1U5KA

Recombinational repair protein reco
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
243
structure length
242
Chain Sequence
RSRTANRSGIVIRRRVTPAGDIIVTLLTPQGKLKAIARGGVKGPLSSSLNLFHHVGVQVYQGPHDLASVKQAVLEGALPTLAEPERYAFAHLMAEFADALFQEGEFSEQAFDLFAASLRGVAHQPDPEWVALVMSYKLLGLAGVIPQTARCARCGAPDPEHPDPLGGQLLCSKCAALPPYPPAVLDFLRHAVRRTVRASFEQPVPSADRPALWRALEKFVTVQVGGVHSWRQLVPSGVPVLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein
publication title A Novel Structure of DNA Repair Protein RecO from Deinococcus radiodurans
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Recombination,replication
total genus 65
structure length 242
sequence length 243
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02565 RecO_C Recombination protein O C terminal
A PF11967 RecO_N Recombination protein O N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.120 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 1u5kA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1u5kA01
3.30.60.100 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1u5kA03
3F2DA 1SMXA 3CCRA 1EQQA 4DR1L 1V1QA 3CMEA 2CCZA 2AHOB 2CQOA 1VQ5A 2LXKA 1JJCB 1VQ6A 1CSPA 4P73A 4A3FG 2D0OA 4X66Q 3GO5A 4WJ3M 3KF8B 4JI5Q 4LF4Q 4BXXG 4P74A 1PHJA 2V1CC 4L5RC 3KFUA 4RMFA 4OO1I 2UXBQ 3PUXA 3KJPA 4YWLA 5C44H 5IP9H 1CKMA 4MTNA 3GTPH 3BJUA 3KLWA 5JEAG 4DV2L 5AJ3L 3EIVA 2ES2A 4YY3L 3RLNA 2I5HA 3ZJYC 4UP8A 3PIPA 4A3GH 3UDXA 1K73C 3OW2A 4LUVA 1XMQL 3CC4A 3CCQA 4DV1L 2ZJPA 1IBKQ 3OTOL 5J3BA 2ZTCA 3DLLA 2NN6G 2R7FA 3MEFA 4X65L 4DPGA 2NN6I 4DV6Q 1XPUA 1WCMG 3CXCA 5IP7H 4PZ8A 5M5WH 4A75A 2UU9L 4JI6L 1A0IA 4BBSH 4A76A 2ZJQA 1Y1VH 4JI2L 2JA8G 2EXDA 3M4OH 3RLOA 5JEAJ 5M5YH 3FHWA 4GOPB 4QGUA 2E2JH 1VQ4A 3PO2H 4AQYL 2NZHA 3I4NG 1Q8KA 4JBKA 3HOZH 4OWWB 4X62L 2BA1A 4GNXB 3G71A 3CCSA 3PCOB 5E7NA 5IYDG 1PH4A 4YHHL 5HGQA 4UY8C 4H02A 3RLFA 4JYAL 3FKIH 1HR0L 1WFQA 1KIXA 1OXVA 4OX9Q 1WOCA 1YVCA 3A5ZB 3L0OA 1XJVA 4LUOA 4AYBG 1BBUA 1UWVA 4C3HH 4DR1Q 1N34L 4IFDI 1VQAA 2Q2IA 2R7DA 4B3ML 4ME3A 5JJIA 4YCWA 4MZ9A 4JG2A 2JE6I 2ZTEA 1L1OB 2K75A 2JA5G 2BH8A 3FP9A 2WB1E 3CC2A 5FJ8G 2YTXA 2K50A 4GOPA 3PF5A 1Q7YC 4C3JH 4DR3L 1QVFA 2KCTA 1SE8A 2AWNA 4DV2Q 1TWAH 3M4PA 5AJ3Q 1Q81C 4YY3Q 1VQKA 3I4MH 2WAQG 4LFCL 4J15A 2Z0SA 1EIYB 4B3TL 3GTQH 4IPGA 3STBD 5C4JH 4IFDJ 1EQRA 2VQFL 1XMQQ 1HZCA 1C9OA 4JI8L 4DV1Q 1YITA 3OTOQ 1KHIA 4OXPA 1YEZA 1KAWA 2R92H 1I3QH 1JJ2A 3H3VI 4X65Q 3UE1A 1M1KC 4GKJL 3GTKH 5IT9c 1KRSA 1HNWL 2K5HA 4P71A 2UU9Q 3S24A 4JI6Q 2AKWB 3HKZG 4LFAL 4BY7H 4L5TA 4JI2Q 1YHBA 3WWVA 5C44G 5IP9G 4LF8L 1PH3A 2F52A 2VQEL 4OONA 3JC66 4R4OA 4BBRH 5GADC 3CCLA 1XNQL 4JOIA 3UDGA 4AQYQ 3CC7A 1W3SA 4FDBA 4HJ5A 4A3GG 1NMFA 4A3MH 1YJWA 2Z6KA 4JV5L 3TRZA 4MNOA 4X62Q 2UXCQ 3J81i 3GD7A 4JCVE 5IWAL 3I7FA 4JBMA 2MO1A 3F2BA 4TQUS 2CKZB 4GLAC 4YHHQ 4JYAQ 3ULPA 5IP7G 1HR0Q 3GDEA 4BBSG 2E5LL 1V9PA 3F1ZA 1Y1VG 3KDFB 4GOPC 1IBLL 1EWIA 2PI2E 4PG3A 4EQ5A 4DK3C 1Q1EA 1N34Q 3EN2A 4A3LH 1N32L 1D8LA 4B3MQ 2IT1A 2H5XA 1U0LA 3CPFA 3KJOA 1RIPA 4LWCA 3PO2G 2GVBA 2NVTH 4UP9A 3S1QH 1N9WA 1O7IA 1UE5A 1SN8A 3PSIA 5GAHC 4DUYL 1M90C 2JA6H 3H15A 1TWCH 1D7QA 4LF7L 3GTLH 1E3PA 4JI1L 3E9HA 4DR3Q 2DUDA 2K52A 3K7AH 3RN5A 3GTOH 2A19A 3MXNB 3ULJA 1Q82C 3FKIG 4GKKL 2PQAB 3H3VH 3D31A 4JBJA 1X54A 4LFCQ 4DAMA 3G48A 1Q12A 1YHAA 1E22A 2KENA 4B3TQ 4DR6L 1AE3A 2VQFQ 1LYLA 4JI8Q 3CCMA 3RR5A 4OO1G 4JOIC 2KBNA 2D62A 1NTGA 4A3JH 1PH9A 1UE1A 1IXRA 3VDYA 1X3EA 4P75A 4RG1A 4DR7L 4QIWE 1HNWQ 1LTLA 1G291 3KF6B 1Q46A 1XPRA 1ASYA 4LFAQ 3NELA 3ICEA 3STBC 4OWXB 3A5UA 4BY1H 4DUZL 4LF8Q 2VQEQ 3F2CA 1XNQQ 2IHEA 1NBWA 1NE3A 3I4MG 2UUCL 2OCEA 1QZHA 2VY3A 4KHZA 1HNXL 3HOVH 4JV5Q 5EAYA 3PF4A 2K5VA 4B3RL 3IRBA 4LFBL 1WYDA 2MFIA 4JC0A 5C0XI 5IWAQ 3RNUA 2XTIA 2R92G 3HOYH 2I5LX 3J81c 3T1HL 1FGUA 3TS0A 2IX1A 4B3SL 5ELNA 1JE5A 3S2HH 4L5QA 2Y0SG 3L7ZC 2B29A 1J5EL 2E5LQ 2RHSB 4BY7G 4DV5L 3AYHB 1HR0W 1I50H 4JI3L 1IBLQ 5M5XH 4GN5A 2L15A 1PH2A 4IJLA 2K14A 4A93G 1VQPA 4BBRG 1N32Q 4DR4L 1CUKA 2F3IA 1VQGA 3G6EA 3NEMA 1X6OA 2RF4A 2HT1A 5K36G 3CF5A 5M3FH 1VQLA 3KF6A 4A3MG 4NXML 5C0XJ 1E24A 4DUYQ 1N33L 1VQ8A 2QA4A 4IPCA 4IOAA 4JI7L 1CKOA 3E9IA 1DGSA 4JI0Q 4LF7Q 4JI1Q 1PH6A 4YWMA 2YYZA 1I94L 3LGJA 3D0FA 4IFDG 1CSQA 4GKKQ 1FVIA 1L2FA 4R1JA 2HIXA 4DV7L 1YJNA 1IBML 1CKNB 4A3CH 4HJAA 1JMCA 1P8LA 4A3EH 4DR6Q 4Y52H 4PZ7A 4K0KL 4A3LG 1WI5A 1XNRL 2RHQB 5GROA 1G51A 4DV3L 4HIMA 4NXNL 1XMOL 1YHQA 4A4IA 4ALPA 3TS2A 2VNUD 4GLVB 1GM5A 4IPDA 4DR7Q 3UDIA 1PH5A 1X3GA 2JA6G 1KL9A 5LMUL 1VQIA 4UP7A 3CCUA 2ATWA 4DUZQ 5IYCH 1AH9A 3H0GH 4POFA 4GNXA 1LUZA 4NPSA 4K0KQ 1GVPA 2UUCQ 3BU2A 1Y1WG 1HNXQ 3I2ZA 4R4IA 3ER0A 3HOVG 2B63H 1VQJA 2GVAA 4B3RQ 1KRTA 2R7ZH 1V43A 4LFBQ 1S40A 2Q2HA 1J6QA 2NZOA 5GQOA 4A3JG 2E8GA 2LXJA 2K4KA 3T1HQ 4PMWA 3K81C 3AQQA 3W5OA 4B3SQ 4Y7NH 4KLKA 2MQHA 4X64L 1K9MC 2JEAI 3PUWA 3HOWH 4A93H 1J5EQ 2UUBL 3BZCA 1CKNA 4PZ6A 3S14H 1E7ZA 4YCUA 4DV5Q 1YJ9A 4JI3Q 2N8NA 1L1OA 1U5KA 4BY1G 3PUZA 1BKBA 4YCVA 3W1BA 1PYSB 3DM3A 5C3EH 4DR4Q 4QL5A 1VQDA 4HIKA 2NVXH 1XTDA 5LMNL 2ZJRA 2N78A 5GAEC 2B3GA 3AFQA 1KC8C 1SROA 1MJCA 3CW2C 3ERSX 4NXMQ 1Y14B 1N33Q 1VQNA 1HJPA 3AFPA 1S72A 1YIJA 4LF5L 4JI7Q 2EQSA 2AWOA 5IYBH 3HOYG 4LF6L 2YV5A 1SLJA 1L0WA 4HIOA 1I94Q 1YBYA 4QY7A 5ELOA 4APVA 2PNHA 2IHFA 3HOXH 4IO9A 4DNIA 5IE8A 4DV7Q 4A3BH 3HFZB 3K8AA 1IBMQ 4DR2L 2CFMA 1QUQB 4JBWA 1E1TA 2QGQA 5HY6A 5H1SE 4GNXC 1QVCA 1VQHA 2HQLA 4HJ7A 2MNAA 5FLMH 1XNRQ 1C7YA 3S17H 3S2DH 1A8VA 1SRUA 3J7ZC 1TXYA 1SR3A 1XMOQ 4DV3Q 1EFWA 4NXNQ 2WFWA 2WP8J 1YZ6A 1VQMA 1N36L 5JJLA 5M3FG 2JEBI 2VW9A 1SFOH 3M3YH 5LMUQ 1Y1WH 2ID0A 3J80i 5C4XH 2A8VA 3GTMH 1PVOA 1T9HA 2ZTDA 2OTJA 1VQ7A 1XPOA 4XIGS 2YU9H 2IY5B 3CQZH 1FJGL 3AEVA 2KHJA 1MKHA 4DV0L 1OTCA 1HZBA 2CWPA 2FXQA 3PUVA 4A3CG 1L1OC 3RZOH 2AMCB 1H95A 2JJQA 4A3EG 2Z6KC 3B6YA 3M85A 1HNZL 1HZ9A 4JI4L 1BVSA 1K8AC 2C35B 4WJ4A 3KDFA 2JQOA 4A3IH 3PIOA 1UE6A 2BA0A 3T1YL 3BZKA 2KHIA 4DAYB 3CD6A 4X64Q 1K8GA 1KD1C 1B8AA 4LUZA 1LM0A 3CCJA 3RZDH 2OTLA 2UUBQ 4TVAB 2QEXA 1PV4A 4AH6A 1QUQA 1GKHA 5IY0A 3GTGH 5IYCG 1PA6A 3H0GG 1VQEA 5C0XG 3PO3H 1X3FA 3M4QA 2ASBA 1K83H 3S1NH 1JT8A 2UUAL 5M3MH 4QQBX 1TWGH 5LMNQ 2JA9A 4AYBE 2B63G 4EX5A 2PQAA 4P72A 1ASZA 3U58A 2OWOA 1EOVA 4LF5Q 2R7ZG 2JA7H 4AIMA 5BR8L 4R4CA 4LF6Q 1OXXK 4IJHA 2EIFA 4DKAC 1MIUA 1S3OA 3S15H 3S16H 4KHPL 3HOWG 1B7YB 1RL2A 3CP0A 1HH2P 3TEHB 4LW1A 1AE2A 2DGYA 4DR2Q 1KQSA 3EBEA 3RN2A 2HHHL 2OQ0A 3U50C 2F4VL 2E2HH 3U4VA 2UXDL 4NB3A 2Q2TA 2GN5A 1GD7A 5C3EG 3CAMA 2BH2A 4GKJQ 2WAQE 1R9TH 3HOUH 1N36Q 3PUYA 4IPHA 2NVQH 2VUMH 1PFSA 2RCNA 1Q1BA 5IYBG 1I5FA 2K5NA 1PYBA 1A63A 2OQKA 1VQCA 3J80c 3CCVA 3M7NA 1JJGA 4HIDA 1IZ6A 3HOXG 4A3KG 2UXCL 4A3DH 1FJGQ 3HKZE 4DV0Q 4O0AA 1VQOA 4POGA 4A3BG 1X56A 3JAMi 2HIVA 1HNZQ 2ALYB 3PV0A 4O2DA 4JI4Q 1I6HH 1EIFA 2IX0A 5FLMG 4HJ8A 4DR5L 2Q2UA 3A74A 2PMZE 2YTVA 4DK6C 3T1YQ 4A3FH 3SGIA 3L2PA 2N49A 3I56A 2ZM6L 1W2BA 2E2IH 1VS0A 4DV4L 1PH7A 3OYYA 4BXXH 1HZAA 3UE0A 3W1GA 1IL2A 5C4XG 1VCIA 4XTCS 1N8RC 3J7A5 3PGZA 1K3RA 1TWFH 4LF9L 1PH1A 1E1OA 2VS1A 2CWAA 1NJIC 2UUAQ 4YWKA 4GN3B 4UPAA 2A1AA 3U4ZA 3UDFA 4LNQA 3I4OA 3K0XA 3GTJH 1UE7A 1X55A 1Z47A 5LMNW 3G4SA 1JB7A 2R93G 3J81j 4A3IG 3A0JA 2I5MX 3ULLA 1OXTA 5BR8Q 3CPWA 1YI2A 1QVGA 3S1MH 3I55A 4X66L 1WCMH 5DLQE 4JI5L 4LF4L 1IYJB 4KHPQ 5GAGC 1A62A 4C3IH 1X65A 3M9BA 4HJ9A 2UXBL 2JA8H 1BBWA 5JJKA 3K80C 2R6GA 3NENA 1WJJA 2HHHQ 4L5SA 4BA1I 4X6AH 1K0RA 2D0PA 2F4VQ 1MJEA 1G6PA 1FL0A 3PO3G 2UXDQ 2WB1G 4R4TA 3TQYA 5M3MG 3HKSA 2XGTA 3F8TA 4GLXA 1UEBA 3I4NH 3Q8DA 1OXUA 1YNXA 1IBKL 4A3KH 1NMGA 1VQBA 3K7UC 2JA7G 2N3SA 5IYDH 4DV6L 4QJFA 4OWTB 3NBHB 3KOJA 1VQ9A 1X9NA 1Q86C 4R4QA 3TREA 2KCMA 2LSSA 1NY4A 1P16A 2YTYA 1C0AA 1GO3E 2MO0A 4KI0A 3JAMc 2PI2A 2JK8A 4DR5Q 4GN4B 1KXLA 3HOUG 2ZM6Q 1QZGA 1B70B 2VL6A 4DV4Q 3CCEA 2VUMG 2JA5H 3S1RH 1EUJA 1TWHH 1PH8A 2I0QA 1VQFA 3KYHC 5FJ8H 4IOCA 2VZAA 3HOZG 2NVYH 1Z9FA 1EYGA 4C2MH 2Y0SE 1OXSC 4LF9Q 5FLXc 4OX9L 3E0EA 4A3DG 2R93H 4JI0L 4BA2I 4GS3A 3CMAA
chains in the Genus database with same CATH superfamily
1SMXA 3CCRA 1EQQA 2XN9C 2CCZA 1BUSA 1CSPA 3NBHA 4P73A 2XRQD 4KKUA 4JI5Q 5HGIA 1TVXA 4P74A 4OO1I 1TWHB 2UXBQ 3F2UA 4ZAIA 2F0GA 1L0YB 4FP5D 1UUPA 4C2MB 3MC0B 4YY3L 1KBEA 1D2BA 1K73C 3NUCA 4LUVA 1D1KA 3TN2A 1XMQL 3CC4A 1Q3LA 1IBKQ 1BR9A 3M7GA 1MJBA 5E3PA 4EQNA 5I9OA 1WTRA 4A76A 2FMMA 3B55A 2QDBA 4DAYA 1II3A 3Q24A 2ODDA 1XTCD 5JAVA 3HZXA 2L0CA 4AQYL 3MTSA 2NZHA 3HOZH 1B2TA 4OWWB 3G71A 3CCSA 5E7NA 1GUWA 3B4VC 4H02A 5M5WB 2XTQA 1VF5C 3D00A 3L0OA 4LUOA 1BBUA 4ZLTF 4FF4A 4DR1Q 1HTPA 4OO1H 2XWBB 5JJIA 4PL5A 5CC4A 4HCEA 4JG2A 1E2WA 1L1OB 2K75A 3D6CA 4RHRA 2JA5G 3DA3A 5C3WA 3FSXA 2YTXA 1QVFA 1ULMA 1PFMA 4HEDA 5I2YA 2F0VA 1CHOI 4FXKC 3FKIB 3T16A 3I4MH 4LFCL 4B3TL 1SYGA 2C9OA 1LO5D 4CJ1B 1PPFI 4C3HB 1EQRA 2VQFL 1HZCA 2K5WA 3A8IE 3OPOA 1A3VA 1VF7A 2IJ0A 4RGNA 5EKLA 2B0UC 3H3VI 1IW7D 4X65Q 1TGSI 4KN7C 3NQIA 3UE1A 2K5HA 4P71A 2UU9Q 3S24A 4JI6Q 1AN8A 4LFAL 4BY7H 4JI2Q 2F03A 3R5AA 3IKJA 5IGEA 3DM1A 1PH3A 2F52A 3HH2C 1XNQL 2V53A 4JOIA 3UDGA 1B9MA 1AZPA 4A3MH 5A35A 2Z1CA 3MXPA 2R92B 3DA4A 3NPPA 4TQUS 1LTTD 4YHHQ 2PZTA 3E2IA 1X4SA 5IP7G 2F0HA 3QOJA 4BBSG 2E5LL 2N1AB 1IBLL 3FC3A 5ELCA 3BVZA 4PG3A 3JAME 1Y1BA 4EQ5A 1CHPD 4A3LH 5G3LF 2E73A 2F4IA 2IT1A 2H5XA 1U0LA 2K5QA 3OXLA 1RIPA 1D5ZC 3T53B 2NVTH 3S1QH 3WDNA 2JA6H 1TWCH 1LR8A 2JBWA 4LF7L 3QIAA 1E3PA 3K6OA 2DUDA 4DR3Q 1H9JA 4PL4A 3K7AH 3GTOH 4GKKL 1SMYD 3H3VH 3D31A 1PYWD 4JBJA 1X54A 4NW2A 4RGMA 4DR6L 1EY9A 1SJED 3TBIB 3A8KE 4A3JH 3GP7A 1PH9A 2UVOA 1EY0A 4OEMB 3LX0A 3E3XA 1MT1A 2A6ED 1LTLA 1XPRA 3FPPA 3GV3A 2JB3A 1WTJA 2VQEQ 3F2CA 2QQDA 1B53A 3FBVA 2UUCL 1SGPI 4O1PA 3FPUB 1CE3A 4NP5A 2QGMA 4K6DA 5JPMC 1TT2A 4B3RL 4JC0A 5C0XI 5IWAQ 2XIWA 2IX1A 1FGUA 3MXNA 3S2HH 4DNCA 1TQOA 2DN8A 4L5QA 3L7ZC 2B29A 1NNXA 3OWEB 1D5XC 2AUKA 3F4MA 4JI3L 3C2PA 2PCFB 2L15A 4GN5A 4IJLA 4FXDA 1EY5A 5EGTA 2EY2A 4BBRG 1N32Q 2WVJA 3BS1A 2E75C 9WGAA 5M3FH 2GA4B 5IGBA 3KF6A 4ODGA 3OOCA 3HOVB 4DUYQ 2QILA 1PTQA 2QA4A 3DMUA 4JI7L 3E9IA 2F0IA 1N13A 4JI0Q 3HOYB 4JI1Q 2P6AC 3ITPA 5IGFA 1FVIA 3KBXA 1ULKA 1ENAA 2PPBC 2BDNA 3PIO3 1QNUA 4PZ7A 1WTQA 4K0KL 1QJOA 1WI5A 3C1FA 2IL8A 2RHQB 1XNRL 5KEEA 1AP0A 1H9RA 4HIMA 2ARPF 4ALPA 3UITA 1MI2A 4UXJA 3UDIA 2DJFC 5LMUL 2ATWA 3BJIA 4CBVA 4DUZQ 3DWAA 4XQQA 5C0XH 1HUNA 3I2ZA 5EJWA 4A3EB 1A2TA 1IL8A 1VQJA 3BVMA 3P7JA 2EY1A 4LFBQ 2EZVA 2JXDA 3DWQA 5GQOA 4IUTA 4KY5A 3K81C 4B3SQ 2JEAI 1CKNA 3QG1A 2PZWA 1E7ZA 2XMXA 4NKLA 2SGQI 4KY7A 2LKVA 2N8NA 4BY1G 3ND8A 1CGJI 5HQ8A 5CCMA 3W1BA 1PYSB 3DM3A 5C3EH 1EZ8A 3VDUA 1VQDA 2G9DA 1XTDA 2ZJRA 1ENCA 1KC8C 3CW2C 4TRDA 1N33Q 3GTQH 3AFPA 5IYBH 1EU4A 4LF6L 2LFNA 5CCLA 4HIOA 5ELOA 2CW0D 4KY6A 3HOWB 1DOLA 3S14B 2SGFI 1IBMQ 3K8AA 1V8QA 4GNXC 