1U5KA

Recombinational repair protein reco
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
243
structure length
242
Chain Sequence
RSRTANRSGIVIRRRVTPAGDIIVTLLTPQGKLKAIARGGVKGPLSSSLNLFHHVGVQVYQGPHDLASVKQAVLEGALPTLAEPERYAFAHLMAEFADALFQEGEFSEQAFDLFAASLRGVAHQPDPEWVALVMSYKLLGLAGVIPQTARCARCGAPDPEHPDPLGGQLLCSKCAALPPYPPAVLDFLRHAVRRTVRASFEQPVPSADRPALWRALEKFVTVQVGGVHSWRQLVPSGVPVLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Novel Structure of DNA Repair Protein RecO from Deinococcus radiodurans
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Recombination,replication
molecule keywords hypothetical protein
total genus 65
structure length 242
sequence length 243
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02565 RecO_C Recombination protein O C terminal
A PF11967 RecO_N Recombination protein O N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.120 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 1u5kA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1u5kA01
3.30.60.100 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1u5kA03
4DR2Q 3GTLH 5EAYA 4HIDA 1GKHA 3CCVA 1Q8KA 1UEBA 4DUZQ 2R92G 2VUMH 2CFMA 4GNXB 1I50H 2PI2A 3CC4A 1HNZL 3PO2H 3S2DH 3GD7A 4DV1L 1E7ZA 1MKHA 1W3SA 4LF4Q 5FJ8H 3PO2G 2UUBL 1XMQL 1Q82C 4HJAA 2MO1A 4YCUA 4A93H 4X65L 1Q46A 1QVCA 2R93G 3HOWG 2PMZE 1PH1A 4GKKQ 1WOCA 2HT1A 1S3OA 3T1YQ 3CCQA 2AHOB 2VZAA 3U50C 2OQ0A 4DV3L 3AFPA 1QUQB 1G6PA 4FDBA 4APVA 3CCMA 3W1BA 1UE1A 4B3SL 4UY8C 3B6YA 1IYJB 1L1OB 2K50A 3HOZG 1HNWQ 1M1KC 1VQIA 2JE6I 1CKOA 3CF5A 4A76A 1T9HA 1VQLA 4LF9L 1BBWA 4P71A 4NXML 4A3GH 3KF6B 3F8TA 1NBWA 4ALPA 1YJWA 1YJNA 1PH7A 4OO1G 1Q81C 3WWVA 1VQ5A 4LF8L 4WJ3M 1UE5A 3PUYA 1CSQA 2WAQE 1X3FA 3ER0A 1XMOQ 5E7NA 1EYGA 2EXDA 2KENA 4LFCL 4JI0Q 4DK6C 4LNQA 1EFWA 3G6EA 1I3QH 1UE7A 3L7ZC 3OYYA 3KDFB 4IPHA 1WYDA 4JI3Q 3CQZH 3BZKA 4GN5A 4DR6Q 3AQQA 4NXMQ 1KC8C 1HH2P 4KI0A 1W2BA 1VQ4A 4WJ4A 1TWCH 4OXPA 3CC2A 1PYSB 4BY1H 1Q7YC 4DR6L 2JA7G 3HOXG 1NY4A 3OTOQ 4A3BG 1SLJA 4BBRH 1X9NA 4JI7L 1K9MC 1IBKL 4IPDA 4DV7L 2DGYA 2D0PA 4R4OA 3GTJH 1OTCA 4BY7H 2HIVA 3ERSX 4X66L 2IX1A 3F2BA 4A3CG 2JA9A 3JAMc 2VQEL 4DPGA 4UP9A 3IRBA 4A3GG 2YTXA 3PIOA 3I4NH 5GQOA 2YTVA 2B63H 1SE8A 4C2MH 3F2CA 4JI1L 4IOCA 2R7DA 2YTYA 3KLWA 2OTJA 3CAMA 3HOXH 3PSIA 3PO3H 3KJPA 1TWAH 5GAHC 4A3EH 4A3KH 4A3LG 1NTGA 4AQYL 2KHIA 1C7YA 3G4SA 4LUVA 1VQCA 2NN6I 2XTIA 2IHEA 3RLOA 4QJFA 1VQMA 2KCMA 3CMEA 2N3SA 5J3BA 2Y0SE 2MFIA 3L0OA 1ASZA 1G291 2I0QA 1IBKQ 5IP9H 4OWWB 3J81j 2Z0SA 1QZGA 2E2JH 2Q2UA 4LF6Q 2R7ZG 4B3MQ 2UUAL 1P8LA 4QY7A 5ELNA 1J5EL 4L5RC 2N49A 1M90C 3S1QH 1NMGA 4DV2L 1JJCB 1PH4A 2VW9A 4JYAQ 1RL2A 4PZ8A 4P74A 1A62A 3HOVH 1S72A 2RHSB 1D8LA 3STBD 1EQQA 4DR3Q 2OTLA 4DV6L 2UXBL 4YCVA 2E5LQ 3ULLA 3HOVG 3GTQH 3J81i 2Z6KC 4PG3A 3PUXA 3CD6A 4BXXH 4DUYL 1YVCA 4DR4Q 2E2IH 3TRZA 4KHPL 4DR5L 2PQAB 4RG1A 1G51A 4PMWA 4DR7Q 4YY3L 5GAGC 5IE8A 4P72A 1PH6A 3UE1A 3HKZG 1JE5A 1SRUA 1YI2A 5JJKA 1X54A 2FXQA 2JA8H 4R4TA 4DV4Q 2WP8J 3CCSA 4DK3C 4YY3Q 4O2DA 5DLQE 1VQ7A 5HY6A 4GNXA 4DNIA 2CQOA 3KJOA 3G71A 1HZCA 3U58A 2UUCL 5C44G 5BR8Q 3FKIH 4A3LH 4LFBQ 2PNHA 1ASYA 4RMFA 