2FHTA 3OTOQ 3KOJA 1I6HH 4PZ6A 2F0QA 1TDPA 3HOZG 4BBSH 2K5HA 1QCBD 2RC4A 1JC7A 4R4IA 4DUYQ 4JG2A 4DGZA 4F88A 3HOUB 1TUSA 3TOBA 2N78A 1PVOA 4HMJA 5JOBA 3T1HQ 3RZDB 1PRTF 4P75A 5GQOA 1LABA 5G3LF 2Z4IA 2KCNA 1PH5A 5J39A 4RHRA 2ICEC 1TWHH 1VQHA 4GN4B 2EY2A 1S5ED 2R7ZH 4BY7H 1HXYD 2F3WA 4KY6A 2CFMA 4DK1A 3VDPA 1CHPD 3K5NA 1GOZA 1EFID 2YFAA 4GS3A 2XN9C 1EEID 1TT2A 1NAPA 2B2TC 2C9OA 3E6ZX 4JI3Q 1HQMC 4HIKA 1Z7KB 5DAEA 4ZLTF 2JXDA 1QZHA 1TY0A 4DFAA 2KHSA 1LTBD 2KJXA 4QB4A 3S2HH 2NVYH 3GTGH 1ASZA 2NVTH 4JYAL 4IUNA 2A6ED 3K7AB 1V1QA 4O2DA 3ULPA 2XRSD 2J87A 4NV2A 5CYUA 3NENA 3NHHA 1SRUA 1HA6A 3W5OA 2LMCB 4TVAB 3CD6A 1JWMD 1WCMH 4MHEA 3H0GG 3R2TA 1F9SA 4ME5A 4AYBE 5IT9c 3SGBI 2Y0SG 3MC0B 1NCVA 1K83H 3W1GA 4V190 1GHKA 3FBVA 2M5XA 4PL4A 2CKZB 4YZDA 2B2WC 1DD2A 2A2DA 3GTPB 4PNYA 2QF7A 3H94A 1K0RA 2NU0I 3IKJA 3SDJA 1ET6A 5JJIA 2VB3X 1PA6A 4S3SA 4B6DA 2VUMB 1L1OA 1ZYRC 4DV7L 4K5VA 1HEVA 1YNND 1DCZA 3IFDA 1B7YB 1PTQA 1WTJA 1XMOQ 2R93H 3O13A 2BOSA 3CXCA 3CMAA 4AS2A 1HZ9A 2X3TA 4IJHA 4BBSB 3NTKA 4ZAIA 1N32L 2F1MA 2DNCA 3RMHA 3R2IA 1QE6A 5IYCH 1XPUA 1SE2A 4FO2A 5M9OA 2YUUA 1QJOA 2K5DA 1BDOA 4ZCKA 1N33L 3EQLC 1AE2A 1UNSA 4DNRB 2KCMA 2OQKA 2RCFA 5A2QL 3TO6A 3M4QA 5FKAC 1VDZA 5T1IA 2E2JB 4IPGA 4G7ZC 3HOWH 1TS3A 1JB7A 3TQYA 1E7ZA 2XGTA 3OMGA 4CKCA 1LUZA 2XRQD 3J7YW 2PPBC 3TEHB 2GVAA 4JI8Q 4F87A 1IL8A 3KLRA 1CA6A 4UY8C 4GOPC 4QIWB 4X62Q 4IALA 1WKXA 1RTOA 3CRKC 2WVJA 2OWOA 1Y1VB 3GTLH 5C44B 2F4VL 1KIXA 4PG3A 4KLKA 4A3BG 4KD4A 4HN7A 1B44D 1XX8A 1HR0Q 1S40A 1SGYI 2WKDA 2L4NA 3MFGA 2N55A 4DV4Q 1XX6A 5BR8L 3Q23A 4JI6Q 1KABA 4U673 1KRSA 3TS0A 5LL6S 4IFDI 4YY3Q 2K1BA 1GXDC 3CPWA 3GV6A 1Y8FA 5CR3A 3HKZB 3L0OA 3AB9A 4JW0A 3KF6A 1K8AC 5JVH3 4QCLA 2K50A 4QQBX 1QVGA 3LWUA 1TWFH 2Z9HA 4LFAL 1PFNA 4YHHQ 3KP9A 2MGSA 2TSSA 3CKIB 4R1JA 3S24A 3GTMH 1M90C 2UU9Q 4KKUA 3RLFA 1ZKOA 4R8IA 4A3JB 4NMZA 1L0YB 4CJ0B 1WTOA 4XXEA 1Q12A 3F8TA 4OO1H 3I56A 2AQ3B 5HURA 3QAHA 3CCJA 1KNEA 1MBYA 3PF5A 2MFIA 4AH6A 1EYGA 4DV0Q 2YTYA 5KYLA 1NBWA 1XNRQ 4K0KQ 1GUSA 2DY8A 1XNQL 1XPOA 1OVOA 4QL5A 3EBEA 1SNPA 4IPCA 3M7NA 2O5IC 1NUCA 3RZOB 2Z8LA 1OMTA 4KD3A 3CU7A 3EVQA 2LS01 1UE5A 1FARA 4JI7L 1H9MA 1RD9D 2CWPA 4EVOA 1CKNA 1SNOA 1VQFA 2F0JA 4A3IB 2JA6H 4X6AH 3J7A5 1R4QB 2EY6A 3Q24A 2EE1A 2AQ2B 3MVVA 1SYEA 3IAYA 2E2IH 4JI5L 2ROWA 3N52A 2LY7A 4J6HA 1TIID 2QPOA 4A3FH 1EZ6A 4X64L 2B2YC 1SR3A 3M9BA 1CA5A 3HKZE 5IYDH 2Z4HA 2OT2A 1SBBB 2FINB 4LUVA 1MJAA 2Z0SA 1D8LA 3TP6A 1B70B 3A74A 1MIUA 3VYUA 2EQSA 5M3MB 2RLDA 4DV5Q 3I4NG 1VQ8A 5JEAJ 4GKKQ 5HQ8A 1PFMA 4LF8Q 3HP3A 2A1AA 4OONA 3BZDB 2Q8RE 1H0ZA 1CKMA 1G51A 3HOVB 1TURA 1OXUA 2F0GA 1A8VA 1LR9A 3J80i 4CGYB 1EOTA 1RIPA 2R92B 1ILQA 1CT0I 1H9SA 4XYQA 2A20A 1GUNA 3A5UA 4GN5A 1BO0A 1X4SA 3ND9A 5FO7B 1G8ZD 2MQHA 4I1TA 4LF9L 3OXFA 5E3PA 3KYHC 3GV3A 3M4OB 4DR4L 5K36H 5E3RA 4LF7Q 1D6EC 3CCLA 3FKIG 3MWYW 3SK8A 4X3SA 1BXTA 2N3SA 4FKDA 2RIOA 1Q1BA 1GO3E 5M3FH 2JA8B 4NKLA 3ERQA 1U4MA 2CWFA 5ELNA 3J80E 4KKSA 3MEHA 3UDFA 4RKBA 4KHPQ 4KHVA 4ZUIA 1NUBA 3JAML 4LF6Q 2X52A 3EFXD 4JI2L 1AFPA 4B9WA 3H3VH 3I55A 1HNXL 3UGLA 1XMQQ 1C48A 2KKMA 3LJ1A 3NTIA 4CJ2C 3S14B 2GSCA 5IP9H 4OX9Q 3CCQA 2EYOA 3QWPA 3I72A 4C2MH 3U58A 1XWEA 1SYCA 2CWAA 3H15A 3S16B 3UGDA 2JYYA 4APVA 3J81c 3KJPA 4JOIC 2BA0A 4XDXA 1BCPD 1FYCA 2HQEA 3KK7A 2OVOA 3R3OA 2EPBA 4NXMQ 1RFHA 4L5QA 1K7VA 1VQ6A 2F3VA 2EYMA 3P75A 4DN4M 3H0GH 4BY1G 1DOLA 1FR3A 2NUCA 2K14A 3AEVA 5C0XJ 4BA2I 1PZJD 3A8KE 3H3VC 1WTHA 2QDLA 1UVFA 1YNXA 5I2YA 4YWLA 3P1HA 1D1IA 3N6RA 4TKOB 3ULLA 2NWGA 2Q2TA 2Z6KA 3UDGA 2N17A 1KBFA 2K01A 1YJNA 1E22A 1HCZA 2JA5H 1I94Q 4WJWA 1AE3A 1L1OC 2AHOB 4C3HB 1A2TA 2R7ZG 5FLMG 4BY7G 2WB1G 4RKLA 5AJ3L 4X3KA 3OVOA 5HY6A 2FMMA 3HOZB 4L9MA 4KY7A 3P23A 4UHVA 4B3RL 1XA6A 2F0VA 3VA9A 2F3CI 3OIQA 1ULNA 1STEA 2RDHA 2R7FA 2KMRA 3HFZB 3S1QH 4JI1Q 1X55A 4MZ9A 4ZRZA 1HTPA 1PH7A 3T13A 1R0RI 4DV3L 3DO9A 5C3XA 2D0OA 1HNWL 2VY3A 3BG3A 4DV6L 4ZYSA 2MJ8A 3RLNA 3RN5A 3OYYA 1A15A 4HSPA 2IL8A 5FLXc 3QTLD 1MI2A 1TQOA 4HFVA 3I91A 4LWCA 1OXVA 2OQ0A 1LTRD 4HJ8A 5D3DA 2ODDA 1ASYA 4AIMA 2H1EA 2IW3A 1Z9FA 3FMCA 1MJ9A 3RD4A 4ZQ3A 2L8EA 1N9WA 1UWVA 2XTQA 2ZTDA 1VF5C 1GUGA 2KCCA 4A3DG 3HH2C 2ENNA 4FF1A 5M5XB 1TS2A 2G9HD 5LNK1 4K2KA 2BH8A 1YI2A 1SYFA 3MXPA 4B3SQ 3OL0A 4RGOS 3SXHA 3PQIA 3T1YQ 1CSQA 1X54A 2NBFA 4JK1C 2R93G 2Y0SB 5IWAL 3J81i 4G75A 1M4VA 4HJAA 5H1SE 1IY5A 5IODA 2JA9A 1ESFA 2JJQA 3NTHA 5IYCG 5JHWC 3IFTA 2FUG1 4HMIA 5FUXA 1ENFA 2SNSA 3PCOB 2HD3A 5C4ZA 2ID0A 3I4MH 4IUQA 5C4JH 4JI4Q 3D0FA 1D1KA 1TKWB 4DUYL 2PMZB 2XRCA 3V05A 1NSNS 3TREA 3HOWG 3T1HL 1RODA 1U0LA 3B55A 1XTDA 4HJ7A 1QOHA 4H7BA 2A68C 2MJFB 2JP1A 4LF4L 4DK6C 1QVFA 9WGAA 3MEKA 1IHZA 1AH9A 1H9RA 1X9NA 3VYSA 1FGUA 3MA2B 4GNXC 4DR1Q 1VQBA 3S2DB 3NUCA 3EJIA 1I3QB 3FRPB 4JI3L 2I5MX 4A76A 3GDEA 3E59A 1JWUD 2UXCQ 1X74A 5CC4A 3FPUB 4DNCA 2JYOA 4IQZA 2KHIA 1KHIA 2V1CA 2JEAI 4E6IA 1C8CA 2CW0C 4IPDA 4H44C 4IZ8A 1RF2D 2QQCA 2VNUD 2OF1A 1Q8IA 1WFQA 2EYHA 2JA7G 2FXQA 2J4XA 2VQEQ 3PO3H 2Y0SE 2L1LB 1JB3A 4XTCS 5CV7A 5BN4A 1EQQA 3PUXA 1BVSA 2KCXA 4RGTA 1EYDA 1G6ZA 5C5MA 2GVIA 4N8X1 3K5OA 4BXXH 2W0TA 4A3BB 1FY7A 4MTNA 4KN7C 1W2BA 4LW1A 1DXMA 3S1RB 3FSXA 3DA4A 1X6OA 1WGTA 1SEBD 2A73B 4H02A 3GTKB 1DONA 3E3XA 5C3WA 1CKNB 3CPFA 2KEEA 1Y69U 4OO1G 5CMDA 5I2XA 1PCEA 1BQQT 4JBWA 3TO7A 4ZK9B 2EZVA 1KAWA 4RA8A 2I46A 3E9HA 3D4DA 3STBD 1HHVA 1MGSA 5JEAH 4JV5Q 3GTJH 1UUCA 3K0XA 1N36Q 4CKEA 1B3AA 1LTAD 3P7JA 1A2UA 1PRTD 3S1NH 2VQFQ 2E73A 3E2IA 3CCEA 1YNJC 1MJEA 1E2VA 3PF4A 3BDCA 2GN5A 5A2QE 2WP8J 4BWGB 1EQTA 2JZMA 3W3AA 1YJ9A 2JA6G 2NVQB 1A3UA 1Y1CA 1V8QA 1SE8A 1JOQA 2HCIA 2QA4A 4HSVA 1KDAA 2ZTEA 2L11A 2WV6D 2HT1A 4A3MB 3K5MA 3STBC 2M00A 1PH2A 3F2BA 2EJGC 1C4QA 3BVZA 2PW7A 4DF7A 1KNAA 4NDXA 1V1IA 1STNA 2QCPX 1ONLA 5I6YA 2IP6A 1Z6HA 1PTOH 5FOBB 4RAUC 4FNFA 4X65Q 1PTOD 3R8BA 4LFBL 1TWGB 4J15A 1AEXA 2UXDQ 1L0XB 3DEPA 4AYBB 2PW5A 1IBLL 3WWVA 4DV4L 4KY5A 2K9HA 1Y8OB 4UP8A 1KQSA 4IN3A 4BY1H 4UXIA 4HGUA 3QG1A 1WTQA 4YY3L 2QGMA 2JSOA 2HGKA 3A54A 3SGIA 2GKRI 4WP4A 4N9TA 5T1GA 2OU2A 2ZXOA 1LTTD 4B3TQ 2JB3A 2ICIA 2QEXA 1BBUA 2EYPA 4NPSA 2J7ZA 3G71A 5K36G 3AMUA 3HS0C 3I4NB 1SJ8A 3TMEA 3M3YB 5C3EH 1VQKA 4YHHL 3PDNA 3CP0A 2SEBD 5C0XH 2HDLA 1K28A 5M3FG 4QY7A 4FF4A 2L0CA 1PTOC 2UU9L 1SXTA 1HDLA 2CWGA 5IP7H 1G291 2WAQE 3F1ZA 4C3IH 5FLMH 2JB1A 3A5ZB 1CQVA 4DNIA 2RA4A 2PQAB 4DV0L 2HHHQ 4B3MQ 4IUTA 5ELBA 5FO9B 1XNRL 4AMLA 2YU9H 1SYGA 4K0KL 1Y1BA 3SGQI 1AZPA 2UXBQ 5IP9G 4POFA 2VW9A 2ZM6L 5JAVA 2YTXA 4AQYQ 3AYHB 1FNVA 3FKIB 2PZWA 3I90A 3CF5A 3U9SA 2WGCA 3H91A 1LT5D 3E9IA 3F2DA 1GUOA 1ZYRD 3QB3A 4DPGA 3FDTA 3BYYB 4I65A 4YCVA 5L37A 1CSPA 3FVQA 1GHJA 5AFWA 1PTOF 2F0SA 2IX0A 1GD7A 4N9PA 3DUZA 2UUAQ 1JWSD 2WINB 3TOAA 2F4IA 3TS2A 1GM5A 1F77A 1TOTA 1S5BD 3ER0A 2NU1I 1BR9A 4E1RA 2V6EA 2EOTA 1DOKA 4HR7B 5EPJA 1ZXTA 3PIPA 2E2HH 3TP8A 3U4ZA 5FUVA 4K8JA 2B2VA 3CCMA 4A3DH 4JVZA 2ES2A 1J6QA 4IJLA 2B2UA 5COYA 3V96A 3PGZA 2IX1A 3PIO3 2JA5G 2BE5C 4CJ1B 3CQZH 4IURA 4PL3A 2NYZD 1X3QA 1HUMA 2HIVA 3PSIA 3A0JA 4GKKL 2K52A 3K80C 1N34L 4LF8L 1QNKA 4Q9VA 2F52A 4JI0Q 1I6HB 1LT4D 5FUWA 2HUGA 1JORA 2GKTI 4L5SA 3ONAB 2PCFB 3A8JE 4H13C 3JAMi 1Z2IA 4DR5Q 3DEOA 1Y1WH 1HR0W 1KAAA 4BS9A 3T51B 4Q5VA 1VF7A 3MFYA 5ELEA 3OWEB 1YHAA 3S17H 2I07B 1TWHB 3L3OC 2LXKA 2F0UA 2R7ZB 3K6OA 2C35B 4BY7B 1G2TA 4GKJQ 1TIHA 1TBOA 1SNQA 2WB1B 4LAAA 2F66B 3JAME 1EWIA 3NWTA 1YVCA 2ETDA 2WFWA 1DS3I 2RSOA 3OMCA 2PQEA 1PH9A 3HG9A 4C3JG 5EKIA 4KHPL 3S2HB 2NVYB 3L9AX 3GTGB 4DV2L 4F8MA 2CWHA 5IGDA 4LF6L 2NN6H 2NVTB 3MXGA 3PV0A 2MPMA 1AN8A 5D14A 1SYDA 1PH8A 1K3BC 1XMQL 3LJ2A 1IYVA 4SGBI 3T4AC 1A3VA 1GUTA 1SFOH 4L8JA 1RJTA 1FD7D 1Q7YC 1WCMB 3I7FA 1G91A 1EY0A 1C0AA 3J80c 3C46A 1VCIA 3VE5A 1IBML 1K83B 4HTHA 2PO4A 2ZXPA 2JA7H 1K8GA 2F0FA 3VR6A 4HEA1 1OXSC 4P71A 3CW2C 1BUVT 4PL5A 1B4OA 3D31A 3I4MG 3A7LA 2FEFA 3J7AF 5E3FA 2C5CA 4XT1B 1VQJA 4JC0A 2EY5A 2R93B 1CUKA 3MEFA 1BNZA 3ITPA 4RGMA 2WB1E 3R93A 2WAQG 1PMRA 2RF4A 4R8NA 4OAUC 5C4XH 4A4IA 1N13A 1AP0A 3SEKC 3NBHB 4KV6A 1B53A 2ZXRA 5DLQE 1JT8A 1Y8PB 2B8GA 4PZ7A 2H4OA 2F0IA 4RHSA 4DXFA 1PH1A 1EWCA 5KNCA 1UHAA 3ZYYX 1I50H 4K5WA 1PZID 2VB2X 1EYCA 4IFDJ 2KMOA 2YQPA 3HOWB 1FL0A 2IHFA 1IBKQ 4JI1L 5KIXA 2K05A 4DV1Q 1VQEA 4IOAA 2JB2A 2FFKB 2IT1A 1NMFA 1CZWA 4FP5D 2NVXH 3PO3G 1A6XA 2N1AB 4JYAQ 1TBRR 2B0UC 5J8CA 2K04A 4YWMA 3MHBA 1R79A 5EQ0A 1IYUA 1PYBA 3M7GA 4XYOA 3E0JA 2A19A 3QOJA 4DR2Q 1VQOA 3GTLB 1I4RA 2D9UA 4BXXG 3CCRA 4A24A 4NXNQ 3GD7A 5FO8B 2F0HA 2EYLA 4TQUS 1QZGA 1ENCA 1YHBA 2EJMA 3NSWA 5JVG3 2N71A 1KRTA 2EXDA 4B3SL 1IZ6A 1TWFB 4DK3C 1SNMA 4IPHA 5JEAG 1PPFI 1TGSI 3EROA 1S4ZA 2D62A 4EQOA 1F2MA 5CV6A 3W2DA 4OWWB 1NMGA 1XXGA 2KQ3A 2B8FA 4LUOA 2F0TA 3MXUA 3GTMB 5M5YH 3KUPA 5JJLA 1AW7A 4RH6A 1FYBA 2F0LA 4P73A 5A35A 4HCSA 4KTAA 2QQDA 3CAMA 1H9JA 5E4XA 1TS5A 3GOXA 2J9RA 1YIJA 4JI4L 5DM63 3IRBA 2CH4A 3ERSX 1A3TA 5NUCA 1CK1A 3GTQH 2AUJD 3GTOH 5HGQA 3E0EA 2NU3I 4ID6A 1II3A 4UXHA 4UAIA 1U9RA 1E2ZA 3X3NA 1T9HA 3PO2H 2AKWB 1KBEA 1FNWA 4A3EH 4Y52H 1LM0A 4ZUJA 3Q0AA 2JA6B 2XWJB 1C9OA 4G7HC 2I0QA 3FNBA 1IKLA 4DR1L 2PZUA 3S15H 2A5HA 3RN2A 2E2IB 1SGRI 5IGGA 4FF2A 2UXCL 3CCSA 1H9KA 1HFGA 1LV9A 1STYA 2NTTA 2DJGC 1F9QA 3TRZA 4A3FB 3I3CA 1O7ZA 4DUZQ 2HDMA 1HNZL 1IYJB 2PQAA 1RKNA 1V1OA 2F4VQ 3RNUA 2K5WA 2XVSA 1DJRD 1YZ6A 3BJUA 4LNQA 2N49A 5EKLA 1W6JA 1EY9A 2VQEL 2QQ0A 3OWFA 2K75A 4PZ8A 1UE1A 3M85A 3K5LA 1LTSD 1TVXA 2KCTA 4KJNA 2VUMG 4Z7HA 5C3EG 1YU6C 1EWHA 4RCOA 5C0XG 2XMXA 2VS1A 3PIP3 1YBYA 4KN4C 2B39A 3I4LA 1F9RA 1PYSB 4DU9A 4PQXA 1NE3A 5LHY1 5IP7G 5CBAE 1WD1A 3UDIA 2MNAA 4C3IG 4MIUA 2ARPF 1CE3A 3D6CA 