1HTLD 3S2DH 1ILPA 3IAS1 3S17H 3CXLA 2NVXB 1RJTA 4NXNQ 2TSSA 4UDUC 2VW9A 1FR3A 3K57A 2F0JA 1JQYD 2SNMA 1CA5A 1SEBD 4OVOA 2K5DA 1MKHA 1SNOA 1HZBA 2FXQA 3K5LA 4Z7GA 4A3CG 5CYUA 2Z6KC 5EPKA 5IIFA 4B9XA 1BVSA 4K5WA 4HFVA 3J7AF 1JB3A 1STYA 2K6AA 3PIOA 1SGQI 2BA0A 1FARA 4DAYB 3K59A 1P9GA 4X3KA 3FVVA 3CCJA 3IAYA 5J1ZA 5CBAE 1SFOB 1Y1WB 2OTLA 3M3YB 2FFKB 5C4XB 3GTMB 3GTGH 5IYCG 1BO0A 3CQZB 2ASBA 2UUAL 1CM9A 5LMNQ 2RDFA 4AYBE 2DNEA 1K8OA 4LF5Q 2R7ZG 3I4LA 5BR8L 2BL7A 4JVZA 5J8CA 4O42A 2B2TC 2G9HD 1LT3D 3G6JB 1TURA 3ERQA 3H6MA 4DR2Q 1KQSA 1B1ZA 2K1BA 2F0MA 2OQ0A 2WIIB 1V1HA 2E2HH 2BOSA 3TOBA 2UXDL 2WB1B 1K83B 1GD7A 1LTBD 4G76A 2GN5A 3CAMA 5M3MB 1TWGB 1GUTA 1N36Q 2KUMA 4IPHA 5LL6S 3BDCA 3LJ1A 2A69D 2EYOA 3OMGA 1I5FA 1TU2B 1A63A 4FYDA 4L6TB 2X3TA 1KLGD 2RVLA 1H9SB 5CGKA 4A3KG 2UXCL 4A3DH 2V4DA 1DM0B 4H0LC 3CHBD 2ALYB 2KQ3A 1Y8FA 3EFXD 3VYRA 1HCZA 1WGCA 3A74A 5I2XA 3I72A 2PMZE 1W2BA 4DK6C 1R9TB 4HGUA 2ZM6L 1TKWB 5T1IA 2PW5A 1PH7A 1U4MA 3UE0A 2DNCA 3HOZB 3PIP3 3R5BA 2PO4A 3PGZA 1R79A 4RHSA 1E1OA 1NJIC 4YWKA 4GN3B 1SYFA 3H09A 1G2SA 3UDFA 5D3DA 2GIVA 2YFBA 3I4OA 3GTJH 4KD3A 1QG7A 1I6HB 1EOTA 4A3IG 3S1MH 3A0JA 2I5MX 3CPWA 1CK1A 1QVGA 4K8IA 1UUCA 2OF1A 1WCMH 2EY6A 4KK7A 4RKBA 1EIGA 4GZYC 1ET9A 1IYJB 2D2CC 1A62A 1X65A 3IFDA 4HJ9A 2R6GA 1ZYRD 5A2QE 1MJEA 1PFBA 1FL0A 1G6PA 3PO3G 3TQYA 2XGTA 2C5CA 2A2CA 4A3KH 3RMHA 3K7UC 2A74C 2KOLA 2Z9HA 4DV6L 1TIHA 3KOJA 4IUPA 1X9NA 1BDOA 2EY5A 2KHSA 1SAPA 1F77A 1H9KA 1K7TA 4DR5Q 1C4QA 1QILA 3SE0A 1KXLA 3DHQA 1QZGA 2VL6A 1S5ED 2M2LA 3CCEA 2VUMG 1GJXA 4ABNA 4RCNA 2I0QA 4C1NI 1VQFA 2L12A 1MJ9A 4KHVA 4L8JA 1OXSC 3MXGA 4LF9Q 2EJGC 2L7XA 3E0EA 1MSGA 3V05A 3CMAA 3R5CA 4ZQ3A 1V1QA 4NDXA 2Z4HA 3OSOA 3KY9A 2LXKA 3LJ0A 1JR0D 1HDLA 1CTMA 1NAPA 2D0OA 4X66Q 2RQXA 3GO5A 4WJ3M 2OZUA 3KF8B 3FRPB 4LF4Q 2JA5B 1A6XA 3K58A 3S1RB 2NU2I 1SDFA 1IKLA 5C44H 3S9WA 1CSOI 4MTNA 2NVYB 2DY8A 3KLWA 5JEAG 4DV2L 3EIVA 2OEOA 5D65A 2R93B 3ZJYC 3PIPA 4A3GH 2K9HA 4I65A 4DV1L 2XTRA 3AB9A 3OTOL 1IW7C 2ZTCA 3DLLA 3MEFA 4A75A 1RHPA 1Y1VH 2JA8G 2YQPA 1SYCA 3DWPA 2WKCA 2F3VA 4U6RA 5M5YH 4GOPB 3GTPB 3BDOA 3CRKC 1R4QB 1VQ4A 3PO2H 5IGDA 2VB3X 3I4NG 4JBKA 2YFAA 3TDQA 1TBQR 5CV5A 2K7VA 1VMPA 5IYDG 1PH4A 1PRTF 3MAQA 4AS2A 3RLFA 1HR0L 4BBSB 1KIXA 4OX9Q 1UAPA 4K14A 4YIJA 2B8GA 5D3IB 4AYBG 1DJRD 1UWVA 4FXGC 4IFDI 1VQAA 1K0SA 2E2JB 1X32A 4HN7A 3MFYA 4YCWA 1W6KA 1JWMD 1OVOA 3FDTA 5JEAH 1K7VA 4I1TA 2N17A 3N6RA 3CC2A 1E2ZA 4DU9A 4C3JH 2OD1A 4Q9VA 2KCTA 1TWAH 1Q81C 4IZ8A 1SMYC 4YY3Q 2HUGA 1PTRA 2Z0SA 2RADA 1S5BD 3MZ5A 3STBD 1B4OA 2J4XA 2K05A 5ELDA 4B08A 1C9OA 1XMQQ 4QMGA 1Y1CA 1KHIA 2BDOA 3J7YW 1KAWA 3KLSA 1I3QH 1JJ2A 4GXTA 1M1KC 4R9WA 2A6EC 5E1FA 3GTKH 1KRSA 4AMLA 2WKDA 2AKWB 1YHBA 1G8ZD 3KK7A 2B2YC 4O1NA 4LF8L 3VR2A 1CHQD 1EQTA 4OONA 4CJ0B 4AQYQ 5K36H 5C4JB 5E4XA 1ZKOA 2Z6KA 4JV5L 5DAUA 4MNOA 1PJUA 1TR5A 1JOQA 1MHWC 2GKVA 3UFFA 2IPKD 4IFDH 3I73A 1V9PA 3F1ZA 4GOPC 1EWIA 4DK1A 4DK3C 1Q1EA 5ELEA 3EN2A 4TKOB 4BBRB 1JWSD 5G3LD 5EBCA 3VR6A 1N9WA 4DK0A 3I70A 3NTHA 1TBRR 7WGAA 4N8X1 3E9HA 1BQQT 2JP1A 2K52A 3D4RA 4V0BA 5DNFA 2FMCA 2B2TA 2RDHA 3MA2B 5ELFA 2ZRRA 1K8MA 4LFCQ 4DAMA 3G48A 4B3TQ 1NSNS 1E22A 2KENA 1YNJD 2VQFQ 4DAPA 2D5DA 5A2QL 1TIID 3I91A 3RR5A 4OO1G 2KBNA 2D62A 1SJ8A 1UE1A 4JW0A 1IXRA 1BCPF 3VDYA 4DR7L 1G291 1L0XB 2O5IC 1EL0A 4LFAQ 2XVSA 1CZWA 3GTLB 5EQ0A 1MSHA 3A5UA 4FNFA 2ENBA 1GOZA 2Z8LA 4CDCC 4H13C 1XNQQ 1NUCA 2IHEA 3I4MG 1IW4A 1EYAA 3TMEA 3VA5A 1TOTA 3PF4A 1EU3A 1WYDA 2MFIA 3NK9A 2O4XA 1X3PA 1RDPD 3TS0A 2N88A 1JICA 1JE5A 4I7ZC 5ELNA 4QUFA 1J5EL 2E5LQ 4LK1C 4BY7G 1PFNA 1HR0W 1I50H 1KDBA 1IBLQ 4J8QA 5M5XH 4BY1B 1PH2A 4YZ9A 2K14A 2JA1A 2M9VA 1VQPA 2KECA 1CUKA 2F3IA 3G6EA 1OYVI 2KKMA 3J80E 4A3MG 1VQ8A 4IPCA 2MHVA 1C48A 4LF7Q 1B9NA 2D9UA 4YWMA 1I94L 4UAIA 1WTHA 4GKKQ 3FVQA 4DV7L 2NB0A 4DR6Q 4ZUJA 1PRTB 4A3LG 1A3TA 2L11A 4N9TA 4E1PA 3W3AA 1XMOL 1YHQA 4IUVA 1GUNA 3A7LA 3P75A 2HQEA 3MHBA 1SNMA 1X3GA 2JA6G 1ESRA 3CCUA 1YNND 4H44C 3V96A 3H0GH 3URYA 2GKTI 2UUCQ 1KAAA 3BU2A 4QF4A 2B63H 1D6EC 2LB7A 4PQXA 1Y8OB 4B3RQ 4L63B 4JPBW 2SNSA 1S40A 4A3JG 3H91A 5IT9E 1T5XD 2K4KA 3W5OA 4KLKA 2MQHA 1YO7A 3BZCA 4PZ6A 3TP7A 2AQ3B 4JI3Q 1KDCA 1WTWA 1DD2A 3PUZA 3QAHA 4YCVA 1Z7KB 4QL5A 4IN3A 1TBNA 2XSCA 2N78A 3FEWX 3ERSX 2R7ZB 4JI7Q 2LEOA 1PTOF 4CDDC 2CWFA 3BG3A 1W6JA 3M4OB 4Y7NB 4A93B 4MIUA 1X3QA 3HOXH 1ICWA 5I6YA 3TZDA 5IE8A 4A3BH 2MUYA 1FNVA 2CFMA 1QUQB 2MGSA 1E1TA 5HY6A 4K0KQ 2J0TD 1XNRQ 5FLMH 1GXDC 1EFWA 5JJLA 2WP8J 1YZ6A 1VQMA 2N52A 2W0TA 3VA9A 5M3FG 5FLXE 4OIJA 2NUCA 4IURA 2B2UC 2A69C 5LMUQ 3J80i 2ENZA 4CDEC 1BOSA 2EYLA 2FHTA 2NZ1D 3GOXA 1FJGL 3AEVA 2KHJA 4DV0L 3NSWA 2QEJC 3RD4A 1TS3A 1AZQA 3PDNA 1L1OC 1HNZL 4Q0FA 1BXTA 3KDFA 2O5JC 1MJAA 1UE6A 1LABA 2KHIA 1B3QA 5E4WC 1IY6A 1LM0A 3RZDH 2QEXA 2CWHA 4AH6A 5IY0A 1DXMA 1FY7A 1BCPB 4XT1B 3L3OC 2YU9B 5C0XG 1X3FA 3S1NH 1JT8A 5BN4A 1CT4I 1RODA 2QKIC 2JA9A 3RZOB 1HXYD 1Z6HA 1ASZA 1H9MA 1JC7A 4A3IB 4QUCA 3J81E 2JA7H 4EVOA 4LF6Q 1OXXK 3FMCA 2N71A 3S16H 1MIUA 4KHPL 4OL7A 5T1GA 1RL2A 3CP0A 3TEHB 1PZID 4KD4A 1AE2A 2HHHL 4KJNA 2F4VL 1LLRD 3A54A 3QO2A 3DO9A 3PO3B 2NYZD 2NTTA 4NB3A 1XA6A 2ZW3A 2F0NA 2K33A 5C3EG 3NE5B 5E3QA 2WAQE 4BWGB 3VE5A 3HOUH 3NHHA 3E59A 2R61A 1HUMA 1PFSA 1IKMA 5IYBG 1PYBA 1VQCA 3SK8A 3J80c 1BBXC 3M7NA 4KKTA 3S15B 4G7OC 1JJGA 1TS5A 3HKZE 1VQOA 4O0AA 2B39A 4POGA 3JAMi 2HIVA 1EIFA 2Q2UA 4A3FH 1CT2I 2E2IH 4BXXH 2VUMB 5FKAC 3A56A 3W1GA 3BZDB 4HAEA 1E0BA 4XTCS 3QB3A 1N8RC 4N8FA 2M5XA 2RLDA 1PH1A 2UUAQ 1CT0I 1M8CA 3U4ZA 3NQTA 4LNQA 3K0XA 4K8JA 1X55A 4X3TA 4Z7HA 3LNNA 3NWTA 4RA8A 3J81j 5BR8Q 1OXTA 3J80L 4DXGA 3I55A 1I4PA 1DONA 1F2YA 5EPJA 4C3IH 1FGBD 3K80C 4X6AH 4BA1I 1TY0A 1JWUD 1TWFB 2A68D 2UXDQ 4K2LA 2FUG1 2Z6BA 1AEXA 4GLXA 1OXUA 1VDZA 2NBFA 1GUOA 2ZXRA 4XYQA 3UI2A 1NMGA 1SGDI 2XRSD 4HSPA 1RTOA 3NBHB 1VDDA 2L5TA 5COYA 2JA8B 3D8GA 2H4OA 1RD9D 4HEA1 5IOCA 1PTOB 4QIWB 2MO0A 5M9OA 1ZEQX 1U4PA 3JAMc 2NU1I 1WTOA 4N9PA 4CKEA 3I4NB 3AU7A 2ZM6Q 2EYPA 2SDFA 2NWGA 1TWHH 1PH8A 5FJ8H 3KYHC 1CQVA 5IT9L 4IOCA 2EVBA 1M8AA 2B2WC 5C4HA 4C2MH 2Y0SE 5FLXc 4A3DG 4JI0L 1Y8NB 1O78A 5JVG3 3F2DA 1HQRD 2F6MB 1GHJA 2CH4A 2PNRC 4G57A 3VR3A 3CMEA 2ROWA 3G7LA 2AHOB 3X3NA 1VQ5A 1JJCB 3T51B 2ZT9C 4B9WA 2PYKA 4ZYSA 1KNAA 5KYIA 1G2TA 1WGTA 1PHJA 4L5RC 3KFUA 4RMFA 4MPIA 5C5MA 3C46A 5IP9H 3JAML 3BJUA 2ES2A 2ICIA 4K5VA 5AJ3L 1WD0A 1BNZA 3DUZA 2I5HA 1SGYI 1I4XA 3OIPA 4DN4M 3UDXA 4RGOS 3OW2A 4EQOA 5EPLA 4J1MA 1SJHD 5J3BA 3WOFA 1NUBA 4DPGA 4DV6Q 1WCMG 3CXCA 5FLXL 3I8ZA 4PZ8A 5M5WH 1A0IA 2ZJQA 5TSSA 3K5OA 3RLOA 4OAVB 1WVLA 2PMZB 1QWYA 2L4NA 1SE2A 3A8JE 3QOLA 3MFGA 2XNAC 1W4RA 4X62L 1TUSA 3DEOA 4F7XA 3PCOB 2WCYA 1PRTD 4UY8C 2RBMA 1LTGD 4UHVA 4JYAL 1ONLA 3FKIH 3KLRA 1WFQA 1K7UA 1E2VA 1OXVA 1WOCA 4RCOA 3JSBA 4M1UB 5CV4A 3Q23A 4ID6A 2F0KA 4KN4C 4C3HH 1N34L 2R7DA 2X69A 4B3ML 4ME3A 4MZ9A 1V1IA 1SYEA 4RKLA 2JE6I 4WJWA 2SOBA 5NUCA 5C5LA 2ZTEA 1RCVD 2JXMB 1XWEA 2BH8A 5CV9A 2WB1E 3PQIA 1Q7YC 2K50A 4F87A 3C3LA 2ENNA 1SE8A 1FNUA 2AWNA 4ZUIA 3M4PA 4DV2Q 1VQKA 1Q90A 1I6VC 2WAQG 5FUVA 1YNJC 4IPGA 3EQLC 1RTNA 4JI8L 4DV1Q 4ZKBB 3OTOQ 2QQEA 2EYFA 3HP3A 1YEZA 2R92H 4WFN3 2CQAA 2EJFC 1DOKA 1HNWL 2B2UA 1B50A 3N52A 3HKZG 2WV6D 3WWVA 2PQEA 2O2LD 5C44G 1O7YA 4R4OA 3JC66 5GADC 3CCLA 3I4MB 2MP1A 5CV8A 3C1EA 3R8BA 5D14A 3CC7A 4FDBA 2BE5D 4HJ5A 4A3GG 2QPOA 1SYDA 2B8FA 3SK4A 5KIXA 1LTSD 2WGCA 2CKZB 5DEHA 3FSYA 4IUUA 1S5FD 3ULPA 1BF4A 1HR0Q 4DF7A 4BY7B 2F0WA 1JORA 1Y1VG 3E5SA 3KDFB 1SYBA 2PI2E 2RIJA 1H0ZA 1A15A 3A55A 1EY4A 1F9RA 2HD3A 2R3ZA 1D5MC 5J39A 1WTVA 3PO2G 3CPFA 3KJOA 2X52A 2CWGA 4K6LA 4A3MB 3QJYA 4XT3B 1O7IA 1SN8A 3PSIA 1V1OA 1LT4D 4L9MA 1D7QA 5JJZA 1HFNA 3Q22A 2J87A 2ORWA 3RN5A 2A20A 1STHA 2A19A 3MXNB 4XYOA 3ULJA 1Q82C 4FF3A 3D4WA 1HFGA 3MXUA 1UVFA 1Q12A 2F0FA 1P9ZA 5FO8B 4KKSA 1NR2A 1LYLA 1S5CD 1I4QA 3LWUA 2OT2A 4JOIC 3UEJA 2NVTB 1X3EA 1BCPD 3T56B 3S1QB 1U4LA 3KF6B 1ASYA 2JA6B 1TBOA 1TWCB 1AN1I 1NR4A 1YNNC 1CGII 3OW7A 4ZRZA 3ICEA 4OWXB 3HEJA 4C3JG 3K7AB 4LF8Q 4RFBA 3GTOB 2MPMA 1NBWA 1NE3A 1EEFD 2AQ1B 4XQJA 2OCEA 2VY3A 4KHZA 4LJZC 1SBBB 1HNXL 3QWPA 1DS3I 3HOVH 4JV5Q 5EAYA 5KRUA 2K5VA 3IRBA 1CA6A 4MTKA 4A3JB 1JCKB 2XTIA 3HOYH 3T1HL 2RIOA 1TS2A 2Y0SG 5J22A 4CGYB 4DV5L 3UGIA 1B44D 2Q8TA 5KNBA 1ESFA 1XX6A 2V6EA 1RKNA 1XXGA 2VXWA 3AJFA 1CFMA 4DR4L 1VQGA 3NEMA 2RF4A 3GQBA 5K36G 2MJFB 1VQLA 4NXML 1KTKA 5C0XJ 1CKOA 1DGSA 2YYZA 3S2HB 2KMQA 3D0FA 4IFDG 1CSQA 3R5DA 5FUXA 4R1JA 1CT1D 1YJNA 1CKNB 1DOMA 4HJAA 1P8LA 5LHY1 4A3EH 3CRLC 3SXHA 3D4DA 4WP4A 1WD1A 1G51A 4DV3L 3TS2A 4A4IA 5M3FB 1HEVA 4GLVB 1GM5A 4IPDA 4DR7Q 3SR1A 3BYTB 4CKCA 1KL9A 1XYIA 2KCNA 3D3RA 3TOAA 4G7HC 1AH9A 3Q6SA 4GNXA 2QZGA 3R2TA 4NPSA 4F88A 1GVPA 1Y69U 1NCVA 1DCZA 1Y1WG 1J9OA 4R4IA 3ER0A 2B2VC 3Q0AA 2LMCB 2Q8IB 1PDQA 1M8BA 2EYHA 1KRTA 2Q2HA 1J6QA 2NZOA 1LACA 2E8GA 3ONAB 3BDLA 2Q8RE 2YUUA 3AQQA 4X64L 3HOWH 1J5EQ 2UUBL 4XQNA 3S14H 3HG9A 2ELIA 2JW6A 1U5KA 4K2KA 1G91A 2A2DA 5JPNC 1LT6D 4HIKA 2NVXH 1EZ6A 2B3GA 2I46A 3AFQA 1VQNA 1Y14B 5JHWC 1S72A 1YIJA 2F66B 1WTXA 2EQSA 3MWYW 3E6ZX 2AWOA 4R8NA 5CR3A 2YV5A 3BYYB 1PTOD 1L0WA 1I94Q 1YBYA 2OU2A 2PNHA 2FJ2A 1DS2I 5CORA 1A3UA 3VDPA 4DV7Q 3HFZB 4ME5A 2ORVA 2QGQA 2F0TA 4I7AA 4HJ7A 2MNAA 1C7YA 5C3EB 3J7ZC 4GKJL 1TXYA 1SR3A 5E3FA 1XMOQ 1FYBA 2WFWA 2JEBI 3GTQB 2AUJD 4OHJA 1SFOH 4HR7B 3M3YH 1B3AA 3T13A 1Y1WH 5C4XH 3UGLA 3GTMH 2OTJA 5L37A 1VQ7A 1XPOA 2GKRI 4XIGS 3CQZH 1EWHA 1Y8PB 3NWSA 2QSBA 2CWPA 4U68A 4U673 2JJQA 1HZ9A 4JI4L 4CDFC 1SE3A 1K8AC 2C35B 3S2DB 4WJ4A 3S17B 3SGBI 2JSOA 3T1YL 2VRWB 3CU7A 3CD6A 1SGRI 1QE6A 2RSOA 3CKIB 1LT5D 1KD1C 1B8AA 1K8GA 2XRCA 1GKHA 2QF7A 2KEEA 3EROA 4KMUC 2JYOA 1S4ZA 3VR4A 1PA6A 3H0GG 3L9AX 2KEDA 2PZUA 1K83H 1T5EA 1CZGA 5M3MH 4QQBX 5FUWA 1TWGH 2WINB 2SEBD 2B63G 2PQAA 1TDPA 3OVOA 3U58A 2IP6A 1I4RA 2K28A 3VYUA 3MEHA 4R4CA 5KYLA 1NXUA 4DKAC 3RU0A 1U4RA 2EYMA 1AFPA 1HH2P 4LW1A 2DGYA 2P5ZX 1ILQA 3EBEA 3RN2A 3GTGB 3QWNA 2E76C 3U50C 1WTPA 2A68C 3U4VA 2Q2TA 3NTIA 1R9TH 2F0QA 1LTAD 2CW0C 2A6HD 2NVQH 2JZMA 1QOHA 1Q1BA 4HTHA 2EDGA 2K5NA 4HIDA 1IZ6A 3HOXG 1FJGQ 4DV0Q 4A3BG 3SDJA 1ML0D 1G6ZA 1O80A 1QNKA 4ZCKA 1HNZQ 3PV0A 3OIQA 4O2DA 2E2HB 4DFAA 1I6HH 5FLMG 1JQOA 3IFTA 2L1BA 4IALA 3SGIA 4YZCA 3I56A 1VS0A 2KCCA 4DV4L 3OYYA 1IYUA 4MN3A 3R93A 2IW3A 2PQ8A 1HZAA 1KLUD 1IL2A 1M4VA 3J7A5 1K3RA 4A3DB 2VS1A 4DWLA 3HGBA 5IGCA 5CBEE 2F0DA 1UE7A 1Z47A 2HCIA 3G4SA 1O7LA 2R93G 3ULLA 4OIKA 1YI2A 1ET6A 3SDZA 5FOBB 1H9SA 1HA5A 1LR9A 5DLQE 4JI5L 4KHPQ 3SEKC 1RF2D 5J8FA 5GAGC 3M9BA 2UXBL 3R2IA 4L5SA 2HHHQ 1SE4A 1K0RA 2BUSA 2D0PA 2F4VQ 4M8AA 3TO7A 2MJ8A 5IGGA 4R4TA 1FNWA 1WKXA 3HKSA 3IAM1 4NMZA 1BMOA 1UVGA 4X3UA 2EXZA 3GTJB 1YNXA 1IBKL 2J7ZA 3KBGA 5I4DA 2JA7G 3S1MB 3FNBA 2IWHA 2M00A 1VQ9A 1WCMB 4OWTB 4EQPA 2KCXA 