3J7ZC 1PYBA 4X65Q 1BBUA 2C35B 1V43A 3S24A 1SROA 4A4IA 1PH5A 2UUBQ 1X56A 5H1SE 1C0AA 2R6GA 2E2HH 4JI4Q 1XTDA 3CC7A 3ICEA 1KL9A 5C4JH 2JA6H 4A3BH 1B7YB 4DR1Q 1VCIA 3M4OH 2RF4A 5M3FH 1SMXA 5IYBG 2E5LL 1I6HH 4K0KL 4IJHA 5IWAQ 5IYCH 5M5WH 2WB1G 4A3CH 3J80i 1VQEA 2MO0A 4POFA 2WFWA 5GAEC 4R4IA 4DV7Q 3NBHB 4LFAQ 2K14A 2AWOA 1TXYA 1YBYA 3HFZB 5M5XH 4A3IH 4A3JG 4KLKA 4X62Q 1IZ6A 2ATWA 2IT1A 2AMCB 4NPSA 1PH3A 2VS1A 4A3IG 1NMFA 5JJLA 4YWLA 4A3FG 1BKBA 1X3GA 3FKIG 2RHQB 2LXJA 1N33L 4DV1Q 1KQSA 2BH8A 2K5VA 4LF5L 5M3FG 4IFDI 4IFDJ 5JJIA 4YHHL 1QUQA 1WFQA 5IYDG 3ULPA 1SN8A 3OTOL 4A75A 3MXNB 3Q8DA 1Z47A 2K5NA 3RN2A 3S1RH 1PH9A 4GLVB 1EUJA 4XTCS 3TS2A 1VQJA 1NE3A 4LUOA 1L1OA 1K8AC 3I4OA 4JBMA 2K4KA 4JI8Q 3GTPH 3M7NA 5LMNW 5IYBH 1HR0L 2A19A 3TREA 4HJ9A 1FGUA 2JA6G 3FP9A 3K81C 1MJCA 4QL5A 3UDXA 4DAMA 2JEBI 4JI6Q 1KXLA 1PVOA 3ZJYC 2KHJA 1HZBA 4DV5Q 3OW2A 2HHHL 4C3IH 4DR4L 3S2HH 2BH2A 3PV0A 3CCRA 5M5YH 1XMOL 2R93H 1TWFH 4Y7NH 3GO5A 4GKJQ 3M85A 4H02A 4BA2I 1XNRQ 3KFUA 2UXCQ 4JG2A 1L1OC 5GROA 3UDGA 2N8NA 5ELOA 2UXDQ 3D31A 4R4QA 4UP7A 4LF9Q 4GOPC 2UUCQ 1K83H 1J5EQ 2ZJRA 3I7FA 2JA5H 3S14H 1KD1C 1KIXA 2AKWB 2I5LX 4J15A 3I56A 1YJ9A 3UE0A 4LF7L 4LF8Q 2B63G 4X6AH 4DR3L 4BBSH 2UXBQ 1JT8A 1X6OA 4A3DG 1CKNA 2KCTA 3A74A 3S16H 4A3EG 4GS3A 1XPRA 3EBEA 4X66Q 1XPUA 2WB1E 1GO3E 1TWGH 3J81c 1QVFA 3H3VI 4A3FH 3J7A5 3K7UC 5HGQA 1LTLA 4BBRG 1X3EA 3PCOB 2VQFQ 3AYHB 1IBLL 1UWVA 4GN3B 3GTOH 4JI5L 3CXCA 1QVGA 4HJ8A 2R7ZH 1HR0W 4AIMA 3F2DA 2VQFL 5LMUQ 1IBLQ 1HZ9A 2HQLA 2KBNA 3GTMH 4A3MH 1H95A 2ZTCA 3E0EA 3STBC 1V1QA 4JI2Q 3J80c 4L5QA 4AQYQ 1J6QA 4JC0A 4EX5A 4A3KG 4BY1G 1E22A 2R7FA 3AFQA 2IY5B 4DV0L 1E24A 1E1TA 4IPCA 4B3ML 2OWOA 1U5KA 4LFBL 3M4QA 1VQHA 1CUKA 3T1HQ 2VQEQ 4UP8A 2IHFA 3BU2A 3HOYG 5IP7H 3GTKH 2UU9L 4PZ6A 4OX9Q 2D0OA 1EOVA 2L15A 4JBWA 3H15A 4IPGA 4QGUA 4NB3A 1R9TH 1Q86C 4LF5Q 2GN5A 3A5UA 1IXRA 3CCLA 1MIUA 1PHJA 1Z9FA 1YITA 4A3DH 4BY7G 2PQAA 4KHPQ 3HOZH 3A0JA 1CKMA 3NELA 3PUWA 2JK8A 5C44H 2A8VA 2NVQH 1LM0A 1JB7A 3F1ZA 4AYBG 1N36Q 2NZOA 3M3YH 5IYCG 1IL2A 5IP9G 1O7IA 3DLLA 1YHBA 3H0GG 4JI8L 3KYHC 4DV4L 4MNOA 3HOUG 4GOPB 3S1MH 2QA4A 3VDYA 4POGA 1HNXL 3KF6A 4BA1I 4PZ7A 4JYAL 1N9WA 2CWPA 3H0GH 5FJ8G 1SFOH 3W5OA 3UDFA 5IWAL 1CSPA 3FHWA 2Q2HA 1HZAA 2ZJPA 3CCUA 2QEXA 4DV5L 1Y14B 5AJ3L 5K36G 1OXVA 2LXKA 4KHZA 4DAYB 3RLNA 4JBKA 4LF6L 1PA6A 2GVAA 3CPFA 2YYZA 2NVYH 4XIGS 1N36L 3GTGH 1JJGA 3HOWH 5GADC 4JI4L 1U0LA 1HNWL 1QZHA 1K73C 2VNUD 2EQSA 2NZHA 2B3GA 1HNZQ 3E9IA 5M3MG 1JMCA 5LMNQ 4B3TL 1A8VA 3S15H 4JI1Q 4HJ7A 1YHQA 1XNQQ 3CP0A 5C0XG 1XMQQ 1I94Q 5C3EH 4B3RQ 3UDIA 1N32L 3E9HA 4GOPA 2ASBA 3JC66 4OWXB 2B29A 1NJIC 1S40A 1VQPA 4Y52H 1E1OA 1VQBA 1YZ6A 1TWHH 1K0RA 2Y0SG 1KRTA 1LYLA 4GKJL 3CCJA 3T1YL 4JI5Q 4JBJA 4BXXG 2PI2E 5IYDH 4GLXA 1K3RA 2Q2TA 3M9BA 3I4MG 3U4VA 1OXSC 2MQHA 4EQ5A 1C9OA 3TEHB 4JI6L 2JEAI 2HIXA 3SGIA 2F4VQ 1A63A 4LWCA 2K75A 1FL0A 1B70B 1DGSA 2EIFA 1CKNB 5FLMH 3CCEA 3PO3G 1LUZA 3KDFA 1UE6A 2IX0A 4IJLA 2F4VL 2ZTDA 5C3EG 4LW1A 1X55A 4DR2L 2NVXH 3HKSA 2CCZA 4L5TA 4DUYQ 3I2ZA 4TVAB 1AE3A 3HKZE 2Q2IA 5IT9c 1VQ6A 1Q12A 4R1JA 2UXDL 3PUVA 1V9PA 4X62L 3TS0A 4YWMA 2OCEA 4R4CA 2GVBA 4OX9L 