5CV4A 1I5FA 3CXLA 3X3MA 1ULKA 3S1MH 1WGCA 1TS4A 5M5YB 4Y7NH 2F0EA 1UEBA 4JV5L 3HKSA 1LR7A 1W3SA 1SGDI 3OSOA 1NR2A 5IGEA 2VQFL 5M3FB 3NXWA 3SK4A 1K7UA 2UZ3A 1EY7A 1G6PA 4JCVE 1X3EA 4MPIA 1B1ZA 4GXTA 2G5DA 2B2TA 1O7IA 4X3TA 3VYRA 1NXUA 1EOVA 3KBXA 3GTQB 4OHJA 4WFN3 1F9PA 4K6DA 1F2YA 3SVMA 3GTOB 2V4DA 3L2PA 4A3LH 4DAPA 5IT9L 3TSSA 2UVOA 3I8ZA 1OYVI 5EJWA 1A0IA 2G9DA 2A6HD 1YTPA 2ZT9C 3C3LA 2KMPA 4O42A 1L0WA 4JI7Q 1PDQA 2JEBI 5IGCA 2UUCL 1W6KA 4HEDA 1CT2I 1FGBD 2FJ2A 2JN4A 4C3JH 1T5EA 1HPTA 1E2WA 1NY4A 1AN1I 3HOXH 1HZBA 2Q2HA 3FP9A 2RQXA 1QVCA 4C2MB 3UDXA 5C44G 3IL8A 1BCPB 3BZCA 1VQ4A 1TXYA 2EJFC 2ASBA 3J7AV 1Q90A 2ERWA 2H5XA 2E75C 3PIOA 2F6MB 4DR3Q 2P5ZX 1WTPA 1FJGQ 2Q2IA 1HPCA 4OWXB 4CDEC 2LKVA 4A75A 2SGFI 2O2LD 5ELCA 3Q6SA 3V2TA 3H0GB 2VXWA 3D4WA 4R4TA 1DOMA 2A68D 1PH6A 1YHQA 4X65L 1PFBA 1WYDA 2XSCA 2A6HC 3QWNA 4I7AA 2UXDL 3QIAA 2QZGA 1DYQA 5DAUA 1IKMA 1QUQB 5EPLA 4YZCA 1Y1WG 1CT4I 1R9TH 5EAYA 5BN5A 4A3KH 4X66L 3OTOL 3FHWA 1O7LA 4QUFA 5ELFA 1SROA 4B3TL 1CGII 3RUZA 2JA5B 2CW0D 2O4XA 1VMCA 1X3FA 5GAGC 2KVMA 4F7XA 1G2SA 1VQDA 2ORVA 1TWAH 1PH3A 2LSSA 4HIOA 1R4PB 2L55A 5KNBA 3DLLA 1DGSA 4BBRH 1K8OA 4UXJA 2ELIA 4OELB 3K57A 3H6MA 3S1QB 3S9WA 2XTRA 2DGYA 2NN6G 1XJVA 2CQOA 4XIGS 2N8NA 2SDFA 4JPBW 4B08A 4MNOA 4EQPA 2VRWB 5LMNQ 3F2UA 5FUYA 2NZOA 1NTGA 4OO1I 2ZJRA 2UXBL 4AQYL 4JI2Q 5KEEA 3R5BA 4NV5A 2K7VA 2KEDA 3KDFB 2HCCA 1S20A 3BU2A 3NELA 4G57A 1MJCA 1HQRD 1W4RA 3EIVA 2BDOA 1VMPA 3AJFA 3NBHA 4M1UB 4TRDA 1WVLA 3A56A 5ELDA 2RDGA 1DS2I 3CCVA 4ILWA 4UP7A 2UUAL 1PTRA 1YNJD 2AWOA 3LNNA 3DXJC 1IXRA 3HOYH 3OXGA 2YTVA 4RMFA 3VYTA 1KLUD 3HOVG 2I5LX 3GP7A 2E5RA 1KDBA 1CT1D 2F0DA 1K3RA 4GNXB 2B63H 4NP5A 2R92G 5LMUQ 5C4XG 1ZEQX 1MSHA 1GKHA 1XMOL 1GJXA 4RGNA 3I4MB 1EIFA 5C4JB 4E1PA 1HH2P 3HOUH 2KMQA 4ALPA 5CGKA 3RZDH 2QSBA 2I5HA 5I6WA 4DR5L 1J5EQ 5KRUA 2DB6A 5AJ3Q 4KKTA 1S5DD 2JA8G 1HUNA 2JA1A 2PI2E 4PMBA 3C1EA 1P16A 3UFFA 4L63B 2WAQB 3BDLA 4OEMB 5ELOA 2QGQA 3LGJA 4GLVB 3CC7A 4EX5A 2BH2A 4DV3Q 4GKJL 1KL9A 4OAVB 1WTWA 1HNWQ 1O7YA 1LT3D 4ABNA 2WCYA 4DV6Q 2YYZA 3DHQA 4B9XA 2F0OA 1HFNA 3K81C 4JI8L 3TP7A 5TSSA 3R5CA 4R4CA 2SGDI 1EQRA 4FXKC 2MO0A 3K7AH 1QILA 1SYBA 4ODGA 2V53A 3UEJA 1RTNA 1B50A 4K5XA 2AQ1B 4X62L 5GROA 3IAM1 2CHBD 2N88A 1JJ2A 2KBNA 4DR7Q 5CCMA 2YV5A 2X69A 3PO3B 1HR0L 3H3VI 3JAMc 3TP5A 4JI6L 4CKBA 2DUDA 2NU2I 1EEFD 1Q86C 5IYBH 4P2CB 1K8MA 3AQQA 2SGEI 3RLOA 5I4DA 1M8AA 3OW7A 3GTPH 7WGAA 1QNUA 3NQTA 3LWEA 1VQ9A 3A8IE 2CCZA 2ATWA 1K0SA 4ZKCB 5HGTA 4Z7GA 2VUMH 2Z1CA 2OTLA 1JQYD 2EXZA 4DR6Q 4YWKA 2Z6KC 1EY4A 3VR5A 2NTSA 1S72A 1K7TA 3KLSA 2IX3A 3I9V1 3GQBA 4A3GG 3R5AA 3GTJB 1PRTB 1EUJA 1SGQI 3SE0A 3S1NB 4QGUA 1L2FA 3URYA 2E5LQ 2QKIC 3PO2G 4EGVA 1UE6A 4A3EG 2VZAA 1CTMA 1D7QA 2LB7A 1KLGD 1FNUA 4C1NK 5EX3A 1TBQR 3ZJYC 4TSSA 1YEZA 3J81L 3FC3A 2B29A 2WKCA 4J1MA 4LF4Q 1JE5A 2LXJA 2OXPA 4C1NI 2E2JH 4MTKA 1OXXK 4WJ4A 4GN3B 4OGQC 1TY2A 2BE5D 1WOCA 3TZDA 4CDDC 5J3BA 1IBKL 4MN3A 1LR8A 4OXPA 2CQAA 3VDYA 1JMCA 3Q22A 3KF8B 2BA1A 4EQ5A 4LFCQ 2JXMB 3PUVA 4DV1L 1ET9A 1KDCA 2L5TA 4UPAA 3J7ZC 1HRJA 3ND8A 2WIIB 4A3CH 1HTLD 2BL8A 1BUSA 5CV8A 3SEBA 5KNDA 4JOIA 4LUZA 4R4OA 2A69D 1B9NA 1D5ZC 5EBDA 5K5PA 1Y1VH 5C44H 1PTOB 4ME3A 4DR2L 2DJFC 1JOKA 5FK9C 1Q9BA 3UITA 2BL7A 1DM0B 4IUPA 5GAHC 4NXNL 2NZ1D 5HI7A 5IY0A 3RU0A 2DY7A 3BDOA 5IGFA 3G48A 4DV5L 4BY1B 3QJYA 1CQFA 4HCEA 2Q8TA 1EYAA 5D3IB 4O1NA 1PZKD 1LTGD 3UI2A 3BJIA 1VS0A 5EX0A 3G7LA 3WDNA 5I9OA 2SGPI 2K03A 1NJIC 1Q8KA 2HQLA 2K33A 4CHTB 1YJWA 2JBWA 2A6EC 3DWQA 3UE1A 3L7ZC 3PMFA 1UEAB 4QF4A 2A69C 1ICFB 1TWCH 5C3EB 3KJOA 1EL0A 3BYTB 3LJ0A 4C56C 5BN3A 4M8AA 5J8FA 4IUVA 2FMCA 4A3JH 2CJSC 1SLJA 4WJ3M 4AS3A 2ENZA 4XQQA 1Q82C 3F4MA 4A3LG 1I4QA 1SSOA 2QILA 1TU2B 2QW7A 4C3IB 3C1FA 1PXUA 5FLXL 5GADC 4LF7L 1EIHA 3SK6A 3K8AA 5FJ8H 1I4GA 1UUPA 1CKOA 1VQNA 2K19A 4OIJA 5CORA 4FYDA 4L5TA 2YU9B 5JPMC 2L12A 4CBVA 4YZ9A 1QUQA 3NE5B 2J0TD 4YCUA 1B2TA 1EY5A 1QWYA 1B8AA 3HOXG 1CHQD 4IOCA 3RZOH 5GAEC 2K32A 1NNXA 1I4PA 3FSYA 1RL2A 1E24A 2A8VA 1STGA 4OVOA 1PJUA 2ALYB 4A3IH 1YNNC 4OX9L 1ML0D 2SOBA 1FVIA 1JQOA 1CM9A 2V1CC 3OW2A 2QQEA 5CBEE 2YFBA 1QG7A 3KLSX 2N52A 4QJFA 4WORA 4NXML 1WTVA 1PFSA 4PV1C 3SDZA 4DUZL 1VQPA 4LFBQ 2RHSB 2E2HB 4LF5Q 4A3KG 2L7XA 1Z47A 1SGNI 3I73A 4A3DB 1IBLQ 2K4KA 1MSGA 3W1BA 4Z9CB 1MHWC 2PI2A 2UUBQ 2SNMA 5C4HA 2ENBA 5M3MH 3CQZB 3WOFA 1ENAA 3KDFA 3VDUA 2E74C 4DKAC 1E1TA 3HOVH 4HIDA 1S5FD 1Q3LA 3FPPA 4A93G 3BVMA 3UE0A 5CV9A 4J8QA 4R9WA 4GOPB 4BBRG 4O1OA 2R92H 1I94L 2ORWA 3L0IA 3MZ5A 1Y1WB 2X6GA 1TWCB 1SMYD 2RKSA 2PZTA 1WD0A 3ULJA 3S17B 3M4OH 1PYWD 4POGA 3D8GA 1AZQA 1BKBA 2P6AC 2R3ZA 2JA8H 1VQMA 1BMOA 1RCVD 5IT9E 3CCUA 1P9GA 4GNXA 1CHOI 3T56B 1OTCA 1S5CD 2ZM6Q 1PHJA 4IFDG 1X3PA 1Q46A 2R6GA 4A3MG 3WOEA 1CI3M 3HZXA 1GUWA 1IW7D 3TZUA 1LTLA 5JPNC 1SJED 2HIXA 4QIWE 3IAS1 1LLRD 2EYFA 3U9OA 1X32A 4R4QA 1SMYC 1SN8A 3S14H 1SFOB 5EGTA 5KYIA 1IL2A 4EQNA 2A74C 3U50C 3HOYG 1ULMA 3OPOA 4U6RA 4KI0A 3VR3A 4PMWA 3S16H 3R5DA 2D0PA 3NEMA 2IWHA 4AYBG 4K8IA 1WI5A 4RFBA 2JA7B 4LJZC 4DR3L 1FJGL 1GVPA 3KFUA 2F0PA 3DM3A 2B63G 1CSOI 1D5MC 4RG1A 1MJBA 2DNEA 1K9MC 1BBWA 3HGBA 3LX0A 2RVLA 3MXNB 3T1YL 4IO9A 1Y14B 1PV4A 1IW7C 2KOLA 1TR5A 4IUUA 1E1OA 4DV7Q 1Z7TA 1HZAA 3HOUG 3J81j 3K0YA 3BZKA 1MT1A 1RHPA 1F2ZA 4LMQD 4DXGA 1N34Q 1JE4A 3A55A 1S3OA 1J8IA 1N32Q 2AUKA 4N8FA 2K28A 2F0NA 3PUYA 1M8CA 2ZRRA 5DM73 1IW4A 4C3HH 2EYJA 2RDFA 5C4XB 1P9ZA 2BDNA 1B9MA 1N33Q 3HOZH 4L6TB 4A3GH 4UDUC 3UEYA 1JJCB 2GVBA 4JBMA 2BUSA 3QO2A 4DAYB 1O80A 2PNRC 1MKHA 1UE7A 4P74A 1I50B 2QDBA 2OD1A 1I6VC 2B3GA 1O78A 1HZCA 3OXLA 1JOOA 5C0XI 2F3IA 3JC66 1E3PA 1RDPD 1M1KC 5C5LA 1VQ7A 3PUZA 4X3UA 2XTIA 5LMNL 2PNHA 2M9VA 1D5XC 4O0AA 4DV2Q 1XPRA 2NVXB 1BBXC 2R7DA 1U4LA 1SJHD 1EY8A 1VQAA 3QOLA 2IHEA 1V1PB 3GO5A 1PH4A 2AMCB 1SE4A 5IYBG 4HAEA 2FU2A 1ILPA 2LEOA 1TBNA 5EKKA 2JQOA 3AFPA 5LL6X 1VQIA 5BR8Q 3CHBD 1LTID 1OMUA 1HJPA 1SDFA 1I4XA 3G6JB 2E2DC 3K7UC 4QMGA 1IBMQ 2FNFX 5ISRA 4PMCA 1STAA 1VQCA 3A7AB 5M5XH 1LYLA 4KJOA 4CDFC 1U4RA 2CAZB 2CVRA 2B2VC 1Q81C 4K2LA 4OIKA 5DNFA 3KF8A 4LFAQ 3VA5A 3HEJA 3K58A 2B2UC 3SR1A 2K6AA 1KC8C 4GLAC 4P72A 4BBSG 2JAEA 1KXLA 1SE3A 1NR4A 2F0MA 3TBIB 1SGEI 1KTKA 2DN8A 2MUYA 2XWBB 5LMUL 3SK5A 1FAQA 2NB0A 2CH4W 1XBTA 4WRDA 1N36L 1BCPC 3D6WA 1P8LA 5CV5A 4HJ5A 1XNQQ 3M4YA 5C6AA 4FXDA 4OL7A 3I2ZA 4Q0FA 1J5EL 4JBKA 1WJJA 1D2BA 2OZUA 4HIMA 3B4VC 4A3GB 5CCLA 3CRLC 4G4KA 4DK0A 3D3RA 1H95A 3TN2A 2NU4I 1E0BA 3PO2B 4UP9A 1DZ1A 4A3CG 4A3EB 1M8BA 2PYKA 1UVGA 3S2DH 1J9OA 1I3QH 3MTSA 3KLWA 1Y1VG 4JI5Q 2GA4B 2Z6BA 3Q8DA 3S15B 1U5KA 4K6LA 1L1OB 5F2DA 5J1ZA 1SNDA 2KECA 3I4OA 4FF3A 1WCMG 4X64Q 2RBMA 2MO1A 1BCPF 3JSBA 4FVMA 1V1HA 2B2WA 1HA5A 3BVGA 4DR7L 2EDGA 2DKVA 3T53B 3HKZG 2NN6I 1EZ8A 4G7OC 1ESRA 2OCEA 3TO9A 5I9PA 1YITA 5EBCA 5LMNW 1LO5D 1HJAI 3EA6A 2K5QA 4A3BH 2JK8A 3VA7A 3P20A 3S1RH 3HRZC 2M2LA 4KK7A 3GTKH 4A3JG 5D65A 3MAQA 3F2CA 1SNCA 4DAVA 2B8TA 5FJ8G 2Q2UA 3DWAA 1A62A 4A93H 3S1MB 4LF9Q 4DR6L 4RWSC 2QEJC 2RADA 2IY5B 2SGQI 4DR4Q 1LT6D 1WTRA 4Y7NB 4DNTB 1F2LA 3K59A 3G4SA 4JBJA 3OHXC 1JJGA 1BOSA 5J22A 1CGJI 1LACA 4KMUC 1B3QA 3T16A 2HHHL 4B3ML 4U68A 3J81E 2E5LL 1EQVA 1XTCD 4A3IG 4BA1I 2GIVA 2RIJA 1STBA 2NVQH 3AFQA 1VDDA 3J80L 1JCKB 4XQNA 4KHZA 3KBGA 2JW6A 1HNXQ 2ZTCA 1QB5D 2BCOA 3NWSA 3H09A 5DEHA 1X65A 2L15A 2WACA 1V43A 4GOPA 1XYIA 1CZGA 2TMPA 4IFDH 2OTJA 1IY6A 2MP1A 1EFWA 5M5WH 1U4PA 3KF6B 4A3MH 1SMXA 5IGBA 3NQIA 5E4WC
chains in the Genus database with same CATH topology
4GLXA 3RR5A 4LFCL 3ICEA 4NB3A 3B6YA 3UGIA 5E7NA 4GI3C 5HGIA 1VQGA 1Q1EA 1HNZQ 5M3MG 4HJ9A 2GKVA 2KENA 2DIPA 1TWGH 2RHQB 4DAMA 1VQLA 2KHJA 2JE6I 1A63A 2VL6A 2ZJPA 4JI0L 1SGPI 1K73C 2ZJQA 3D00A 3I4NH 2K5NA 3M3YH 2PMZE 4FDBA 3TJQA 2NZHA 3DA3A 4B3RQ 4G76A 1EIYB 1X3GA 4DWLA 4YCWA 4OWTB 2AWNA 3CC2A 3CC4A 4L5RC 1KMAA 2RCNA 3U4VA 1V9PA 2E8GA 3G6EA 1YO7A 1C7YA 5IE8A 3FKIH 1KD1C 2UUCQ 2LUYA 3PUWA 3KY9A 4A3FG 1X56A 3M4PA 4O1PA 5IYDG 2EIFA 1OXTA 1N8RC 5IWAQ 2A2CA 5JJKA 2K5VA 4LF5L 3CMEA 3EN2A 1VQ5A 2UUBL 2P22B 4X66Q 3OTOQ 3KOJA 1I6HH 4PZ6A 3HOZG 4BBSH 2K5HA 4R4IA 4DUYQ 4JG2A 1TUSA 2N78A 1PVOA 3T1HQ 4P75A 5GQOA 1PH5A 1TWHH 1VQHA 4GN4B 2R7ZH 4BY7H 2CFMA 3VDPA 2YFAA 4GS3A 4JI3Q 5DAEA 4HIKA 1Z7KB 2JXDA 1QZHA 3S2HH 2NVYH 3GTGH 1ASZA 2NVTH 4JYAL 1V1QA 4O2DA 3ULPA 2J87A 4NV2A 3NENA 1SRUA 3W5OA 4TVAB 3CD6A 1WCMH 3H0GG 4AYBE 5IT9c 3SGBI 2Y0SG 1K83H 3W1GA 3FBVA 2M5XA 4PL4A 2CKZB 4YZDA 2A2DA 2NU0I 1K0RA 3SDJA 5JJIA 1PA6A 4B6DA 1L1OA 4DV7L 1B7YB 1PTQA 1XMOQ 2R93H 3CXCA 3CMAA 4AS2A 1HZ9A 4IJHA 1N32L 5IYCH 1XPUA 2YUUA 1N33L 1AE2A 2KCMA 2OQKA 3M4QA 4IPGA 3HOWH 1JB7A 3TQYA 1E7ZA 2XGTA 1LUZA 3TEHB 2GVAA 4JI8Q 4UY8C 4GOPC 4X62Q 2WVJA 2OWOA 3GTLH 2F4VL 1KIXA 4PG3A 4KLKA 4A3BG 1HR0Q 1SGYI 1S40A 4DV4Q 1XX6A 5BR8L 4JI6Q 1KRSA 3TS0A 4IFDI 4YY3Q 3CPWA 1Y8FA 3L0OA 3KF6A 1K8AC 2K50A 4QQBX 1QVGA 1TWFH 4LFAL 4YHHQ 3KP9A 4R1JA 3S24A 3GTMH 1M90C 2UU9Q 3RLFA 1Q12A 3F8TA 3I56A 3CCJA 3PF5A 2MFIA 4AH6A 1EYGA 4DV0Q 2YTYA 1NBWA 1XNRQ 4K0KQ 1XNQL 1XPOA 1OVOA 4QL5A 3EBEA 4IPCA 3M7NA 1OMTA 1UE5A 1FARA 4JI7L 2CWPA 1CKNA 1VQFA 2JA6H 4X6AH 3J7A5 2E2IH 4JI5L 2ROWA 2QPOA 4A3FH 4X64L 1SR3A 3M9BA 3HKZE 5IYDH 4LUVA 2Z0SA 1D8LA 1B70B 3A74A 1MIUA 2EQSA 4DV5Q 3I4NG 5HQ8A 4GKKQ 1VQ8A 5JEAJ 4LF8Q 2A1AA 4OONA 1H0ZA 1CKMA 1G51A 1TURA 1OXUA 1A8VA 1LR9A 3J80i 1RIPA 1CT0I 2A20A 3A5UA 4GN5A 1X4SA 2MQHA 4I1TA 4LF9L 3OXFA 3KYHC 4DR4L 4LF7Q 3CCLA 3FKIG 2N3SA 4FKDA 2RIOA 1Q1BA 1GO3E 5M3FH 5ELNA 3UDFA 4KHPQ 1NUBA 4LF6Q 4JI2L 3H3VH 3I55A 1HNXL 3UGLA 1XMQQ 2KKMA 3LJ1A 5IP9H 4OX9Q 3CCQA 3QWPA 4C2MH 3U58A 2CWAA 3H15A 3UGDA 2JYYA 