3TREA 2KCMA 2DKVA 2LSSA 1NY4A 1IHZA 2YTYA 1GO3E 1V1PA 4KI0A 4RAUC 2PI2A 4QB4A 3ZYYX 5EX0A 2BL8A 3HOUG 4A3KB 2JA5H 3ND9A 4Q5VA 3S1RH 1EUJA 2LUYA 2RKSA 2VZAA 2L8EA 2F0LA 1PRTC 4DXFA 2NVYH 1Z9FA 5AFWA 3K0YA 1MBYA 2R93H 4FO2A 1PZKD 4BA2I 2QDLA 4GS3A 1GUSA 1VMCA 2B8TA 4DR1L 2NU4I 2CQOA 1VQ6A 1KNEA 4A3FG 1Z2IA 1K3BC 4BXXG 4NV5A 2ICEC 2V1CC 1XX8A 3PUXA 3KJPA 4YWLA 1CKMA 3GTPH 2A5HA 4RWSC 1Q8IA 3RLNA 2WAQB 4IQZA 3VA7A 4UP8A 1F2MA 1IY5A 2FEFA 3CCQA 1SNPA 2ZJPA 1PXUA 4S3SA 2NN6G 2R7FA 4HMJA 4X65L 1XPUA 2NN6I 5KNCA 1ZYRC 5IP7H 4Y52H 2UU9L 4JI6L 3HKZB 4BBSH 4C3IG 2SGDI 2Z4IA 3D6WA 4WORA 4JI2L 1FD7D 2EXDA 5C44B 2F1MA 2DIPA 5JEAJ 3FHWA 1C8CA 3GV6A 2F0PA 4QGUA 5CV6A 2E2JH 3QR8A 2G5DA 2BE5C 4A3GB 4CKBA 1Q8KA 3KF8A 3NBIA 4FKDA 2B2VA 1KABA 3HS0C 2F0UA 2BA1A 4GNXB 3SHLA 1A2UA 4YHHL 5HGQA 2B2YA 3KUPA 3TZUA 4DAVA 1DZ1A 1HA6A 1K28A 4X3SA 1YVCA 1Y1VB 3A5ZB 3PMFA 1SGEI 1XJVA 5M5YB 3UGDA 2IX3A 1SGNI 5JOBA 2Q2IA 2K04A 5ELBA 3PO2B 1U9RA 2RSNA 1EIHA 4DNTB 2L9HA 2KMRA 3FP9A 1OO9B 5FJ8G 4GOPA 3PF5A 4DR3L 3OHXC 2ZXOA 1STAA 5AJ3Q 2QQCA 5DM73 2H1EA 2NN6H 4J15A 5FO9B 1EIYB 2K03A 5C4JH 4IFDJ 4GI3C 1RFHA 1YITA 4OXPA 3L0IA 3O13A 4IUQA 1S20A 1BCPC 2FU2A 1STBA 5IT9c 1KDAA 1F2ZA 4ULLA 5EBDA 3M4YA 4L5TA 5EKKA 4C3JB 5IP9G 4SGBI 2VQEL 1TWAB 4BBRH 2TMPA 2LY7A 5I6WA 1W3SA 5CV7A 1NMFA 1YJWA 3SVMA 3TRZA 3DEPA 4KTAA 5BN3A 4X62Q 2UXCQ 3J81i 3GD7A 4JCVE 5IWAL 1I3QB 3I7FA 2MO1A 4JBMA 3F2BA 1CQFA 3SGQI 1O7ZA 4GLAC 3GTKB 5KNDA 2Y0SB 1OMTA 4JYAQ 1STEA 3GDEA 3SEBA 1EYCA 5C3XA 3LWEA 2SGEI 2P22B 1EYDA 1N34Q 3HRZC 2CJSC 1N32L 1D8LA 4B3MQ 1PZJD 4LWCA 1DYQA 2GVBA 4UP9A 1R0RI 1UE5A 5GAHC 4DUYL 1M90C 3U9SA 3H15A 2F3WA 2EPBA 3GTLH 1TY2A 4KJOA 2EYJA 4JI1L 4AYBB 4XDXA 3TO9A 3FKIG 2CAZB 2PQAB 3RUZA 4IUNA 1YHAA 5K5PA 1AE3A 4C3HG 4JI8Q 3CCMA 3MVVA 1NTGA 1MD2D 3I90A 1FAQA 5CMDA 4P75A 2KMOA 1I4GA 4RG1A 1F2LA 1HNWQ 2ZXPA 4QIWE 1Q46A 1UEAB 3NELA 1EY7A 1HJAI 1CI3M 3SK5A 1PCEA 3STBC 2CH4W 4BY1H 4DUZL 4YZDA 2K01A 3UOEA 1F9QA 1SNDA 1QZHA 5KGUA 2A73B 1YTPA 2QW7A 1ENFA 5E3RA 4LFBL 1HPTA 1EQVA 3RNUA 4OAUC 2R92G 2GVIA 4PL3A 2I5LX 3J7AV 3J81c 3K5MA 4B3SL 2JN4A 4C1NK 3I9V1 4H7BA 3R3OA 2Y0MA 2RHSB 4KV6A 3AYHB 4HMIA 2RA4A 2DB6A 2OXPA 4A93G 4FF1A 1X6OA 2HT1A 5I9PA 3CF5A 4WRDA 1E24A 1N33L 3TO6A 2SGPI 5ISRA 4IOAA 2X6LA 2FNFX 1PTOC 2HDLA 5DAEA 3OWFA 2F0OA 1PH6A 4TSSA 3LGJA 3P20A 1L2FA 3E0JA 4R8IA 2HIXA 1IBML 1I50B 4A3CH 2K32A 5M5XB 1JMCA 5C6AA 3LJ2A 3NXWA 3AMUA 3TJQA 3J81L 5GROA 4HCSA 2BCOA 4NXNL 2VNUD 2VB2X 5HGTA 2OVOA 1QCBD 1PH5A 3UEYA 1VQIA 4OGQC 4UP7A 1R4PB 1TS4A 5IYCH 1UNSA 2NVQB 1PMRA 4POFA 1LUZA 2KA7A 4FVMA 2QQ0A 1XBTA 2E2DC 3VYTA 1HNXQ 1QB5D 1LTID 3TP5A 2GVAA 2R7ZH 1V43A 5EX3A 1UHAA 2FINB 2JB1A 1Q9BA 2LXJA 1EWCA 4PMWA 5FK9C 3T1HQ 3M4OH 3EVQA 4Y7NH 4A93H 1K9MC 2F0SA 3PUWA 1V1PB 5LL6X 2UZ3A 2RC4A 4DV5Q 3NP8A 4YCUA 1YJ9A 1D1IA 1JE4A 1L1OA 3OMCA 1BKBA 4DA2A 3H0GB 3VYSA 4DNRB 4PNYA 2K19A 4DR4Q 4UXHA 3SK6A 1SNCA 5LMNL 5GAEC 2B63B 3TP8A 4NXMQ 1SROA 1MJCA 3HOVG 4FF2A 4ZK9B 1HJPA 4LF5L 1LR7A 3IL8A 3W2DA 1F9PA 4J6HA 3HOYG 2E5RA 1SLJA 4ZKCB 4QY7A 4APVA 3EJIA 4IO9A 2IHFA 2RDGA 2ETDA 2RCFA 5HI7A 2V1CA 4DNIA 1KBFA 4CHTB 4EGVA 1STGA 4DR2L 2F0EA 4JBWA 5H1SE 1QVCA 1VQHA 2HQLA 4B6DA 1A8VA 1SRUA 1MGSA 2WACA 5IODA 1EFID 4DV3Q 2HGKA 4NV2A 1N36L 2A6HC 4LMQD 4K5XA 5EKIA 2L55A 2J9RA 4QCLA 2ID0A 2EOTA 2DJGC 2A8VA 2CHBD 1PVOA 1T9HA 2ZTDA 4RH6A 3HOXB 2YU9H 2IY5B 4G75A 4A3BB 1OTCA 2HCCA 3I3CA 3PUVA 3RZOH 2AMCB 1H95A 4A3EG 3B6YA 3H94A 3M85A 1J8IA 2JQOA 4A24A 4A3IH 1ICFB 4F8MA 2AQ2B 3BZKA 3KLSX 4X64Q 2NU3I 4LUZA 4DGZA 2UUBQ 4TVAB 1PV4A 1QUQA 4JK1C 1S5DD 4OELB 2KMPA 4G4KA 1YU6C 1VQEA 3PO3H 3M4QA 2JYYA 1EY6A 3BVGA 2GSCA 4EX5A 4P72A 2OWOA 1EOVA 2KVMA 4AIMA 3VR5A 4IJHA 1IYVA 2EIFA 3TP6A 1S3OA 3S15H 4E6IA 3HOWG 1B7YB 1BUVT 5LNK1 2EE1A 3RZDB 1AW7A 1HRJA 2X6GA 1SXTA 3NTKA 3S1NB 2BH2A 4GKJQ 3TSSA 4O1OA 1PLFA 2L1LB 3PUYA 2LS01 2NU0I 1I4HA 2JB2A 2VUMH 2EJMA 1HHVA 2JA7B 2RCNA 4XXEA 4UXIA 2OQKA 1HQMC 1SNQA 3CCVA 3S16B 4ILWA 5C4ZA 4C56C 5DM63 5FO7B 1X56A 3T4AC 4JI4Q 1Z7TA 2IX0A 1FYCA 4HJ8A 4DR5L 1JOOA 2YTVA 3T1YQ 2DY7A 2N49A 3L2PA 3HOUB 1OMUA 3X3MA 3KP9A 3OL0A 2QCPX 1STNA 3EA6A 5C4XG 3QTLD 1VCIA 4PMCA 1TWFH 4LF9L 3OXGA 2CWAA 4UPAA 2A1AA 1EEID 5FUYA 1JB7A 5LMNW 3OXFA 2I07B 1GUGA 4CJ2C 1HPCA 4V190 4A3FB 4LAAA 1ZXTA 4X66L 2E2IB 3H3VC 2B2WA 4LF4L 4P2CB 3K5NA 4G7ZC 2JA8H 1BBWA 2PW7A 5JJKA 3P1HA 3NENA 1WJJA 4MHEA 1GHKA 1PTOH 3A7AB 2XWJB 1EY8A 1KMAA 2WB1G 3U9OA 2HDMA 3P23A 5M3MG 3F8TA 3V2TA 1UEBA 2JAEA 4PV1C 3I4NH 3Q8DA 2ERWA 1VQBA 4HSVA 2N3SA 5IYDH 2N55A 2E74C 4QJFA 1Q86C 4R4QA 4C3IB 1ULNA 5F2DA 4PMBA 4BS9A 1P16A 1C0AA 1SSOA 2F3CI 2JK8A 4RGTA 2KJXA 4Z9CB 4GN4B 1B70B 2NTSA 4DV4Q 1X74A 5JVH3 5HURA 4AS3A 1LTRD 1LV9A 3HOZG 1JOKA 5BN5A 1EYGA 1F9SA 4E1RA 3WOEA 4OX9L 3DXJC 2CVRA 3MEKA
chains in the Genus database with same CATH topology
1SMXA 3CCRA 1EQQA 2CCZA 1BUSA 1CSPA 4P73A 4JI5Q 5HGIA 4P74A 4OO1I 2UXBQ 4YY3L 1KBEA 1K73C 4LUVA 1XMQL 3CC4A 1IBKQ 4A76A 2ODDA 4AQYL 2NZHA 3HOZH 4OWWB 3G71A 3CCSA 5E7NA 3B4VC 4H02A 2XTQA 3D00A 3L0OA 4LUOA 1BBUA 4DR1Q 5JJIA 4PL5A 4JG2A 1L1OB 2K75A 2JA5G 3DA3A 2YTXA 1QVFA 1CHOI 3I4MH 4LFCL 4B3TL 1PPFI 1EQRA 2VQFL 1HZCA 2B0UC 3H3VI 4X65Q 1TGSI 3UE1A 2K5HA 4P71A 2UU9Q 3S24A 4JI6Q 4LFAL 4BY7H 4JI2Q 1PH3A 2F52A 3HH2C 1XNQL 2V53A 4JOIA 3UDGA 4A3MH 3DA4A 4TQUS 4YHHQ 3E2IA 1X4SA 5IP7G 4BBSG 2E5LL 2N1AB 1IBLL 3FC3A 4PG3A 1Y1BA 4EQ5A 4A3LH 2E73A 2IT1A 2H5XA 1U0LA 3OXLA 1RIPA 2NVTH 3S1QH 2JA6H 1TWCH 1LR8A 4LF7L 1E3PA 4DR3Q 2DUDA 4PL4A 3K7AH 3GTOH 4GKKL 3H3VH 3D31A 4JBJA 1X54A 4DR6L 4A3JH 1PH9A 1MT1A 1LTLA 1XPRA 2JB3A 2VQEQ 3F2CA 2QQDA 3FBVA 2UUCL 1SGPI 4O1PA 1CE3A 4B3RL 4JC0A 5C0XI 5IWAQ 2IX1A 1FGUA 3S2HH 4L5QA 3L7ZC 2B29A 3F4MA 4JI3L 4GN5A 2L15A 4IJLA 4BBRG 1N32Q 2WVJA 5M3FH 3KF6A 4DUYQ 1PTQA 2QA4A 4JI7L 3E9IA 1N13A 4JI0Q 4JI1Q 2P6AC 1FVIA 4PZ7A 4K0KL 1WI5A 1XNRL 2RHQB 4HIMA 2ARPF 4ALPA 3UITA 4UXJA 3UDIA 5LMUL 2ATWA 3BJIA 4DUZQ 3I2ZA 1VQJA 4LFBQ 2JXDA 5GQOA 3K81C 4B3SQ 2JEAI 1CKNA 1E7ZA 2XMXA 2SGQI 2N8NA 4BY1G 1CGJI 5HQ8A 5CCMA 3W1BA 1PYSB 3DM3A 5C3EH 3VDUA 1VQDA 1XTDA 2ZJRA 1KC8C 3CW2C 1N33Q 3GTQH 3AFPA 5IYBH 4LF6L 5CCLA 4HIOA 5ELOA 2SGFI 1IBMQ 3K8AA 4GNXC 3S2DH 3IAS1 3S17H 3CXLA 4NXNQ 2VW9A 4OVOA 1MKHA 1HZBA 2FXQA 4A3CG 4Z7GA 2Z6KC 1BVSA 4HFVA 3PIOA 1SGQI 2BA0A 1FARA 4DAYB 3CCJA 2OTLA 3GTGH 5IYCG 2ASBA 2UUAL 5LMNQ 4AYBE 4LF5Q 2R7ZG 5BR8L 1TURA 4DR2Q 1KQSA 2OQ0A 1V1HA 2E2HH 2UXDL 2GN5A 1GD7A 4G76A 3CAMA 1N36Q 4IPHA 3LJ1A 1I5FA 1A63A 4A3KG 2UXCL 4A3DH 2ALYB 1Y8FA 3A74A 2PMZE 1W2BA 4DK6C 4HGUA 2ZM6L 1PH7A 3UE0A 3PGZA 1R79A 1E1OA 1NJIC 4YWKA 4GN3B 3UDFA 2YFBA 3I4OA 3GTJH 4A3IG 3S1MH 3A0JA 2I5MX 3CPWA 1QVGA 1UUCA 1WCMH 1IYJB 1A62A 1X65A 4HJ9A 2R6GA 1MJEA 1G6PA 1FL0A 3PO3G 3TQYA 2XGTA 2A2CA 4A3KH 3K7UC 4DV6L 1TIHA 3KOJA 1X9NA 4DR5Q 1KXLA 1QZGA 2VL6A 3CCEA 2VUMG 2I0QA 1VQFA 1OXSC 4LF9Q 2L7XA 3E0EA 3CMAA 1V1QA 3KY9A 2LXKA 3LJ0A 1HDLA 2D0OA 4X66Q 3GO5A 4WJ3M 3KF8B 4LF4Q 2NU2I 5C44H 1CSOI 4MTNA 3KLWA 5JEAG 4DV2L 3EIVA 3ZJYC 3PIPA 4A3GH 2K9HA 4DV1L 2XTRA 3OTOL 2ZTCA 3DLLA 3MEFA 4A75A 1Y1VH 2JA8G 2YQPA 4U6RA 5M5YH 4GOPB 1VQ4A 3PO2H 3I4NG 4JBKA 2YFAA 1TBQR 5IYDG 1PH4A 4AS2A 3RLFA 1HR0L 1KIXA 4OX9Q 4AYBG 1UWVA 4IFDI 1VQAA 4YCWA 1OVOA 4I1TA 2N17A 3CC2A 2OD1A 4C3JH 4Q9VA 2KCTA 1TWAH 1Q81C 4YY3Q 1PTRA 2Z0SA 3STBD 1XMQQ 1Y1CA 1C9OA 1KHIA 1KAWA 1I3QH 1JJ2A 4GXTA 1M1KC 3GTKH 1KRSA 2AKWB 1YHBA 4LF8L 4OONA 4AQYQ 2Z6KA 4JV5L 4MNOA 1PJUA 2GKVA 3UFFA 1V9PA 3F1ZA 4GOPC 1EWIA 4DK3C 1Q1EA 3EN2A 1N9WA 1TBRR 3E9HA 2K52A 2ZRRA 4LFCQ 4DAMA 3G48A 4B3TQ 1E22A 2KENA 2VQFQ 3RR5A 4OO1G 2KBNA 2D62A 1SJ8A 1UE1A 1IXRA 3VDYA 4DR7L 1G291 4LFAQ 3A5UA 1XNQQ 2IHEA 3I4MG 1IW4A 1TOTA 3PF4A 1WYDA 2MFIA 3TS0A 5ELNA 1JE5A 1J5EL 2E5LQ 4BY7G 1HR0W 1I50H 1IBLQ 5M5XH 1PH2A 4YZ9A 2K14A 2JA1A 1VQPA 1CUKA 2F3IA 3G6EA 1OYVI 2KKMA 4A3MG 1VQ8A 4IPCA 4LF7Q 4YWMA 1I94L 4GKKQ 4DV7L 4DR6Q 4A3LG 4E1PA 1XMOL 1YHQA 1X3GA 2JA6G 3CCUA 3H0GH 2GKTI 2UUCQ 3BU2A 2B63H 4B3RQ 1S40A 4A3JG 2K4KA 3W5OA 4KLKA 2MQHA 1YO7A 3BZCA 4PZ6A 4JI3Q 3PUZA 4YCVA 1Z7KB 4QL5A 1TBNA 2N78A 3ERSX 4JI7Q 2LEOA 3HOXH 5IE8A 4A3BH 2CFMA 1QUQB 1E1TA 5HY6A 4K0KQ 1XNRQ 5FLMH 1EFWA 5JJLA 2WP8J 1YZ6A 1VQMA 2N52A 2W0TA 3VA9A 5M3FG 5LMUQ 3J80i 2ENZA 3GOXA 1FJGL 3AEVA 2KHJA 4DV0L 3PDNA 1L1OC 1HNZL 3KDFA 1UE6A 2KHIA 1IY6A 1LM0A 3RZDH 2QEXA 4AH6A 5IY0A 5C0XG 1X3FA 3S1NH 1JT8A 1CT4I 2JA9A 1ASZA 2JA7H 4LF6Q 1OXXK 2N71A 3S16H 1MIUA 4KHPL 1RL2A 3CP0A 3TEHB 1AE2A 2HHHL 2F4VL 3DO9A 4NB3A 1XA6A 5C3EG 2WAQE 3VE5A 3HOUH 3E59A 1PFSA 5IYBG 1PYBA 1VQCA 3J80c 3M7NA 1JJGA 3HKZE 1VQOA 4O0AA 4POGA 3JAMi 2HIVA 1EIFA 2Q2UA 4A3FH 1CT2I 2E2IH 4BXXH 3W1GA 4XTCS 1N8RC 2M5XA 1PH1A 2UUAQ 1CT0I 1M8CA 3U4ZA 4LNQA 3K0XA 1X55A 4Z7HA 3J81j 5BR8Q 1OXTA 3I55A 4C3IH 3K80C 4X6AH 4BA1I 2UXDQ 2FUG1 4GLXA 1OXUA 1NMGA 1SGDI 3NBHB 1VDDA 4HEA1 2MO0A 3JAMc 2NU1I 2ZM6Q 1TWHH 1PH8A 5FJ8H 3KYHC 4IOCA 4C2MH 2Y0SE 5FLXc 4A3DG 4JI0L 3F2DA 2F6MB 2ROWA 3CMEA 2AHOB 1VQ5A 1JJCB 1PHJA 4L5RC 3KFUA 4RMFA 5IP9H 3BJUA 2ES2A 5AJ3L 2I5HA 1SGYI 3UDXA 3OW2A 5J3BA 1NUBA 4DPGA 4DV6Q 1WCMG 3CXCA 4PZ8A 5M5WH 1A0IA 2ZJQA 3RLOA 4OAVB 1W4RA 4X62L 1TUSA 3PCOB 2WCYA 4UY8C 4JYAL 3FKIH 1WFQA 1OXVA 1WOCA 3JSBA 4C3HH 1N34L 2R7DA 4B3ML 4ME3A 4MZ9A 1V1IA 2JE6I 2ZTEA 2BH8A 2WB1E 1Q7YC 2K50A 2ENNA 1SE8A 2AWNA 4DV2Q 3M4PA 1VQKA 2WAQG 5FUVA 4IPGA 4JI8L 4DV1Q 3OTOQ 2QQEA 1YEZA 2R92H 1HNWL 3HKZG 3WWVA 5C44G 4R4OA 3JC66 5GADC 3CCLA 3CC7A 4FDBA 4HJ5A 4A3GG 2QPOA 2CKZB 3ULPA 1HR0Q 1Y1VG 3KDFB 2PI2E 1H0ZA 3PO2G 3CPFA 3KJOA 1O7IA 1SN8A 3PSIA 4L9MA 1D7QA 2J87A 2ORWA 3RN5A 2A20A 2A19A 3MXNB 3ULJA 1Q82C 1UVFA 1Q12A 1LYLA 4JOIC 3UEJA 1X3EA 3KF6B 1ASYA 1TBOA 1AN1I 1CGII 3ICEA 4OWXB 4LF8Q 1NBWA 1NE3A 2OCEA 2VY3A 4KHZA 1HNXL 3QWPA 1DS3I 3HOVH 4JV5Q 5EAYA 2K5VA 3IRBA 2XTIA 3HOYH 3T1HL 2RIOA 2Y0SG 4DV5L 3UGIA 1XX6A 2V6EA 3AJFA 4DR4L 1VQGA 3NEMA 2RF4A 5K36G 2MJFB 1VQLA 4NXML 5C0XJ 1CKOA 1DGSA 2YYZA 2KMQA 3D0FA 4IFDG 1CSQA 5FUXA 4R1JA 1YJNA 1CKNB 4HJAA 1P8LA 4A3EH 1G51A 4DV3L 3TS2A 4A4IA 4GLVB 1GM5A 4IPDA 4DR7Q 1KL9A 1AH9A 4GNXA 4NPSA 1GVPA 1Y1WG 4R4IA 3ER0A 1M8BA 1KRTA 2Q2HA 1J6QA 2NZOA 2E8GA 2YUUA 3AQQA 4X64L 3HOWH 1J5EQ 2UUBL 3S14H 2ELIA 2JW6A 1U5KA 2A2DA 4HIKA 2NVXH 2B3GA 3AFQA 1VQNA 1Y14B 5JHWC 1S72A 1YIJA 2F66B 2EQSA 2AWOA 2YV5A 1L0WA 1I94Q 1YBYA 2PNHA 1DS2I 3VDPA 4DV7Q 3HFZB 2ORVA 2QGQA 4HJ7A 2MNAA 1C7YA 3J7ZC 4GKJL 1TXYA 1SR3A 1XMOQ 1FYBA 2WFWA 2JEBI 1SFOH 3M3YH 1Y1WH 5C4XH 3UGLA 3GTMH 2OTJA 1VQ7A 1XPOA 2GKRI 4XIGS 3CQZH 2CWPA 2JJQA 1HZ9A 4JI4L 1K8AC 2C35B 4WJ4A 3SGBI 3T1YL 2VRWB 3CD6A 1SGRI 1K8GA 1KD1C 1B8AA 2XRCA 1GKHA 1PA6A 3H0GG 1K83H 4QQBX 5M3MH 5FUWA 1TWGH 2B63G 2PQAA 3OVOA 3U58A 2IP6A 4R4CA 4DKAC 3RU0A 1HH2P 4LW1A 2DGYA 3EBEA 