3EN2A 3KF8B 3CW2C 2VL6A 3K7AH 2NN6G 3CMAA 2JA7H 4QIWE 2ALYB 4NXNQ 1N8RC 1Y1VG 4C3HH 5JEAG 4AH6A 4P75A 2OQKA 4HJ5A 1K8GA 3G48A 1N33Q 1N32Q 2K52A 1VQGA 3GDEA 4DV3Q 1XNQL 1AH9A 5FLMG 4NXNL 3NEMA 3DM3A 1FVIA 3BJUA 1IBML 1XNRL 3BZCA 3U4ZA 2ZM6L 3I4MH 4LUZA 4JI0L 4JOIA 1Y1WG 4LFCQ 1XPOA 2YU9H 4DV2Q 1N34L 2F3IA 3JAMi 2DUDA 4JOIC 1BVSA 2N78A 5LMUL 3H3VH 2JA8G 3T1HL 5C4XG 2JJQA 3TQYA 1VQDA 5AJ3Q 4DUZL 3W1GA 2UU9Q 2ZJQA 1Q1BA 2JA5G 3MEFA 5IY0A 1EQRA 1PFSA 1VS0A 2YV5A 4LF4L 1GM5A 4AYBE 1I5FA 2XGTA 4JI3L 3PIPA 1PV4A 1VQAA 1IBMQ 2ES2A 4UPAA 2UXCL 1L2FA 1YNXA 3L2PA 5LMNL 1YHAA 1VQ8A 4B3TQ 3S1NH 4GKKL 4A93G 2A1AA 2QGQA 3LGJA 5JEAJ 3KOJA 4OONA 1N34Q 3EIVA 1P16A 2HHHQ 2VY3A 3RR5A 4IO9A 1KRSA 4GNXC 4X64L 1HNXQ 4JV5Q 5C0XJ 5C0XI 1YEZA 4YWKA 1Y1VH 1FJGL 4B3RL 3RZDH 2RCNA 4HIOA 2R92H 4DV6Q 3HOUH 1A0IA 2LSSA 4OWTB 1VQKA 2VUMG 4HIKA 4JI7Q 2D62A 3I55A 4P73A 1VQOA 3HOYH 1RIPA 1KHIA 3PUZA 4GN4B 1VQNA 2NVTH 5FLXc 4DR5Q 1OXUA 2H5XA 2AWNA 4TQUS 4QQBX 1GD7A 1MJEA 3PGZA 3RLFA 4MZ9A 2I5HA 1Y1WH 2UUAQ 4A3JH 4YCWA 2MNAA 1VQ9A 1JJ2A 4LF7Q 2BA1A 2I5MX 1FJGQ 3RN5A 1KAWA 2WAQG 4GLAC 5C4XH 1HR0Q 4IOAA 4JV5L 2CWAA 1D7QA 3K80C 4OO1I 4JI2L 4JCVE 5BR8L 3I4NG 4ME3A 3PF5A 1EIYB 2V1CC 4DKAC 4HIMA 4C3JH 1PH2A 3D0FA 1WCMH 1B8AA 1E3PA 4MTNA 1EIFA 4DV0Q 3CPWA 3RZOH 1GVPA 1X65A 2E8GA 3AEVA 3ULJA 4L5SA 3RNUA 1WCMG 1WI5A 3S17H 2F52A 1AE2A 2CKZB 4O0AA 4DR7L 2ID0A 3M4PA 1HJPA 3NENA 1OXXK 2BA0A 3A5ZB 1EWIA 3K0XA 2ZTEA 4X64Q 1WJJA 4A3MG 1I94L 4IFDG 4K0KQ 1PH8A 4BBSG 1YIJA 1L0WA 1SR3A 2Z6KA 4DR1L 2JQOA 3K8AA 5M3MH 5IP7G 4YHHQ 1OXTA 1XJVA 4LFAL 2ZM6Q 3PF4A 1VQFA 1Q1EA 4B3SQ 2K5HA
chains in the Genus database with same CATH superfamily
4DK0A 3GTLH 2JN4A 1S5CD 3I91A 3DWQA 2O5IC 2R92G 3UEYA 2X3TA 1HUNA 1I50H 1AFPA 3S2DH 5CV5A 2WV6D 1MKHA 1W6KA 4G4KA 1SGRI 1XMQL 1Q82C 2L7XA 1F9SA 1TWGB 1YNJC 1EEID 1UEAB 3KK7A 2OQ0A 4OHJA 3OMGA 4DV3L 1LLRD 2NWGA 1KNAA 1UE1A 5ELEA 4XXEA 4UY8C 3H3VC 3CF5A 1Y1BA 1TVXA 1DOLA 2GA4B 2WKDA 4O1OA 4A3GH 1JC7A 1YJNA 4LF8L 2KEDA 1WTHA 1EYAA 1XMOQ 3TZDA 1LT3D 1EYGA 5IT9L 4RHRA 4LNQA 4DK6C 1EFWA 2F3VA 3DEOA 2PYKA 4OAUC 1IY6A 1WYDA 4OIJA 1EU4A 3BZKA 2R92B 3MEKA 1TWCH 3D00A 2A6HD 3A56A 5CV7A 3K59A 4E6IA 2BE5D 1N13A 1B9NA 3PO2B 4A3BG 4BBRH 1I4QA 1IBKL 1E2WA 2DGYA 4R4OA 1OTCA 4K5WA 2XWBB 5E4WC 5E4XA 4DU9A 1BQQT 4A3CG 2GKTI 4AMLA 5KIXA 2V4DA 3PIOA 2YTVA 2B63H 1SE8A 2OTJA 1CGII 2R7DA 2YTYA 4QCLA 2B2WA 1DJRD 1TWAH 1NTGA 1C7YA 4UXHA 3G4SA 1TS3A 4HMIA 4QJFA 2KCMA 2MFIA 2I46A 3L0OA 5DM63 1LABA 5T1IA 1JOOA 4Q5VA 1ASZA 2Q2UA 3BYTB 4GI3C 4B3MQ 4A24A 1EYCA 1NMGA 4IUTA 1K8OA 4MTKA 3OIPA 2VW9A 4JYAQ 3MXPA 5EX3A 3STBD 1K3BC 3I4LA 4YCVA 2E5LQ 3HOVG 3J81i 3E0JA 3W2DA 3PUXA 3CD6A 2Q8TA 2F0KA 2E2IH 2Y0MA 4XQNA 1GHKA 2LS01 3S17B 2A2DA 4AYBB 5IE8A 3RUZA 1SRUA 4G7ZC 1YI2A 3K5OA 2JA8H 3NXWA 1ULNA 2EZVA 2BL7A 3T13A 4TKOB 4YY3Q 5ELBA 3FKIB 1D5MC 5DLQE 1VQ7A 4JW0A 2F6MB 1I3QB 2CQOA 4DNIA 3U58A 4A3LH 1LTID 3D3RA 2PPBC 4RH6A 2HDMA 4RMFA 4YZDA 3J7ZC 3T4AC 4X65Q 1JR0D 1BBUA 4FXKC 5E3PA 1V43A 1SROA 5LHY1 1PTOC 2R6GA 5CC4A 1TWHB 3EVQA 2HCIA 5CCLA 1ENFA 1EY8A 4L9MA 5C4JH 3S1MB 2E76C 4ID6A 1B7YB 3M4OH 5M3FH 5IYBG 