4APVA 3J81c 3KJPA 4JOIC 2BA0A 2OVOA 4NXMQ 1RFHA 4L5QA 1VQ6A 3H0GH 4BY1G 2K14A 3AEVA 5C0XJ 4BA2I 1UVFA 1YNXA 4YWLA 3ULLA 2Q2TA 2Z6KA 3UDGA 2N17A 1KBFA 1YJNA 1E22A 2JA5H 1I94Q 1AE3A 1L1OC 2AHOB 2R7ZG 5FLMG 4BY7G 2WB1G 5AJ3L 3OVOA 5HY6A 4L9MA 3P23A 4B3RL 1XA6A 3VA9A 2F3CI 2R7FA 2KMRA 3HFZB 3S1QH 4JI1Q 1X55A 4MZ9A 1PH7A 1R0RI 4DV3L 3DO9A 2D0OA 1HNWL 2VY3A 4DV6L 3RLNA 3RN5A 3OYYA 5FLXc 3QTLD 4HFVA 4LWCA 1OXVA 2OQ0A 4HJ8A 2ODDA 1ASYA 4AIMA 1Z9FA 2L8EA 1N9WA 1UWVA 2XTQA 2ZTDA 4A3DG 3HH2C 2ENNA 5LNK1 2BH8A 1YI2A 4B3SQ 3OL0A 3T1YQ 1CSQA 1X54A 2R93G 5IWAL 3J81i 4G75A 4HJAA 5H1SE 1IY5A 2JA9A 2JJQA 5IYCG 5JHWC 2FUG1 5FUXA 3PCOB 2ID0A 3I4MH 5C4JH 4JI4Q 3D0FA 4DUYL 2XRCA 3HOWG 3TREA 3T1HL 1U0LA 1XTDA 4HJ7A 2MJFB 4LF4L 4DK6C 1QVFA 3MEKA 1AH9A 1X9NA 1FGUA 4GNXC 4DR1Q 1VQBA 4JI3L 2I5MX 4A76A 3GDEA 3E59A 2UXCQ 1X74A 2KHIA 1KHIA 2V1CA 2JEAI 4IPDA 2QQCA 2VNUD 1WFQA 2JA7G 2FXQA 3PO3H 2VQEQ 2Y0SE 2L1LB 4XTCS 1EQQA 3PUXA 1BVSA 2KCXA 2GVIA 4BXXH 2W0TA 4MTNA 1W2BA 4LW1A 3DA4A 1X6OA 4H02A 1CKNB 3CPFA 4OO1G 1PCEA 4JBWA 1KAWA 3E9HA 3STBD 4JV5Q 3GTJH 1UUCA 3K0XA 1N36Q 3S1NH 2VQFQ 2E73A 3E2IA 3CCEA 1MJEA 3PF4A 2GN5A 2WP8J 2JZMA 1YJ9A 2JA6G 1Y1CA 1SE8A 2QA4A 2ZTEA 2HT1A 3STBC 1PH2A 3F2BA 1V1IA 2IP6A 4X65Q 4LFBL 4J15A 2UXDQ 1IBLL 3WWVA 4DV4L 2K9HA 4UP8A 1KQSA 4BY1H 4UXIA 4HGUA 4YY3L 3SGIA 2GKRI 4B3TQ 2JB3A 2QEXA 1BBUA 4NPSA 3G71A 5K36G 1SJ8A 5C3EH 1VQKA 4YHHL 3PDNA 3CP0A 5M3FG 4QY7A 2UU9L 5IP7H 1G291 2WAQE 3F1ZA 4C3IH 5FLMH 2JB1A 3A5ZB 4DNIA 2PQAB 4DV0L 2HHHQ 4B3MQ 1XNRL 2YU9H 4K0KL 1Y1BA 3SGQI 2UXBQ 5IP9G 4POFA 2VW9A 2ZM6L 4AQYQ 2YTXA 3AYHB 3CF5A 3E9IA 3F2DA 4DPGA 4YCVA 1CSPA 2IX0A 1GD7A 2UUAQ 3TS2A 1GM5A 1TOTA 2NU1I 3ER0A 4E1RA 2V6EA 3PIPA 2E2HH 3U4ZA 5FUVA 3CCMA 4A3DH 2ES2A 1J6QA 4IJLA 3PGZA 2IX1A 2JA5G 3CQZH 4PL3A 2HIVA 3PSIA 3A0JA 4GKKL 2K52A 3K80C 1N34L 4LF8L 4Q9VA 2F52A 4JI0Q 5FUWA 2GKTI 4L5SA 3JAMi 4DR5Q 1Y1WH 1HR0W 1YHAA 3S17H 2LXKA 2C35B 4GKJQ 1TIHA 1TBOA 2F66B 1EWIA 1YVCA 2WFWA 1DS3I 1PH9A 4KHPL 4DV2L 4LF6L 3PV0A 1PH8A 1XMQL 3LJ2A 4SGBI 1SFOH 1Q7YC 3I7FA 1C0AA 3J80c 1VCIA 3VE5A 1IBML 2JA7H 1K8GA 4HEA1 1OXSC 4P71A 3CW2C 4PL5A 3D31A 3I4MG 4JC0A 1VQJA 1CUKA 3MEFA 2WB1E 2WAQG 2RF4A 4OAUC 5C4XH 4A4IA 1N13A 3SEKC 3NBHB 5DLQE 1JT8A 4PZ7A 1PH1A 1I50H 4IFDJ 2KMOA 2YQPA 1FL0A 2IHFA 1IBKQ 4JI1L 4DV1Q 4IOAA 1VQEA 2JB2A 2IT1A 1NMFA 2NVXH 3PO3G 2N1AB 4JYAQ 1TBRR 2B0UC 4YWMA 1R79A 1PYBA 2A19A 4DR2Q 1VQOA 4BXXG 3CCRA 4A24A 4NXNQ 3GD7A 4TQUS 1QZGA 1YHBA 2N71A 1KRTA 2EXDA 4B3SL 1IZ6A 4DK3C 4IPHA 5JEAG 1PPFI 1TGSI 2D62A 4OWWB 1NMGA 4LUOA 5M5YH 5JJLA 1FYBA 4P73A 2QQDA 3CAMA 3GOXA 2J9RA 1YIJA 4JI4L 3IRBA 3ERSX 3GTQH 3GTOH 5HGQA 3E0EA 2NU3I 4UXHA 1T9HA 3PO2H 2AKWB 1KBEA 4A3EH 4Y52H 1LM0A 1C9OA 2I0QA 4DR1L 3S15H 3RN2A 1SGRI 2UXCL 3CCSA 3TRZA 4DUZQ 1HNZL 1IYJB 2PQAA 2F4VQ 3RNUA 1YZ6A 3BJUA 4LNQA 2N49A 2VQEL 2QQ0A 2K75A 4PZ8A 1UE1A 3M85A 2KCTA 2VUMG 4Z7HA 5C3EG 1YU6C 5C0XG 2XMXA 2VS1A 1YBYA 1PYSB 1NE3A 5IP7G 3UDIA 2MNAA 2ARPF 1CE3A 1I5FA 3CXLA 3S1MH 4Y7NH 1UEBA 4JV5L 3HKSA 1LR7A 1W3SA 1SGDI 2VQFL 2UZ3A 1G6PA 4JCVE 1X3EA 1HDLA 4GXTA 1O7IA 1EOVA 4A3LH 3L2PA 1OYVI 1A0IA 1YTPA 2KMPA 1L0WA 4JI7Q 2JEBI 2UUCL 1CT2I 4C3JH 1HPTA 1NY4A 1AN1I 3HOXH 1HZBA 2Q2HA 3FP9A 1QVCA 3UDXA 5C44G 3BZCA 1VQ4A 1TXYA 2ASBA 2ERWA 2H5XA 3PIOA 2F6MB 4DR3Q 1FJGQ 2Q2IA 4OWXB 4A75A 2SGFI 4R4TA 1PH6A 1YHQA 4X65L 1WYDA 2UXDL 1QUQB 4YZCA 1Y1WG 1CT4I 1R9TH 5EAYA 4A3KH 4X66L 3OTOL 3FHWA 1SROA 4B3TL 1CGII 1X3FA 5GAGC 1VQDA 2ORVA 1TWAH 1PH3A 2LSSA 4HIOA 3DLLA 1DGSA 4BBRH 4UXJA 2ELIA 2XTRA 2DGYA 2NN6G 1XJVA 2CQOA 4XIGS 2N8NA 4MNOA 2VRWB 5LMNQ 5FUYA 2NZOA 1NTGA 4OO1I 2UXBL 2ZJRA 4AQYL 4JI2Q 4NV5A 3KDFB 3BU2A 3NELA 1MJCA 1W4RA 3EIVA 3AJFA 1DS2I 3CCVA 4UP7A 2UUAL 1PTRA 2AWOA 1IXRA 3HOYH 3OXGA 2YTVA 4RMFA 3HOVG 2I5LX 2E5RA 1K3RA 4GNXB 2B63H 2R92G 5LMUQ 5C4XG 1GKHA 1XMOL 1EIFA 4E1PA 1HH2P 3HOUH 2KMQA 4ALPA 3RZDH 2I5HA 4DR5L 1J5EQ 2DB6A 5AJ3Q 2JA8G 2JA1A 2PI2E 1P16A 3UFFA 5ELOA 2QGQA 3LGJA 4GLVB 3CC7A 4EX5A 2BH2A 4DV3Q 4GKJL 1KL9A 4OAVB 1HNWQ 2WCYA 4DV6Q 2YYZA 3K81C 4JI8L 4R4CA 2SGDI 1EQRA 2MO0A 3K7AH 2V53A 3UEJA 4X62L 5GROA 3IAM1 1JJ2A 2KBNA 4DR7Q 5CCMA 2YV5A 1HR0L 3H3VI 3JAMc 4JI6L 2DUDA 2NU2I 1Q86C 5IYBH 3AQQA 2SGEI 3RLOA 3GTPH 1VQ9A 2CCZA 2ATWA 4Z7GA 2VUMH 2OTLA 4DR6Q 4YWKA 2Z6KC 1S72A 3I9V1 4A3GG 1EUJA 1SGQI 4QGUA 1L2FA 2E5LQ 3PO2G 1UE6A 4A3EG 2VZAA 1D7QA 5EX3A 1TBQR 3ZJYC 1YEZA 3FC3A 2B29A 4LF4Q 1JE5A 2LXJA 2E2JH 1OXXK 4WJ4A 4GN3B 1WOCA 5J3BA 1IBKL 1LR8A 4OXPA 3VDYA 1JMCA 3KF8B 2BA1A 4EQ5A 4LFCQ 3PUVA 4DV1L 4UPAA 3J7ZC 4A3CH 1BUSA 4JOIA 4LUZA 4R4OA 1Y1VH 5C44H 4ME3A 4DR2L 3UITA 5GAHC 4NXNL 5HI7A 5IY0A 3RU0A 3G48A 4DV5L 3BJIA 1VS0A 5EX0A 2SGPI 1NJIC 1Q8KA 2HQLA 1YJWA 3UE1A 3L7ZC 1TWCH 3KJOA 3LJ0A 4A3JH 2CJSC 1SLJA 4WJ3M 4AS3A 2ENZA 1Q82C 3F4MA 4A3LG 4LF7L 5GADC 5FJ8H 3K8AA 1CKOA 1VQNA 2K19A 4L5TA 4YZ9A 1QUQA 4YCUA 1B8AA 3HOXG 4IOCA 3RZOH 5GAEC 1RL2A 1E24A 2A8VA 4OVOA 1PJUA 2ALYB 4A3IH 4OX9L 1FVIA 2V1CC 3OW2A 2QQEA 2YFBA 2N52A 4QJFA 4NXML 1PFSA 4DUZL 1VQPA 4LFBQ 2RHSB 4LF5Q 4A3KG 2L7XA 1Z47A 1SGNI 1IBLQ 2K4KA 3W1BA 2PI2A 2UUBQ 5M3MH 3KDFA 3VDUA 4DKAC 1E1TA 3HOVH 4HIDA 4A93G 3UE0A 4GOPB 4BBRG 4O1OA 2R92H 1I94L 2ORWA 3L0IA 3ULJA 3M4OH 4POGA 1BKBA 2P6AC 2JA8H 1VQMA 1BMOA 3CCUA 4GNXA 1CHOI 1OTCA 2ZM6Q 1PHJA 4IFDG 1Q46A 2R6GA 4A3MG 1LTLA 2HIXA 4QIWE 3IAS1 4R4QA 1SN8A 3S14H 1IL2A 3U50C 3HOYG 4U6RA 4KI0A 4PMWA 3S16H 2D0PA 3NEMA 4AYBG 1WI5A 4DR3L 1FJGL 1GVPA 3KFUA 3DM3A 2B63G 1CSOI 4RG1A 1K9MC 1BBWA 3T1YL 3MXNB 4IO9A 1Y14B 1PV4A 1E1OA 4DV7Q 1HZAA 3HOUG 3J81j 3BZKA 1MT1A 1N34Q 1S3OA 1N32Q 1M8CA 3PUYA 2ZRRA 1IW4A 4C3HH 1N33Q 3HOZH 3UEYA 4A3GH 1JJCB 2GVBA 4JBMA 2BUSA 4DAYB 1MKHA 1UE7A 4P74A 2OD1A 2B3GA 3OXLA 1HZCA 5C0XI 2F3IA 3JC66 1E3PA 1M1KC 1VQ7A 3PUZA 2XTIA 5LMNL 2PNHA 4O0AA 4DV2Q 1XPRA 2R7DA 1VQAA 2IHEA 3GO5A 1PH4A 2AMCB 5IYBG 2LEOA 1TBNA 2JQOA 3AFPA 1VQIA 5BR8Q 1OMUA 1HJPA 3K7UC 1IBMQ 2FNFX 1VQCA 5M5XH 1LYLA 2CAZB 1Q81C 4LFAQ 1KC8C 4GLAC 4P72A 4BBSG 2JAEA 1KXLA 1SGEI 5LMUL 1FAQA 1XBTA 1N36L 1P8LA 1XNQQ 4HJ5A 1J5EL 3I2ZA 4JBKA 1WJJA 4HIMA 3B4VC 5CCLA 1H95A 2NU4I 4UP9A 1M8BA 4A3CG 1UVGA 3S2DH 1I3QH 3KLWA 1Y1VG 4JI5Q 3Q8DA 1U5KA 1L1OB 3I4OA 1WCMG 4X64Q 2MO1A 3JSBA 1V1HA 4DR7L 3HKZG 2NN6I 2OCEA 1YITA 5LMNW 1HJAI 4A3BH 2JK8A 3S1RH 3GTKH 4A3JG 3F2CA 2B8TA 5FJ8G 2Q2UA 1A62A 4A93H 4LF9Q 4DR6L 2IY5B 2SGQI 4DR4Q 3G4SA 4JBJA 1JJGA 1CGJI 4B3ML 2HHHL 2E5LL 4A3IG 4BA1I 2NVQH 3AFQA 1VDDA 4KHZA 2JW6A 1HNXQ 2ZTCA 1X65A 2L15A 4GOPA 1V43A 2OTJA 1IY6A 1EFWA 5M5WH 3KF6B 4A3MH 1SMXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H0G H;  4BY1 G;  4GLX A;  1CUK A;  3RR5 A;  4LFC L;  3MEF A;  3ICE A;  3ZJY C;  1YEZ A;  4NB3 A;  3B6Y A;  2B29 A;  4LF4 Q;  1JE5 A;  2LXJ A;  2E2J H;  2K14 A;  3AEV A;  1OXX K;  5C0X J;  2WB1 E;  4GN3 B;  4BA2 I;  4WJ4 A;  2WAQ G;  5E7N A;  2RF4 A;  1VQG A;  1YNX A;  1WOC A;  5C4X H;  5J3B A;  4A4I A;  4YWL A;  1IBK L;  1Q1E A;  3NBH B;  4OXP A;  1HNZ Q;  3ULL A;  3VDY A;  1JMC A;  5M3M G;  5DLQ E;  4HJ9 A;  3KF8 B;  2BA1 A;  2KEN A;  4EQ5 A;  2Q2T A;  2Z6K A;  4LFC Q;  3UDG A;  1JT8 A;  4PZ7 A;  3PUV A;  4DV1 L;  1TWG H;  1PH1 A;  4UPA A;  1YJN A;  2RHQ B;  1E22 A;  3J7Z C;  4DAM A;  1I50 H;  1VQL A;  2JA5 H;  2KHJ A;  1I94 Q;  4A3C H;  2JE6 I;  4IFD J;  1L1O C;  1AE3 A;  2AHO B;  1FL0 A;  2IHF A;  1IBK Q;  4JOI A;  4LUZ A;  4R4O A;  2R7Z G;  1A63 A;  4JI1 L;  5FLM G;  4BY7 G;  2VL6 A;  2UXB L;  2WB1 G;  5AJ3 L;  1Y1V H;  5HY6 A;  5C44 H;  4DV1 Q;  4ME3 A;  1VQE A;  4IOA A;  4DR2 L;  2ZJP A;  4B3R L;  4JI0 L;  2IT1 A;  1NMF A;  5GAH C;  2NVX H;  4NXN L;  3PO3 G;  5IY0 A;  1K73 C;  2ZJQ A;  2R7F A;  4JYA Q;  4YWM A;  3HFZ B;  3I4N H;  3S1Q H;  4JI1 Q;  1X55 A;  2K5N A;  4MZ9 A;  2PMZ E;  4A3M H;  3M3Y H;  4FDB A;  1PH7 A;  3G48 A;  2NZH A;  1PYB A;  4DV3 L;  4DV5 L;  2A19 A;  2D0O A;  4DR2 Q;  1VQO A;  4B3R Q;  1HNW L;  2VY3 A;  3CCR A;  4BXX G;  1EIY B;  4DV6 L;  1X3G A;  4YCW A;  4NXN Q;  3GD7 A;  1VS0 A;  4OWT B;  3RLN A;  1NJI C;  1Q8K A;  2HQL A;  3RN5 A;  2AWN A;  1YJW A;  3OYY A;  3UE1 A;  3L7Z C;  5FLX c;  1TWC H;  3CC2 A;  3KJO A;  4TQU S;  1QZG A;  1YHB A;  3CC4 A;  4LWC A;  4L5R C;  1OXV A;  2OQ0 A;  2RCN A;  3U4V A;  1V9P A;  4HJ8 A;  4A3J H;  1KRT A;  2E8G A;  1SLJ A;  2EXD A;  4B3S L;  4WJ3 M;  3G6E A;  4AIM A;  1C7Y A;  1IZ6 A;  3FKI H;  5IE8 A;  1Z9F A;  1Q82 C;  1ASY A;  4A3L G;  2R93 H;  4DK3 C;  1N9W A;  4IPH A;  4LF7 L;  1UWV A;  5JEA G;  5GAD C;  1KD1 C;  5FJ8 H;  3K8A A;  2ZTD A;  2D62 A;  4A3D G;  1CKO A;  2UUC Q;  1VQN A;  4OWW B;  1NMG A;  3PUW A;  4LUO A;  4L5T A;  4A3F G;  2BH8 A;  5M5Y H;  1YI2 A;  1QUQ A;  4B3S Q;  5JJL A;  1X56 A;  4YCU A;  3T1Y Q;  1CSQ A;  1X54 A;  3M4P A;  4P73 A;  1B8A A;  2R93 G;  3HOX G;  5IWA L;  3CAM A;  3J81 i;  4IOC A;  3RZO H;  5IYD G;  5GAE C;  2EIF A;  1RL2 A;  1E24 A;  1YIJ A;  2A8V A;  4JI4 L;  4HJA A;  3IRB A;  5H1S E;  1OXT A;  3ERS X;  2JA9 A;  2ALY B;  2JJQ A;  4A3I H;  5IYC G;  1N8R C;  3GTQ H;  4OX9 L;  3GTO H;  5HGQ A;  1FVI A;  3E0E A;  5IWA Q;  3PCO B;  5JJK A;  2V1C C;  3OW2 A;  2K5V A;  4LF5 L;  2ID0 A;  3I4M H;  5C4J H;  3CME A;  4JI4 Q;  1T9H A;  3D0F A;  3EN2 A;  3PO2 H;  2AKW B;  1VQ5 A;  4DUY L;  4A3E H;  2UUB L;  3HOW G;  3TRE A;  4QJF A;  4NXM L;  4Y52 H;  3T1H L;  1LM0 A;  1PFS A;  1C9O A;  4DUZ L;  1U0L A;  1VQP A;  4X66 Q;  2I0Q A;  1XTD A;  3KOJ A;  3OTO Q;  4HJ7 A;  4PZ6 A;  4DR1 L;  3S15 H;  2RHS B;  3HOZ G;  4BBS H;  2K5H A;  4LF5 Q;  4A3K G;  4LFB