3RN2A 3U50C 3U4VA 2Q2TA 1R9TH 2NVQH 2JZMA 1Q1BA 2K5NA 4HIDA 1IZ6A 3HOXG 1FJGQ 4DV0Q 4A3BG 3SDJA 1HNZQ 3PV0A 4O2DA 1I6HH 5FLMG 3SGIA 3I56A 4YZCA 1VS0A 4DV4L 3OYYA 1HZAA 1IL2A 3J7A5 1K3RA 2VS1A 4DWLA 1UE7A 1Z47A 3G4SA 2R93G 3ULLA 1YI2A 1LR9A 5DLQE 4JI5L 4KHPQ 3SEKC 5GAGC 3M9BA 2UXBL 4L5SA 2HHHQ 1K0RA 2BUSA 2D0PA 2F4VQ 4R4TA 3HKSA 3IAM1 1BMOA 1UVGA 1YNXA 1IBKL 2JA7G 1VQ9A 4OWTB 2KCXA 3TREA 2KCMA 2LSSA 1NY4A 2YTYA 1GO3E 4KI0A 2PI2A 5EX0A 3HOUG 2JA5H 3S1RH 1EUJA 2LUYA 2VZAA 2L8EA 2NVYH 1Z9FA 2R93H 4BA2I 4GS3A 2B8TA 4DR1L 2NU4I 2CQOA 1VQ6A 4A3FG 4BXXG 4NV5A 2V1CC 3PUXA 3KJPA 4YWLA 1CKMA 3GTPH 3RLNA 4UP8A 1IY5A 3CCQA 2ZJPA 2NN6G 2R7FA 4X65L 1XPUA 2NN6I 5IP7H 4Y52H 2UU9L 4JI6L 4BBSH 2SGDI 4JI2L 2EXDA 2DIPA 5JEAJ 3FHWA 4QGUA 2E2JH 4FKDA 1Q8KA 2BA1A 4GNXB 4YHHL 5HGQA 1YVCA 3A5ZB 1SGEI 1XJVA 3UGDA 1SGNI 2Q2IA 2KMRA 3FP9A 5FJ8G 4GOPA 3PF5A 4DR3L 5AJ3Q 2QQCA 4J15A 1EIYB 5C4JH 4IFDJ 4GI3C 1RFHA 1YITA 4OXPA 3L0IA 5IT9c 4L5TA 5IP9G 4SGBI 2VQEL 4BBRH 1W3SA 1NMFA 1YJWA 3TRZA 4X62Q 2UXCQ 3J81i 3GD7A 4JCVE 5IWAL 3I7FA 4JBMA 2MO1A 3SGQI 3F2BA 4GLAC 1OMTA 4JYAQ 3GDEA 2SGEI 2P22B 1N34Q 2CJSC 1N32L 1D8LA 4B3MQ 4LWCA 2GVBA 4UP9A 1R0RI 1UE5A 5GAHC 4DUYL 1M90C 3H15A 3GTLH 4JI1L 3FKIG 2CAZB 2PQAB 1YHAA 1AE3A 4JI8Q 3CCMA 1NTGA 1FAQA 4P75A 2KMOA 4RG1A 1HNWQ 4QIWE 1Q46A 3NELA 1HJAI 1PCEA 3STBC 4BY1H 4DUZL 4YZDA 1QZHA 1YTPA 4LFBL 1HPTA 3RNUA 4OAUC 2R92G 2GVIA 4PL3A 2I5LX 3J81c 4B3SL 3I9V1 2RHSB 3AYHB 2DB6A 4A93G 1X6OA 2HT1A 3CF5A 1E24A 1N33L 2SGPI 4IOAA 2FNFX 5DAEA 1PH6A 3LGJA 1L2FA 2HIXA 1IBML 4A3CH 1JMCA 3LJ2A 3TJQA 5GROA 4NXNL 2VNUD 2OVOA 1PH5A 3UEYA 1VQIA 4UP7A 5IYCH 4POFA 1LUZA 2QQ0A 1XBTA 1HNXQ 2GVAA 2R7ZH 1V43A 5EX3A 2JB1A 2LXJA 3T1HQ 3M4OH 4PMWA 4Y7NH 4A93H 1K9MC 3PUWA 2UZ3A 4DV5Q 4YCUA 1YJ9A 1L1OA 1BKBA 4UXHA 2K19A 4DR4Q 5LMNL 5GAEC 4NXMQ 1SROA 3HOVG 1MJCA 1HJPA 4LF5L 1LR7A 3HOYG 2E5RA 1SLJA 4QY7A 4APVA 4IO9A 2IHFA 5HI7A 2V1CA 4DNIA 1KBFA 4DR2L 4JBWA 5H1SE 1QVCA 1VQHA 2HQLA 4B6DA 1A8VA 1SRUA 4DV3Q 4NV2A 1N36L 2J9RA 2ID0A 2A8VA 1PVOA 1T9HA 2ZTDA 2YU9H 2IY5B 4G75A 1OTCA 3PUVA 3RZOH 2AMCB 1H95A 4A3EG 3B6YA 3M85A 2JQOA 4A24A 4A3IH 3BZKA 4X64Q 2NU3I 4LUZA 2UUBQ 4TVAB 1PV4A 1QUQA 2KMPA 1YU6C 1VQEA 3PO3H 3M4QA 2JYYA 4EX5A 4P72A 2OWOA 1EOVA 4AIMA 4IJHA 2EIFA 1S3OA 3S15H 3HOWG 1B7YB 5LNK1 2BH2A 4GKJQ 4O1OA 2L1LB 3PUYA 2NU0I 2JB2A 2VUMH 2RCNA 4UXIA 2OQKA 3CCVA 1X56A 4JI4Q 2IX0A 4HJ8A 4DR5L 2YTVA 3T1YQ 3L2PA 2N49A 1OMUA 3KP9A 3OL0A 5C4XG 3QTLD 1VCIA 1TWFH 4LF9L 3OXGA 2CWAA 4UPAA 2A1AA 5FUYA 1JB7A 5LMNW 3OXFA 4X66L 4LF4L 2JA8H 1BBWA 5JJKA 3NENA 1WJJA 1KMAA 2WB1G 3P23A 5M3MG 3F8TA 3I4NH 1UEBA 2JAEA 3Q8DA 2ERWA 1VQBA 2N3SA 5IYDH 4QJFA 1Q86C 4R4QA 1P16A 1C0AA 2F3CI 2JK8A 4GN4B 1B70B 1X74A 4DV4Q 4AS3A 3HOZG 1EYGA 4E1RA 4OX9L 3MEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F2D A;  1SMX A;  3CCR A;  1EQQ A;  4DR1 L;  1V1Q A;  3CME A;  2CCZ A;  2AHO B;  2CQO A;  1VQ5 A;  2LXK A;  1JJC B;  1VQ6 A;  1CSP A;  4P73 A;  4A3F G;  2D0O A;  4X66 Q;  3GO5 A;  4WJ3 M;  3KF8 B;  4JI5 Q;  4LF4 Q;  4BXX G;  4P74 A;  1PHJ A;  2V1C C;  4L5R C;  3KFU A;  4RMF A;  4OO1 I;  2UXB Q;  3PUX A;  3KJP A;  4YWL A;  5C44 H;  5IP9 H;  1CKM A;  4MTN A;  3GTP H;  3BJU A;  3KLW A;  5JEA G;  4DV2 L;  5AJ3 L;  3EIV A;  2ES2 A;  4YY3 L;  3RLN A;  2I5H A;  3ZJY C;  4UP8 A;  3PIP A;  4A3G H;  3UDX A;  1K73 C;  3OW2 A;  4LUV A;  1XMQ L;  3CC4 A;  3CCQ A;  4DV1 L;  2ZJP A;  1IBK Q;  3OTO L;  5J3B A;  2ZTC A;  3DLL A;  2NN6 G;  2R7F A;  3MEF A;  4X65 L;  4DPG A;  2NN6 I;  4DV6 Q;  1XPU A;  1WCM G;  3CXC A;  5IP7 H;  4PZ8 A;  5M5W H;  4A75 A;  2UU9 L;  4JI6 L;  1A0I A;  4BBS H;  4A76 A;  2ZJQ A;  1Y1V H;  4JI2 L;  2JA8 G;  2EXD A;  3M4O H;  3RLO A;  5JEA J;  5M5Y H;  3FHW A;  4GOP B;  4QGU A;  2E2J H;  1VQ4 A;  3PO2 H;  4AQY L;  2NZH A;  3I4N G;  1Q8K A;  4JBK A;  3HOZ H;  4OWW B;  4X62 L;  2BA1 A;  4GNX B;  3G71 A;  3CCS A;  3PCO B;  5E7N A;  5IYD G;  1PH4 A;  4YHH L;  5HGQ A;  4UY8 C;  4H02 A;  3RLF A;  4JYA L;  3FKI H;  1HR0 L;  1WFQ A;  1KIX A;  1OXV A;  4OX9 Q;  1WOC A;  1YVC A;  3A5Z B;  3L0O A;  1XJV A;  4LUO A;  4AYB G;  1BBU A;  1UWV A;  4C3H H;  4DR1 Q;  1N34 L;  4IFD I;  1VQA A;  2Q2I A;  2R7D A;  4B3M L;  4ME3 A;  5JJI A;  4YCW A;  4MZ9 A;  4JG2 A;  2JE6 I;  2ZTE A;  1L1O B;  2K75 A;  2JA5 G;  2BH8 A;  3FP9 A;  2WB1 E;  3CC2 A;  5FJ8 G;  2YTX A;  2K50 A;  4GOP A;  3PF5 A;  1Q7Y C;  4C3J H;  4DR3 L;  1QVF A;  2KCT A;  1SE8 A;  2AWN A;  4DV2 Q;  1TWA H;  3M4P A;  5AJ3 Q;  1Q81 C;  4YY3 Q;  1VQK A;  3I4M H;  2WAQ G;  4LFC L;  4J15 A;  2Z0S A;  1EIY B;  4B3T L;  3GTQ H;  4IPG A;  3STB D;  5C4J H;  4IFD J;  1EQR A;  2VQF L;  1XMQ Q;  1HZC A;  1C9O A;  4JI8 L;  4DV1 Q;  1YIT A;  3OTO Q;  1KHI A;  4OXP A;  1YEZ A;  1KAW A;  2R92 H;  1I3Q H;  1JJ2 A;  3H3V I;  4X65 Q;  3UE1 A;  1M1K C;  4GKJ L;  3GTK H;  5IT9 c;  1KRS A;  1HNW L;  2K5H A;  4P71 A;  2UU9 Q;  3S24 A;  4JI6 Q;  2AKW B;  3HKZ G;  4LFA L;  4BY7 H;  4L5T A;  4JI2 Q;  1YHB A;  3WWV A;  5C44 G;  5IP9 G;  4LF8 L;  1PH3 A;  2F52 A;  2VQE L;  4OON A;  3JC6 6;  4R4O A;  4BBR H;  5GAD C;  3CCL A;  1XNQ L;  4JOI A;  3UDG A;  4AQY Q;  3CC7 A;  1W3S A;  4FDB A;  4HJ5 A;  4A3G G;  1NMF A;  4A3M H;  1YJW A;  2Z6K A;  4JV5 L;  3TRZ A;  4MNO A;  4X62 Q;  2UXC Q;  3J81 i;  3GD7 A;  4JCV E;  5IWA L;  3I7F A;  4JBM A;  2MO1 A;  3F2B A;  4TQU S;  2CKZ B;  4GLA C;  4YHH Q;  4JYA Q;  3ULP A;  5IP7 G;  1HR0 Q;  3GDE A;  4BBS G;  2E5L L;  1V9P A;  3F1Z A;  1Y1V G;  3KDF B;  4GOP C;  1IBL L;  1EWI A;  2PI2 E;  4PG3 A;  4EQ5 A;  4DK3 C;  1Q1E A;  1N34 Q;  3EN2 A;  4A3L H;  1N32 L;  1D8L A;  4B3M Q;  2IT1 A;  2H5X A;  1U0L A;  3CPF A;  3KJO A;  1RIP A;  4LWC A;  3PO2 G;  2GVB A;  2NVT H;  4UP9 A;  3S1Q H;  1N9W A;  1O7I A;  1UE5 A;  1SN8 A;  3PSI A;  5GAH C;  4DUY L;  1M90 C;  2JA6 H;  3H15 A;  1TWC H;  1D7Q A;  4LF7 L;  3GTL H;  1E3P A;  4JI1 L;  3E9H A;  4DR3 Q;  2DUD A;  2K52 A;  3K7A H;  3RN5 A;  3GTO H;  2A19 A;  3MXN B;  3ULJ A;  1Q82 C;  3FKI G;  4GKK L;  2PQA B;  3H3V H;  3D31 A;  4JBJ A;  1X54 A;  4LFC Q;  4DAM A;  3G48 A;  1Q12 A;  1YHA A;  1E22 A;  2KEN A;  4B3T Q;  4DR6 L;  1AE3 A;  2VQF Q;  1LYL A;  4JI8 Q;  3CCM A;  3RR5 A;  4OO1 G;  4JOI C;  2KBN A;  2D62 A;  1NTG A;  4A3J H;  1PH9 A;  1UE1 A;  1IXR A;  3VDY A;  1X3E A;  4P75 A;  4RG1 A;  4DR7 L;  4QIW E;  1HNW Q;  1LTL A;  1G29 1;  3KF6 B;  1Q46 A;  1XPR A;  1ASY A;  4LFA Q;  3NEL A;  3ICE A;  3STB C;  4OWX B;  3A5U A;  4BY1 H;  4DUZ L;  4LF8 Q;  2VQE Q;  3F2C A;  1XNQ Q;  2IHE A;  1NBW A;  1NE3 A;  3I4M G;  2UUC L;  2OCE A;  1QZH A;  2VY3 A;  4KHZ A;  1HNX L;  3HOV H;  4JV5 Q;  5EAY A;  3PF4 A;  2K5V A;  4B3R L;  3IRB A;  4LFB L;  1WYD A;  2MFI A;  4JC0 A;  5C0X I;  5IWA Q;  3RNU A;  2XTI A;  2R92 G;  3HOY H;  2I5L X;  3J81 c;  3T1H L;  1FGU A;  3TS0 A;  2IX1 A;  4B3S L;  5ELN A;  1JE5 A;  3S2H H;  4L5Q A;  2Y0S G;  3L7Z C;  2B29 A;  1J5E L;  2E5L Q;  2RHS B;  4BY7 G;  4DV5 L;  3AYH B;  1HR0 W;  1I50 H;  4JI3 L;  1IBL Q;  5M5X H;  4GN5 A;  2L15 A;  1PH2 A;  4IJL A;  2K14 A;  4A93 G;  1VQP A;  4BBR G;  1N32 Q;  4DR4 L;  1CUK A;  2F3I A;  1VQG A;  3G6E A;  3NEM A;  1X6O A;  2RF4 A;  2HT1 A;  5K36 G;  3CF5 A;  5M3F H;  1VQL A;  3KF6 A;  4A3M G;  4NXM L;  5C0X J;  1E24 A;  4DUY Q;  1N33 L;  1VQ8 A;  2QA4 A;  4IPC A;  4IOA A;  4JI7 L;  1CKO A;  3E9I A;  1DGS A;  4JI0 Q;  4LF7 Q;  4JI1 Q;  1PH6 A;  4YWM A;  2YYZ A;  1I94 L;  3LGJ A;  3D0F A;  4IFD G;  1CSQ A;  4GKK Q;  1FVI A;  1L2F A;  4R1J A;  2HIX A;  4DV7 L;  1YJN A;  1IBM L;  1CKN B;  4A3C H;  4HJA A;  1JMC A;  1P8L A;  4A3E H;  4DR6 Q;  4Y52 H;  4PZ7 A;  4K0K L;  4A3L G;  1WI5 A;  1XNR L;  2RHQ B;  5GRO A;  1G51 A;  4DV3 L;  4HIM A;  4NXN L;  1XMO L;  1YHQ A;  4A4I A;  4ALP A;  3TS2 A;  2VNU D;  4GLV B;  1GM5 A;  4IPD A;  4DR7 Q;  3UDI A;  1PH5 A;  1X3G A;  2JA6 G;  1KL9 A;  5LMU L;  1VQI A;  4UP7 A;  3CCU A;  2ATW A;  4DUZ Q;  5IYC H;  1AH9 A;  3H0G H;  4POF A;  4GNX A;  1LUZ A;  4NPS A;  4K0K Q;  1GVP A;  2UUC Q;  3BU2 A;  1Y1W G;  1HNX Q;  3I2Z A;  4R4I A;  3ER0 A;  3HOV G;  2B63 H;  1VQJ A;  2GVA A;  4B3R Q;  1KRT A;  2R7Z H;  1V43 A;  4LFB Q;  1S40 A;  2Q2H A;  1J6Q A;  2NZO A;  5GQO A;  4A3J G;  2E8G A;  2LXJ A;  2K4K A;  3T1H Q;  4PMW A;  3K81 C;  3AQQ A;  3W5O A;  4B3S Q;  4Y7N H;  4KLK A;  2MQH A;  4X64 L;  1K9M C;  2JEA I;  3PUW A;  3HOW H;  4A93 H;  1J5E Q;  2UUB L;  3BZC A;  1CKN A;  4PZ6 A;  3S14 H;  1E7Z A;  4YCU A;  4DV5 Q;  1YJ9 A;  4JI3 Q;  2N8N A;  1L1O A;  1U5K A;  4BY1 G;  3PUZ A;  1BKB A;  4YCV A;  3W1B A;  1PYS B;  3DM3 A;  5C3E H;  4DR4 Q;  4QL5 A;  1VQD A;  4HIK A;  2NVX H;  1XTD A;  5LMN L;  2ZJR A;  2N78 A;  5GAE C;  2B3G A;  3AFQ A;  1KC8 C;  1SRO A;  1MJC A;  3CW2 C;  3ERS X;  4NXM Q;  1Y14 B;  1N33 Q;  1VQN A;  1HJP A;  3AFP A;  1S72 A;  1YIJ A;  4LF5 L;  4JI7 Q;  2EQS A;  2AWO A;  5IYB H;  3HOY G;  4LF6 L;  2YV5 A;  1SLJ A;  1L0W A;  4HIO A;  1I94 Q;  1YBY A;  4QY7 A;  5ELO A;  4APV A;  2PNH A;  2IHF A;  3HOX H;  4IO9 A;  4DNI A;  5IE8 A;  4DV7 Q;  4A3B H;  3HFZ B;  3K8A A;  1IBM Q;  4DR2 L;  2CFM A;  1QUQ B;  4JBW A;  1E1T A;  2QGQ A;  5HY6 A;  5H1S E;  4GNX C;  1QVC A;  1VQH A;  2HQL A;  4HJ7 A;  2MNA A;  5FLM H;  1XNR Q;  1C7Y A;  3S17 H;  3S2D H;  1A8V A;  1SRU A;  3J7Z C;  1TXY A;  1SR3 A;  1XMO Q;  4DV3 Q;  1EFW A;  4NXN Q;  2WFW A;  2WP8 J;  1YZ6 A;  1VQM A;  1N36 L;  5JJL A;  5M3F G;  2JEB I;  2VW9 A;  1SFO H;  3M3Y H;  5LMU Q;  1Y1W H;  2ID0 A;  3J80 i;  5C4X H;  2A8V A;  3GTM H;  1PVO A;  1T9H A;  2ZTD A;  2OTJ A;  1VQ7 A;  1XPO A;  4XIG S;  2YU9 H;  2IY5 B;  3CQZ H;  1FJG L;  3AEV A;  2KHJ A;  1MKH A;  4DV0 L;  1OTC A;  1HZB A;  2CWP A;  2FXQ A;  3PUV A;  4A3C G;  1L1O C;  3RZO H;  2AMC B;  1H95 A;  2JJQ A;  4A3E G;  2Z6K C;  3B6Y A;  3M85 A;  1HNZ L;  1HZ9 A;  4JI4 L;  1BVS A;  1K8A C;  2C35 B;  4WJ4 A;  3KDF A;  2JQO A;  4A3I H;  3PIO A;  1UE6 A;  2BA0 A;  3T1Y L;  3BZK A;  2KHI A;  4DAY B;  3CD6 A;  4X64 Q;  1K8G A;  1KD1 C;  1B8A A;  4LUZ A;  1LM0 A;  3CCJ A;  3RZD H;  2OTL A;  2UUB Q;  4TVA B;  2QEX A;  1PV4 A;  4AH6 A;  1QUQ A;  1GKH A;  5IY0 A;  3GTG H;  5IYC G;  1PA6 A;  3H0G G;  1VQE A;  5C0X G;  3PO3 H;  1X3F A;  3M4Q A;  2ASB A;  1K83 H;  3S1N H;  1JT8 A;  2UUA L;  5M3M H;  4QQB X;  1TWG H;  5LMN Q;  2JA9 A;  4AYB E;  2B63 G;  4EX5 A;  2PQA A;  4P72 A;  1ASZ A;  3U58 A;  2OWO A;  1EOV A;  4LF5 Q;  2R7Z G;  2JA7 H;  4AIM A;  5BR8 L;  4R4C A;  4LF6 Q;  1OXX K;  4IJH A;  2EIF A;  4DKA C;  1MIU A;  1S3O A;  3S15 H;  3S16 H;  4KHP L;  3HOW G;  1B7Y B;  1RL2 A;  3CP0 A;  1HH2 P;  3TEH B;  4LW1 