4IJHA 1QILA 3K6OA 2NVQB 5KYIA 5IYCH 4A3CH 3Q6SA 5EPLA 4CBVA 4DV7Q 3JAME 3FC3A 2VXWA 1F2MA 4LFAQ 3TZUA 4A3IH 2LEOA 4X62Q 4NPSA 2K19A 1AN1I 3VDPA 1ZXTA 1PH3A 2B2VA 2VS1A 1NAPA 5JJLA 1PJUA 2K03A 4NV2A 4A3FG 1PFBA 1V1HA 1Y8PB 1KTKA 2RHQB 2LXJA 1U4MA 1KQSA 2BH8A 2K5VA 1CHOI 4X3SA 4G76A 4XT3B 2DJFC 3ULPA 1SJ8A 4A75A 1L0YB 1SGNI 2KUMA 4GLVB 3PMFA 1TURA 1L1OA 3I4OA 1A3UA 2OVOA 3NPPA 2O5JC 2IWHA 3TREA 1BBXC 2YU9B 1DYQA 4DAMA 2RLDA 2JEBI 4JI6Q 4DV5Q 1RODA 4FXGC 4ZLTF 5EKIA 5IIFA 3GTJB 1TY2A 5J39A 3GO5A 1RTNA 1EIGA 4WP4A 4H02A 2L55A 2PZTA 3DHQA 4QF4A 4C3HG 1YU6C 1UAPA 1O78A 4LF9Q 2B8GA 2OU2A 5C4XB 1KBEA 1SXTA 4C3IG 2ZJRA 3IL8A 1EQVA 2AKWB 5M5WB 1KIXA 4ZKBB 3PDNA 3TJQA 2I5LX 5I2YA 3I56A 2ZXPA 4A3DG 3MWYW 3T51B 3A74A 2EY2A 3CRKC 5IGCA 3J81c 4JPBW 4A3FH 1LTLA 4Q0FA 3S16B 3BS1A 1X3EA 2K28A 1IBLL 2G9DA 2QSBA 1S4ZA 5CBEE 2XRSD 3CXCA 2JYYA 5IGFA 5CCMA 1CZGA 3KP9A 2XTRA 1QWYA 4F8MA 1CT2I 2ARPF 2VUMB 1JE4A 1T5EA 4C56C 4AQYQ 1OYVI 1X4SA 4A3KG 1E22A 2R7FA 3ND8A 4DV0L 4DGZA 2KMRA 1STAA 1MHWC 4B3ML 4AS3A 2OWOA 1U5KA 4LFBL 4KN4C 1J8IA 1CUKA 3QOLA 2VQEQ 4K2LA 5M3MB 4UP8A 3BU2A 5EGTA 4C3IB 3A8KE 1HHVA 2D0OA 4IN3A 4JBWA 4FP5D 4K14A 4QGUA 4WJ4A 2A20A 4LAAA 1SYEA 3R8BA 3I4NB 2BDOA 1B53A 3I72A 3CCLA 5F2DA 1MIUA 1Z9FA 4A3DH 4H44C 2PQAA 2NVQH 1UUCA 2LY7A 1Y1CA 2ZRRA 5IYCG 2ZT9C 1KLGD 2JXMB 1O7IA 4DV4L 1YHBA 2X52A 1SMYD 4GOPB 4OO1H 3KF6A 2E2JB 2ZXRA 2CWPA 3BVMA 3H0GH 1G91A 2PQ8A 1TBQR 2RDHA 3CKIB 4DV5L 1KLUD 2F0GA 1EY9A 1Y14B 1OXVA 2NBFA 3JAML 3CPFA 1NR4A 2NVYH 2YYZA 3I90A 3D4DA 5KNDA 3OW7A 3LJ2A 1N36L 1UNSA 2B0UC 5GADC 1FNWA 5JVG3 1HNWL 4ZUIA 1Z6HA 4IUUA 2EQSA 2LUYA 1F9PA 5M3MG 3H6MA 5COYA 1FYBA 5LMNQ 3HGBA 3C46A 4JI1Q 2H4OA 1XBTA 1LTGD 4DAYA 1K7VA 2RA4A 2QDBA 1N32L 2ASBA 1NJIC 4OWXB 4Y52H 1E1OA 4XT1B 1TWHH 1BCPD 1TS2A 2LMCB 4RFBA 4GKJL 1PCEA 1B3QA 2L1LB 4A3JB 5IYDH 2J87A 1XX8A 1TBOA 1LT6D 4QIWB 1EYDA 1E0BA 3AB9A 3GV6A 4BS9A 2JA8B 1CQFA 1C9OA 4WFN3 2HIXA 1STGA 4DF7A 2SGEI 1B70B 5FLMH 2VB2X 3FRPB 3KDFA 4LW1A 1ET6A 2CCZA 5AFWA 3LWEA 4J1MA 1RDPD 2ORVA 4TVAB 1AE3A 1RFHA 1RF2D 1VQ6A 4R1JA 2HQEA 4CJ2C 4TRDA 5E3FA 2OCEA 2X6LA 4R4CA 2RSOA 1TR5A 4NXNQ 1O80A 1N33Q 1K7UA 4P75A 2OQKA 3VYRA 5D14A 1KABA 1XNQL 4IUQA 3NEMA 2LB7A 3GQBA 4KMUC 3U4ZA 1SYBA 3I4MH 2XN9C 1XPOA 5HQ8A 1HTPA 5ISRA 3JAMi 2DUDA 5EJWA 2NB0A 2JA8G 1HJAI 5AJ3Q 3W1GA 3FPPA 1B9MA 2BE5C 2E73A 3MEFA 4B9XA 4R9WA 1HUMA 4FF3A 1AZQA 3TP6A 2YV5A 5CV6A 2P6AC 4AYBE 3VA5A 3I9V1 4DXFA 4AS2A 1GUTA 2ES2A 1XXGA 3L2PA 2QKIC 2QGQA 1SGDI 3IFTA 3G6JB 4OONA 1N34Q 3GOXA 1MJ9A 1P16A 3SE0A 4IO9A 1F9QA 1Z7TA 4X64L 1H9SA 2E5RA 1S5ED 2R92H 4OGQC 1D5ZC 4CHTB 2EY6A 3I55A 3HOYH 1VQNA 5CV4A 1I4GA 2AWNA 4QQBX 4MZ9A 4UDUC 1EZ8A 4OAVB 5A35A 1AZPA 1PRTD 3A7AB 1A3TA 1JJ2A 4GZYC 1HR0Q 1KAWA 2WAQG 3KF8A 5C4XH 4IOAA 3K80C 4OO1I 3J7AF 4ME3A 4E1RA 5E3QA 1PH2A 4HIMA 3GTGB 2A74C 3D0FA 5FOBB 3BVZA 2O4XA 1TU2B 3CPWA 3QTLD 1GVPA 1JCKB 3AEVA 3ULJA 4L5SA 3O13A 3SK5A 1BF4A 3M4PA 5EQ0A 1HJPA 1ILPA 1OXXK 3A5ZB 4X64Q 1EWIA 3NTHA 1EZ6A 2ZTEA 2M5XA 4K0KQ 3K7AB 1WVLA 4DR1L 2JYOA 3OHXC 5M3MH 4LFAL 2FJ2A 2JB3A 4ZCKA 2SGFI 2ZM6Q 3E5SA 3C2PA 3CCVA 1Q8KA 4KY7A 4XDXA 2CWGA 4GNXB 