Q;  3RN2 A;  1Z47 A;  2UXC L;  3CCS A;  4R4I A;  4LF4 L;  4DK6 C;  1IBL Q;  2K4K A;  3W1B A;  4JG2 A;  4DUY Q;  1QVF A;  2PI2 A;  3TRZ A;  2N78 A;  2UUB Q;  1PVO A;  1AH9 A;  3T1H Q;  1X9N A;  5M3M H;  1FGU A;  4P75 A;  4DUZ Q;  4GNX C;  3KDF A;  5GQO A;  1HNZ L;  1IYJ B;  1VQB A;  2PQA A;  4DKA C;  4DR1 Q;  3RNU A;  2F4V Q;  1E1T A;  4JI3 L;  2I5M X;  4A76 A;  1YZ6 A;  3BJU A;  3GDE A;  4HID A;  1PH5 A;  4LNQ A;  2N49 A;  3HOV H;  4A93 G;  2UXC Q;  1TWH H;  1VQH A;  4GN4 B;  3UE0 A;  2VQE L;  4GOP B;  2KHI A;  1KHI A;  4BBR G;  2JEA I;  2R7Z H;  2R92 H;  2K75 A;  1I94 L;  4PZ8 A;  4BY7 H;  1UE1 A;  2CFM A;  4IPD A;  3M85 A;  2KCT A;  4GS3 A;  2VUM G;  2VNU D;  5C3E G;  4JI3 Q;  4HIK A;  1WFQ A;  2JA7 G;  1QZH A;  2FXQ A;  5C0X G;  2VS1 A;  3ULJ A;  2VQE Q;  1YBY A;  2Y0S E;  3PO3 H;  3M4O H;  3S2H H;  4XTC S;  1PYS B;  2NVY H;  1EQQ A;  3GTG H;  3PUX A;  1NE3 A;  1ASZ A;  1BVS A;  4POG A;  5IP7 G;  2NVT H;  4JYA L;  1V1Q A;  1BKB A;  4O2D A;  3UDI A;  2MNA A;  3ULP A;  2JA8 H;  1VQM A;  1I5F A;  4BXX H;  3NEN A;  1SRU A;  3S1M H;  4MTN A;  3CCU A;  1W2B A;  4GNX A;  3W5O A;  1OTC A;  4TVA B;  4LW1 A;  2ZM6 Q;  1PHJ A;  3CD6 A;  4IFD G;  1Q46 A;  1WCM H;  2R6G A;  1X6O A;  4Y7N H;  4A3M G;  1UEB A;  4H02 A;  3H0G G;  4JV5 L;  3HKS A;  4AYB E;  5IT9 c;  1CKN B;  1LTL A;  3CPF A;  2Y0S G;  1W3S A;  4OO1 G;  2HIX A;  1K83 H;  4QIW E;  3W1G A;  4R4Q A;  2VQF L;  4JBW A;  1SN8 A;  3S14 H;  2CKZ B;  1G6P A;  1KAW A;  4JCV E;  1X3E A;  3E9H A;  1O7I A;  1IL2 A;  3STB D;  1EOV A;  4A3L H;  1K0R A;  3U50 C;  3L2P A;  3HOY G;  4JV5 Q;  4KI0 A;  4PMW A;  3GTJ H;  3K0X A;  3S16 H;  5JJI A;  1N36 Q;  1PA6 A;  2D0P A;  3S1N H;  1A0I A;  1L1O A;  3NEM A;  2VQF Q;  1L0W A;  4JI7 Q;  2JEB I;  4AYB G;  1WI5 A;  4DV7 L;  3CCE A;  2UUC L;  4DR3 L;  1MJE A;  1FJG L;  3PF4 A;  1GVP A;  2GN5 A;  3KFU A;  2WP8 J;  1B7Y B;  3DM3 A;  2B63 G;  4C3J H;  4RG1 A;  1YJ9 A;  1XMO Q;  1NY4 A;  2JA6 G;  3HOX H;  1HZB A;  2Q2H A;  1BBW A;  3FP9 A;  3CXC A;  3CMA A;  1K9M C;  1QVC A;  1SE8 A;  3MXN B;  3UDX A;  1HZ9 A;  4IO9 A;  2QA4 A;  5C44 G;  3T1Y L;  4IJH A;  1Y14 B;  3BZC A;  1VQ4 A;  1PV4 A;  1TXY A;  1N32 L;  2ASB A;  2H5X A;  2ZTE A;  1E1O A;  3PIO A;  4DV7 Q;  5IYC H;  4DR3 Q;  1FJG Q;  1XPU A;  2Q2I A;  1HZA A;  3HOU G;  3J81 j;  4OWX B;  2HT1 A;  3BZK A;  4A75 A;  1N34 Q;  3STB C;  1N33 L;  1AE2 A;  1S3O A;  1PH2 A;  4R4T A;  2KCM A;  2OQK A;  1PH6 A;  1YHQ A;  3F2B A;  1N32 Q;  4X65 L;  3M4Q A;  1WYD A;  3PUY A;  4IPG A;  3HOW H;  2UXD L;  1JB7 A;  4C3H H;  3TQY A;  1E7Z A;  1QUQ B;  2XGT A;  1Y1W G;  4JC0 A;  1N33 Q;  1R9T H;  1LUZ A;  3HOZ H;  5EAY A;  4A3G H;  4A3K H;  1JJC B;  2GVB A;  4X66 L;  4JBM A;  3OTO L;  4DAY B;  4X65 Q;  3FHW A;  4LFB L;  3TEH B;  1MKH A;  1UE7 A;  2GVA A;  4J15 A;  4JI8 Q;  1SRO A;  4B3T L;  2UXD Q;  4P74 A;  1IBL L;  4UY8 C;  3WWV A;  4DV4 L;  4GOP C;  1X3F A;  2B3G A;  5GAG C;  4X62 Q;  4UP8 A;  1KQS A;  1HZC A;  4BY1 H;  1VQD A;  5C0X I;  1TWA H;  2F3I A;  1PH3 A;  2LSS A;  4YY3 L;  4HIO A;  3JC6 6;  1E3P A;  2OWO A;  3GTL H;  1M1K C;  2F4V L;  3SGI A;  3DLL A;  1DGS A;  4PG3 A;  1KIX A;  3PUZ A;  4KLK A;  1VQ7 A;  2XTI A;  4A3B G;  1HR0 Q;  4BBR H;  2PNH A;  5LMN L;  1S40 A;  4B3T Q;  4O0A A;  4DV2 Q;  1XPR A;  4DV4 Q;  2QEX A;  2R7D A;  1BBU A;  4NPS A;  1VQA A;  5BR8 L;  3G71 A;  4JI6 Q;  5K36 G;  2IHE A;  3GO5 A;  1KRS A;  3TS0 A;  2DGY A;  2NN6 G;  5C3E H;  1PH4 A;  4YHH L;  1VQK A;  1XJV A;  4IFD I;  4YY3 Q;  3CP0 A;  2CQO A;  4XIG S;  2AMC B;  2N8N A;  5IYB G;  4MNO A;  3CPW A;  5M3F G;  4QY7 A;  5LMN Q;  2NZO A;  2JQO A;  3L0O A;  1NTG A;  3KF6 A;  3AFP A;  1K8A C;  2ZJR A;  2UU9 L;  4OO1 I;  2K50 A;  1VQI A;  5IP7 H;  1QVG A;  5BR8 Q;  4QQB X;  4AQY L;  4JI2 Q;  1TWF H;  1G29 1;  2WAQ E;  3F1Z A;  4C3I H;  5FLM H;  3A5Z B;  4LFA L;  1HJP A;  3K7U C;  4YHH Q;  1IBM Q;  3KDF B;  4DNI A;  4R1J A;  2PQA B;  3BU2 A;  3NEL A;  4DV0 L;  2HHH Q;  4B3M Q;  1XNR L;  1MJC A;  1VQC A;  3S24 A;  5M5X H;  2YU9 H;  3EIV A;  3GTM H;  4K0K L;  1M90 C;  1LYL A;  2UU9 Q;  2UXB Q;  3RLF A;  5IP9 G;  4POF A;  2VW9 A;  2ZM6 L;  4AQY Q;  2YTX A;  1Q81 C;  3AYH B;  4LFA Q;  1Q12 A;  3F8T A;  3I56 A;  3CF5 A;  3CCJ A;  1KC8 C;  4GLA C;  4P72 A;  3CCV A;  2MFI A;  4AH6 A;  3PF5 A;  4DV0 Q;  1EYG A;  4BBS G;  2YTY A;  3E9I A;  4UP7 A;  2UUA L;  1NBW A;  1XNR Q;  3F2D A;  1KXL A;  4K0K Q;  2AWO A;  4DPG A;  4YCV A;  1XNQ L;  1IXR A;  3HOY H;  1XPO A;  1CSP A;  2YTV A;  5LMU L;  4QL5 A;  3EBE A;  4IPC A;  4RMF A;  3M7N A;  2IX0 A;  1GD7 A;  3HOV G;  2I5L X;  1N36 L;  2UUA Q;  1P8L A;  1UE5 A;  1K3R A;  4JI7 L;  4GNX B;  1XNQ Q;  4HJ5 A;  1GM5 A;  2B63 H;  2CWP A;  2R92 G;  3TS2 A;  1CKN A;  1VQF A;  3ER0 A;  3I2Z A;  1J5E L;  4JBK A;  2JA6 H;  1WJJ A;  5LMU Q;  3J7A 5;  4X6A H;  5C4X G;  4HIM A;  1GKH A;  1XMO L;  3PIP A;  2E2H H;  2E2I H;  4JI5 L;  3U4Z A;  3CCM A;  4A3D H;  2ES2 A;  1EIF A;  1H95 A;  1HH2 P;  1J6Q A;  4IJL A;  3HOU H;  4ALP A;  3PGZ A;  2IX1 A;  4A3F H;  2JA5 G;  4UP9 A;  2I5H A;  3CQZ H;  4X64 L;  4DR5 L;  3RZD H;  1J5E Q;  4A3C G;  5AJ3 Q;  1SR3 A;  2HIV A;  3A0J A;  3M9B A;  3PSI A;  3S2D H;  4GKK L;  2K52 A;  3HKZ E;  3K80 C;  1I3Q H;  1N34 L;  4LF8 L;  2JA8 G;  3KLW A;  1Y1V G;  2F52 A;  4JI0 Q;  4JI5 Q;  3Q8D A;  2PI2 E;  5IYD H;  1U5K A;  4LUV A;  1P16 A;  1L1O B;  4L5S A;  3I4O A;  3JAM i;  2Z0S A;  1D8L A;  1WCM G;  5ELO A;  2QGQ A;  3LGJ A;  4X64 Q;  1B70 B;  4GLV B;  3A74 A;  4DR5 Q;  1Y1W H;  3CC7 A;  1MIU A;  2MO1 A;  4EX5 A;  2BH2 A;  4DV3 Q;  2EQS A;  4DV5 Q;  3I4N G;  4GKJ L;  1KL9 A;  1HR0 W;  5JEA J;  1VQ8 A;  4GKK Q;  4LF8 Q;  1HNW Q;  2A1A A;  4OON A;  4DR7 L;  1YHA A;  4DV6 Q;  1CKM A;  1G51 A;  2YYZ A;  3S17 H;  1OXU A;  3HKZ G;  3K81 C;  1A8V A;  2LXK A;  2NN6 I;  4JI8 L;  3J80 i;  4R4C A;  1EQR A;  2MO0 A;  2C35 B;  1RIP A;  2OCE A;  3K7A H;  1YIT A;  4GKJ Q;  5LMN W;  4X62 L;  5GRO A;  3A5U A;  1EWI A;  4GN5 A;  1JJ2 A;  2KBN A;  4A3B H;  4DR7 Q;  2YV5 A;  1YVC A;  2JK8 A;  2WFW A;  2MQH A;  3S1R H;  4LF9 L;  3KYH C;  1HR0 L;  1PH9 A;  3GTK H;  4A3J G;  3H3V I;  4DR4 L;  4LF7 Q;  4KHP L;  3JAM c;  4DV2 L;  3F2C A;  4LF6 L;  3CCL A;  4JI6 L;  3FKI G;  2DUD A;  3PV0 A;  2N3S A;  1Q86 C;  5IYB H;  1PH8 A;  1Q1B A;  1GO3 E;  5M3F H;  5FJ8 G;  1XMQ L;  2Q2U A;  3AQQ A;  1A62 A;  5ELN A;  4A93 H;  1SFO H;  3RLO A;  4LF9 Q;  4DR6 L;  3GTP H;  2IY5 B;  3UDF A;  1Q7Y C;  4DR4 Q;  4KHP Q;  1VQ9 A;  4LF6 Q;  1I6H H;  3I7F A;  3G4S A;  2CCZ A;  4JBJ A;  4JI2 L;  2ATW A;  3J80 c;  1C0A A;  1JJG A;  3H3V H;  1VCI A;  3I55 A;  2VUM H;  1HNX L;  2OTL A;  1IBM L;  1XMQ Q;  2JA7 H;  4B3M L;  2HHH L;  1K8G A;  4DR6 Q;  4YWK A;  2Z6K C;  2E5L L;  5IP9 H;  4OX9 Q;  3CCQ A;  4A3I G;  1S72 A;  4BA1 I;  1OXS C;  3AFQ A;  2NVQ H;  4C2M H;  3U58 A;  4A3G G;  2CWA A;  4KHZ A;  3H15 A;  4P71 A;  3CW2 C;  1HNX Q;  2ZTC A;  4APV A;  3J81 c;  1EUJ A;  4JOI C;  2BA0 A;  3KJP A;  3D31 A;  1X65 A;  3I4M G;  2L15 A;  4GOP A;  1V43 A;  4QGU A;  1L2F A;  2E5L Q;  4NXM Q;  2OTJ A;  3PO2 G;  4L5Q A;  1EFW A;  5M5W H;  1UE6 A;  1VQ6 A;  3KF6 B;  4A3E G;  1SMX A;  2VZA A;  1VQJ A;  1D7Q A; 
#chains in the Genus database with same CATH topology
 4C3J B;  2EVB A;  4GLX A;  3RR5 A;  3HOX B;  4LFC L;  3E5S A;  3ICE A;  2Q8I B;  4NB3 A;  3UOE A;  3B6Y A;  5IOC A;  1MD2 D;  2ZW3 A;  3UGI A;  5E7N A;  1UAP A;  4GI3 C;  5HGI A;  1VQG A;  5KGU A;  1Q1E A;  4YIJ A;  1HNZ Q;  5M3M G;  4HJ9 A;  2GKV A;  2KEN A;  3OIP A;  3NPP A;  3DWP A;  2DIP A;  1TWG H;  2RSN A;  2RHQ B;  1EU3 A;  4GZY C;  4DAM A;  1VQL A;  2KHJ A;  3FEW X;  2JE6 I;  3NBI A;  3SHL A;  2D2C C;  1A63 A;  2L9H A;  3FVV A;  2E76 C;  2VL6 A;  2X6L A;  1R9T B;  2PQ8 A;  4A3K B;  2ZJP A;  4ZKB B;  4JI0 L;  1SGP I;  1JIC A;  1K73 C;  2ZJQ A;  1WTX A;  3D00 A;  3I4N H;  2K5N A;  3DMU A;  2PMZ E;  3M3Y H;  4FDB A;  1EY6 A;  3TJQ A;  2NZH A;  1SAP A;  4RCN A;  3VR2 A;  3DA3 A;  1JR0 D;  1TWA B;  3QR8 A;  5IIF A;  4B3R Q;  4A93 B;  4G76 A;  1EIY B;  5JJZ A;  5FLX E;  1X3G A;  4DWL A;  4YCW A;  3C2P A;  3VR4 A;  4BBR B;  3BS1 A;  4OWT B;  1EU4 A;  3OOC A;  2XIW A;  3AU7 A;  1BF4 A;  2AWN A;  3MXN A;  1ICW A;  3DM1 A;  3CC2 A;  2R61 A;  5G3L D;  5E1F A;  3CC4 A;  2IJ0 A;  4L5R C;  1KMA A;  1Y8N B;  2RCN A;  3U4V A;  1V9P A;  2IPK D;  4QUC A;  3TDQ A;  2E8G A;  5EPK A;  2KUM A;  1YO7 A;  4XQJ A;  5IE8 A;  3FKI H;  3G6E A;  1C7Y A;  3I70 A;  4CDC C;  1KD1 C;  2LFN A;  2L1B A;  4K14 A;  4ULL A;  2B2Y A;  2UUC Q;  2LUY A;  3PUW A;  3NP8 A;  4FXG C;  3KY9 A;  3D4R A;  4A3F G;  5M5W B;  5E3Q A;  1STH A;  2D5D A;  2KA7 A;  2MHV A;  1X56 A;  3M4P A;  4O1P A;  4V0B A;  1H9S B;  5IYD G;  4DAY A;  2F03 A;  1OO9 B;  2O5J C;  2EIF A;  2XNA C;  1PRT C;  1I4H A;  1EIG A;  2OEO A;  2F0K A;  2F0W A;  1OXT A;  4DA2 A;  1PLF A;  1N8R C;  1CFM A;  3HOY B;  4I7Z C;  4NW2 A;  2Y0M A;  5IWA Q;  2A2C A;  5JJK A;  3NK9 A;  2K5V A;  4LF5 L;  3CME A;  1T5X D;  4XT3 B;  4LK1 C;  3EN2 A;  1VQ5 A;  2UUB L;  2B63 B;  2P22 B;  4C3H G;  4H0L C;  1V1P A;  4X66 Q;  2EY1 A;  2FHT A;  3OTO Q;  3KOJ A;  1I6H H;  4PZ6 A;  2F0Q A;  1TDP A;  3HOZ G;  4BBS H;  2K5H A;  1QCB D;  2RC4 A;  1JC7 A;  4R4I A;  4DUY Q;  4JG2 A;  4DGZ A;  4F88 A;  3HOU B;  1TUS A;  3TOB A;  2N78 A;  1PVO A;  4HMJ A;  5JOB A;  3T1H Q;  3RZD B;  1PRT F;  4P75 A;  5GQO A;  1LAB A;  5G3L