A;  1AE2 A;  2DGY A;  4DR2 Q;  1KQS A;  3EBE A;  3RN2 A;  2HHH L;  2OQ0 A;  3U50 C;  2F4V L;  2E2H H;  3U4V A;  2UXD L;  4NB3 A;  2Q2T A;  2GN5 A;  1GD7 A;  5C3E G;  3CAM A;  2BH2 A;  4GKJ Q;  2WAQ E;  1R9T H;  3HOU H;  1N36 Q;  3PUY A;  4IPH A;  2NVQ H;  2VUM H;  1PFS A;  2RCN A;  1Q1B A;  5IYB G;  1I5F A;  2K5N A;  1PYB A;  1A63 A;  2OQK A;  1VQC A;  3J80 c;  3CCV A;  3M7N A;  1JJG A;  4HID A;  1IZ6 A;  3HOX G;  4A3K G;  2UXC L;  4A3D H;  1FJG Q;  3HKZ E;  4DV0 Q;  4O0A A;  1VQO A;  4POG A;  4A3B G;  1X56 A;  3JAM i;  2HIV A;  1HNZ Q;  2ALY B;  3PV0 A;  4O2D A;  4JI4 Q;  1I6H H;  1EIF A;  2IX0 A;  5FLM G;  4HJ8 A;  4DR5 L;  2Q2U A;  3A74 A;  2PMZ E;  2YTV A;  4DK6 C;  3T1Y Q;  4A3F H;  3SGI A;  3L2P A;  2N49 A;  3I56 A;  2ZM6 L;  1W2B A;  2E2I H;  1VS0 A;  4DV4 L;  1PH7 A;  3OYY A;  4BXX H;  1HZA A;  3UE0 A;  3W1G A;  1IL2 A;  5C4X G;  1VCI A;  4XTC S;  1N8R C;  3J7A 5;  3PGZ A;  1K3R A;  1TWF H;  4LF9 L;  1PH1 A;  1E1O A;  2VS1 A;  2CWA A;  1NJI C;  2UUA Q;  4YWK A;  4GN3 B;  4UPA A;  2A1A A;  3U4Z A;  3UDF A;  4LNQ A;  3I4O A;  3K0X A;  3GTJ H;  1UE7 A;  1X55 A;  1Z47 A;  5LMN W;  3G4S A;  1JB7 A;  2R93 G;  3J81 j;  4A3I G;  3A0J A;  2I5M X;  3ULL A;  1OXT A;  5BR8 Q;  3CPW A;  1YI2 A;  1QVG A;  3S1M H;  3I55 A;  4X66 L;  1WCM H;  5DLQ E;  4JI5 L;  4LF4 L;  1IYJ B;  4KHP Q;  5GAG C;  1A62 A;  4C3I H;  1X65 A;  3M9B A;  4HJ9 A;  2UXB L;  2JA8 H;  1BBW A;  5JJK A;  3K80 C;  2R6G A;  3NEN A;  1WJJ A;  2HHH Q;  4L5S A;  4BA1 I;  4X6A H;  1K0R A;  2D0P A;  2F4V Q;  1MJE A;  1G6P A;  1FL0 A;  3PO3 G;  2UXD Q;  2WB1 G;  4R4T A;  3TQY A;  5M3M G;  3HKS A;  2XGT A;  3F8T A;  4GLX A;  1UEB A;  3I4N H;  3Q8D A;  1OXU A;  1YNX A;  1IBK L;  4A3K H;  1NMG A;  1VQB A;  3K7U C;  2JA7 G;  2N3S A;  5IYD H;  4DV6 L;  4QJF A;  4OWT B;  3NBH B;  3KOJ A;  1VQ9 A;  1X9N A;  1Q86 C;  4R4Q A;  3TRE A;  2KCM A;  2LSS A;  1NY4 A;  1P16 A;  2YTY A;  1C0A A;  1GO3 E;  2MO0 A;  4KI0 A;  3JAM c;  2PI2 A;  2JK8 A;  4DR5 Q;  4GN4 B;  1KXL A;  3HOU G;  2ZM6 Q;  1QZG A;  1B70 B;  2VL6 A;  4DV4 Q;  3CCE A;  2VUM G;  2JA5 H;  3S1R H;  1EUJ A;  1TWH H;  1PH8 A;  2I0Q A;  1VQF A;  3KYH C;  5FJ8 H;  4IOC A;  2VZA A;  3HOZ G;  2NVY H;  1Z9F A;  1EYG A;  4C2M H;  2Y0S E;  1OXS C;  4LF9 Q;  5FLX c;  4OX9 L;  3E0E A;  4A3D G;  2R93 H;  4JI0 L;  4BA2 I;  4GS3 A;  3CMA A; 
#chains in the Genus database with same CATH topology
 1SMX A;  3CCR A;  1EQQ A;  2XN9 C;  2CCZ A;  1BUS A;  1CSP A;  3NBH A;  4P73 A;  2XRQ D;  4KKU A;  4JI5 Q;  5HGI A;  1TVX A;  4P74 A;  4OO1 I;  1TWH B;  2UXB Q;  3F2U A;  4ZAI A;  2F0G A;  1L0Y B;  4FP5 D;  1UUP A;  4C2M B;  3MC0 B;  4YY3 L;  1KBE A;  1D2B A;  1K73 C;  3NUC A;  4LUV A;  1D1K A;  3TN2 A;  1XMQ L;  3CC4 A;  1Q3L A;  1IBK Q;  1BR9 A;  3M7G A;  1MJB A;  5E3P A;  4EQN A;  5I9O A;  1WTR A;  4A76 A;  2FMM A;  3B55 A;  2QDB A;  4DAY A;  1II3 A;  3Q24 A;  2ODD A;  1XTC D;  5JAV A;  3HZX A;  2L0C A;  4AQY L;  3MTS A;  2NZH A;  3HOZ H;  1B2T A;  4OWW B;  3G71 A;  3CCS A;  5E7N A;  1GUW A;  3B4V C;  4H02 A;  5M5W B;  2XTQ A;  1VF5 C;  3D00 A;  3L0O A;  4LUO A;  1BBU A;  4ZLT F;  4FF4 A;  4DR1 Q;  1HTP A;  4OO1 H;  2XWB B;  5JJI A;  4PL5 A;  5CC4 A;  4HCE A;  4JG2 A;  1E2W A;  1L1O B;  2K75 A;  3D6C A;  4RHR A;  2JA5 G;  3DA3 A;  5C3W A;  3FSX A;  2YTX A;  1QVF A;  1ULM A;  1PFM A;  4HED A;  5I2Y A;  2F0V A;  1CHO I;  4FXK C;  3FKI B;  3T16 A;  3I4M H;  4LFC L;  4B3T L;  1SYG A;  2C9O A;  1LO5 D;  4CJ1 B;  1PPF I;  4C3H B;  1EQR A;  2VQF L;  1HZC A;  2K5W A;  3A8I E;  3OPO A;  1A3V A;  1VF7 A;  2IJ0 A;  4RGN A;  5EKL A;  2B0U C;  3H3V I;  1IW7 D;  4X65 Q;  1TGS I;  4KN7 C;  3NQI A;  3UE1 A;  2K5H A;  4P71 A;  2UU9 Q;  3S24 A;  4JI6 Q;  1AN8 A;  4LFA L;  4BY7 H;  4JI2 Q;  2F03 A;  3R5A A;  3IKJ A;  5IGE A;  3DM1 A;  1PH3 A;  2F52 A;  3HH2 C;  1XNQ L;  2V53 A;  4JOI A;  3UDG A;  1B9M A;  1AZP A;  4A3M H;  5A35 A;  2Z1C A;  3MXP A;  2R92 B;  3DA4 A;  3NPP A;  4TQU S;  1LTT D;  4YHH Q;  2PZT A;  3E2I A;  1X4S A;  5IP7 G;  2F0H A;  3QOJ A;  4BBS G;  2E5L L;  2N1A B;  1IBL L;  3FC3 A;  5ELC A;  3BVZ A;  4PG3 A;  3JAM E;  1Y1B A;  4EQ5 A;  1CHP D;  4A3L H;  5G3L F;  2E73 A;  2F4I A;  2IT1 A;  2H5X A;  1U0L A;  2K5Q A;  3OXL A;  1RIP A;  1D5Z C;  3T53 B;  2NVT H;  3S1Q H;  3WDN A;  2JA6 H;  1TWC H;  1LR8 A;  2JBW A;  4LF7 L;  3QIA A;  1E3P A;  3K6O A;  2DUD A;  4DR3 Q;  1H9J A;  4PL4 A;  3K7A H;  3GTO H;  4GKK L;  1SMY D;  3H3V H;  3D31 A;  1PYW D;  4JBJ A;  1X54 A;  4NW2 A;  4RGM A;  4DR6 L;  1EY9 A;  1SJE D;  3TBI B;  3A8K E;  4A3J H;  3GP7 A;  1PH9 A;  2UVO A;  1EY0 A;  4OEM B;  3LX0 A;  3E3X A;  1MT1 A;  2A6E D;  1LTL A;  1XPR A;  3FPP A;  3GV3 A;  2JB3 A;  1WTJ A;  2VQE Q;  3F2C A;  2QQD A;  1B53 A;  3FBV A;  2UUC L;  1SGP I;  4O1P A;  3FPU B;  1CE3 A;  4NP5 A;  2QGM A;  4K6D A;  5JPM C;  1TT2 A;  4B3R L;  4JC0 A;  5C0X I;  5IWA Q;  2XIW A;  2IX1 A;  1FGU A;  3MXN A;  3S2H H;  4DNC A;  1TQO A;  2DN8 A;  4L5Q A;  3L7Z C;  2B29 A;  1NNX A;  3OWE B;  1D5X C;  2AUK A;  3F4M A;  4JI3 L;  3C2P A;  2PCF B;  2L15 A;  4GN5 A;  4IJL A;  4FXD A;  1EY5 A;  5EGT A;  2EY2 A;  4BBR G;  1N32 Q;  2WVJ A;  3BS1 A;  2E75 C;  9WGA A;  5M3F H;  2GA4 B;  5IGB A;  3KF6 A;  4ODG A;  3OOC A;  3HOV B;  4DUY Q;  2QIL A;  1PTQ A;  2QA4 A;  3DMU A;  4JI7 L;  3E9I A;  2F0I A;  1N13 A;  4JI0 Q;  3HOY B;  4JI1 Q;  2P6A C;  3ITP A;  5IGF A;  1FVI A;  3KBX A;  1ULK A;  1ENA A;  2PPB C;  2BDN A;  3PIO 3;  1QNU A;  4PZ7 A;  1WTQ A;  4K0K L;  1QJO A;  1WI5 A;  3C1F A;  2IL8 A;  2RHQ B;  1XNR L;  5KEE A;  1AP0 A;  1H9R A;  4HIM A;  2ARP F;  4ALP A;  3UIT A;  1MI2 A;  4UXJ A;  3UDI A;  2DJF C;  5LMU L;  2ATW A;  3BJI A;  4CBV A;  4DUZ Q;  3DWA A;  4XQQ A;  5C0X H;  1HUN A;  3I2Z A;  5EJW A;  4A3E B;  1A2T A;  1IL8 A;  1VQJ A;  3BVM A;  3P7J A;  2EY1 A;  4LFB Q;  2EZV A;  2JXD A;  3DWQ A;  5GQO A;  4IUT A;  4KY5 A;  3K81 C;  4B3S Q;  2JEA I;  1CKN A;  3QG1 A;  2PZW A;  1E7Z A;  2XMX A;  4NKL A;  2SGQ I;  4KY7 A;  2LKV A;  2N8N A;  4BY1 G;  3ND8 A;  1CGJ I;  5HQ8 A;  5CCM A;  3W1B A;  1PYS B;  3DM3 A;  5C3E H;  1EZ8 A;  3VDU A;  1VQD A;  2G9D A;  1XTD A;  2ZJR A;  1ENC A;  1KC8 C;  3CW2 C;  4TRD A;  1N33 Q;  3GTQ H;  3AFP A;  5IYB H;  1EU4 A;  4LF6 L;  2LFN A;  5CCL A;  4HIO A;  5ELO A;  2CW0 D;  4KY6 A;  3HOW B;  1DOL A;  3S14 B;  2SGF I;  1IBM Q;  3K8A A;  1V8Q A;  4GNX C;  1HTL D;  3S2D H;  1ILP A;  3IAS 1;  3S17 H;  3CXL A;  2NVX B;  1RJT A;  4NXN Q;  2TSS A;  4UDU C;  2VW9 A;  1FR3 A;  3K57 A;  2F0J A;  1JQY D;  2SNM A;  1CA5 A;  1SEB D;  4OVO A;  2K5D A;  1MKH A;  1SNO A;  1HZB A;  2FXQ A;  3K5L A;  4Z7G A;  4A3C G;  5CYU A;  2Z6K C;  5EPK A;  5IIF A;  4B9X A;  1BVS A;  4K5W A;  4HFV A;  3J7A F;  1JB3 A;  1STY A;  2K6A A;  3PIO A;  1SGQ I;  2BA0 A;  1FAR A;  4DAY B;  3K59 A;  1P9G A;  4X3K A;  3FVV A;  3CCJ A;  3IAY A;  5J1Z A;  5CBA E;  1SFO B;  1Y1W B;  2OTL A;  3M3Y B;  2FFK B;  5C4X B;  3GTM B;  3GTG H;  5IYC G;  1BO0 A;  3CQZ B;  2ASB A;  2UUA L;  1CM9 A;  5LMN Q;  2RDF A;  4AYB E;  2DNE A;  1K8O A;  4LF5 Q;  2R7Z G;  3I4L A;  5BR8 L;  2BL7 A;  4JVZ A;  5J8C A;  4O42 A;  2B2T C;  2G9H D;  1LT3 D;  3G6J B;  1TUR A;  3ERQ A;  3H6M A;  4DR2 Q;  1KQS A;  1B1Z A;  2K1B A;  2F0M A;  2OQ0 A;  2WII B;  1V1H A;  2E2H H;  2BOS A;  3TOB A;  2UXD L;  2WB1 B;  1K83 B;  1GD7 A;  1LTB D;  4G76 A;  2GN5 A;  3CAM A;  5M3M B;  1TWG B;  1GUT A;  1N36 Q;  2KUM A;  4IPH A;  5LL6 S;  3BDC A;  3LJ1 A;  2A69 D;  2EYO A;  3OMG A;  1I5F A;  1TU2 B;  1A63 A;  4FYD A;  4L6T B;  2X3T A;  1KLG D;  2RVL A;  1H9S B;  5CGK A;  4A3K G;  2UXC L;  4A3D H;  2V4D A;  1DM0 B;  4H0L C;  3CHB D;  2ALY B;  2KQ3 A;  1Y8F A;  3EFX D;  3VYR A;  1HCZ A;  1WGC A;  3A74 A;  5I2X A;  3I72 A;  2PMZ E;  1W2B A;  4DK6 C;  1R9T B;  4HGU A;  2ZM6 L;  1TKW B;  5T1I A;  2PW5 A;  1PH7 A;  1U4M A;  3UE0 A;  2DNC A;  3HOZ B;  3PIP 3;  3R5B A;  2PO4 A;  3PGZ A;  1R79 A;  4RHS A;  1E1O A;  1NJI C;  4YWK A;  4GN3 B;  1SYF A;  3H09 A;  1G2S A;  3UDF A;  5D3D A;  2GIV A;  2YFB A;  3I4O A;  3GTJ H;  4KD3 A;  1QG7 A;  1I6H B;  1EOT A;  4A3I G;  3S1M H;  3A0J A;  2I5M X;  3CPW A;  1CK1 A;  1QVG A;  4K8I A;  1UUC A;  2OF1 A;  1WCM H;  2EY6 A;  4KK7 A;  4RKB A;  1EIG A;  4GZY C;  1ET9 A;  1IYJ B;  2D2C C;  1A62 A;  1X65 A;  3IFD A;  4HJ9 A;  2R6G A;  1ZYR D;  5A2Q E;  1MJE A;  1PFB A;  1FL0 A;  1G6P A;  3PO3 G;  3TQY A;  2XGT A;  2C5C A;  2A2C A;  4A3K H;  3RMH A;  3K7U C;  2A74 C;  2KOL A;  2Z9H A;  4DV6 L;  1TIH A;  3KOJ A;  4IUP A;  1X9N A;  1BDO A;  2EY5 A;  2KHS A;  1SAP A;  1F77 A;  1H9K A;  1K7T A;  4DR5 Q;  1C4Q A;  1QIL A;  3SE0 A;  1KXL A;  3DHQ A;  1QZG A;  2VL6 A;  1S5E D;  2M2L A;  3CCE A;  2VUM G;  1GJX A;  4ABN A;  4RCN A;  2I0Q A;  4C1N I;  1VQF A;  2L12 A;  1MJ9 A;  4KHV A;  4L8J A;  1OXS C;  3MXG A;  4LF9 Q;  2EJG C;  2L7X A;  3E0E A;  1MSG A;  3V05 A;  3CMA A;  3R5C A;  4ZQ3 A;  1V1Q A;  4NDX A;  2Z4H A;  3OSO A;  3KY9 A;  2LXK A;  3LJ0 A;  1JR0 D;  1HDL A;  1CTM A;  1NAP A;  2D0O A;  4X66 Q;  2RQX A;  3GO5 A;  4WJ3 M;  2OZU A;  3KF8 B;  3FRP B;  4LF4 Q;  2JA5 B;  1A6X A;  3K58 A;  3S1R B;  2NU2 I;  1SDF A;  1IKL A;  5C44 H;  3S9W A;  1CSO I;  4MTN A;  2NVY B;  2DY8 A;  3KLW A;  5JEA G;  4DV2 L;  3EIV A;  2OEO A;  5D65 A;  2R93 B;  3ZJY C;  3PIP A;  4A3G H;  2K9H A;  4I65 A;  4DV1 L;  2XTR A;  3AB9 A;  3OTO L;  1IW7 C;  2ZTC A;  3DLL A;  3MEF A;  4A75 A;  1RHP A;  1Y1V H;  2JA8 G;  2YQP A;  1SYC A;  3DWP A;  2WKC A;  2F3V A;  4U6R A;  5M5Y H;  4GOP B;  3GTP B;  3BDO A;  3CRK C;  1R4Q B;  1VQ4 A;  3PO2 H;  5IGD A;  2VB3 X;  3I4N G;  4JBK A;  2YFA A;  3TDQ A;  1TBQ R;  5CV5 A;  2K7V A;  1VMP A;  5IYD G;  1PH4 A;  1PRT F;  3MAQ A;  4AS2 A;  3RLF A;  1HR0 L;  4BBS B;  1KIX A;  4OX9 Q;  1UAP A;  4K14 A;  4YIJ A;  2B8G A;  5D3I B;  4AYB G;  1DJR D;  1UWV A;  4FXG C;  4IFD I;  1VQA A;  1K0S A;  2E2J B;  1X32 A;  4HN7 A;  3MFY A;  4YCW A;  1W6K A;  1JWM D;  1OVO A;  3FDT A;  5JEA H;  1K7V A;  4I1T A;  2N17 A;  3N6R A;  3CC2 A;  1E2Z A;  4DU9 A;  4C3J H;  2OD1 A;  4Q9V A;  2KCT A;  1TWA H;  1Q81 C;  4IZ8 A;  1SMY C;  4YY3 Q;  2HUG A;  1PTR A;  2Z0S A;  2RAD A;  1S5B D;  3MZ5 A;  3STB D;  1B4O A;  2J4X A;  2K05 A;  5ELD A;  4B08 A;  1C9O A;  1XMQ Q;  4QMG A;  1Y1C A;  1KHI A;  2BDO A;  3J7Y W;  1KAW A;  3KLS A;  1I3Q H;  1JJ2 A;  4GXT A;  1M1K C;  4R9W A;  2A6E C;  5E1F A;  3GTK H;  1KRS A;  4AML A;  2WKD A;  2AKW B;  1YHB A;  1G8Z D;  3KK7 A;  2B2Y C;  4O1N A;  4LF8 L;  3VR2 A;  1CHQ D;  1EQT A;  4OON A;  4CJ0 B;  4AQY Q;  5K36 H;  