2DB6A 3CC4A 4RGNA 1K7TA 4IQZA 1F9RA 2WAQB 3GD7A 4YIJA 4LF4Q 3PO2G 1OMUA 1V1IA 4KKUA 2NVXB 2MO1A 4X65L 1Q46A 4CDDC 2KA7A 1QB5D 2F0MA 2PMZE 3E3XA 1AN8A 1S3OA 3T1YQ 2VZAA 5TSSA 2J7ZA 3B6YA 3PQIA 2K50A 1M1KC 1VQIA 2JE6I 1CKOA 3CU7A 5C4HA 1T9HA 2SEBD 4A76A 1VQLA 4LF9L 1MJBA 5IGDA 4NXML 3F8TA 4KY5A 2Z6BA 4ALPA 4OO1G 1C48A 1UE5A 1CSQA 3GTKB 3TOAA 1X3FA 4F7XA 2AQ2B 3VDUA 2KENA 2B2WC 3X3NA 1BDOA 1SSOA 2NYZD 5IGEA 2PW5A 4DR6Q 3SEBA 4NXMQ 1HH2P 3MVVA 1S5DD 5IT9E 3CC2A 1WTQA 4V0BA 1Q7YC 2F0HA 3MFYA 3HOXG 3DA4A 5HGIA 1SLJA 2B2UA 2Z1CA 4IPDA 2EYMA 2D0PA 3GTJH 1YNJD 3L3OC 1SGPI 4EQOA 4BY7H 3UGDA 5JVH3 4RKLA 3WDNA 1PTOB 5KRUA 4RCNA 2YTXA 1HTLD 5GQOA 5I9OA 4C2MH 4JI1L 5C0XH 1XWEA 3CAMA 3HOXH 3PSIA 4A3EH 2DKVA 2KHIA 2LFNA 2XTIA 1VQMA 4NKLA 2N3SA 3FMCA 5J3BA 2Z8LA 2CW0D 3S9WA 4QMGA 1M8AA 5IP9H 1BMOA 2Z0SA 2MP1A 3DWPA 5ELNA 4DNRB 4R8NA 2QDLA 2FFKB 4FF2A 4PZ8A 1PRTB 4P74A 1A62A 1TT2A 2BOSA 2OTLA 3NWSA 1STNA 3TMEA 2UXBL 3ULLA 5CR3A 2Z6KC 4PG3A 1BNZA 3D6WA 1WTWA 4DR4Q 1FNVA 4RGOS 4DR5L 1CSOI 1PPFI 3NP8A 4PMWA 2EJGC 3EA6A 5GAGC 1XTCD 2F0NA 1JE5A 3HKZG 3MTSA 2NVTB 1G8ZD 1B1ZA 2A68C 4DK3C 5M5YB 1H0ZA 2L4NA 4RA8A 2V1CA 4GNXA 4P2CB 3G71A 5C44G 1BCPC 2L11A 3E59A 3K0YA 3IAM1 4EQNA 3S24A 3FNBA 1SYDA 1X56A 5H1SE 3S14B 2B39A 4JI4Q 4RHSA 2FMMA 1EIHA 4HTHA 2JA6H 1SYGA 2RIOA 2L8EA 3R93A 1HRJA 2WGCA 4HR7B 1M4VA 4Z7HA 2WB1G 5M5WH 4NW2A 4U68A 4POFA 5CBAE 4H0LC 1TY0A 1Y8FA 2K5QA 1DXMA 1TXYA 2J0TD 3SDJA 4A3JG 4C3HB 2ATWA 1TBRR 1IHZA 1VMPA 2AMCB 2IT1A 3GV3A 3H09A 1WD0A 1BKBA 1X3GA 1KDBA 3S15B 4KV6A 3PO3B 4LF5L 2K7VA 5JHWC 1PXUA 2NU3I 2FEFA 4A3DB 2QQEA 3FEWX 1QUQA 1SE2A 5IYDG 1GHJA 3J7YW 3EFXD 3Q8DA 1Z47A 2K5NA 2EYHA 1EUJA 4B9WA 1VMCA 1VQJA 4LUOA 3NWTA 1K8AC 1DZ1A 3GTPH 1MI2A 1TDPA 2RVLA 1U4LA 3VR6A 1EY0A 3K81C 1G2SA 4QL5A 1NR2A 3UDXA 3IFDA 3ZJYC 4JV5L 4C3IH 5FUVA 3PV0A 2VB3X 1XMOL 3G7LA 1LR7A 3DWAA 2KCCA 1TWFH 1MSHA 3RU0A 2PZWA 1X32A 4N9PA 1QNKA 4BA2I 1XNRQ 1ESRA 1Y1WB 3MFGA 3VYUA 1L1OC 4WRDA 5GROA 2N8NA 2K01A 4FO2A 4R4QA 3RD4A 3T56B 1K83H 1A6XA 1J5EQ 2GKRI 2X6GA 3I7FA 1P9ZA 2QEJC 1B44D 1Z2IA 3UE0A 1EFID 5I2XA 2B63G 4DR3L 2BL8A 4Y7NB 2KCTA 3HG9A 4E1PA 1SNOA 1QJOA 2WB1E 1GO3E 1SJED 1I4PA 3H3VI 3J7A5 5HGQA 4BBRG 3CRLC 2VQFQ 5FLXE 1SFOB 2QILA 2CJSC 3WOFA 1R79A 1QVGA 2R7ZH 1HR0W 2WKCA 3HRZC 5LMUQ 4A3MH 2A73B 2A68D 2ZTCA 1V1QA 4JI2Q 3QIAA 3UI2A 3J80c 4Z9CB 1TKWB 2A6HC 2OD1A 3HP3A 4JC0A 5EKKA 4BY1G 3AFQA 1HFGA 1HFNA 2ZXOA 2IL8A 1D1KA 1VQHA 3T1HQ 3F2UA 1STEA 4L8JA 1LTRD 3TOBA 3NUCA 1NUBA 2IHFA 2QZGA 2DNEA 5IP7H 4OX9Q 2L15A 5FK9C 2K1BA 4UXIA 1T5XD 3SR1A 2E75C 2J9RA 3HS0C 1V1OA 1PHJA 3TBIB 1JOKA 2EE1A 4K5VA 2EYPA 2NTSA 3A0JA 4A3EB 3NELA 2JK8A 2D5DA 2EVBA 1MBYA 4ULLA 3H0GG 3KYHC 4MNOA 1D5XC 3S1MH 1B50A 4BA1I 2PW7A 4PZ7A 4JYAL 1N9WA 1SFOH 5CYUA 1WTXA 1EY7A 3UDFA 5IWAL 1IW7C 3N52A 2GKVA 2ZJPA 2KMPA 4JK1C 2IJ0A 4DAYB 1QG7A 4BY1B 2GVAA 4XIGS 5K36H 1JJGA 4FYDA 3TDQA 4OIKA 1CTMA 4I65A 2ICEC 1K73C 3IAYA 2VNUD 1IKMA 2B3GA 3E9IA 4MHEA 4B3TL 1FNUA 1UVFA 2XWJB 3CP0A 5C0XG 1I94Q 4UAIA 5C3EH 3E9HA 4GOPA 2B29A 2QQ0A 4C1NK 1ULMA 3X3MA 1VQBA 1K0RA 1H9KA 3W3AA 1KRTA 4DFAA 1LYLA 3CCJA 2IW3A 4JBJA 4BXXG 3V05A 