F;  2Z4I A;  2KCN A;  1PH5 A;  5J39 A;  4RHR A;  2ICE C;  1TWH H;  1VQH A;  4GN4 B;  2EY2 A;  1S5E D;  2R7Z H;  4BY7 H;  1HXY D;  2F3W A;  4KY6 A;  2CFM A;  4DK1 A;  3VDP A;  1CHP D;  3K5N A;  1GOZ A;  1EFI D;  2YFA A;  4GS3 A;  2XN9 C;  1EEI D;  1TT2 A;  1NAP A;  2B2T C;  2C9O A;  3E6Z X;  4JI3 Q;  1HQM C;  4HIK A;  1Z7K B;  5DAE A;  4ZLT F;  2JXD A;  1QZH A;  1TY0 A;  4DFA A;  2KHS A;  1LTB D;  2KJX A;  4QB4 A;  3S2H H;  2NVY H;  3GTG H;  1ASZ A;  2NVT H;  4JYA L;  4IUN A;  2A6E D;  3K7A B;  1V1Q A;  4O2D A;  3ULP A;  2XRS D;  2J87 A;  4NV2 A;  5CYU A;  3NEN A;  3NHH A;  1SRU A;  1HA6 A;  3W5O A;  2LMC B;  4TVA B;  3CD6 A;  1JWM D;  1WCM H;  4MHE A;  3H0G G;  3R2T A;  1F9S A;  4ME5 A;  4AYB E;  5IT9 c;  3SGB I;  2Y0S G;  3MC0 B;  1NCV A;  1K83 H;  3W1G A;  4V19 0;  1GHK A;  3FBV A;  2M5X A;  4PL4 A;  2CKZ B;  4YZD A;  2B2W C;  1DD2 A;  2A2D A;  3GTP B;  4PNY A;  2QF7 A;  3H94 A;  1K0R A;  2NU0 I;  3IKJ A;  3SDJ A;  1ET6 A;  5JJI A;  2VB3 X;  1PA6 A;  4S3S A;  4B6D A;  2VUM B;  1L1O A;  1ZYR C;  4DV7 L;  4K5V A;  1HEV A;  1YNN D;  1DCZ A;  3IFD A;  1B7Y B;  1PTQ A;  1WTJ A;  1XMO Q;  2R93 H;  3O13 A;  2BOS A;  3CXC A;  3CMA A;  4AS2 A;  1HZ9 A;  2X3T A;  4IJH A;  4BBS B;  3NTK A;  4ZAI A;  1N32 L;  2F1M A;  2DNC A;  3RMH A;  3R2I A;  1QE6 A;  5IYC H;  1XPU A;  1SE2 A;  4FO2 A;  5M9O A;  2YUU A;  1QJO A;  2K5D A;  1BDO A;  4ZCK A;  1N33 L;  3EQL C;  1AE2 A;  1UNS A;  4DNR B;  2KCM A;  2OQK A;  2RCF A;  5A2Q L;  3TO6 A;  3M4Q A;  5FKA C;  1VDZ A;  5T1I A;  2E2J B;  4IPG A;  4G7Z C;  3HOW H;  1TS3 A;  1JB7 A;  3TQY A;  1E7Z A;  2XGT A;  3OMG A;  4CKC A;  1LUZ A;  2XRQ D;  3J7Y W;  2PPB C;  3TEH B;  2GVA A;  4JI8 Q;  4F87 A;  1IL8 A;  3KLR A;  1CA6 A;  4UY8 C;  4GOP C;  4QIW B;  4X62 Q;  4IAL A;  1WKX A;  1RTO A;  3CRK C;  2WVJ A;  2OWO A;  1Y1V B;  3GTL H;  5C44 B;  2F4V L;  1KIX A;  4PG3 A;  4KLK A;  4A3B G;  4KD4 A;  4HN7 A;  1B44 D;  1XX8 A;  1HR0 Q;  1S40 A;  1SGY I;  2WKD A;  2L4N A;  3MFG A;  2N55 A;  4DV4 Q;  1XX6 A;  5BR8 L;  3Q23 A;  4JI6 Q;  1KAB A;  4U67 3;  1KRS A;  3TS0 A;  5LL6 S;  4IFD I;  4YY3 Q;  2K1B A;  1GXD C;  3CPW A;  3GV6 A;  1Y8F A;  5CR3 A;  3HKZ B;  3L0O A;  3AB9 A;  4JW0 A;  3KF6 A;  1K8A C;  5JVH 3;  4QCL A;  2K50 A;  4QQB X;  1QVG A;  3LWU A;  1TWF H;  2Z9H A;  4LFA L;  1PFN A;  4YHH Q;  3KP9 A;  2MGS A;  2TSS A;  3CKI B;  4R1J A;  3S24 A;  3GTM H;  1M90 C;  2UU9 Q;  4KKU A;  3RLF A;  1ZKO A;  4R8I A;  4A3J B;  4NMZ A;  1L0Y B;  4CJ0 B;  1WTO A;  4XXE A;  1Q12 A;  3F8T A;  4OO1 H;  3I56 A;  2AQ3 B;  5HUR A;  3QAH A;  3CCJ A;  1KNE A;  1MBY A;  3PF5 A;  2MFI A;  4AH6 A;  1EYG A;  4DV0 Q;  2YTY A;  5KYL A;  1NBW A;  1XNR Q;  4K0K Q;  1GUS A;  2DY8 A;  1XNQ L;  1XPO A;  1OVO A;  4QL5 A;  3EBE A;  1SNP A;  4IPC A;  3M7N A;  2O5I C;  1NUC A;  3RZO B;  2Z8L A;  1OMT A;  4KD3 A;  3CU7 A;  3EVQ A;  2LS0 1;  1UE5 A;  1FAR A;  4JI7 L;  1H9M A;  1RD9 D;  2CWP A;  4EVO A;  1CKN A;  1SNO A;  1VQF A;  2F0J A;  4A3I B;  2JA6 H;  4X6A H;  3J7A 5;  1R4Q B;  2EY6 A;  3Q24 A;  2EE1 A;  2AQ2 B;  3MVV A;  1SYE A;  3IAY A;  2E2I H;  4JI5 L;  2ROW A;  3N52 A;  2LY7 A;  4J6H A;  1TII D;  2QPO A;  4A3F H;  1EZ6 A;  4X64 L;  2B2Y C;  1SR3 A;  3M9B A;  1CA5 A;  3HKZ E;  5IYD H;  2Z4H A;  2OT2 A;  1SBB B;  2FIN B;  4LUV A;  1MJA A;  2Z0S A;  1D8L A;  3TP6 A;  1B70 B;  3A74 A;  1MIU A;  3VYU A;  2EQS A;  5M3M B;  2RLD A;  4DV5 Q;  3I4N G;  1VQ8 A;  5JEA J;  4GKK Q;  5HQ8 A;  1PFM A;  4LF8 Q;  3HP3 A;  2A1A A;  4OON A;  3BZD B;  2Q8R E;  1H0Z A;  1CKM A;  1G51 A;  3HOV B;  1TUR A;  1OXU A;  2F0G A;  1A8V A;  1LR9 A;  3J80 i;  4CGY B;  1EOT A;  1RIP A;  2R92 B;  1ILQ A;  1CT0 I;  1H9S A;  4XYQ A;  2A20 A;  1GUN A;  3A5U A;  4GN5 A;  1BO0 A;  1X4S A;  3ND9 A;  5FO7 B;  1G8Z D;  2MQH A;  4I1T A;  4LF9 L;  3OXF A;  5E3P A;  3KYH C;  3GV3 A;  3M4O B;  4DR4 L;  5K36 H;  5E3R A;  4LF7 Q;  1D6E C;  3CCL A;  3FKI G;  3MWY W;  3SK8 A;  4X3S A;  1BXT A;  2N3S A;  4FKD A;  2RIO A;  1Q1B A;  1GO3 E;  5M3F H;  2JA8 B;  4NKL A;  3ERQ A;  1U4M A;  2CWF A;  5ELN A;  3J80 E;  4KKS A;  3MEH A;  3UDF A;  4RKB A;  4KHP Q;  4KHV A;  4ZUI A;  1NUB A;  3JAM L;  4LF6 Q;  2X52 A;  3EFX D;  4JI2 L;  1AFP A;  4B9W A;  3H3V H;  3I55 A;  1HNX L;  3UGL A;  1XMQ Q;  1C48 A;  2KKM A;  3LJ1 A;  3NTI A;  4CJ2 C;  3S14 B;  2GSC A;  5IP9 H;  4OX9 Q;  3CCQ A;  2EYO A;  3QWP A;  3I72 A;  4C2M H;  3U58 A;  1XWE A;  1SYC A;  2CWA A;  3H15 A;  3S16 B;  3UGD A;  2JYY A;  4APV A;  3J81 c;  3KJP A;  4JOI C;  2BA0 A;  4XDX A;  1BCP D;  1FYC A;  2HQE A;  3KK7 A;  2OVO A;  3R3O A;  2EPB A;  4NXM Q;  1RFH A;  4L5Q A;  1K7V A;  1VQ6 A;  2F3V A;  2EYM A;  3P75 A;  4DN4 M;  3H0G H;  4BY1 G;  1DOL A;  1FR3 A;  2NUC A;  2K14 A;  3AEV A;  5C0X J;  4BA2 I;  1PZJ D;  3A8K E;  3H3V C;  1WTH A;  2QDL A;  1UVF A;  1YNX A;  5I2Y A;  4YWL A;  3P1H A;  1D1I A;  3N6R A;  4TKO B;  3ULL A;  2NWG A;  2Q2T A;  2Z6K A;  3UDG A;  2N17 A;  1KBF A;  2K01 A;  1YJN A;  1E22 A;  1HCZ A;  2JA5 H;  1I94 Q;  4WJW A;  1AE3 A;  1L1O C;  2AHO B;  4C3H B;  1A2T A;  2R7Z G;  5FLM G;  4BY7 G;  2WB1 G;  4RKL A;  5AJ3 L;  4X3K A;  3OVO A;  5HY6 A;  2FMM A;  3HOZ B;  4L9M A;  4KY7 A;  3P23 A;  4UHV A;  4B3R L;  1XA6 A;  2F0V A;  3VA9 A;  2F3C I;  3OIQ A;  1ULN A;  1STE A;  2RDH A;  2R7F A;  2KMR A;  3HFZ B;  3S1Q H;  4JI1 Q;  1X55 A;  4MZ9 A;  4ZRZ A;  1HTP A;  1PH7 A;  3T13 A;  1R0R I;  4DV3 L;  3DO9 A;  5C3X A;  2D0O A;  1HNW L;  2VY3 A;  3BG3 A;  4DV6 L;  4ZYS A;  2MJ8 A;  3RLN A;  3RN5 A;  3OYY A;  1A15 A;  4HSP A;  2IL8 A;  5FLX c;  3QTL D;  1MI2 A;  1TQO A;  4HFV A;  3I91 A;  4LWC A;  1OXV A;  2OQ0 A;  1LTR D;  4HJ8 A;  5D3D A;  2ODD A;  1ASY A;  4AIM A;  2H1E A;  2IW3 A;  1Z9F A;  3FMC A;  1MJ9 A;  3RD4 A;  4ZQ3 A;  2L8E A;  1N9W A;  1UWV A;  2XTQ A;  2ZTD A;  1VF5 C;  1GUG A;  2KCC A;  4A3D G;  3HH2 C;  2ENN A;  4FF1 A;  5M5X B;  1TS2 A;  2G9H D;  5LNK 1;  4K2K A;  2BH8 A;  1YI2 A;  1SYF A;  3MXP A;  4B3S Q;  3OL0 A;  4RGO S;  3SXH A;  3PQI A;  3T1Y Q;  1CSQ A;  1X54 A;  2NBF A;  4JK1 C;  2R93 G;  2Y0S B;  5IWA L;  3J81 i;  4G75 A;  1M4V A;  4HJA A;  5H1S E;  1IY5 A;  5IOD A;  2JA9 A;  1ESF A;  2JJQ A;  3NTH A;  5IYC G;  5JHW C;  3IFT A;  2FUG 1;  4HMI A;  5FUX A;  1ENF A;  2SNS A;  3PCO B;  2HD3 A;  5C4Z A;  2ID0 A;  3I4M H;  4IUQ A;  5C4J H;  4JI4 Q;  3D0F A;  1D1K A;  1TKW B;  4DUY L;  2PMZ B;  2XRC A;  3V05 A;  1NSN S;  3TRE A;  3HOW G;  3T1H L;  1ROD A;  1U0L A;  3B55 A;  1XTD A;  4HJ7 A;  1QOH A;  4H7B A;  2A68 C;  2MJF B;  2JP1 A;  4LF4 L;  4DK6 C;  1QVF A;  9WGA A;  3MEK A;  1IHZ A;  1AH9 A;  1H9R A;  1X9N A;  3VYS A;  1FGU A;  3MA2 B;  4GNX C;  4DR1 Q;  1VQB A;  3S2D B;  3NUC A;  3EJI A;  1I3Q B;  3FRP B;  4JI3 L;  2I5M X;  4A76 A;  3GDE A;  3E59 A;  1JWU D;  2UXC Q;  1X74 A;  5CC4 A;  3FPU B;  4DNC A;  2JYO A;  4IQZ A;  2KHI A;  1KHI A;  2V1C A;  2JEA I;  4E6I A;  1C8C A;  2CW0 C;  4IPD A;  4H44 C;  4IZ8 A;  1RF2 D;  2QQC A;  2VNU D;  2OF1 A;  1Q8I A;  1WFQ A;  2EYH A;  2JA7 G;  2FXQ A;  2J4X A;  2VQE Q;  3PO3 H;  2Y0S E;  2L1L B;  1JB3 A;  4XTC S;  5CV7 A;  5BN4 A;  1EQQ A;  3PUX A;  1BVS A;  2KCX A;  4RGT A;  1EYD A;  1G6Z A;  5C5M A;  2GVI A;  4N8X 1;  3K5O A;  4BXX H;  2W0T A;  4A3B B;  1FY7 A;  4MTN A;  4KN7 C;  1W2B A;  4LW1 A;  1DXM A;  3S1R B;  3FSX A;  3DA4 A;  1X6O A;  1WGT A;  1SEB D;  2A73 B;  4H02 A;  3GTK B;  1DON A;  3E3X A;  5C3W A;  1CKN B;  3CPF A;  2KEE A;  1Y69 U;  4OO1 G;  5CMD A;  5I2X A;  1PCE A;  1BQQ T;  4JBW A;  3TO7 A;  4ZK9 B;  2EZV A;  1KAW A;  4RA8 A;  2I46 A;  3E9H A;  3D4D A;  3STB D;  1HHV A;  1MGS A;  5JEA H;  4JV5 Q;  3GTJ H;  1UUC A;  3K0X A;  1N36 Q;  4CKE A;  1B3A A;  1LTA D;  3P7J A;  1A2U A;  1PRT D;  3S1N H;  2VQF Q;  2E73 A;  3E2I A;  3CCE A;  1YNJ C;  1MJE A;  1E2V A;  3PF4 A;  3BDC A;  2GN5 A;  5A2Q E;  2WP8 J;  4BWG B;  1EQT A;  2JZM A;  3W3A A;  1YJ9 A;  2JA6 G;  2NVQ B;  1A3U A;  1Y1C A;  1V8Q A;  1SE8 A;  1JOQ A;  2HCI A;  2QA4 A;  4HSV A;  1KDA A;  2ZTE A;  2L11 A;  2WV6 D;  2HT1 A;  4A3M B;  3K5M A;  3STB C;  2M00 A;  1PH2 A;  3F2B A;  2EJG C;  1C4Q A;  3BVZ A;  2PW7 A;  4DF7 A;  1KNA A;  4NDX A;  1V1I A;  1STN A;  2QCP X;  1ONL A;  5I6Y A;  2IP6 A;  1Z6H A;  1PTO H;  5FOB B;  4RAU C;  4FNF A;  4X65 Q;  1PTO D;  3R8B A;  4LFB L;  1TWG B;  4J15 A;  1AEX A;  2UXD Q;  1L0X B;  3DEP A;  4AYB B;  2PW5 A;  1IBL L;  3WWV A;  4DV4 L;  4KY5 A;  2K9H A;  1Y8O B;  4UP8 A;  1KQS A;  4IN3 A;  4BY1 H;  4UXI A;  4HGU A;  3QG1 A;  1WTQ A;  4YY3 L;  2QGM A;  2JSO A;  2HGK A;  3A54 A;  3SGI A;  2GKR I;  4WP4 A;  4N9T A;  5T1G A;  2OU2 A;  2ZXO A;  1LTT D;  4B3T Q;  2JB3 A;  2ICI A;  2QEX A;  1BBU A;  2EYP A;  4NPS A;  2J7Z A;  3G71 A;  5K36 G;  3AMU A;  3HS0 C;  3I4N B;  1SJ8 A;  3TME A;  3M3Y B;  5C3E H;  1VQK A;  4YHH L;  3PDN A;  3CP0 A;  2SEB D;  5C0X H;  2HDL A;  1K28 A;  5M3F G;  4QY7 A;  4FF4 A;  2L0C A;  1PTO C;  2UU9 L;  1SXT A;  1HDL A;  2CWG A;  5IP7 H;  1G29 1;  2WAQ E;  3F1Z A;  4C3I H;  5FLM H;  2JB1 A;  3A5Z B;  1CQV A;  4DNI A;  2RA4 A;  2PQA B;  4DV0 L;  2HHH Q;  4B3M Q;  4IUT A;  5ELB A;  5FO9 B;  1XNR L;  4AML A;  2YU9 H;  1SYG A;  4K0K L;  1Y1B A;  3SGQ I;  1AZP A;  2UXB Q;  5IP9 G;  4POF A;  2VW9 A;  2ZM6 L;  5JAV A;  2YTX A;  4AQY Q;  3AYH B;  1FNV A;  3FKI B;  2PZW A;  3I90 A;  3CF5 A;  3U9S A;  2WGC A;  3H91 A;  1LT5 D;  3E9I A;  3F2D A;  1GUO A;  1ZYR D;  3QB3 A;  