5C4J B;  5E4X A;  1ZKO A;  2Z6K A;  4JV5 L;  5DAU A;  4MNO A;  1PJU A;  1TR5 A;  1JOQ A;  1MHW C;  2GKV A;  3UFF A;  2IPK D;  4IFD H;  3I73 A;  1V9P A;  3F1Z A;  4GOP C;  1EWI A;  4DK1 A;  4DK3 C;  1Q1E A;  5ELE A;  3EN2 A;  4TKO B;  4BBR B;  1JWS D;  5G3L D;  5EBC A;  3VR6 A;  1N9W A;  4DK0 A;  3I70 A;  3NTH A;  1TBR R;  7WGA A;  4N8X 1;  3E9H A;  1BQQ T;  2JP1 A;  2K52 A;  3D4R A;  4V0B A;  5DNF A;  2FMC A;  2B2T A;  2RDH A;  3MA2 B;  5ELF A;  2ZRR A;  1K8M A;  4LFC Q;  4DAM A;  3G48 A;  4B3T Q;  1NSN S;  1E22 A;  2KEN A;  1YNJ D;  2VQF Q;  4DAP A;  2D5D A;  5A2Q L;  1TII D;  3I91 A;  3RR5 A;  4OO1 G;  2KBN A;  2D62 A;  1SJ8 A;  1UE1 A;  4JW0 A;  1IXR A;  1BCP F;  3VDY A;  4DR7 L;  1G29 1;  1L0X B;  2O5I C;  1EL0 A;  4LFA Q;  2XVS A;  1CZW A;  3GTL B;  5EQ0 A;  1MSH A;  3A5U A;  4FNF A;  2ENB A;  1GOZ A;  2Z8L A;  4CDC C;  4H13 C;  1XNQ Q;  1NUC A;  2IHE A;  3I4M G;  1IW4 A;  1EYA A;  3TME A;  3VA5 A;  1TOT A;  3PF4 A;  1EU3 A;  1WYD A;  2MFI A;  3NK9 A;  2O4X A;  1X3P A;  1RDP D;  3TS0 A;  2N88 A;  1JIC A;  1JE5 A;  4I7Z C;  5ELN A;  4QUF A;  1J5E L;  2E5L Q;  4LK1 C;  4BY7 G;  1PFN A;  1HR0 W;  1I50 H;  1KDB A;  1IBL Q;  4J8Q A;  5M5X H;  4BY1 B;  1PH2 A;  4YZ9 A;  2K14 A;  2JA1 A;  2M9V A;  1VQP A;  2KEC A;  1CUK A;  2F3I A;  3G6E A;  1OYV I;  2KKM A;  3J80 E;  4A3M G;  1VQ8 A;  4IPC A;  2MHV A;  1C48 A;  4LF7 Q;  1B9N A;  2D9U A;  4YWM A;  1I94 L;  4UAI A;  1WTH A;  4GKK Q;  3FVQ A;  4DV7 L;  2NB0 A;  4DR6 Q;  4ZUJ A;  1PRT B;  4A3L G;  1A3T A;  2L11 A;  4N9T A;  4E1P A;  3W3A A;  1XMO L;  1YHQ A;  4IUV A;  1GUN A;  3A7L A;  3P75 A;  2HQE A;  3MHB A;  1SNM A;  1X3G A;  2JA6 G;  1ESR A;  3CCU A;  1YNN D;  4H44 C;  3V96 A;  3H0G H;  3URY A;  2GKT I;  2UUC Q;  1KAA A;  3BU2 A;  4QF4 A;  2B63 H;  1D6E C;  2LB7 A;  4PQX A;  1Y8O B;  4B3R Q;  4L63 B;  4JPB W;  2SNS A;  1S40 A;  4A3J G;  3H91 A;  5IT9 E;  1T5X D;  2K4K A;  3W5O A;  4KLK A;  2MQH A;  1YO7 A;  3BZC A;  4PZ6 A;  3TP7 A;  2AQ3 B;  4JI3 Q;  1KDC A;  1WTW A;  1DD2 A;  3PUZ A;  3QAH A;  4YCV A;  1Z7K B;  4QL5 A;  4IN3 A;  1TBN A;  2XSC A;  2N78 A;  3FEW X;  3ERS X;  2R7Z B;  4JI7 Q;  2LEO A;  1PTO F;  4CDD C;  2CWF A;  3BG3 A;  1W6J A;  3M4O B;  4Y7N B;  4A93 B;  4MIU A;  1X3Q A;  3HOX H;  1ICW A;  5I6Y A;  3TZD A;  5IE8 A;  4A3B H;  2MUY A;  1FNV A;  2CFM A;  1QUQ B;  2MGS A;  1E1T A;  5HY6 A;  4K0K Q;  2J0T D;  1XNR Q;  5FLM H;  1GXD C;  1EFW A;  5JJL A;  2WP8 J;  1YZ6 A;  1VQM A;  2N52 A;  2W0T A;  3VA9 A;  5M3F G;  5FLX E;  4OIJ A;  2NUC A;  4IUR A;  2B2U C;  2A69 C;  5LMU Q;  3J80 i;  2ENZ A;  4CDE C;  1BOS A;  2EYL A;  2FHT A;  2NZ1 D;  3GOX A;  1FJG L;  3AEV A;  2KHJ A;  4DV0 L;  3NSW A;  2QEJ C;  3RD4 A;  1TS3 A;  1AZQ A;  3PDN A;  1L1O C;  1HNZ L;  4Q0F A;  1BXT A;  3KDF A;  2O5J C;  1MJA A;  1UE6 A;  1LAB A;  2KHI A;  1B3Q A;  5E4W C;  1IY6 A;  1LM0 A;  3RZD H;  2QEX A;  2CWH A;  4AH6 A;  5IY0 A;  1DXM A;  1FY7 A;  1BCP B;  4XT1 B;  3L3O C;  2YU9 B;  5C0X G;  1X3F A;  3S1N H;  1JT8 A;  5BN4 A;  1CT4 I;  1ROD A;  2QKI C;  2JA9 A;  3RZO B;  1HXY D;  1Z6H A;  1ASZ A;  1H9M A;  1JC7 A;  4A3I B;  4QUC A;  3J81 E;  2JA7 H;  4EVO A;  4LF6 Q;  1OXX K;  3FMC A;  2N71 A;  3S16 H;  1MIU A;  4KHP L;  4OL7 A;  5T1G A;  1RL2 A;  3CP0 A;  3TEH B;  1PZI D;  4KD4 A;  1AE2 A;  2HHH L;  4KJN A;  2F4V L;  1LLR D;  3A54 A;  3QO2 A;  3DO9 A;  3PO3 B;  2NYZ D;  2NTT A;  4NB3 A;  1XA6 A;  2ZW3 A;  2F0N A;  2K33 A;  5C3E G;  3NE5 B;  5E3Q A;  2WAQ E;  4BWG B;  3VE5 A;  3HOU H;  3NHH A;  3E59 A;  2R61 A;  1HUM A;  1PFS A;  1IKM A;  5IYB G;  1PYB A;  1VQC A;  3SK8 A;  3J80 c;  1BBX C;  3M7N A;  4KKT A;  3S15 B;  4G7O C;  1JJG A;  1TS5 A;  3HKZ E;  1VQO A;  4O0A A;  2B39 A;  4POG A;  3JAM i;  2HIV A;  1EIF A;  2Q2U A;  4A3F H;  1CT2 I;  2E2I H;  4BXX H;  2VUM B;  5FKA C;  3A56 A;  3W1G A;  3BZD B;  4HAE A;  1E0B A;  4XTC S;  3QB3 A;  1N8R C;  4N8F A;  2M5X A;  2RLD A;  1PH1 A;  2UUA Q;  1CT0 I;  1M8C A;  3U4Z A;  3NQT A;  4LNQ A;  3K0X A;  4K8J A;  1X55 A;  4X3T A;  4Z7H A;  3LNN A;  3NWT A;  4RA8 A;  3J81 j;  5BR8 Q;  1OXT A;  3J80 L;  4DXG A;  3I55 A;  1I4P A;  1DON A;  1F2Y A;  5EPJ A;  4C3I H;  1FGB D;  3K80 C;  4X6A H;  4BA1 I;  1TY0 A;  1JWU D;  1TWF B;  2A68 D;  2UXD Q;  4K2L A;  2FUG 1;  2Z6B A;  1AEX A;  4GLX A;  1OXU A;  1VDZ A;  2NBF A;  1GUO A;  2ZXR A;  4XYQ A;  3UI2 A;  1NMG A;  1SGD I;  2XRS D;  4HSP A;  1RTO A;  3NBH B;  1VDD A;  2L5T A;  5COY A;  2JA8 B;  3D8G A;  2H4O A;  1RD9 D;  4HEA 1;  5IOC A;  1PTO B;  4QIW B;  2MO0 A;  5M9O A;  1ZEQ X;  1U4P A;  3JAM c;  2NU1 I;  1WTO A;  4N9P A;  4CKE A;  3I4N B;  3AU7 A;  2ZM6 Q;  2EYP A;  2SDF A;  2NWG A;  1TWH H;  1PH8 A;  5FJ8 H;  3KYH C;  1CQV A;  5IT9 L;  4IOC A;  2EVB A;  1M8A A;  2B2W C;  5C4H A;  4C2M H;  2Y0S E;  5FLX c;  4A3D G;  4JI0 L;  1Y8N B;  1O78 A;  5JVG 3;  3F2D A;  1HQR D;  2F6M B;  1GHJ A;  2CH4 A;  2PNR C;  4G57 A;  3VR3 A;  3CME A;  2ROW A;  3G7L A;  2AHO B;  3X3N A;  1VQ5 A;  1JJC B;  3T51 B;  2ZT9 C;  4B9W A;  2PYK A;  4ZYS A;  1KNA A;  5KYI A;  1G2T A;  1WGT A;  1PHJ A;  4L5R C;  3KFU A;  4RMF A;  4MPI A;  5C5M A;  3C46 A;  5IP9 H;  3JAM L;  3BJU A;  2ES2 A;  2ICI A;  4K5V A;  5AJ3 L;  1WD0 A;  1BNZ A;  3DUZ A;  2I5H A;  1SGY I;  1I4X A;  3OIP A;  4DN4 M;  3UDX A;  4RGO S;  3OW2 A;  4EQO A;  5EPL A;  4J1M A;  1SJH D;  5J3B A;  3WOF A;  1NUB A;  4DPG A;  4DV6 Q;  1WCM G;  3CXC A;  5FLX L;  3I8Z A;  4PZ8 A;  5M5W H;  1A0I A;  2ZJQ A;  5TSS A;  3K5O A;  3RLO A;  4OAV B;  1WVL A;  2PMZ B;  1QWY A;  2L4N A;  1SE2 A;  3A8J E;  3QOL A;  3MFG A;  2XNA C;  1W4R A;  4X62 L;  1TUS A;  3DEO A;  4F7X A;  3PCO B;  2WCY A;  1PRT D;  4UY8 C;  2RBM A;  1LTG D;  4UHV A;  4JYA L;  1ONL A;  3FKI H;  3KLR A;  1WFQ A;  1K7U A;  1E2V A;  1OXV A;  1WOC A;  4RCO A;  3JSB A;  4M1U B;  5CV4 A;  3Q23 A;  4ID6 A;  2F0K A;  4KN4 C;  4C3H H;  1N34 L;  2R7D A;  2X69 A;  4B3M L;  4ME3 A;  4MZ9 A;  1V1I A;  1SYE A;  4RKL A;  2JE6 I;  4WJW A;  2SOB A;  5NUC A;  5C5L A;  2ZTE A;  1RCV D;  2JXM B;  1XWE A;  2BH8 A;  5CV9 A;  2WB1 E;  3PQI A;  1Q7Y C;  2K50 A;  4F87 A;  3C3L A;  2ENN A;  1SE8 A;  1FNU A;  2AWN A;  4ZUI A;  3M4P A;  4DV2 Q;  1VQK A;  1Q90 A;  1I6V C;  2WAQ G;  5FUV A;  1YNJ C;  4IPG A;  3EQL C;  1RTN A;  4JI8 L;  4DV1 Q;  4ZKB B;  3OTO Q;  2QQE A;  2EYF A;  3HP3 A;  1YEZ A;  2R92 H;  4WFN 3;  2CQA A;  2EJF C;  1DOK A;  1HNW L;  2B2U A;  1B50 A;  3N52 A;  3HKZ G;  2WV6 D;  3WWV A;  2PQE A;  2O2L D;  5C44 G;  1O7Y A;  4R4O A;  3JC6 6;  5GAD C;  3CCL A;  3I4M B;  2MP1 A;  5CV8 A;  3C1E A;  3R8B A;  5D14 A;  3CC7 A;  4FDB A;  2BE5 D;  4HJ5 A;  4A3G G;  2QPO A;  1SYD A;  2B8F A;  3SK4 A;  5KIX A;  1LTS D;  2WGC A;  2CKZ B;  5DEH A;  3FSY A;  4IUU A;  1S5F D;  3ULP A;  1BF4 A;  1HR0 Q;  4DF7 A;  4BY7 B;  2F0W A;  1JOR A;  1Y1V G;  3E5S A;  3KDF B;  1SYB A;  2PI2 E;  2RIJ A;  1H0Z A;  1A15 A;  3A55 A;  1EY4 A;  1F9R A;  2HD3 A;  2R3Z A;  1D5M C;  5J39 A;  1WTV A;  3PO2 G;  3CPF A;  3KJO A;  2X52 A;  2CWG A;  4K6L A;  4A3M B;  3QJY A;  4XT3 B;  1O7I A;  1SN8 A;  3PSI A;  1V1O A;  1LT4 D;  4L9M A;  1D7Q A;  5JJZ A;  1HFN A;  3Q22 A;  2J87 A;  2ORW A;  3RN5 A;  2A20 A;  1STH A;  2A19 A;  3MXN B;  4XYO A;  3ULJ A;  1Q82 C;  4FF3 A;  3D4W A;  1HFG A;  3MXU A;  1UVF A;  1Q12 A;  2F0F A;  1P9Z A;  5FO8 B;  4KKS A;  1NR2 A;  1LYL A;  1S5C D;  1I4Q A;  3LWU A;  2OT2 A;  4JOI C;  3UEJ A;  2NVT B;  1X3E A;  1BCP D;  3T56 B;  3S1Q B;  1U4L A;  3KF6 B;  1ASY A;  2JA6 B;  1TBO A;  1TWC B;  1AN1 I;  1NR4 A;  1YNN C;  1CGI I;  3OW7 A;  4ZRZ A;  3ICE A;  4OWX B;  3HEJ A;  4C3J G;  3K7A B;  4LF8 Q;  4RFB A;  3GTO B;  2MPM A;  1NBW A;  1NE3 A;  1EEF D;  2AQ1 B;  4XQJ A;  2OCE A;  2VY3 A;  4KHZ A;  4LJZ C;  1SBB B;  1HNX L;  3QWP A;  1DS3 I;  3HOV H;  4JV5 Q;  5EAY A;  5KRU A;  2K5V A;  3IRB A;  1CA6 A;  4MTK A;  4A3J B;  1JCK B;  2XTI A;  3HOY H;  3T1H L;  2RIO A;  1TS2 A;  2Y0S G;  5J22 A;  4CGY B;  4DV5 L;  3UGI A;  1B44 D;  2Q8T A;  5KNB A;  1ESF A;  1XX6 A;  2V6E A;  1RKN A;  1XXG A;  2VXW A;  3AJF A;  1CFM A;  4DR4 L;  1VQG A;  3NEM A;  2RF4 A;  3GQB A;  5K36 G;  2MJF B;  1VQL A;  4NXM L;  1KTK A;  5C0X J;  1CKO A;  1DGS A;  2YYZ A;  3S2H B;  2KMQ A;  3D0F A;  4IFD G;  1CSQ A;  3R5D A;  5FUX A;  4R1J A;  1CT1 D;  1YJN A;  1CKN B;  1DOM A;  4HJA A;  1P8L A;  5LHY 1;  4A3E H;  3CRL C;  3SXH A;  3D4D A;  4WP4 A;  1WD1 A;  1G51 A;  4DV3 L;  3TS2 A;  4A4I A;  5M3F B;  1HEV A;  4GLV B;  1GM5 A;  4IPD A;  4DR7 Q;  3SR1 A;  3BYT B;  4CKC A;  1KL9 A;  1XYI A;  2KCN A;  3D3R A;  3TOA A;  4G7H C;  1AH9 A;  3Q6S A;  4GNX A;  2QZG A;  3R2T A;  4NPS A;  4F88 A;  1GVP A;  1Y69 U;  1NCV A;  1DCZ A;  1Y1W G;  1J9O A;  4R4I A;  3ER0 A;  2B2V C;  3Q0A A;  2LMC B;  2Q8I B;  1PDQ A;  1M8B A;  2EYH A;  1KRT A;  2Q2H A;  1J6Q A;  2NZO A;  1LAC A;  2E8G A;  3ONA B;  3BDL A;  2Q8R E;  2YUU A;  3AQQ A;  4X64 L;  3HOW H;  1J5E Q;  2UUB L;  4XQN A;  3S14 H;  3HG9 A;  2ELI A;  2JW6 A;  1U5K A;  4K2K A;  1G91 A;  2A2D A;  5JPN C;  1LT6 D;  4HIK A;  2NVX H;  1EZ6 A;  2B3G A;  2I46 A;  3AFQ A;  1VQN A;  1Y14 B;  5JHW C;  1S72 A;  1YIJ A;  2F66 B;  1WTX A;  2EQS A;  3MWY W;  3E6Z X;  2AWO A;  4R8N A;  5CR3 A;  2YV5 A;  3BYY B;  1PTO D;  1L0W A;  1I94 Q;  1YBY A;  2OU2 A;  2PNH A;  2FJ2 A;  1DS2 I;  5COR A;  1A3U A;  3VDP A;  4DV7 Q;  3HFZ B;  4ME5 A;  2ORV A;  2QGQ A;  2F0T A;  4I7A A;  4HJ7 A;  2MNA A;  1C7Y A;  5C3E B;  3J7Z C;  4GKJ L;  1TXY A;  1SR3 A;  5E3F A;  1XMO Q;  1FYB A;  2WFW A;  2JEB I;  3GTQ B;  2AUJ D;  4OHJ A;  1SFO H;  4HR7 B;  3M3Y H;  1B3A A;  3T13 A;  1Y1W H;  5C4X H;  3UGL A;  3GTM H;  2OTJ A;  5L37 A;  1VQ7 A;  1XPO A;  2GKR I;  4XIG S;  3CQZ H;  1EWH A;  1Y8P B;  3NWS A;  2QSB A;  2CWP A;  4U68 A;  4U67 3;  2JJQ A;  1HZ9 A;  4JI4 L;  4CDF C;  1SE3 A;  1K8A C;  2C35 B;  3S2D B;  4WJ4 A;  3S17 B;  3SGB I;  2JSO A;  3T1Y L;  2VRW B;  3CU7 A;  3CD6 A;  1SGR I;  1QE6 A;  2RSO A;  3CKI B;  1LT5 D;  1KD1 C;  1B8A A;  1K8G A;  2XRC A;  1GKH A;  2QF7 A;  2KEE A;  3ERO A;  4KMU C;  2JYO A;  1S4Z A;  3VR4 A;  1PA6 A;  3H0G G;  3L9A X;  2KED A;  2PZU A;  1K83 H;  1T5E A;  1CZG A;  5M3M H;  4QQB X;  5FUW A;  1TWG H;  2WIN B;  2SEB D;  2B63 G;  2PQA A;  1TDP A;  3OVO A;  3U58 A;  2IP6 A;  1I4R A;  2K28 A;  3VYU A;  3MEH A;  4R4C A;  5KYL A;  1NXU A;  4DKA C;  3RU0 A;  1U4R A;  2EYM A;  1AFP A;  1HH2 P;  4LW1 A;  2DGY A;  2P5Z X;  1ILQ A;  3EBE A;  3RN2 A;  3GTG B;  3QWN A;  2E76 C;  3U50 C;  1WTP A;  2A68 C;  3U4V A;  2Q2T A;  3NTI A;  1R9T H;  2F0Q A;  1LTA D;  2CW0 