4DA2A 3FVQA 1LT4D 2CH4A 2ETDA 3I4MG 2ORWA 1OXSC 2G9HD 4HFVA 3SGIA 4LWCA 2K75A 2EIFA 1CA5A 1CKNB 1Q8IA 3Q24A 4IJLA 2F0EA 2SNMA 2ZTDA 4HEA1 1X3QA 3GTPB 2QGMA 1DOKA 3I2ZA 3MXGA 1EY4A 2Q2IA 1BOSA 1Q12A 2K33A 1LO5D 1TWAB 3K5MA 4X62L 2B2VC 1SBBB 3M7GA 1NXUA 4OX9L 2GVBA 3A7LA 1A15A 3KF8B 3K7AH 2ALYB 2JB2A 4C3HH 1QE6A 1D1IA 4H13C 1AH9A 5C4ZA 1R9TB 4IURA 5FLMG 2K5WA 4NXNL 3DM3A 4ZAIA 1XNRL 3BZCA 2ZM6L 5FO7B 4C3JG 2FU2A 4JOIA 2AUKA 3OXLA 3I4MB 3H3VH 1O7YA 3TQYA 1JWUD 2F3CI 4ZK9B 2UU9Q 2ZJQA 3NBIA 1BCPB 1EQRA 1EEFD 4RAUC 4LF4L 1I5FA 4ILWA 2EPBA 1IBMQ 5IGGA 3DA3A 2UXCL 3PIP3 1PRTF 4B3TQ 1YHAA 1MT1A 2A1AA 2OF1A 2ERWA 4HMJA 2NU0I 1ICWA 1ML0D 2HHHQ 2VY3A 5EPJA 5C0XI 3R5CA 4ZRZA 3RZDH 4N9TA 1EQTA 3HOUH 1HEVA 1C4QA 2LSSA 1KBFA 4JI7Q 3TP7A 1K83B 2JB1A 1RIPA 3PUZA 2OZUA 1JWSD 2JXDA 2NVTH 4DR5Q 1OXUA 2EYLA 1MJEA 4ZKCB 4C1NI 4A3JH 5C3XA 2E2IB 4CKEA 1VDDA 2F03A 4LF7Q 4UHVA 4PL4A 3RN5A 1XX6A 1LV9A 2CWAA 4DNCA 4JI2L 2WVJA 2B2TA 2KCNA 4IFDH 1EIYB 2Z4HA 4DKAC 4C3JH 3QR8A 1WCMH 4DV0Q 2A5HA 1X65A 1DCZA 1RJTA 3RNUA 1WI5A 2SNSA 5LNK1 4A93B 2CKZB 4O0AA 3NK9A 3HOUB 5M5XB 1PFNA 4EGVA 1PH8A 1SR3A 1WTRA 2JQOA 2IX3A 4YHHQ 1OXTA 1XJVA 2M2LA 5JPNC 1DD2A 2F0VA 3UGIA 3DUZA 4B3SQ 2ROWA 4DR2Q 1GKHA 1JOQA 1DM0B 1PZKD 4DUZQ 1UHAA 4A3FB 1TQOA 2JSOA 2PI2A 1HNZL 3PO2H 4DV1L 4K8IA 3HOXB 1IY5A 1U4RA 2UUBL 1I6HB 5FUWA 2MHVA 4YCUA 4HJAA 4A93H 4GXTA 1PLFA 1QVCA 2XIWA 2R93G 3HOWG 3N6RA 2HT1A 2AHOB 3U50C 1QUQB 4FDBA 4APVA 3W1BA 1WCMB 3DXJC 4YZCA 4MPIA 1EY6A 3WOEA 5EBDA 2N17A 1BR9A 1BBWA 2A6EC 1YO7A 1ESFA 2B2UC 2N55A 3KF6B 1NBWA 2KQ3A 2R61A 3HH2C 5KNBA 3E2IA 3WWVA 1TWCB 4WJ3M 3ER0A 5FUXA 1IKLA 1AEXA 2EXDA 3ONAB 4JI0Q 3G6EA 1G6ZA 3VA7A 3VYTA 4IPHA 3OYYA 4OL7A 4FXDA 4JI3Q 2AQ1B 2OXPA 4GN5A 4KI0A 1TOTA 1W2BA 4OXPA 1PYSB 4BY1H 1WTVA 1TGSI 4DR6L 4RKBA 2YUUA 3IAS1 2HDLA 4JI7L 1K9MC 4DV7L 2R93B 2NU1I 2HIVA 2K32A 3ERSX 4NV5A 2JA9A 3JAMc 4UP9A 4A3GG 3I4NH 3VYSA 3UFFA 3KLWA 4KD3A 3PO3H 3KJPA 2CAZB 5GAHC 2SGDI 4PMBA 4ZUJA 1G2TA 5C44B 1VQCA 2IHEA 3CMEA 2MPMA 4A3KB 2Y0SE 2QQDA 1Z7KB 2EYJA 3S1RB 2I0QA 5DNFA 1KDCA 1QZGA 2E2JH 2R7ZG 2UUAL 3K5LA 3LJ1A 3HZXA 4L5RC 5K5PA 3LX0A 1M90C 3S1QH 1O7LA 4DV2L 1JJCB 3I70A 1NCVA 4ME5A 1RKNA 3D4WA 1UUPA 2XVSA 2K5DA 5J8CA 1GUOA 2RHSB 4FKDA 2JAEA 1EQQA 4DR3Q 2GIVA 4DV6L 2SOBA 3SGQI 2KKMA 2XNAC 1X3PA 1LACA 1YVCA 4DUYL 1VDZA 4CDFC 3TRZA 3C1EA 5FUYA 4YZ9A 3CQZB 4RG1A 1G51A 3RMHA 3PIO3 1PH6A 1Q90A 5JJKA 5LL6S 2UZ3A 4LK1C 1D2BA 3OWEB 4DV4Q 3TP5A 2WP8J 3I3CA 4O2DA 1GJXA 5C4JB 3FSYA 3S1NB 1F2ZA 3KJOA 1HZCA 2UUCL 5BR8Q 1WKXA 1ASYA 3OMCA 2C35B 1PH5A 2B2YC 1C0AA 1LTAD 2E2HH 5I6WA 1XTDA 1II3A 3ICEA 1H9JA 3B4VC 3OVOA 2P22B 2M00A 5DAEA 4H7BA 4A3MB 5C5LA 1VCIA 1RCVD 2RF4A 4F87A 2A6ED 2E5LL 3MHBA 1EWHA 3NHHA 1GUNA 1VQEA 2WFWA 4R4IA 1W4RA 4OELB 1TUSA 1AW7A 2K14A 2E2HB 1YBYA 3HFZB 5M5XH 2RADA 4FVMA 1TS5A 2NU4I 4CKBA 3K57A 1MJAA 2UVOA 3DEPA 5LL6X 2DJGC 4HCSA 1N33L 2YFBA 3J81E 4DV1Q 1R4PB 3TO6A 5M3FG 3T53B 4IFDJ 4YHHL 3R3OA 3OTOL 4PL3A 2EOTA 2V53A 3GP7A 1CQVA 3RN2A 1PH9A 5A2QL 2RCFA 4BBRB 1STHA 4FF1A 1NE3A 2CHBD 4JBMA 2N52A 1GOZA 5LMNW 1HR0L 1JWMD 4DWLA 2TMPA 1ENAA 2JA6G 3SGBI 1PVOA 3M4YA 2HHHL 