4DPG A;  3FDT A;  3BYY B;  4I65 A;  4YCV A;  5L37 A;  1CSP A;  3FVQ A;  1GHJ A;  5AFW A;  1PTO F;  2F0S A;  2IX0 A;  1GD7 A;  4N9P A;  3DUZ A;  2UUA Q;  1JWS D;  2WIN B;  3TOA A;  2F4I A;  3TS2 A;  1GM5 A;  1F77 A;  1TOT A;  1S5B D;  3ER0 A;  2NU1 I;  1BR9 A;  4E1R A;  2V6E A;  2EOT A;  1DOK A;  4HR7 B;  5EPJ A;  1ZXT A;  3PIP A;  2E2H H;  3TP8 A;  3U4Z A;  5FUV A;  4K8J A;  2B2V A;  3CCM A;  4A3D H;  4JVZ A;  2ES2 A;  1J6Q A;  4IJL A;  2B2U A;  5COY A;  3V96 A;  3PGZ A;  2IX1 A;  3PIO 3;  2JA5 G;  2BE5 C;  4CJ1 B;  3CQZ H;  4IUR A;  4PL3 A;  2NYZ D;  1X3Q A;  1HUM A;  2HIV A;  3PSI A;  3A0J A;  4GKK L;  2K52 A;  3K80 C;  1N34 L;  4LF8 L;  1QNK A;  4Q9V A;  2F52 A;  4JI0 Q;  1I6H B;  1LT4 D;  5FUW A;  2HUG A;  1JOR A;  2GKT I;  4L5S A;  3ONA B;  2PCF B;  3A8J E;  4H13 C;  3JAM i;  1Z2I A;  4DR5 Q;  3DEO A;  1Y1W H;  1HR0 W;  1KAA A;  4BS9 A;  3T51 B;  4Q5V A;  1VF7 A;  3MFY A;  5ELE A;  3OWE B;  1YHA A;  3S17 H;  2I07 B;  1TWH B;  3L3O C;  2LXK A;  2F0U A;  2R7Z B;  3K6O A;  2C35 B;  4BY7 B;  1G2T A;  4GKJ Q;  1TIH A;  1TBO A;  1SNQ A;  2WB1 B;  4LAA A;  2F66 B;  3JAM E;  1EWI A;  3NWT A;  1YVC A;  2ETD A;  2WFW A;  1DS3 I;  2RSO A;  3OMC A;  2PQE A;  1PH9 A;  3HG9 A;  4C3J G;  5EKI A;  4KHP L;  3S2H B;  2NVY B;  3L9A X;  3GTG B;  4DV2 L;  4F8M A;  2CWH A;  5IGD A;  4LF6 L;  2NN6 H;  2NVT B;  3MXG A;  3PV0 A;  2MPM A;  1AN8 A;  5D14 A;  1SYD A;  1PH8 A;  1K3B C;  1XMQ L;  3LJ2 A;  1IYV A;  4SGB I;  3T4A C;  1A3V A;  1GUT A;  1SFO H;  4L8J A;  1RJT A;  1FD7 D;  1Q7Y C;  1WCM B;  3I7F A;  1G91 A;  1EY0 A;  1C0A A;  3J80 c;  3C46 A;  1VCI A;  3VE5 A;  1IBM L;  1K83 B;  4HTH A;  2PO4 A;  2ZXP A;  2JA7 H;  1K8G A;  2F0F A;  3VR6 A;  4HEA 1;  1OXS C;  4P71 A;  3CW2 C;  1BUV T;  4PL5 A;  1B4O A;  3D31 A;  3I4M G;  3A7L A;  2FEF A;  3J7A F;  5E3F A;  2C5C A;  4XT1 B;  1VQJ A;  4JC0 A;  2EY5 A;  2R93 B;  1CUK A;  3MEF A;  1BNZ A;  3ITP A;  4RGM A;  2WB1 E;  3R93 A;  2WAQ G;  1PMR A;  2RF4 A;  4R8N A;  4OAU C;  5C4X H;  4A4I A;  1N13 A;  1AP0 A;  3SEK C;  3NBH B;  4KV6 A;  1B53 A;  2ZXR A;  5DLQ E;  1JT8 A;  1Y8P B;  2B8G A;  4PZ7 A;  2H4O A;  2F0I A;  4RHS A;  4DXF A;  1PH1 A;  1EWC A;  5KNC A;  1UHA A;  3ZYY X;  1I50 H;  4K5W A;  1PZI D;  2VB2 X;  1EYC A;  4IFD J;  2KMO A;  2YQP A;  3HOW B;  1FL0 A;  2IHF A;  1IBK Q;  4JI1 L;  5KIX A;  2K05 A;  4DV1 Q;  1VQE A;  4IOA A;  2JB2 A;  2FFK B;  2IT1 A;  1NMF A;  1CZW A;  4FP5 D;  2NVX H;  3PO3 G;  1A6X A;  2N1A B;  4JYA Q;  1TBR R;  2B0U C;  5J8C A;  2K04 A;  4YWM A;  3MHB A;  1R79 A;  5EQ0 A;  1IYU A;  1PYB A;  3M7G A;  4XYO A;  3E0J A;  2A19 A;  3QOJ A;  4DR2 Q;  1VQO A;  3GTL B;  1I4R A;  2D9U A;  4BXX G;  3CCR A;  4A24 A;  4NXN Q;  3GD7 A;  5FO8 B;  2F0H A;  2EYL A;  4TQU S;  1QZG A;  1ENC A;  1YHB A;  2EJM A;  3NSW A;  5JVG 3;  2N71 A;  1KRT A;  2EXD A;  4B3S L;  1IZ6 A;  1TWF B;  4DK3 C;  1SNM A;  4IPH A;  5JEA G;  1PPF I;  1TGS I;  3ERO A;  1S4Z A;  2D62 A;  4EQO A;  1F2M A;  5CV6 A;  3W2D A;  4OWW B;  1NMG A;  1XXG A;  2KQ3 A;  2B8F A;  4LUO A;  2F0T A;  3MXU A;  3GTM B;  5M5Y H;  3KUP A;  5JJL A;  1AW7 A;  4RH6 A;  1FYB A;  2F0L A;  4P73 A;  5A35 A;  4HCS A;  4KTA A;  2QQD A;  3CAM A;  1H9J A;  5E4X A;  1TS5 A;  3GOX A;  2J9R A;  1YIJ A;  4JI4 L;  5DM6 3;  3IRB A;  2CH4 A;  3ERS X;  1A3T A;  5NUC A;  1CK1 A;  3GTQ H;  2AUJ D;  3GTO H;  5HGQ A;  3E0E A;  2NU3 I;  4ID6 A;  1II3 A;  4UXH A;  4UAI A;  1U9R A;  1E2Z A;  3X3N A;  1T9H A;  3PO2 H;  2AKW B;  1KBE A;  1FNW A;  4A3E H;  4Y52 H;  1LM0 A;  4ZUJ A;  3Q0A A;  2JA6 B;  2XWJ B;  1C9O A;  4G7H C;  2I0Q A;  3FNB A;  1IKL A;  4DR1 L;  2PZU A;  3S15 H;  2A5H A;  3RN2 A;  2E2I B;  1SGR I;  5IGG A;  4FF2 A;  2UXC L;  3CCS A;  1H9K A;  1HFG A;  1LV9 A;  1STY A;  2NTT A;  2DJG C;  1F9Q A;  3TRZ A;  4A3F B;  3I3C A;  1O7Z A;  4DUZ Q;  2HDM A;  1HNZ L;  1IYJ B;  2PQA A;  1RKN A;  1V1O A;  2F4V Q;  3RNU A;  2K5W A;  2XVS A;  1DJR D;  1YZ6 A;  3BJU A;  4LNQ A;  2N49 A;  5EKL A;  1W6J A;  1EY9 A;  2VQE L;  2QQ0 A;  3OWF A;  2K75 A;  4PZ8 A;  1UE1 A;  3M85 A;  3K5L A;  1LTS D;  1TVX A;  2KCT A;  4KJN A;  2VUM G;  4Z7H A;  5C3E G;  1YU6 C;  1EWH A;  4RCO A;  5C0X G;  2XMX A;  2VS1 A;  3PIP 3;  1YBY A;  4KN4 C;  2B39 A;  3I4L A;  1F9R A;  1PYS B;  4DU9 A;  4PQX A;  1NE3 A;  5LHY 1;  5IP7 G;  5CBA E;  1WD1 A;  3UDI A;  2MNA A;  4C3I G;  4MIU A;  2ARP F;  1CE3 A;  3D6C A;  5CV4 A;  1I5F A;  3CXL A;  3X3M A;  1ULK A;  3S1M H;  1WGC A;  1TS4 A;  5M5Y B;  4Y7N H;  2F0E A;  1UEB A;  4JV5 L;  3HKS A;  1LR7 A;  1W3S A;  1SGD I;  3OSO A;  1NR2 A;  5IGE A;  2VQF L;  5M3F B;  3NXW A;  3SK4 A;  1K7U A;  2UZ3 A;  1EY7 A;  1G6P A;  4JCV E;  1X3E A;  4MPI A;  1B1Z A;  4GXT A;  2G5D A;  2B2T A;  1O7I A;  4X3T A;  3VYR A;  1NXU A;  1EOV A;  3KBX A;  3GTQ B;  4OHJ A;  4WFN 3;  1F9P A;  4K6D A;  1F2Y A;  3SVM A;  3GTO B;  2V4D A;  3L2P A;  4A3L H;  4DAP A;  5IT9 L;  3TSS A;  2UVO A;  3I8Z A;  1OYV I;  5EJW A;  1A0I A;  2G9D A;  2A6H D;  1YTP A;  2ZT9 C;  3C3L A;  2KMP A;  4O42 A;  1L0W A;  4JI7 Q;  1PDQ A;  2JEB I;  5IGC A;  2UUC L;  1W6K A;  4HED A;  1CT2 I;  1FGB D;  2FJ2 A;  2JN4 A;  4C3J H;  1T5E A;  1HPT A;  1E2W A;  1NY4 A;  1AN1 I;  3HOX H;  1HZB A;  2Q2H A;  3FP9 A;  2RQX A;  1QVC A;  4C2M B;  3UDX A;  5C44 G;  3IL8 A;  1BCP B;  3BZC A;  1VQ4 A;  1TXY A;  2EJF C;  2ASB A;  3J7A V;  1Q90 A;  2ERW A;  2H5X A;  2E75 C;  3PIO A;  2F6M B;  4DR3 Q;  2P5Z X;  1WTP A;  1FJG Q;  2Q2I A;  1HPC A;  4OWX B;  4CDE C;  2LKV A;  4A75 A;  2SGF I;  2O2L D;  5ELC A;  3Q6S A;  3V2T A;  3H0G B;  2VXW A;  3D4W A;  4R4T A;  1DOM A;  2A68 D;  1PH6 A;  1YHQ A;  4X65 L;  1PFB A;  1WYD A;  2XSC A;  2A6H C;  3QWN A;  4I7A A;  2UXD L;  3QIA A;  2QZG A;  1DYQ A;  5DAU A;  1IKM A;  1QUQ B;  5EPL A;  4YZC A;  1Y1W G;  1CT4 I;  1R9T H;  5EAY A;  5BN5 A;  4A3K H;  4X66 L;  3OTO L;  3FHW A;  1O7L A;  4QUF A;  5ELF A;  1SRO A;  4B3T L;  1CGI I;  3RUZ A;  2JA5 B;  2CW0 D;  2O4X A;  1VMC A;  1X3F A;  5GAG C;  2KVM A;  4F7X A;  1G2S A;  1VQD A;  2ORV A;  1TWA H;  1PH3 A;  2LSS A;  4HIO A;  1R4P B;  2L55 A;  5KNB A;  3DLL A;  1DGS A;  4BBR H;  1K8O A;  4UXJ A;  2ELI A;  4OEL B;  3K57 A;  3H6M A;  3S1Q B;  3S9W A;  2XTR A;  2DGY A;  2NN6 G;  1XJV A;  2CQO A;  4XIG S;  2N8N A;  2SDF A;  4JPB W;  4B08 A;  4MNO A;  4EQP A;  2VRW B;  5LMN Q;  3F2U A;  5FUY A;  2NZO A;  1NTG A;  4OO1 I;  2ZJR A;  2UXB L;  4AQY L;  4JI2 Q;  5KEE A;  3R5B A;  4NV5 A;  2K7V A;  2KED A;  3KDF B;  2HCC A;  1S20 A;  3BU2 A;  3NEL A;  4G57 A;  1MJC A;  1HQR D;  1W4R A;  3EIV A;  2BDO A;  1VMP A;  3AJF A;  3NBH A;  4M1U B;  4TRD A;  1WVL A;  3A56 A;  5ELD A;  2RDG A;  1DS2 I;  3CCV A;  4ILW A;  4UP7 A;  2UUA L;  1PTR A;  1YNJ D;  2AWO A;  3LNN A;  3DXJ C;  1IXR A;  3HOY H;  3OXG A;  2YTV A;  4RMF A;  3VYT A;  1KLU D;  3HOV G;  2I5L X;  3GP7 A;  2E5R A;  1KDB A;  1CT1 D;  2F0D A;  1K3R A;  4GNX B;  2B63 H;  4NP5 A;  2R92 G;  5LMU Q;  5C4X G;  1ZEQ X;  1MSH A;  1GKH A;  1XMO L;  1GJX A;  4RGN A;  3I4M B;  1EIF A;  5C4J B;  4E1P A;  1HH2 P;  3HOU H;  2KMQ A;  4ALP A;  5CGK A;  3RZD H;  2QSB A;  2I5H A;  5I6W A;  4DR5 L;  1J5E Q;  5KRU A;  2DB6 A;  5AJ3 Q;  4KKT A;  1S5D D;  2JA8 G;  1HUN A;  2JA1 A;  2PI2 E;  4PMB A;  3C1E A;  1P16 A;  3UFF A;  4L63 B;  2WAQ B;  3BDL A;  4OEM B;  5ELO A;  2QGQ A;  3LGJ A;  4GLV B;  3CC7 A;  4EX5 A;  2BH2 A;  4DV3 Q;  4GKJ L;  1KL9 A;  4OAV B;  1WTW A;  1HNW Q;  1O7Y A;  1LT3 D;  4ABN A;  2WCY A;  4DV6 Q;  2YYZ A;  3DHQ A;  4B9X A;  2F0O A;  1HFN A;  3K81 C;  4JI8 L;  3TP7 A;  5TSS A;  3R5C A;  4R4C A;  2SGD I;  1EQR A;  4FXK C;  2MO0 A;  3K7A H;  1QIL A;  1SYB A;  4ODG A;  2V53 A;  3UEJ A;  1RTN A;  1B50 A;  4K5X A;  2AQ1 B;  4X62 L;  5GRO A;  3IAM 1;  2CHB D;  2N88 A;  1JJ2 A;  2KBN A;  4DR7 Q;  5CCM A;  2YV5 A;  2X69 A;  3PO3 B;  1HR0 L;  3H3V I;  3JAM c;  3TP5 A;  4JI6 L;  4CKB A;  2DUD A;  2NU2 I;  1EEF D;  1Q86 C;  5IYB H;  4P2C B;  1K8M A;  3AQQ A;  2SGE I;  3RLO A;  5I4D A;  1M8A A;  3OW7 A;  3GTP H;  7WGA A;  1QNU A;  3NQT A;  3LWE A;  1VQ9 A;  3A8I E;  2CCZ A;  2ATW A;  1K0S A;  4ZKC B;  5HGT A;  4Z7G A;  2VUM H;  2Z1C A;  2OTL A;  1JQY D;  2EXZ A;  4DR6 Q;  4YWK A;  2Z6K C;  1EY4 A;  3VR5 A;  2NTS A;  1S72 A;  1K7T A;  3KLS A;  2IX3 A;  3I9V 1;  3GQB A;  4A3G G;  3R5A A;  3GTJ B;  1PRT B;  1EUJ A;  1SGQ I;  3SE0 A;  3S1N B;  4QGU A;  1L2F A;  3URY A;  2E5L Q;  2QKI C;  3PO2 G;  4EGV A;  1UE6 A;  4A3E G;  2VZA A;  1CTM A;  1D7Q A;  2LB7 A;  1KLG D;  1FNU A;  4C1N K;  5EX3 A;  1TBQ R;  3ZJY C;  4TSS A;  1YEZ A;  3J81 L;  3FC3 A;  2B29 A;  2WKC A;  4J1M A;  4LF4 Q;  1JE5 A;  2LXJ A;  2OXP A;  4C1N I;  2E2J H;  4MTK A;  1OXX K;  4WJ4 A;  4GN3 B;  4OGQ C;  1TY2 A;  2BE5 D;  1WOC A;  3TZD A;  4CDD C;  5J3B A;  1IBK L;  4MN3 A;  1LR8 A;  4OXP A;  2CQA A;  3VDY A;  1JMC A;  3Q22 A;  3KF8 B;  2BA1 A;  4EQ5 A;  4LFC Q;  2JXM B;  3PUV A;  4DV1 L;  1ET9 A;  1KDC A;  2L5T A;  4UPA A;  3J7Z C;  1HRJ A;  3ND8 A;  2WII B;  4A3C H;  1HTL D;  2BL8 A;  1BUS A;  5CV8 A;  3SEB A;  5KND A;  4JOI A;  4LUZ A;  4R4O A;  2A69 D;  1B9N A;  1D5Z C;  5EBD A;  5K5P A;  1Y1V H;  5C44 H;  1PTO B;  4ME3 A;  4DR2 L;  2DJF C;  1JOK A;  5FK9 C;  1Q9B A;  3UIT A;  2BL7 A;  1DM0 B;  4IUP A;  5GAH C;  4NXN L;  2NZ1 D;  5HI7 A;  5IY0 A;  3RU0 A;  2DY7 A;  3BDO A;  5IGF A;  3G48 A;  4DV5 L;  4BY1 B;  3QJY A;  1CQF A;  4HCE A;  2Q8T A;  1EYA A;  5D3I B;  