C;  2A6H D;  2NVQ H;  2JZM A;  1QOH A;  1Q1B A;  4HTH A;  2EDG A;  2K5N A;  4HID A;  1IZ6 A;  3HOX G;  1FJG Q;  4DV0 Q;  4A3B G;  3SDJ A;  1ML0 D;  1G6Z A;  1O80 A;  1QNK A;  4ZCK A;  1HNZ Q;  3PV0 A;  3OIQ A;  4O2D A;  2E2H B;  4DFA A;  1I6H H;  5FLM G;  1JQO A;  3IFT A;  2L1B A;  4IAL A;  3SGI A;  4YZC A;  3I56 A;  1VS0 A;  2KCC A;  4DV4 L;  3OYY A;  1IYU A;  4MN3 A;  3R93 A;  2IW3 A;  2PQ8 A;  1HZA A;  1KLU D;  1IL2 A;  1M4V A;  3J7A 5;  1K3R A;  4A3D B;  2VS1 A;  4DWL A;  3HGB A;  5IGC A;  5CBE E;  2F0D A;  1UE7 A;  1Z47 A;  2HCI A;  3G4S A;  1O7L A;  2R93 G;  3ULL A;  4OIK A;  1YI2 A;  1ET6 A;  3SDZ A;  5FOB B;  1H9S A;  1HA5 A;  1LR9 A;  5DLQ E;  4JI5 L;  4KHP Q;  3SEK C;  1RF2 D;  5J8F A;  5GAG C;  3M9B A;  2UXB L;  3R2I A;  4L5S A;  2HHH Q;  1SE4 A;  1K0R A;  2BUS A;  2D0P A;  2F4V Q;  4M8A A;  3TO7 A;  2MJ8 A;  5IGG A;  4R4T A;  1FNW A;  1WKX A;  3HKS A;  3IAM 1;  4NMZ A;  1BMO A;  1UVG A;  4X3U A;  2EXZ A;  3GTJ B;  1YNX A;  1IBK L;  2J7Z A;  3KBG A;  5I4D A;  2JA7 G;  3S1M B;  3FNB A;  2IWH A;  2M00 A;  1VQ9 A;  1WCM B;  4OWT B;  4EQP A;  2KCX A;  3TRE A;  2KCM A;  2DKV A;  2LSS A;  1NY4 A;  1IHZ A;  2YTY A;  1GO3 E;  1V1P A;  4KI0 A;  4RAU C;  2PI2 A;  4QB4 A;  3ZYY X;  5EX0 A;  2BL8 A;  3HOU G;  4A3K B;  2JA5 H;  3ND9 A;  4Q5V A;  3S1R H;  1EUJ A;  2LUY A;  2RKS A;  2VZA A;  2L8E A;  2F0L A;  1PRT C;  4DXF A;  2NVY H;  1Z9F A;  5AFW A;  3K0Y A;  1MBY A;  2R93 H;  4FO2 A;  1PZK D;  4BA2 I;  2QDL A;  4GS3 A;  1GUS A;  1VMC A;  2B8T A;  4DR1 L;  2NU4 I;  2CQO A;  1VQ6 A;  1KNE A;  4A3F G;  1Z2I A;  1K3B C;  4BXX G;  4NV5 A;  2ICE C;  2V1C C;  1XX8 A;  3PUX A;  3KJP A;  4YWL A;  1CKM A;  3GTP H;  2A5H A;  4RWS C;  1Q8I A;  3RLN A;  2WAQ B;  4IQZ A;  3VA7 A;  4UP8 A;  1F2M A;  1IY5 A;  2FEF A;  3CCQ A;  1SNP A;  2ZJP A;  1PXU A;  4S3S A;  2NN6 G;  2R7F A;  4HMJ A;  4X65 L;  1XPU A;  2NN6 I;  5KNC A;  1ZYR C;  5IP7 H;  4Y52 H;  2UU9 L;  4JI6 L;  3HKZ B;  4BBS H;  4C3I G;  2SGD I;  2Z4I A;  3D6W A;  4WOR A;  4JI2 L;  1FD7 D;  2EXD A;  5C44 B;  2F1M A;  2DIP A;  5JEA J;  3FHW A;  1C8C A;  3GV6 A;  2F0P A;  4QGU A;  5CV6 A;  2E2J H;  3QR8 A;  2G5D A;  2BE5 C;  4A3G B;  4CKB A;  1Q8K A;  3KF8 A;  3NBI A;  4FKD A;  2B2V A;  1KAB A;  3HS0 C;  2F0U A;  2BA1 A;  4GNX B;  3SHL A;  1A2U A;  4YHH L;  5HGQ A;  2B2Y A;  3KUP A;  3TZU A;  4DAV A;  1DZ1 A;  1HA6 A;  1K28 A;  4X3S A;  1YVC A;  1Y1V B;  3A5Z B;  3PMF A;  1SGE I;  1XJV A;  5M5Y B;  3UGD A;  2IX3 A;  1SGN I;  5JOB A;  2Q2I A;  2K04 A;  5ELB A;  3PO2 B;  1U9R A;  2RSN A;  1EIH A;  4DNT B;  2L9H A;  2KMR A;  3FP9 A;  1OO9 B;  5FJ8 G;  4GOP A;  3PF5 A;  4DR3 L;  3OHX C;  2ZXO A;  1STA A;  5AJ3 Q;  2QQC A;  5DM7 3;  2H1E A;  2NN6 H;  4J15 A;  5FO9 B;  1EIY B;  2K03 A;  5C4J H;  4IFD J;  4GI3 C;  1RFH A;  1YIT A;  4OXP A;  3L0I A;  3O13 A;  4IUQ A;  1S20 A;  1BCP C;  2FU2 A;  1STB A;  5IT9 c;  1KDA A;  1F2Z A;  4ULL A;  5EBD A;  3M4Y A;  4L5T A;  5EKK A;  4C3J B;  5IP9 G;  4SGB I;  2VQE L;  1TWA B;  4BBR H;  2TMP A;  2LY7 A;  5I6W A;  1W3S A;  5CV7 A;  1NMF A;  1YJW A;  3SVM A;  3TRZ A;  3DEP A;  4KTA A;  5BN3 A;  4X62 Q;  2UXC Q;  3J81 i;  3GD7 A;  4JCV E;  5IWA L;  1I3Q B;  3I7F A;  2MO1 A;  4JBM A;  3F2B A;  1CQF A;  3SGQ I;  1O7Z A;  4GLA C;  3GTK B;  5KND A;  2Y0S B;  1OMT A;  4JYA Q;  1STE A;  3GDE A;  3SEB A;  1EYC A;  5C3X A;  3LWE A;  2SGE I;  2P22 B;  1EYD A;  1N34 Q;  3HRZ C;  2CJS C;  1N32 L;  1D8L A;  4B3M Q;  1PZJ D;  4LWC A;  1DYQ A;  2GVB A;  4UP9 A;  1R0R I;  1UE5 A;  5GAH C;  4DUY L;  1M90 C;  3U9S A;  3H15 A;  2F3W A;  2EPB A;  3GTL H;  1TY2 A;  4KJO A;  2EYJ A;  4JI1 L;  4AYB B;  4XDX A;  3TO9 A;  3FKI G;  2CAZ B;  2PQA B;  3RUZ A;  4IUN A;  1YHA A;  5K5P A;  1AE3 A;  4C3H G;  4JI8 Q;  3CCM A;  3MVV A;  1NTG A;  1MD2 D;  3I90 A;  1FAQ A;  5CMD A;  4P75 A;  2KMO A;  1I4G A;  4RG1 A;  1F2L A;  1HNW Q;  2ZXP A;  4QIW E;  1Q46 A;  1UEA B;  3NEL A;  1EY7 A;  1HJA I;  1CI3 M;  3SK5 A;  1PCE A;  3STB C;  2CH4 W;  4BY1 H;  4DUZ L;  4YZD A;  2K01 A;  3UOE A;  1F9Q A;  1SND A;  1QZH A;  5KGU A;  2A73 B;  1YTP A;  2QW7 A;  1ENF A;  5E3R A;  4LFB L;  1HPT A;  1EQV A;  3RNU A;  4OAU C;  2R92 G;  2GVI A;  4PL3 A;  2I5L X;  3J7A V;  3J81 c;  3K5M A;  4B3S L;  2JN4 A;  4C1N K;  3I9V 1;  4H7B A;  3R3O A;  2Y0M A;  2RHS B;  4KV6 A;  3AYH B;  4HMI A;  2RA4 A;  2DB6 A;  2OXP A;  4A93 G;  4FF1 A;  1X6O A;  2HT1 A;  5I9P A;  3CF5 A;  4WRD A;  1E24 A;  1N33 L;  3TO6 A;  2SGP I;  5ISR A;  4IOA A;  2X6L A;  2FNF X;  1PTO C;  2HDL A;  5DAE A;  3OWF A;  2F0O A;  1PH6 A;  4TSS A;  3LGJ A;  3P20 A;  1L2F A;  3E0J A;  4R8I A;  2HIX A;  1IBM L;  1I50 B;  4A3C H;  2K32 A;  5M5X B;  1JMC A;  5C6A A;  3LJ2 A;  3NXW A;  3AMU A;  3TJQ A;  3J81 L;  5GRO A;  4HCS A;  2BCO A;  4NXN L;  2VNU D;  2VB2 X;  5HGT A;  2OVO A;  1QCB D;  1PH5 A;  3UEY A;  1VQI A;  4OGQ C;  4UP7 A;  1R4P B;  1TS4 A;  5IYC H;  1UNS A;  2NVQ B;  1PMR A;  4POF A;  1LUZ A;  2KA7 A;  4FVM A;  2QQ0 A;  1XBT A;  2E2D C;  3VYT A;  1HNX Q;  1QB5 D;  1LTI D;  3TP5 A;  2GVA A;  2R7Z H;  1V43 A;  5EX3 A;  1UHA A;  2FIN B;  2JB1 A;  1Q9B A;  2LXJ A;  1EWC A;  4PMW A;  5FK9 C;  3T1H Q;  3M4O H;  3EVQ A;  4Y7N H;  4A93 H;  1K9M C;  2F0S A;  3PUW A;  1V1P B;  5LL6 X;  2UZ3 A;  2RC4 A;  4DV5 Q;  3NP8 A;  4YCU A;  1YJ9 A;  1D1I A;  1JE4 A;  1L1O A;  3OMC A;  1BKB A;  4DA2 A;  3H0G B;  3VYS A;  4DNR B;  4PNY A;  2K19 A;  4DR4 Q;  4UXH A;  3SK6 A;  1SNC A;  5LMN L;  5GAE C;  2B63 B;  3TP8 A;  4NXM Q;  1SRO A;  1MJC A;  3HOV G;  4FF2 A;  4ZK9 B;  1HJP A;  4LF5 L;  1LR7 A;  3IL8 A;  3W2D A;  1F9P A;  4J6H A;  3HOY G;  2E5R A;  1SLJ A;  4ZKC B;  4QY7 A;  4APV A;  3EJI A;  4IO9 A;  2IHF A;  2RDG A;  2ETD A;  2RCF A;  5HI7 A;  2V1C A;  4DNI A;  1KBF A;  4CHT B;  4EGV A;  1STG A;  4DR2 L;  2F0E A;  4JBW A;  5H1S E;  1QVC A;  1VQH A;  2HQL A;  4B6D A;  1A8V A;  1SRU A;  1MGS A;  2WAC A;  5IOD A;  1EFI D;  4DV3 Q;  2HGK A;  4NV2 A;  1N36 L;  2A6H C;  4LMQ D;  4K5X A;  5EKI A;  2L55 A;  2J9R A;  4QCL A;  2ID0 A;  2EOT A;  2DJG C;  2A8V A;  2CHB D;  1PVO A;  1T9H A;  2ZTD A;  4RH6 A;  3HOX B;  2YU9 H;  2IY5 B;  4G75 A;  4A3B B;  1OTC A;  2HCC A;  3I3C A;  3PUV A;  3RZO H;  2AMC B;  1H95 A;  4A3E G;  3B6Y A;  3H94 A;  3M85 A;  1J8I A;  2JQO A;  4A24 A;  4A3I H;  1ICF B;  4F8M A;  2AQ2 B;  3BZK A;  3KLS X;  4X64 Q;  2NU3 I;  4LUZ A;  4DGZ A;  2UUB Q;  4TVA B;  1PV4 A;  1QUQ A;  4JK1 C;  1S5D D;  4OEL B;  2KMP A;  4G4K A;  1YU6 C;  1VQE A;  3PO3 H;  3M4Q A;  2JYY A;  1EY6 A;  3BVG A;  2GSC A;  4EX5 A;  4P72 A;  2OWO A;  1EOV A;  2KVM A;  4AIM A;  3VR5 A;  4IJH A;  1IYV A;  2EIF A;  3TP6 A;  1S3O A;  3S15 H;  4E6I A;  3HOW G;  1B7Y B;  1BUV T;  5LNK 1;  2EE1 A;  3RZD B;  1AW7 A;  1HRJ A;  2X6G A;  1SXT A;  3NTK A;  3S1N B;  2BH2 A;  4GKJ Q;  3TSS A;  4O1O A;  1PLF A;  2L1L B;  3PUY A;  2LS0 1;  2NU0 I;  1I4H A;  2JB2 A;  2VUM H;  2EJM A;  1HHV A;  2JA7 B;  2RCN A;  4XXE A;  4UXI A;  2OQK A;  1HQM C;  1SNQ A;  3CCV A;  3S16 B;  4ILW A;  5C4Z A;  4C56 C;  5DM6 3;  5FO7 B;  1X56 A;  3T4A C;  4JI4 Q;  1Z7T A;  2IX0 A;  1FYC A;  4HJ8 A;  4DR5 L;  1JOO A;  2YTV A;  3T1Y Q;  2DY7 A;  2N49 A;  3L2P A;  3HOU B;  1OMU A;  3X3M A;  3KP9 A;  3OL0 A;  2QCP X;  1STN A;  3EA6 A;  5C4X G;  3QTL D;  1VCI A;  4PMC A;  1TWF H;  4LF9 L;  3OXG A;  2CWA A;  4UPA A;  2A1A A;  1EEI D;  5FUY A;  1JB7 A;  5LMN W;  3OXF A;  2I07 B;  1GUG A;  4CJ2 C;  1HPC A;  4V19 0;  4A3F B;  4LAA A;  1ZXT A;  4X66 L;  2E2I B;  3H3V C;  2B2W A;  4LF4 L;  4P2C B;  3K5N A;  4G7Z C;  2JA8 H;  1BBW A;  2PW7 A;  5JJK A;  3P1H A;  3NEN A;  1WJJ A;  4MHE A;  1GHK A;  1PTO H;  3A7A B;  2XWJ B;  1EY8 A;  1KMA A;  2WB1 G;  3U9O A;  2HDM A;  3P23 A;  5M3M G;  3F8T A;  3V2T A;  1UEB A;  2JAE A;  4PV1 C;  3I4N H;  3Q8D A;  2ERW A;  1VQB A;  4HSV A;  2N3S A;  5IYD H;  2N55 A;  2E74 C;  4QJF A;  1Q86 C;  4R4Q A;  4C3I B;  1ULN A;  5F2D A;  4PMB A;  4BS9 A;  1P16 A;  1C0A A;  1SSO A;  2F3C I;  2JK8 A;  4RGT A;  2KJX A;  4Z9C B;  4GN4 B;  1B70 B;  2NTS A;  4DV4 Q;  1X74 A;  5JVH 3;  5HUR A;  4AS3 A;  1LTR D;  1LV9 A;  3HOZ G;  1JOK A;  5BN5 A;  1EYG A;  1F9S A;  4E1R A;  3WOE A;  4OX9 L;  3DXJ C;  2CVR A;  3MEK A; 
#chains in the Genus database with same CATH homology
 1SMX A;  3CCR A;  1EQQ A;  2CCZ A;  1BUS A;  1CSP A;  4P73 A;  4JI5 Q;  5HGI A;  4P74 A;  4OO1 I;  2UXB Q;  4YY3 L;  1KBE A;  1K73 C;  4LUV A;  1XMQ L;  3CC4 A;  1IBK Q;  4A76 A;  2ODD A;  4AQY L;  2NZH A;  3HOZ H;  4OWW B;  3G71 A;  3CCS A;  5E7N A;  3B4V C;  4H02 A;  2XTQ A;  3D00 A;  3L0O A;  4LUO A;  1BBU A;  4DR1 Q;  5JJI A;  4PL5 A;  4JG2 A;  1L1O B;  2K75 A;  2JA5 G;  3DA3 A;  2YTX A;  1QVF A;  1CHO I;  3I4M H;  4LFC L;  4B3T L;  1PPF I;  1EQR A;  2VQF L;  1HZC A;  2B0U C;  3H3V I;  4X65 Q;  1TGS I;  3UE1 A;  2K5H A;  4P71 A;  2UU9 Q;  3S24 A;  4JI6 Q;  4LFA L;  4BY7 H;  4JI2 Q;  1PH3 A;  2F52 A;  3HH2 C;  1XNQ L;  2V53 A;  4JOI A;  3UDG A;  4A3M H;  3DA4 A;  4TQU S;  4YHH Q;  3E2I A;  1X4S A;  5IP7 G;  4BBS G;  2E5L L;  2N1A B;  1IBL L;  3FC3 A;  4PG3 A;  1Y1B A;  4EQ5 A;  4A3L H;  2E73 A;  2IT1 A;  2H5X A;  1U0L A;  3OXL A;  1RIP A;  2NVT H;  3S1Q H;  2JA6 H;  1TWC H;  1LR8 A;  4LF7 L;  1E3P A;  4DR3 Q;  2DUD A;  4PL4 A;  3K7A H;  3GTO H;  4GKK L;  3H3V H;  3D31 A;  4JBJ A;  1X54 A;  4DR6 L;  4A3J H;  1PH9 A;  1MT1 A;  1LTL A;  1XPR A;  2JB3 A;  2VQE Q;  3F2C A;  2QQD A;  3FBV A;  2UUC L;  1SGP I;  4O1P A;  1CE3 A;  4B3R L;  4JC0 A;  5C0X I;  5IWA Q;  2IX1 A;  1FGU A;  3S2H H;  4L5Q A;  3L7Z C;  2B29 A;  3F4M A;  4JI3 L;  4GN5 A;  2L15 A;  4IJL A;  4BBR G;  1N32 Q;  2WVJ A;  5M3F H;  3KF6 A;  4DUY Q;  1PTQ A;  2QA4 A;  4JI7 L;  3E9I A;  1N13 A;  4JI0 Q;  4JI1 Q;  2P6A C;  1FVI A;  4PZ7 A;  4K0K L;  1WI5 A;  1XNR L;  2RHQ B;  4HIM A;  2ARP F;  4ALP A;  3UIT A;  4UXJ A;  3UDI A;  5LMU L;  2ATW A;  3BJI A;  4DUZ Q;  3I2Z A;  1VQJ A;  4LFB Q;  2JXD A;  5GQO A;  3K81 C;  4B3S Q;  2JEA I;  1CKN A;  1E7Z A;  2XMX A;  2SGQ I;  2N8N A;  4BY1 G;  1CGJ I;  5HQ8 A;  5CCM A;  3W1B A;  1PYS B;  3DM3 A;  5C3E H;  3VDU A;  1VQD A;  1XTD A;  2ZJR A;  1KC8 C;  3CW2 C;  1N33 Q;  3GTQ H;  3AFP A;  5IYB H;  4LF6 L;  5CCL A;  4HIO A;  5ELO A;  2SGF I;  1IBM Q;  3K8A A;  4GNX C;  3S2D H;  3IAS 1;  3S17 H;  3CXL A;  4NXN Q;  2VW9 A;  4OVO A;  1MKH A;  1HZB A;  2FXQ A;  4A3C G;  4Z7G A;  2Z6K C;  1BVS A;  4HFV A;  3PIO A;  1SGQ I;  2BA0 A;  1FAR A;  4DAY B;  3CCJ A;  2OTL A;  3GTG H;  5IYC G;  2ASB A;  2UUA L;  5LMN Q;  4AYB E;  4LF5 Q;  2R7Z G;  5BR8 L;  1TUR A;  