1HZBA 3S2HH 4NMZA 1OVOA 5M5YH 1NSNS 4GKJQ 3M85A 2PZUA 2UXCQ 4JG2A 3F4MA 1XA6A 2DIPA 5JEAH 5ELOA 2N88A 3P1HA 2UXDQ 4UP7A 4A3IB 4GOPC 1CFMA 1LTSD 2UUCQ 3VR3A 3HOYB 3S14H 3VE5A 2FUG1 3GTMB 4LF8Q 4LF7L 1IYUA 2UXBQ 1SNPA 4U6RA 1X6OA 1CKNA 3D6CA 4A3BB 2K04A 4IUPA 4A3EG 4GS3A 4X66Q 2EDGA 3V96A 1TWGH 2CQAA 1VF5C 3H0GB 4JI5L 3R5BA 1S20A 4HJ8A 2EJFC 4QUFA 4V190 2ENZA 4AIMA 3F2DA 2VQFL 1ONLA 3SEKC 1HZ9A 2HQLA 3GTMH 2AUJD 2JA6B 3E0EA 1W6JA 1MGSA 2NZ1D 1ULKA 4G75A 2L5TA 1J6QA 2IY5B 2ODDA 3C3LA 1CT4I 4O1NA 1GXDC 4KKTA 2W0TA 1VF7A 3MEHA 5JJZA 4L63B 3HOYG 2A69D 2UU9L 4B08A 1SGEI 2K6AA 3AJFA 1EOVA 3SHLA 3CXLA 4IPGA 1CHQD 1R9TH 1I4XA 4JVZA 2GN5A 3A5UA 1SNMA 1IXRA 3HOVB 1MD2D 3TSSA 2FMCA 1YITA 4Q9VA 4BY7G 3I73A 4KHPQ 2A2CA 1JORA 3PUWA 2A8VA 5C44H 1IYVA 1EL0A 1JB7A 1QOHA 2CW0C 1N36Q 2F0DA 2NZOA 3M3YH 1UVGA 1BCPF 1F2YA 5IP9G 3DLLA 4JI8L 1IL2A 3HOUG 5E3RA 3VDYA 1SDFA 4EVOA 2A69C 5JOBA 1CSPA 3FHWA 2Q2HA 2QEXA 1STYA 3D8GA 1KMAA 1HQMC 3CHBD 3OL0A 1V1PA 2F0TA 5AJ3L 5K36G 3K58A 2LXKA 1R4QB 4KHZA 4LF6L 3RLNA 1PA6A 3BDLA 1CA6A 3ITPA 1K8MA 1KNEA 3NQIA 1U0LA 1GUSA 1QZHA 1D6EC 1SE3A 2NZHA 1Y8NB 1HNZQ 3S15H 4R8IA 3FBVA 1XNQQ 2XRCA 5E1FA 1HPCA 1HA5A 2FHTA 4B3RQ 2F0UA 1CI3M 3UGLA 2KCXA 1SGQI 4BY7B 2D2CC 1YZ6A 4X3KA 2F0LA 3NQTA 2L12A 1K3RA 4GLXA 3M9BA 1ZEQX 2MJ8A 1IL8A 4JI6L 3TEHB 2JEAI 1A63A 3BDOA 1FAQA 5T1GA 1LUZA 2LKVA 1KDAA 4BWGB 1FD7D 5ELFA 2TSSA 5C3EG 1X55A 4DR2L 3AMUA 3AU7A 3KBGA 4DUYQ 2F4IA 2YQPA 4KN7C 2RDGA 3TS0A 4YWMA 4LMQD 3EN2A 2O2LD 3CW2C 5CGKA 2NN6G 2JA7H 5KGUA 2E74C 1Q9BA 4XYQA 1N8RC 1K8GA 4AH6A 4HJ5A 1N32Q 4MIUA 4NDXA 1AP0A 4IUVA 4KJOA 5ELDA 4RWSC 1HDLA 4LUZA 1DS3I 4LFCQ 2F66B 1SEBD 2YU9H 3J80L 2F3IA 1BVSA 3QOJA 1CHPD 3T1HL 3S2DB 5C4XG 1CGJI 1PZJD 2ENBA 4K6LA 2ELIA 2JA5G 4I7AA 3GTLB 1PYWD 1B4OA 2QQCA 1ET9A 2XGTA 4JI3L 3PIPA 1RTOA 3FVVA 5LMNL 4GKKL 3V2TA 4A93G 2OEOA 5JEAJ 4K8JA 3KOJA 4DXGA 7WGAA 3EIVA 3NTIA 4JV5Q 3RR5A 2N1AB 3Q22A 1HNXQ 3Q23A 1YEZA 1Y1VH 1FJGL 2RCNA 4HIOA 2CWHA 1VQKA 2VUMG 4M1UB 4HIKA 3S2HB 3QO2A 3KBXA 4I7ZC 4P73A 1VQOA 3J7AV 1WGCA 1KHIA 4GN4B 5BN4A 4X3UA 3SXHA 3PGZA 3OOCA 4KJNA 4PL5A 1O7ZA 2MNAA 2BA1A 1LTBD 1FARA 3SK4A 1D7QA 2F3WA 2V6EA 2VRWB 1CT1D 1K28A 1PTRA 3B55A 2V1CC 3QWNA 1YTPA 3HOWB 1FY7A 1B8AA 4MTNA 4X3TA 1HXYD 1TIHA 4J6HA 3L9AX 3QJYA 1WCMG 2DN8A 3S17H 2F52A 3HOZB 1AE2A 3VA9A 4DR7L 4KHVA 2ID0A 1DOMA 1ENCA 2BA0A 3K0XA 2H1EA 4A3MG 1PFMA 4DNTB 4CJ1B 5A2QE 5JAVA 1L0WA 3QWPA 3EQLC 3SDZA 2WB1B 2BCOA 2FINB 1QCBD 5G3LF 1H9RA 4RGMA 3PF4A 2JA1A 1Q1EA 3KLSA 2F0OA 4I1TA 5EAYA 4HIDA 5DAUA 3NSWA 1FR3A 2CH4W 1UEBA 4KK7A 5BN3A 2I07B 2VUMH 2CFMA 1XYIA 3NE5B 1BXTA 1E7ZA 3P75A 1JQYD 1W3SA 5M3FB 5FJ8H 4KD4A 2F0FA 3ERQA 1PH1A 4GKKQ 1WOCA 5IGBA 3CCQA 1CM9A 3AFPA 1G6PA 3TO7A 1JICA 5I9PA 3CCMA 3MAQA 4B3SL 5J22A 1HNWQ 1IYJB 1L1OB 3HOZG 3MXUA 4HSVA 5G3LD 4A3GB 5EX0A 4NP5A 5I4DA 3BDCA 2EXZA 5IOCA 4P71A 3KUPA 1Y69U 3SVMA 1SE4A 2RIJA 1A2TA 3SK6A 1YJWA 1PH7A 3OXFA 1Q81C 1VQ5A 3BJIA 2Z4IA 3PUYA 4QUCA 2Q8RE 2WAQE 4OEMB 1OO9B 4DN4M 5E7NA 5JPMC 3L0IA 4LFCL 5HURA 2K05A 1HQRD 1I3QH 1UE7A 3L7ZC 3KDFB 2XTQA 3CQZH 2XMXA 3RZDB 3AQQA 1KC8C 1VQ4A 3LWUA 3A54A 2NU2I 3QB3A 2NVYB 