4O1N A;  1PZK D;  1LTG D;  3UI2 A;  3BJI A;  1VS0 A;  5EX0 A;  3G7L A;  3WDN A;  5I9O A;  2SGP I;  2K03 A;  1NJI C;  1Q8K A;  2HQL A;  2K33 A;  4CHT B;  1YJW A;  2JBW A;  2A6E C;  3DWQ A;  3UE1 A;  3L7Z C;  3PMF A;  1UEA B;  4QF4 A;  2A69 C;  1ICF B;  1TWC H;  5C3E B;  3KJO A;  1EL0 A;  3BYT B;  3LJ0 A;  4C56 C;  5BN3 A;  4M8A A;  5J8F A;  4IUV A;  2FMC A;  4A3J H;  2CJS C;  1SLJ A;  4WJ3 M;  4AS3 A;  2ENZ A;  4XQQ A;  1Q82 C;  3F4M A;  4A3L G;  1I4Q A;  1SSO A;  2QIL A;  1TU2 B;  2QW7 A;  4C3I B;  3C1F A;  1PXU A;  5FLX L;  5GAD C;  4LF7 L;  1EIH A;  3SK6 A;  3K8A A;  5FJ8 H;  1I4G A;  1UUP A;  1CKO A;  1VQN A;  2K19 A;  4OIJ A;  5COR A;  4FYD A;  4L5T A;  2YU9 B;  5JPM C;  2L12 A;  4CBV A;  4YZ9 A;  1QUQ A;  3NE5 B;  2J0T D;  4YCU A;  1B2T A;  1EY5 A;  1QWY A;  1B8A A;  3HOX G;  1CHQ D;  4IOC A;  3RZO H;  5GAE C;  2K32 A;  1NNX A;  1I4P A;  3FSY A;  1RL2 A;  1E24 A;  2A8V A;  1STG A;  4OVO A;  1PJU A;  2ALY B;  4A3I H;  1YNN C;  4OX9 L;  1ML0 D;  2SOB A;  1FVI A;  1JQO A;  1CM9 A;  2V1C C;  3OW2 A;  2QQE A;  5CBE E;  2YFB A;  1QG7 A;  3KLS X;  2N52 A;  4QJF A;  4WOR A;  4NXM L;  1WTV A;  1PFS A;  4PV1 C;  3SDZ A;  4DUZ L;  1VQP A;  4LFB Q;  2RHS B;  2E2H B;  4LF5 Q;  4A3K G;  2L7X A;  1Z47 A;  1SGN I;  3I73 A;  4A3D B;  1IBL Q;  2K4K A;  1MSG A;  3W1B A;  4Z9C B;  1MHW C;  2PI2 A;  2UUB Q;  2SNM A;  5C4H A;  2ENB A;  5M3M H;  3CQZ B;  3WOF A;  1ENA A;  3KDF A;  3VDU A;  2E74 C;  4DKA C;  1E1T A;  3HOV H;  4HID A;  1S5F D;  1Q3L A;  3FPP A;  4A93 G;  3BVM A;  3UE0 A;  5CV9 A;  4J8Q A;  4R9W A;  4GOP B;  4BBR G;  4O1O A;  2R92 H;  1I94 L;  2ORW A;  3L0I A;  3MZ5 A;  1Y1W B;  2X6G A;  1TWC B;  1SMY D;  2RKS A;  2PZT A;  1WD0 A;  3ULJ A;  3S17 B;  3M4O H;  1PYW D;  4POG A;  3D8G A;  1AZQ A;  1BKB A;  2P6A C;  2R3Z A;  2JA8 H;  1VQM A;  1BMO A;  1RCV D;  5IT9 E;  3CCU A;  1P9G A;  4GNX A;  1CHO I;  3T56 B;  1OTC A;  1S5C D;  2ZM6 Q;  1PHJ A;  4IFD G;  1X3P A;  1Q46 A;  2R6G A;  4A3M G;  3WOE A;  1CI3 M;  3HZX A;  1GUW A;  1IW7 D;  3TZU A;  1LTL A;  5JPN C;  1SJE D;  2HIX A;  4QIW E;  3IAS 1;  1LLR D;  2EYF A;  3U9O A;  1X32 A;  4R4Q A;  1SMY C;  1SN8 A;  3S14 H;  1SFO B;  5EGT A;  5KYI A;  1IL2 A;  4EQN A;  2A74 C;  3U50 C;  3HOY G;  1ULM A;  3OPO A;  4U6R A;  4KI0 A;  3VR3 A;  4PMW A;  3S16 H;  3R5D A;  2D0P A;  3NEM A;  2IWH A;  4AYB G;  4K8I A;  1WI5 A;  4RFB A;  2JA7 B;  4LJZ C;  4DR3 L;  1FJG L;  1GVP A;  3KFU A;  2F0P A;  3DM3 A;  2B63 G;  1CSO I;  1D5M C;  4RG1 A;  1MJB A;  2DNE A;  1K9M C;  1BBW A;  3HGB A;  3LX0 A;  2RVL A;  3MXN B;  3T1Y L;  4IO9 A;  1Y14 B;  1PV4 A;  1IW7 C;  2KOL A;  1TR5 A;  4IUU A;  1E1O A;  4DV7 Q;  1Z7T A;  1HZA A;  3HOU G;  3J81 j;  3K0Y A;  3BZK A;  1MT1 A;  1RHP A;  1F2Z A;  4LMQ D;  4DXG A;  1N34 Q;  1JE4 A;  3A55 A;  1S3O A;  1J8I A;  1N32 Q;  2AUK A;  4N8F A;  2K28 A;  2F0N A;  3PUY A;  1M8C A;  2ZRR A;  5DM7 3;  1IW4 A;  4C3H H;  2EYJ A;  2RDF A;  5C4X B;  1P9Z A;  2BDN A;  1B9M A;  1N33 Q;  3HOZ H;  4L6T B;  4A3G H;  4UDU C;  3UEY A;  1JJC B;  2GVB A;  4JBM A;  2BUS A;  3QO2 A;  4DAY B;  1O80 A;  2PNR C;  1MKH A;  1UE7 A;  4P74 A;  1I50 B;  2QDB A;  2OD1 A;  1I6V C;  2B3G A;  1O78 A;  1HZC A;  3OXL A;  1JOO A;  5C0X I;  2F3I A;  3JC6 6;  1E3P A;  1RDP D;  1M1K C;  5C5L A;  1VQ7 A;  3PUZ A;  4X3U A;  2XTI A;  5LMN L;  2PNH A;  2M9V A;  1D5X C;  4O0A A;  4DV2 Q;  1XPR A;  2NVX B;  1BBX C;  2R7D A;  1U4L A;  1SJH D;  1EY8 A;  1VQA A;  3QOL A;  2IHE A;  1V1P B;  3GO5 A;  1PH4 A;  2AMC B;  1SE4 A;  5IYB G;  4HAE A;  2FU2 A;  1ILP A;  2LEO A;  1TBN A;  5EKK A;  2JQO A;  3AFP A;  5LL6 X;  1VQI A;  5BR8 Q;  3CHB D;  1LTI D;  1OMU A;  1HJP A;  1SDF A;  1I4X A;  3G6J B;  2E2D C;  3K7U C;  4QMG A;  1IBM Q;  2FNF X;  5ISR A;  4PMC A;  1STA A;  1VQC A;  3A7A B;  5M5X H;  1LYL A;  4KJO A;  4CDF C;  1U4R A;  2CAZ B;  2CVR A;  2B2V C;  1Q81 C;  4K2L A;  4OIK A;  5DNF A;  3KF8 A;  4LFA Q;  3VA5 A;  3HEJ A;  3K58 A;  2B2U C;  3SR1 A;  2K6A A;  1KC8 C;  4GLA C;  4P72 A;  4BBS G;  2JAE A;  1KXL A;  1SE3 A;  1NR4 A;  2F0M A;  3TBI B;  1SGE I;  1KTK A;  2DN8 A;  2MUY A;  2XWB B;  5LMU L;  3SK5 A;  1FAQ A;  2NB0 A;  2CH4 W;  1XBT A;  4WRD A;  1N36 L;  1BCP C;  3D6W A;  1P8L A;  5CV5 A;  4HJ5 A;  1XNQ Q;  3M4Y A;  5C6A A;  4FXD A;  4OL7 A;  3I2Z A;  4Q0F A;  1J5E L;  4JBK A;  1WJJ A;  1D2B A;  2OZU A;  4HIM A;  3B4V C;  4A3G B;  5CCL A;  3CRL C;  4G4K A;  4DK0 A;  3D3R A;  1H95 A;  3TN2 A;  2NU4 I;  1E0B A;  3PO2 B;  4UP9 A;  1DZ1 A;  4A3C G;  4A3E B;  1M8B A;  2PYK A;  1UVG A;  3S2D H;  1J9O A;  1I3Q H;  3MTS A;  3KLW A;  1Y1V G;  4JI5 Q;  2GA4 B;  2Z6B A;  3Q8D A;  3S15 B;  1U5K A;  4K6L A;  1L1O B;  5F2D A;  5J1Z A;  1SND A;  2KEC A;  3I4O A;  4FF3 A;  1WCM G;  4X64 Q;  2RBM A;  2MO1 A;  1BCP F;  3JSB A;  4FVM A;  1V1H A;  2B2W A;  1HA5 A;  3BVG A;  4DR7 L;  2EDG A;  2DKV A;  3T53 B;  3HKZ G;  2NN6 I;  1EZ8 A;  4G7O C;  1ESR A;  2OCE A;  3TO9 A;  5I9P A;  1YIT A;  5EBC A;  5LMN W;  1LO5 D;  1HJA I;  3EA6 A;  2K5Q A;  4A3B H;  2JK8 A;  3VA7 A;  3P20 A;  3S1R H;  3HRZ C;  2M2L A;  4KK7 A;  3GTK H;  4A3J G;  5D65 A;  3MAQ A;  3F2C A;  1SNC A;  4DAV A;  2B8T A;  5FJ8 G;  2Q2U A;  3DWA A;  1A62 A;  4A93 H;  3S1M B;  4LF9 Q;  4DR6 L;  4RWS C;  2QEJ C;  2RAD A;  2IY5 B;  2SGQ I;  4DR4 Q;  1LT6 D;  1WTR A;  4Y7N B;  4DNT B;  1F2L A;  3K59 A;  3G4S A;  4JBJ A;  3OHX C;  1JJG A;  1BOS A;  5J22 A;  1CGJ I;  1LAC A;  4KMU C;  1B3Q A;  3T16 A;  2HHH L;  4B3M L;  4U68 A;  3J81 E;  2E5L L;  1EQV A;  1XTC D;  4A3I G;  4BA1 I;  2GIV A;  2RIJ A;  1STB A;  2NVQ H;  3AFQ A;  1VDD A;  3J80 L;  1JCK B;  4XQN A;  4KHZ A;  3KBG A;  2JW6 A;  1HNX Q;  2ZTC A;  1QB5 D;  2BCO A;  3NWS A;  3H09 A;  5DEH A;  1X65 A;  2L15 A;  2WAC A;  1V43 A;  4GOP A;  1XYI A;  1CZG A;  2TMP A;  4IFD H;  2OTJ A;  1IY6 A;  2MP1 A;  1EFW A;  5M5W H;  1U4P A;  3KF6 B;  4A3M H;  1SMX A;  5IGB A;  3NQI A;  5E4W C; 
#chains in the Genus database with same CATH homology
 4GLX A;  3RR5 A;  4LFC L;  3ICE A;  4NB3 A;  3B6Y A;  3UGI A;  5E7N A;  4GI3 C;  5HGI A;  1VQG A;  1Q1E A;  1HNZ Q;  5M3M G;  4HJ9 A;  2GKV A;  2KEN A;  2DIP A;  1TWG H;  2RHQ B;  4DAM A;  1VQL A;  2KHJ A;  2JE6 I;  1A63 A;  2VL6 A;  2ZJP A;  4JI0 L;  1SGP I;  1K73 C;  2ZJQ A;  3D00 A;  3I4N H;  2K5N A;  3M3Y H;  2PMZ E;  4FDB A;  3TJQ A;  2NZH A;  3DA3 A;  4B3R Q;  4G76 A;  1EIY B;  1X3G A;  4DWL A;  4YCW A;  4OWT B;  2AWN A;  3CC2 A;  3CC4 A;  4L5R C;  1KMA A;  2RCN A;  3U4V A;  1V9P A;  2E8G A;  3G6E A;  1YO7 A;  1C7Y A;  5IE8 A;  3FKI H;  1KD1 C;  2UUC Q;  2LUY A;  3PUW A;  3KY9 A;  4A3F G;  1X56 A;  3M4P A;  4O1P A;  5IYD G;  2EIF A;  1OXT A;  1N8R C;  5IWA Q;  2A2C A;  5JJK A;  2K5V A;  4LF5 L;  3CME A;  3EN2 A;  1VQ5 A;  2UUB L;  2P22 B;  4X66 Q;  3OTO Q;  3KOJ A;  1I6H H;  4PZ6 A;  3HOZ G;  4BBS H;  2K5H A;  4R4I A;  4DUY Q;  4JG2 A;  1TUS A;  2N78 A;  1PVO A;  3T1H Q;  4P75 A;  5GQO A;  1PH5 A;  1TWH H;  1VQH A;  4GN4 B;  2R7Z H;  4BY7 H;  2CFM A;  3VDP A;  2YFA A;  4GS3 A;  4JI3 Q;  5DAE A;  4HIK A;  1Z7K B;  2JXD A;  1QZH A;  3S2H H;  2NVY H;  3GTG H;  1ASZ A;  2NVT H;  4JYA L;  1V1Q A;  4O2D A;  3ULP A;  2J87 A;  4NV2 A;  3NEN A;  1SRU A;  3W5O A;  4TVA B;  3CD6 A;  1WCM H;  3H0G G;  4AYB E;  5IT9 c;  3SGB I;  2Y0S G;  1K83 H;  3W1G A;  3FBV A;  2M5X A;  4PL4 A;  2CKZ B;  4YZD A;  2A2D A;  2NU0 I;  1K0R A;  3SDJ A;  5JJI A;  1PA6 A;  4B6D A;  1L1O A;  4DV7 L;  1B7Y B;  1PTQ A;  1XMO Q;  2R93 H;  3CXC A;  3CMA A;  4AS2 A;  1HZ9 A;  4IJH A;  1N32 L;  5IYC H;  1XPU A;  2YUU A;  1N33 L;  1AE2 A;  2KCM A;  2OQK A;  3M4Q A;  4IPG A;  3HOW H;  1JB7 A;  3TQY A;  1E7Z A;  2XGT A;  1LUZ A;  3TEH B;  2GVA A;  4JI8 Q;  4UY8 C;  4GOP C;  4X62 Q;  2WVJ A;  2OWO A;  3GTL H;  2F4V L;  1KIX A;  4PG3 A;  4KLK A;  4A3B G;  1HR0 Q;  1SGY I;  1S40 A;  4DV4 Q;  1XX6 A;  5BR8 L;  4JI6 Q;  1KRS A;  3TS0 A;  4IFD I;  4YY3 Q;  3CPW A;  1Y8F A;  3L0O A;  3KF6 A;  1K8A C;  2K50 A;  4QQB X;  1QVG A;  1TWF H;  4LFA L;  4YHH Q;  3KP9 A;  4R1J A;  3S24 A;  3GTM H;  1M90 C;  2UU9 Q;  3RLF A;  1Q12 A;  3F8T A;  3I56 A;  3CCJ A;  3PF5 A;  2MFI A;  4AH6 A;  1EYG A;  4DV0 Q;  2YTY A;  1NBW A;  1XNR Q;  4K0K Q;  1XNQ L;  1XPO A;  1OVO A;  4QL5 A;  3EBE A;  4IPC A;  3M7N A;  1OMT A;  1UE5 A;  1FAR A;  4JI7 L;  2CWP A;  1CKN A;  1VQF A;  2JA6 H;  4X6A H;  3J7A 5;  2E2I H;  4JI5 L;  2ROW A;  2QPO A;  4A3F H;  4X64 L;  1SR3 A;  3M9B A;  3HKZ E;  5IYD H;  4LUV A;  2Z0S A;  1D8L A;  1B70 B;  3A74 A;  1MIU A;  2EQS A;  4DV5 Q;  3I4N G;  5HQ8 A;  4GKK Q;  1VQ8 A;  5JEA J;  4LF8 Q;  2A1A A;  4OON A;  1H0Z A;  1CKM A;  1G51 A;  1TUR A;  1OXU A;  1A8V A;  1LR9 A;  3J80 i;  1RIP A;  1CT0 I;  2A20 A;  3A5U A;  4GN5 A;  1X4S A;  2MQH A;  4I1T A;  4LF9 L;  3OXF A;  3KYH C;  4DR4 L;  4LF7 Q;  3CCL A;  3FKI G;  2N3S A;  4FKD A;  2RIO A;  1Q1B A;  1GO3 E;  5M3F H;  5ELN A;  3UDF A;  4KHP Q;  1NUB A;  4LF6 Q;  4JI2 L;  3H3V H;  3I55 A;  1HNX L;  3UGL A;  1XMQ Q;  2KKM A;  3LJ1 A;  5IP9 H;  4OX9 Q;  3CCQ A;  3QWP A;  4C2M H;  3U58 A;  2CWA A;  3H15 A;  3UGD A;  2JYY A;  4APV A;  3J81 c;  3KJP A;  4JOI C;  2BA0 A;  2OVO A;  4NXM Q;  1RFH A;  4L5Q A;  1VQ6 A;  3H0G H;  4BY1 G;  2K14 A;  3AEV A;  5C0X J;  4BA2 I;  1UVF A;  1YNX A;  4YWL A;  3ULL A;  2Q2T A;  2Z6K A;  3UDG A;  2N17 A;  1KBF A;  1YJN A;  1E22 A;  2JA5 H;  1I94 Q;  1AE3 A;  1L1O C;  2AHO B;  2R7Z G;  5FLM G;  