4DR2 Q;  1KQS A;  2OQ0 A;  1V1H A;  2E2H H;  2UXD L;  2GN5 A;  1GD7 A;  4G76 A;  3CAM A;  1N36 Q;  4IPH A;  3LJ1 A;  1I5F A;  1A63 A;  4A3K G;  2UXC L;  4A3D H;  2ALY B;  1Y8F A;  3A74 A;  2PMZ E;  1W2B A;  4DK6 C;  4HGU A;  2ZM6 L;  1PH7 A;  3UE0 A;  3PGZ A;  1R79 A;  1E1O A;  1NJI C;  4YWK A;  4GN3 B;  3UDF A;  2YFB A;  3I4O A;  3GTJ H;  4A3I G;  3S1M H;  3A0J A;  2I5M X;  3CPW A;  1QVG A;  1UUC A;  1WCM H;  1IYJ B;  1A62 A;  1X65 A;  4HJ9 A;  2R6G A;  1MJE A;  1G6P A;  1FL0 A;  3PO3 G;  3TQY A;  2XGT A;  2A2C A;  4A3K H;  3K7U C;  4DV6 L;  1TIH A;  3KOJ A;  1X9N A;  4DR5 Q;  1KXL A;  1QZG A;  2VL6 A;  3CCE A;  2VUM G;  2I0Q A;  1VQF A;  1OXS C;  4LF9 Q;  2L7X A;  3E0E A;  3CMA A;  1V1Q A;  3KY9 A;  2LXK A;  3LJ0 A;  1HDL A;  2D0O A;  4X66 Q;  3GO5 A;  4WJ3 M;  3KF8 B;  4LF4 Q;  2NU2 I;  5C44 H;  1CSO I;  4MTN A;  3KLW A;  5JEA G;  4DV2 L;  3EIV A;  3ZJY C;  3PIP A;  4A3G H;  2K9H A;  4DV1 L;  2XTR A;  3OTO L;  2ZTC A;  3DLL A;  3MEF A;  4A75 A;  1Y1V H;  2JA8 G;  2YQP A;  4U6R A;  5M5Y H;  4GOP B;  1VQ4 A;  3PO2 H;  3I4N G;  4JBK A;  2YFA A;  1TBQ R;  5IYD G;  1PH4 A;  4AS2 A;  3RLF A;  1HR0 L;  1KIX A;  4OX9 Q;  4AYB G;  1UWV A;  4IFD I;  1VQA A;  4YCW A;  1OVO A;  4I1T A;  2N17 A;  3CC2 A;  2OD1 A;  4C3J H;  4Q9V A;  2KCT A;  1TWA H;  1Q81 C;  4YY3 Q;  1PTR A;  2Z0S A;  3STB D;  1XMQ Q;  1Y1C A;  1C9O A;  1KHI A;  1KAW A;  1I3Q H;  1JJ2 A;  4GXT A;  1M1K C;  3GTK H;  1KRS A;  2AKW B;  1YHB A;  4LF8 L;  4OON A;  4AQY Q;  2Z6K A;  4JV5 L;  4MNO A;  1PJU A;  2GKV A;  3UFF A;  1V9P A;  3F1Z A;  4GOP C;  1EWI A;  4DK3 C;  1Q1E A;  3EN2 A;  1N9W A;  1TBR R;  3E9H A;  2K52 A;  2ZRR A;  4LFC Q;  4DAM A;  3G48 A;  4B3T Q;  1E22 A;  2KEN A;  2VQF Q;  3RR5 A;  4OO1 G;  2KBN A;  2D62 A;  1SJ8 A;  1UE1 A;  1IXR A;  3VDY A;  4DR7 L;  1G29 1;  4LFA Q;  3A5U A;  1XNQ Q;  2IHE A;  3I4M G;  1IW4 A;  1TOT A;  3PF4 A;  1WYD A;  2MFI A;  3TS0 A;  5ELN A;  1JE5 A;  1J5E L;  2E5L Q;  4BY7 G;  1HR0 W;  1I50 H;  1IBL Q;  5M5X H;  1PH2 A;  4YZ9 A;  2K14 A;  2JA1 A;  1VQP A;  1CUK A;  2F3I A;  3G6E A;  1OYV I;  2KKM A;  4A3M G;  1VQ8 A;  4IPC A;  4LF7 Q;  4YWM A;  1I94 L;  4GKK Q;  4DV7 L;  4DR6 Q;  4A3L G;  4E1P A;  1XMO L;  1YHQ A;  1X3G A;  2JA6 G;  3CCU A;  3H0G H;  2GKT I;  2UUC Q;  3BU2 A;  2B63 H;  4B3R Q;  1S40 A;  4A3J G;  2K4K A;  3W5O A;  4KLK A;  2MQH A;  1YO7 A;  3BZC A;  4PZ6 A;  4JI3 Q;  3PUZ A;  4YCV A;  1Z7K B;  4QL5 A;  1TBN A;  2N78 A;  3ERS X;  4JI7 Q;  2LEO A;  3HOX H;  5IE8 A;  4A3B H;  2CFM A;  1QUQ B;  1E1T A;  5HY6 A;  4K0K Q;  1XNR Q;  5FLM H;  1EFW A;  5JJL A;  2WP8 J;  1YZ6 A;  1VQM A;  2N52 A;  2W0T A;  3VA9 A;  5M3F G;  5LMU Q;  3J80 i;  2ENZ A;  3GOX A;  1FJG L;  3AEV A;  2KHJ A;  4DV0 L;  3PDN A;  1L1O C;  1HNZ L;  3KDF A;  1UE6 A;  2KHI A;  1IY6 A;  1LM0 A;  3RZD H;  2QEX A;  4AH6 A;  5IY0 A;  5C0X G;  1X3F A;  3S1N H;  1JT8 A;  1CT4 I;  2JA9 A;  1ASZ A;  2JA7 H;  4LF6 Q;  1OXX K;  2N71 A;  3S16 H;  1MIU A;  4KHP L;  1RL2 A;  3CP0 A;  3TEH B;  1AE2 A;  2HHH L;  2F4V L;  3DO9 A;  4NB3 A;  1XA6 A;  5C3E G;  2WAQ E;  3VE5 A;  3HOU H;  3E59 A;  1PFS A;  5IYB G;  1PYB A;  1VQC A;  3J80 c;  3M7N A;  1JJG A;  3HKZ E;  1VQO A;  4O0A A;  4POG A;  3JAM i;  2HIV A;  1EIF A;  2Q2U A;  4A3F H;  1CT2 I;  2E2I H;  4BXX H;  3W1G A;  4XTC S;  1N8R C;  2M5X A;  1PH1 A;  2UUA Q;  1CT0 I;  1M8C A;  3U4Z A;  4LNQ A;  3K0X A;  1X55 A;  4Z7H A;  3J81 j;  5BR8 Q;  1OXT A;  3I55 A;  4C3I H;  3K80 C;  4X6A H;  4BA1 I;  2UXD Q;  2FUG 1;  4GLX A;  1OXU A;  1NMG A;  1SGD I;  3NBH B;  1VDD A;  4HEA 1;  2MO0 A;  3JAM c;  2NU1 I;  2ZM6 Q;  1TWH H;  1PH8 A;  5FJ8 H;  3KYH C;  4IOC A;  4C2M H;  2Y0S E;  5FLX c;  4A3D G;  4JI0 L;  3F2D A;  2F6M B;  2ROW A;  3CME A;  2AHO B;  1VQ5 A;  1JJC B;  1PHJ A;  4L5R C;  3KFU A;  4RMF A;  5IP9 H;  3BJU A;  2ES2 A;  5AJ3 L;  2I5H A;  1SGY I;  3UDX A;  3OW2 A;  5J3B A;  1NUB A;  4DPG A;  4DV6 Q;  1WCM G;  3CXC A;  4PZ8 A;  5M5W H;  1A0I A;  2ZJQ A;  3RLO A;  4OAV B;  1W4R A;  4X62 L;  1TUS A;  3PCO B;  2WCY A;  4UY8 C;  4JYA L;  3FKI H;  1WFQ A;  1OXV A;  1WOC A;  3JSB A;  4C3H H;  1N34 L;  2R7D A;  4B3M L;  4ME3 A;  4MZ9 A;  1V1I A;  2JE6 I;  2ZTE A;  2BH8 A;  2WB1 E;  1Q7Y C;  2K50 A;  2ENN A;  1SE8 A;  2AWN A;  4DV2 Q;  3M4P A;  1VQK A;  2WAQ G;  5FUV A;  4IPG A;  4JI8 L;  4DV1 Q;  3OTO Q;  2QQE A;  1YEZ A;  2R92 H;  1HNW L;  3HKZ G;  3WWV A;  5C44 G;  4R4O A;  3JC6 6;  5GAD C;  3CCL A;  3CC7 A;  4FDB A;  4HJ5 A;  4A3G G;  2QPO A;  2CKZ B;  3ULP A;  1HR0 Q;  1Y1V G;  3KDF B;  2PI2 E;  1H0Z A;  3PO2 G;  3CPF A;  3KJO A;  1O7I A;  1SN8 A;  3PSI A;  4L9M A;  1D7Q A;  2J87 A;  2ORW A;  3RN5 A;  2A20 A;  2A19 A;  3MXN B;  3ULJ A;  1Q82 C;  1UVF A;  1Q12 A;  1LYL A;  4JOI C;  3UEJ A;  1X3E A;  3KF6 B;  1ASY A;  1TBO A;  1AN1 I;  1CGI I;  3ICE A;  4OWX B;  4LF8 Q;  1NBW A;  1NE3 A;  2OCE A;  2VY3 A;  4KHZ A;  1HNX L;  3QWP A;  1DS3 I;  3HOV H;  4JV5 Q;  5EAY A;  2K5V A;  3IRB A;  2XTI A;  3HOY H;  3T1H L;  2RIO A;  2Y0S G;  4DV5 L;  3UGI A;  1XX6 A;  2V6E A;  3AJF A;  4DR4 L;  1VQG A;  3NEM A;  2RF4 A;  5K36 G;  2MJF B;  1VQL A;  4NXM L;  5C0X J;  1CKO A;  1DGS A;  2YYZ A;  2KMQ A;  3D0F A;  4IFD G;  1CSQ A;  5FUX A;  4R1J A;  1YJN A;  1CKN B;  4HJA A;  1P8L A;  4A3E H;  1G51 A;  4DV3 L;  3TS2 A;  4A4I A;  4GLV B;  1GM5 A;  4IPD A;  4DR7 Q;  1KL9 A;  1AH9 A;  4GNX A;  4NPS A;  1GVP A;  1Y1W G;  4R4I A;  3ER0 A;  1M8B A;  1KRT A;  2Q2H A;  1J6Q A;  2NZO A;  2E8G A;  2YUU A;  3AQQ A;  4X64 L;  3HOW H;  1J5E Q;  2UUB L;  3S14 H;  2ELI A;  2JW6 A;  1U5K A;  2A2D A;  4HIK A;  2NVX H;  2B3G A;  3AFQ A;  1VQN A;  1Y14 B;  5JHW C;  1S72 A;  1YIJ A;  2F66 B;  2EQS A;  2AWO A;  2YV5 A;  1L0W A;  1I94 Q;  1YBY A;  2PNH A;  1DS2 I;  3VDP A;  4DV7 Q;  3HFZ B;  2ORV A;  2QGQ A;  4HJ7 A;  2MNA A;  1C7Y A;  3J7Z C;  4GKJ L;  1TXY A;  1SR3 A;  1XMO Q;  1FYB A;  2WFW A;  2JEB I;  1SFO H;  3M3Y H;  1Y1W H;  5C4X H;  3UGL A;  3GTM H;  2OTJ A;  1VQ7 A;  1XPO A;  2GKR I;  4XIG S;  3CQZ H;  2CWP A;  2JJQ A;  1HZ9 A;  4JI4 L;  1K8A C;  2C35 B;  4WJ4 A;  3SGB I;  3T1Y L;  2VRW B;  3CD6 A;  1SGR I;  1K8G A;  1KD1 C;  1B8A A;  2XRC A;  1GKH A;  1PA6 A;  3H0G G;  1K83 H;  4QQB X;  5M3M H;  5FUW A;  1TWG H;  2B63 G;  2PQA A;  3OVO A;  3U58 A;  2IP6 A;  4R4C A;  4DKA C;  3RU0 A;  1HH2 P;  4LW1 A;  2DGY A;  3EBE A;  3RN2 A;  3U50 C;  3U4V A;  2Q2T A;  1R9T H;  2NVQ H;  2JZM A;  1Q1B A;  2K5N A;  4HID A;  1IZ6 A;  3HOX G;  1FJG Q;  4DV0 Q;  4A3B G;  3SDJ A;  1HNZ Q;  3PV0 A;  4O2D A;  1I6H H;  5FLM G;  3SGI A;  3I56 A;  4YZC A;  1VS0 A;  4DV4 L;  3OYY A;  1HZA A;  1IL2 A;  3J7A 5;  1K3R A;  2VS1 A;  4DWL A;  1UE7 A;  1Z47 A;  3G4S A;  2R93 G;  3ULL A;  1YI2 A;  1LR9 A;  5DLQ E;  4JI5 L;  4KHP Q;  3SEK C;  5GAG C;  3M9B A;  2UXB L;  4L5S A;  2HHH Q;  1K0R A;  2BUS A;  2D0P A;  2F4V Q;  4R4T A;  3HKS A;  3IAM 1;  1BMO A;  1UVG A;  1YNX A;  1IBK L;  2JA7 G;  1VQ9 A;  4OWT B;  2KCX A;  3TRE A;  2KCM A;  2LSS A;  1NY4 A;  2YTY A;  1GO3 E;  4KI0 A;  2PI2 A;  5EX0 A;  3HOU G;  2JA5 H;  3S1R H;  1EUJ A;  2LUY A;  2VZA A;  2L8E A;  2NVY H;  1Z9F A;  2R93 H;  4BA2 I;  4GS3 A;  2B8T A;  4DR1 L;  2NU4 I;  2CQO A;  1VQ6 A;  4A3F G;  4BXX G;  4NV5 A;  2V1C C;  3PUX A;  3KJP A;  4YWL A;  1CKM A;  3GTP H;  3RLN A;  4UP8 A;  1IY5 A;  3CCQ A;  2ZJP A;  2NN6 G;  2R7F A;  4X65 L;  1XPU A;  2NN6 I;  5IP7 H;  4Y52 H;  2UU9 L;  4JI6 L;  4BBS H;  2SGD I;  4JI2 L;  2EXD A;  2DIP A;  5JEA J;  3FHW A;  4QGU A;  2E2J H;  4FKD A;  1Q8K A;  2BA1 A;  4GNX B;  4YHH L;  5HGQ A;  1YVC A;  3A5Z B;  1SGE I;  1XJV A;  3UGD A;  1SGN I;  2Q2I A;  2KMR A;  3FP9 A;  5FJ8 G;  4GOP A;  3PF5 A;  4DR3 L;  5AJ3 Q;  2QQC A;  4J15 A;  1EIY B;  5C4J H;  4IFD J;  4GI3 C;  1RFH A;  1YIT A;  4OXP A;  3L0I A;  5IT9 c;  4L5T A;  5IP9 G;  4SGB I;  2VQE L;  4BBR H;  1W3S A;  1NMF A;  1YJW A;  3TRZ A;  4X62 Q;  2UXC Q;  3J81 i;  3GD7 A;  4JCV E;  5IWA L;  3I7F A;  4JBM A;  2MO1 A;  3SGQ I;  3F2B A;  4GLA C;  1OMT A;  4JYA Q;  3GDE A;  2SGE I;  2P22 B;  1N34 Q;  2CJS C;  1N32 L;  1D8L A;  4B3M Q;  4LWC A;  2GVB A;  4UP9 A;  1R0R I;  1UE5 A;  5GAH C;  4DUY L;  1M90 C;  3H15 A;  3GTL H;  4JI1 L;  3FKI G;  2CAZ B;  2PQA B;  1YHA A;  1AE3 A;  4JI8 Q;  3CCM A;  1NTG A;  1FAQ A;  4P75 A;  2KMO A;  4RG1 A;  1HNW Q;  4QIW E;  1Q46 A;  3NEL A;  1HJA I;  1PCE A;  3STB C;  4BY1 H;  4DUZ L;  4YZD A;  1QZH A;  1YTP A;  4LFB L;  1HPT A;  3RNU A;  4OAU C;  2R92 G;  2GVI A;  4PL3 A;  2I5L X;  3J81 c;  4B3S L;  3I9V 1;  2RHS B;  3AYH B;  2DB6 A;  4A93 G;  1X6O A;  2HT1 A;  3CF5 A;  1E24 A;  1N33 L;  2SGP I;  4IOA A;  2FNF X;  5DAE A;  1PH6 A;  3LGJ A;  1L2F A;  2HIX A;  1IBM L;  4A3C H;  1JMC A;  3LJ2 A;  3TJQ A;  5GRO A;  4NXN L;  2VNU D;  2OVO A;  1PH5 A;  3UEY A;  1VQI A;  4UP7 A;  5IYC H;  4POF A;  1LUZ A;  2QQ0 A;  1XBT A;  1HNX Q;  2GVA A;  2R7Z H;  1V43 A;  5EX3 A;  2JB1 A;  2LXJ A;  3T1H Q;  3M4O H;  4PMW A;  4Y7N H;  4A93 H;  1K9M C;  3PUW A;  2UZ3 A;  4DV5 Q;  4YCU A;  1YJ9 A;  1L1O A;  1BKB A;  4UXH A;  2K19 A;  4DR4 Q;  5LMN L;  5GAE C;  4NXM Q;  1SRO A;  3HOV G;  1MJC A;  1HJP A;  4LF5 L;  1LR7 A;  3HOY G;  2E5R A;  1SLJ A;  4QY7 A;  4APV A;  4IO9 A;  2IHF A;  5HI7 A;  2V1C A;  4DNI A;  1KBF A;  4DR2 L;  4JBW A;  5H1S E;  1QVC A;  1VQH A;  2HQL A;  4B6D A;  1A8V A;  1SRU A;  4DV3 Q;  4NV2 A;  1N36 L;  2J9R A;  2ID0 A;  2A8V A;  1PVO A;  1T9H A;  2ZTD A;  2YU9 H;  2IY5 B;  4G75 A;  1OTC A;  3PUV A;  3RZO H;  2AMC B;  1H95 A;  4A3E G;  3B6Y A;  3M85 A;  2JQO A;  4A24 A;  4A3I H;  3BZK A;  4X64 Q;  2NU3 I;  4LUZ A;  2UUB Q;  4TVA B;  1PV4 A;  1QUQ A;  2KMP A;  1YU6 C;  1VQE A;  3PO3 H;  3M4Q A;  2JYY A;  4EX5 A;  4P72 A;  2OWO A;  1EOV A;  4AIM A;  4IJH A;  2EIF A;  1S3O A;  3S15 H;  3HOW G;  1B7Y B;  5LNK 1;  2BH2 A;  4GKJ Q;  4O1O A;  2L1L B;  3PUY A;  2NU0 I;  2JB2 A;  2VUM H;  2RCN A;  4UXI A;  2OQK A;  3CCV A;  1X56 A;  4JI4 Q;  2IX0 A;  4HJ8 A;  4DR5 L;  2YTV A;  3T1Y Q;  3L2P A;  2N49 A;  1OMU A;  3KP9 A;  3OL0 A;  5C4X G;  3QTL D;  1VCI A;  1TWF H;  4LF9 L;  3OXG A;  2CWA A;  4UPA A;  2A1A A;  5FUY A;  1JB7 A;  5LMN W;  3OXF A;  4X66 L;  4LF4 L;  2JA8 H;  1BBW A;  5JJK A;  3NEN A;  1WJJ A;  1KMA A;  2WB1 G;  3P23 A;  5M3M G;  3F8T A;  3I4N H;  1UEB A;  2JAE A;  3Q8D A;  2ERW A;  1VQB A;  2N3S A;  5IYD H;  4QJF A;  1Q86 C;  4R4Q A;  1P16 A;  1C0A A;  2F3C I;  2JK8 A;  4GN4 B;  1B70 B;  1X74 A;  4DV4 Q;  4AS3 A;  3HOZ G;  1EYG A;  4E1R A;  4OX9 L;  3MEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...