4BY7 G;  2WB1 G;  5AJ3 L;  3OVO A;  5HY6 A;  4L9M A;  3P23 A;  4B3R L;  1XA6 A;  3VA9 A;  2F3C I;  2R7F A;  2KMR A;  3HFZ B;  3S1Q H;  4JI1 Q;  1X55 A;  4MZ9 A;  1PH7 A;  1R0R I;  4DV3 L;  3DO9 A;  2D0O A;  1HNW L;  2VY3 A;  4DV6 L;  3RLN A;  3RN5 A;  3OYY A;  5FLX c;  3QTL D;  4HFV A;  4LWC A;  1OXV A;  2OQ0 A;  4HJ8 A;  2ODD A;  1ASY A;  4AIM A;  1Z9F A;  2L8E A;  1N9W A;  1UWV A;  2XTQ A;  2ZTD A;  4A3D G;  3HH2 C;  2ENN A;  5LNK 1;  2BH8 A;  1YI2 A;  4B3S Q;  3OL0 A;  3T1Y Q;  1CSQ A;  1X54 A;  2R93 G;  5IWA L;  3J81 i;  4G75 A;  4HJA A;  5H1S E;  1IY5 A;  2JA9 A;  2JJQ A;  5IYC G;  5JHW C;  2FUG 1;  5FUX A;  3PCO B;  2ID0 A;  3I4M H;  5C4J H;  4JI4 Q;  3D0F A;  4DUY L;  2XRC A;  3HOW G;  3TRE A;  3T1H L;  1U0L A;  1XTD A;  4HJ7 A;  2MJF B;  4LF4 L;  4DK6 C;  1QVF A;  3MEK A;  1AH9 A;  1X9N A;  1FGU A;  4GNX C;  4DR1 Q;  1VQB A;  4JI3 L;  2I5M X;  4A76 A;  3GDE A;  3E59 A;  2UXC Q;  1X74 A;  2KHI A;  1KHI A;  2V1C A;  2JEA I;  4IPD A;  2QQC A;  2VNU D;  1WFQ A;  2JA7 G;  2FXQ A;  3PO3 H;  2VQE Q;  2Y0S E;  2L1L B;  4XTC S;  1EQQ A;  3PUX A;  1BVS A;  2KCX A;  2GVI A;  4BXX H;  2W0T A;  4MTN A;  1W2B A;  4LW1 A;  3DA4 A;  1X6O A;  4H02 A;  1CKN B;  3CPF A;  4OO1 G;  1PCE A;  4JBW A;  1KAW A;  3E9H A;  3STB D;  4JV5 Q;  3GTJ H;  1UUC A;  3K0X A;  1N36 Q;  3S1N H;  2VQF Q;  2E73 A;  3E2I A;  3CCE A;  1MJE A;  3PF4 A;  2GN5 A;  2WP8 J;  2JZM A;  1YJ9 A;  2JA6 G;  1Y1C A;  1SE8 A;  2QA4 A;  2ZTE A;  2HT1 A;  3STB C;  1PH2 A;  3F2B A;  1V1I A;  2IP6 A;  4X65 Q;  4LFB L;  4J15 A;  2UXD Q;  1IBL L;  3WWV A;  4DV4 L;  2K9H A;  4UP8 A;  1KQS A;  4BY1 H;  4UXI A;  4HGU A;  4YY3 L;  3SGI A;  2GKR I;  4B3T Q;  2JB3 A;  2QEX A;  1BBU A;  4NPS A;  3G71 A;  5K36 G;  1SJ8 A;  5C3E H;  1VQK A;  4YHH L;  3PDN A;  3CP0 A;  5M3F G;  4QY7 A;  2UU9 L;  5IP7 H;  1G29 1;  2WAQ E;  3F1Z A;  4C3I H;  5FLM H;  2JB1 A;  3A5Z B;  4DNI A;  2PQA B;  4DV0 L;  2HHH Q;  4B3M Q;  1XNR L;  2YU9 H;  4K0K L;  1Y1B A;  3SGQ I;  2UXB Q;  5IP9 G;  4POF A;  2VW9 A;  2ZM6 L;  4AQY Q;  2YTX A;  3AYH B;  3CF5 A;  3E9I A;  3F2D A;  4DPG A;  4YCV A;  1CSP A;  2IX0 A;  1GD7 A;  2UUA Q;  3TS2 A;  1GM5 A;  1TOT A;  2NU1 I;  3ER0 A;  4E1R A;  2V6E A;  3PIP A;  2E2H H;  3U4Z A;  5FUV A;  3CCM A;  4A3D H;  2ES2 A;  1J6Q A;  4IJL A;  3PGZ A;  2IX1 A;  2JA5 G;  3CQZ H;  4PL3 A;  2HIV A;  3PSI A;  3A0J A;  4GKK L;  2K52 A;  3K80 C;  1N34 L;  4LF8 L;  4Q9V A;  2F52 A;  4JI0 Q;  5FUW A;  2GKT I;  4L5S A;  3JAM i;  4DR5 Q;  1Y1W H;  1HR0 W;  1YHA A;  3S17 H;  2LXK A;  2C35 B;  4GKJ Q;  1TIH A;  1TBO A;  2F66 B;  1EWI A;  1YVC A;  2WFW A;  1DS3 I;  1PH9 A;  4KHP L;  4DV2 L;  4LF6 L;  3PV0 A;  1PH8 A;  1XMQ L;  3LJ2 A;  4SGB I;  1SFO H;  1Q7Y C;  3I7F A;  1C0A A;  3J80 c;  1VCI A;  3VE5 A;  1IBM L;  2JA7 H;  1K8G A;  4HEA 1;  1OXS C;  4P71 A;  3CW2 C;  4PL5 A;  3D31 A;  3I4M G;  4JC0 A;  1VQJ A;  1CUK A;  3MEF A;  2WB1 E;  2WAQ G;  2RF4 A;  4OAU C;  5C4X H;  4A4I A;  1N13 A;  3SEK C;  3NBH B;  5DLQ E;  1JT8 A;  4PZ7 A;  1PH1 A;  1I50 H;  4IFD J;  2KMO A;  2YQP A;  1FL0 A;  2IHF A;  1IBK Q;  4JI1 L;  4DV1 Q;  4IOA A;  1VQE A;  2JB2 A;  2IT1 A;  1NMF A;  2NVX H;  3PO3 G;  2N1A B;  4JYA Q;  1TBR R;  2B0U C;  4YWM A;  1R79 A;  1PYB A;  2A19 A;  4DR2 Q;  1VQO A;  4BXX G;  3CCR A;  4A24 A;  4NXN Q;  3GD7 A;  4TQU S;  1QZG A;  1YHB A;  2N71 A;  1KRT A;  2EXD A;  4B3S L;  1IZ6 A;  4DK3 C;  4IPH A;  5JEA G;  1PPF I;  1TGS I;  2D62 A;  4OWW B;  1NMG A;  4LUO A;  5M5Y H;  5JJL A;  1FYB A;  4P73 A;  2QQD A;  3CAM A;  3GOX A;  2J9R A;  1YIJ A;  4JI4 L;  3IRB A;  3ERS X;  3GTQ H;  3GTO H;  5HGQ A;  3E0E A;  2NU3 I;  4UXH A;  1T9H A;  3PO2 H;  2AKW B;  1KBE A;  4A3E H;  4Y52 H;  1LM0 A;  1C9O A;  2I0Q A;  4DR1 L;  3S15 H;  3RN2 A;  1SGR I;  2UXC L;  3CCS A;  3TRZ A;  4DUZ Q;  1HNZ L;  1IYJ B;  2PQA A;  2F4V Q;  3RNU A;  1YZ6 A;  3BJU A;  4LNQ A;  2N49 A;  2VQE L;  2QQ0 A;  2K75 A;  4PZ8 A;  1UE1 A;  3M85 A;  2KCT A;  2VUM G;  4Z7H A;  5C3E G;  1YU6 C;  5C0X G;  2XMX A;  2VS1 A;  1YBY A;  1PYS B;  1NE3 A;  5IP7 G;  3UDI A;  2MNA A;  2ARP F;  1CE3 A;  1I5F A;  3CXL A;  3S1M H;  4Y7N H;  1UEB A;  4JV5 L;  3HKS A;  1LR7 A;  1W3S A;  1SGD I;  2VQF L;  2UZ3 A;  1G6P A;  4JCV E;  1X3E A;  1HDL A;  4GXT A;  1O7I A;  1EOV A;  4A3L H;  3L2P A;  1OYV I;  1A0I A;  1YTP A;  2KMP A;  1L0W A;  4JI7 Q;  2JEB I;  2UUC L;  1CT2 I;  4C3J H;  1HPT A;  1NY4 A;  1AN1 I;  3HOX H;  1HZB A;  2Q2H A;  3FP9 A;  1QVC A;  3UDX A;  5C44 G;  3BZC A;  1VQ4 A;  1TXY A;  2ASB A;  2ERW A;  2H5X A;  3PIO A;  2F6M B;  4DR3 Q;  1FJG Q;  2Q2I A;  4OWX B;  4A75 A;  2SGF I;  4R4T A;  1PH6 A;  1YHQ A;  4X65 L;  1WYD A;  2UXD L;  1QUQ B;  4YZC A;  1Y1W G;  1CT4 I;  1R9T H;  5EAY A;  4A3K H;  4X66 L;  3OTO L;  3FHW A;  1SRO A;  4B3T L;  1CGI I;  1X3F A;  5GAG C;  1VQD A;  2ORV A;  1TWA H;  1PH3 A;  2LSS A;  4HIO A;  3DLL A;  1DGS A;  4BBR H;  4UXJ A;  2ELI A;  2XTR A;  2DGY A;  2NN6 G;  1XJV A;  2CQO A;  4XIG S;  2N8N A;  4MNO A;  2VRW B;  5LMN Q;  5FUY A;  2NZO A;  1NTG A;  4OO1 I;  2UXB L;  2ZJR A;  4AQY L;  4JI2 Q;  4NV5 A;  3KDF B;  3BU2 A;  3NEL A;  1MJC A;  1W4R A;  3EIV A;  3AJF A;  1DS2 I;  3CCV A;  4UP7 A;  2UUA L;  1PTR A;  2AWO A;  1IXR A;  3HOY H;  3OXG A;  2YTV A;  4RMF A;  3HOV G;  2I5L X;  2E5R A;  1K3R A;  4GNX B;  2B63 H;  2R92 G;  5LMU Q;  5C4X G;  1GKH A;  1XMO L;  1EIF A;  4E1P A;  1HH2 P;  3HOU H;  2KMQ A;  4ALP A;  3RZD H;  2I5H A;  4DR5 L;  1J5E Q;  2DB6 A;  5AJ3 Q;  2JA8 G;  2JA1 A;  2PI2 E;  1P16 A;  3UFF A;  5ELO A;  2QGQ A;  3LGJ A;  4GLV B;  3CC7 A;  4EX5 A;  2BH2 A;  4DV3 Q;  4GKJ L;  1KL9 A;  4OAV B;  1HNW Q;  2WCY A;  4DV6 Q;  2YYZ A;  3K81 C;  4JI8 L;  4R4C A;  2SGD I;  1EQR A;  2MO0 A;  3K7A H;  2V53 A;  3UEJ A;  4X62 L;  5GRO A;  3IAM 1;  1JJ2 A;  2KBN A;  4DR7 Q;  5CCM A;  2YV5 A;  1HR0 L;  3H3V I;  3JAM c;  4JI6 L;  2DUD A;  2NU2 I;  1Q86 C;  5IYB H;  3AQQ A;  2SGE I;  3RLO A;  3GTP H;  1VQ9 A;  2CCZ A;  2ATW A;  4Z7G A;  2VUM H;  2OTL A;  4DR6 Q;  4YWK A;  2Z6K C;  1S72 A;  3I9V 1;  4A3G G;  1EUJ A;  1SGQ I;  4QGU A;  1L2F A;  2E5L Q;  3PO2 G;  1UE6 A;  4A3E G;  2VZA A;  1D7Q A;  5EX3 A;  1TBQ R;  3ZJY C;  1YEZ A;  3FC3 A;  2B29 A;  4LF4 Q;  1JE5 A;  2LXJ A;  2E2J H;  1OXX K;  4WJ4 A;  4GN3 B;  1WOC A;  5J3B A;  1IBK L;  1LR8 A;  4OXP A;  3VDY A;  1JMC A;  3KF8 B;  2BA1 A;  4EQ5 A;  4LFC Q;  3PUV A;  4DV1 L;  4UPA A;  3J7Z C;  4A3C H;  1BUS A;  4JOI A;  4LUZ A;  4R4O A;  1Y1V H;  5C44 H;  4ME3 A;  4DR2 L;  3UIT A;  5GAH C;  4NXN L;  5HI7 A;  5IY0 A;  3RU0 A;  3G48 A;  4DV5 L;  3BJI A;  1VS0 A;  5EX0 A;  2SGP I;  1NJI C;  1Q8K A;  2HQL A;  1YJW A;  3UE1 A;  3L7Z C;  1TWC H;  3KJO A;  3LJ0 A;  4A3J H;  2CJS C;  1SLJ A;  4WJ3 M;  4AS3 A;  2ENZ A;  1Q82 C;  3F4M A;  4A3L G;  4LF7 L;  5GAD C;  5FJ8 H;  3K8A A;  1CKO A;  1VQN A;  2K19 A;  4L5T A;  4YZ9 A;  1QUQ A;  4YCU A;  1B8A A;  3HOX G;  4IOC A;  3RZO H;  5GAE C;  1RL2 A;  1E24 A;  2A8V A;  4OVO A;  1PJU A;  2ALY B;  4A3I H;  4OX9 L;  1FVI A;  2V1C C;  3OW2 A;  2QQE A;  2YFB A;  2N52 A;  4QJF A;  4NXM L;  1PFS A;  4DUZ L;  1VQP A;  4LFB Q;  2RHS B;  4LF5 Q;  4A3K G;  2L7X A;  1Z47 A;  1SGN I;  1IBL Q;  2K4K A;  3W1B A;  2PI2 A;  2UUB Q;  5M3M H;  3KDF A;  3VDU A;  4DKA C;  1E1T A;  3HOV H;  4HID A;  4A93 G;  3UE0 A;  4GOP B;  4BBR G;  4O1O A;  2R92 H;  1I94 L;  2ORW A;  3L0I A;  3ULJ A;  3M4O H;  4POG A;  1BKB A;  2P6A C;  2JA8 H;  1VQM A;  1BMO A;  3CCU A;  4GNX A;  1CHO I;  1OTC A;  2ZM6 Q;  1PHJ A;  4IFD G;  1Q46 A;  2R6G A;  4A3M G;  1LTL A;  2HIX A;  4QIW E;  3IAS 1;  4R4Q A;  1SN8 A;  3S14 H;  1IL2 A;  3U50 C;  3HOY G;  4U6R A;  4KI0 A;  4PMW A;  3S16 H;  2D0P A;  3NEM A;  4AYB G;  1WI5 A;  4DR3 L;  1FJG L;  1GVP A;  3KFU A;  3DM3 A;  2B63 G;  1CSO I;  4RG1 A;  1K9M C;  1BBW A;  3T1Y L;  3MXN B;  4IO9 A;  1Y14 B;  1PV4 A;  1E1O A;  4DV7 Q;  1HZA A;  3HOU G;  3J81 j;  3BZK A;  1MT1 A;  1N34 Q;  1S3O A;  1N32 Q;  1M8C A;  3PUY A;  2ZRR A;  1IW4 A;  4C3H H;  1N33 Q;  3HOZ H;  3UEY A;  4A3G H;  1JJC B;  2GVB A;  4JBM A;  2BUS A;  4DAY B;  1MKH A;  1UE7 A;  4P74 A;  2OD1 A;  2B3G A;  3OXL A;  1HZC A;  5C0X I;  2F3I A;  3JC6 6;  1E3P A;  1M1K C;  1VQ7 A;  3PUZ A;  2XTI A;  5LMN L;  2PNH A;  4O0A A;  4DV2 Q;  1XPR A;  2R7D A;  1VQA A;  2IHE A;  3GO5 A;  1PH4 A;  2AMC B;  5IYB G;  2LEO A;  1TBN A;  2JQO A;  3AFP A;  1VQI A;  5BR8 Q;  1OMU A;  1HJP A;  3K7U C;  1IBM Q;  2FNF X;  1VQC A;  5M5X H;  1LYL A;  2CAZ B;  1Q81 C;  4LFA Q;  1KC8 C;  4GLA C;  4P72 A;  4BBS G;  2JAE A;  1KXL A;  1SGE I;  5LMU L;  1FAQ A;  1XBT A;  1N36 L;  1P8L A;  1XNQ Q;  4HJ5 A;  1J5E L;  3I2Z A;  4JBK A;  1WJJ A;  4HIM A;  3B4V C;  5CCL A;  1H95 A;  2NU4 I;  4UP9 A;  1M8B A;  4A3C G;  1UVG A;  3S2D H;  1I3Q H;  3KLW A;  1Y1V G;  4JI5 Q;  3Q8D A;  1U5K A;  1L1O B;  3I4O A;  1WCM G;  4X64 Q;  2MO1 A;  3JSB A;  1V1H A;  4DR7 L;  3HKZ G;  2NN6 I;  2OCE A;  1YIT A;  5LMN W;  1HJA I;  4A3B H;  2JK8 A;  3S1R H;  3GTK H;  4A3J G;  3F2C A;  2B8T A;  5FJ8 G;  2Q2U A;  1A62 A;  4A93 H;  4LF9 Q;  4DR6 L;  2IY5 B;  2SGQ I;  4DR4 Q;  3G4S A;  4JBJ A;  1JJG A;  1CGJ I;  4B3M L;  2HHH L;  2E5L L;  4A3I G;  4BA1 I;  2NVQ H;  3AFQ A;  1VDD A;  4KHZ A;  2JW6 A;  1HNX Q;  2ZTC A;  1X65 A;  2L15 A;  4GOP A;  1V43 A;  2OTJ A;  1IY6 A;  1EFW A;  5M5W H;  3KF6 B;  4A3M H;  1SMX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...