2NN6H 2JA7G 1NY4A 3OTOQ 3UITA 3P23A 3BG3A 3QG1A 1X9NA 4G57A 2KECA 5C6AA 2Q8IB 2PO4A 1CZWA 1ICFB 2WACA 4X66L 2IX1A 4Z7GA 4OVOA 3F2BA 2VQEL 5EPKA 1TBNA 3FDTA 4DPGA 3IRBA 5CORA 1M8CA 3F2CA 4IOCA 3JSBA 4A3KH 2RKSA 4A3LG 4AQYL 3LNNA 4LUVA 2NN6I 3RLOA 3HEJA 5J1ZA 1G291 2D9UA 3OWFA 1IBKQ 3IKJA 4OWWB 3J81j 4LF6Q 5FO8B 1P8LA 4QY7A 4U673 2EY5A 1ILQA 1J5EL 1PZID 2N49A 5KEEA 1PTQA 3Q0AA 1PH4A 1FGBD 4HCEA 4RCOA 1RL2A 4SGBI 3R5AA 3HOVH 3ZYYX 1S72A 5C5MA 1D8LA 1LTTD 3GTQH 1PTOH 2F1MA 2EYFA 2F0IA 4BXXH 2HUGA 4KHPL 2MUYA 2J4XA 2JBWA 2PQAB 3I8ZA 3OXGA 4DR7Q 4YY3L 4P72A 3UE1A 2B8FA 1X54A 2FXQA 1B2TA 4CKCA 4R4TA 3KLRA 4KTAA 1S5FD 3CCSA 3DO9A 2KHSA 3J80E 1SNCA 3MXNA 1LR9A 4PMCA 2PNRC 5HY6A 3DMUA 3FKIH 4IZ8A 4LFBQ 2PNHA 4RGTA 4G7HC 1PYBA 2C5CA 4A4IA 2K9HA 2UUBQ 2CVRA 3TO9A 4F88A 3CC7A 5FKAC 1KL9A 3VR5A 1J9OA 3GTQB 2JZMA 1F2LA 2F0SA 4A3BH 4DR1Q 5L37A 1SMXA 3URYA 1I6HH 4K0KL 2HCCA 5IWAQ 4CDEC 3J80i 2F0WA 2MO0A 1H9SB 2XRQD 4DK1A 2GSCA 5CMDA 5GAEC 3NBHB 3C1FA 4IUNA 1K0SA 1OMTA 2B2YA 2AWOA 2RSNA 1V8QA 4KLKA 1IZ6A 2RQXA 1X74A 4A3IG 1NMFA 1SAPA 4YWLA 1CT0I 1PRTC 3FKIG 2DNCA 4IALA 5DEHA 2Z9HA 4XQJA 2N71A 4IFDI 5JJIA 1B3AA 1WFQA 1SN8A 4CGYB 2QCPX 3MXNB 3S1RH 1WTOA 4XTCS 3TS2A 4FNFA 1SMYC 2K4KA 4JI8Q 3M7NA 1PDQA 2AQ3B 3P20A 5IYBH 2A19A 2KOLA 4HJ9A 1FGUA 3FP9A 1MJCA 1TIID 1KXLA 2RDFA 2E2DC 2KHJA 3OW2A 4DR4L 2BH2A 3CCRA 2WCYA 4ABNA 2R93H 4Y7NH 5KNCA 1BUSA 2YFAA 1WGTA 3KFUA 2OT2A 4HN7A 4C3JB 4B6DA 2SDFA 3UDGA 4LJZC 3D31A 3H91A 2JA5H 1KD1C 3LJ0A 2PQEA 1JB3A 4CJ0B 1EY5A 3SK8A 2F0QA 4J15A 1PTOF 1YJ9A 1L0XB 3BYYB 4X6AH 2BUSA 2CWFA 1HCZA 4BBSH 3OSOA 4XYOA 1JT8A 2EJMA 1TWFB 3S16H 3M4OB 1XPRA 1ZYRD 3EBEA 3R2TA 1XPUA 5D3DA 4HEDA 1SJHD 1QVFA 4G7OC 3K7UC 1H9MA 3PCOB 1A3VA 2JW6A 2L1BA 2PCFB 1UWVA 3AYHB 4GN3B 3VR4A 3GTOH 1YNNC 4DAPA 3H94A 4MN3A 3T16A 1FYCA 2G5DA 1LT5D 3BZDB 1IBLQ 5J8FA 2KBNA 1H95A 3STBC 3P7JA 2MGSA 3MZ5A 1SGYI 1I6VC 1NNXA 3MA2B 5DM73 4L5QA 2WIIB 4EX5A 5CV8A 4L6TB 1E24A 1E1TA 1PTOD 4IPCA 2L0CA 5KYLA 2JP1A 3M4QA 3R2IA 1Y8OB 5C3WA 1BUVT 1IW4A 4HAEA 1WD1A 3GTKH 2ENNA 1JQOA 4PZ6A 1GUWA 1Q86C 1HPTA 3H15A 3R5DA 5IODA 4LF5Q 4NB3A 3OIQA 3VR2A 5BN5A 3M3YB 3HOZH 2Y0SB 1CKMA 1LM0A 1SYFA 3F1ZA 4AYBG 4K5XA 3HKZB 3E6ZX 2P5ZX 4N8X1 2KVMA 2QA4A 4POGA 1HNXL 3A8IE 5FLXL 2L9HA 3U9SA 2R3ZA 5FJ8G 3GTOB 5HGTA 1F77A 3W5OA 1HZAA 2KEEA 5D65A 3CCUA 1WTPA 2EY1A 1GUGA 5C3EB 2M9VA 4JBKA 1LR8A 3GTGH 1DONA 3HOWH 1SNDA 2NUCA 4JI4L 3K5NA 2B2TC 1ZYRC 1JMCA 1I4RA 2KMQA 1A8VA 1Y1VB 4HJ7A 1YHQA 3EROA 2PMZB 1S5BD 1XMQQ 1V1PB 3UDIA 3NTKA 3JC66 1CK1A 1S40A 1VQPA 2HD3A 3FSXA 2B8TA 2Y0SG 4JI5Q 2C9OA 3T1YL 2QPOA 2PI2E 2Q2TA 3U4VA 1IW7D 2MQHA 1WTJA 4EQ5A 3NBHA 4S3SA 3S1QB 2F4VQ 1SYCA 1FL0A 1DGSA 3PO3G 3CCEA 2JA5B 4TSSA 1UE6A 2IX0A 1DS2I 2F4VL 4PV1C 1MSGA 1C8CA 2NVXH 3UOEA 3HKSA 1R0RI 4HSPA 4L5TA 4KY6A 4J8QA 1KAAA 3HKZE 5IT9c 4N8FA 2UXDL 3PUVA 1V9PA 2RC4A 2IPKD 3U9OA 3OPOA 2VL6A 5NUCA 4DAVA 2NTTA 3CMAA 1STBA 4PNYA 4QIWE 1Y1VG 5JEAG 3G48A 2K52A 2JA7B 1VQGA 3GDEA 4DV3Q 5I6YA 1FVIA 3A55A 3BJUA 5ELCA 1IBML 2ZW3A 4C2MB 4M8AA 1Y1WG 4JI0L 4DV2Q 1N34L 5LMUL 1PMRA 2N78A 4JOIC 1NUCA 2JJQA 2QF7A 5HI7A 1VQDA 5FO9B 4PQXA 5M9OA 4DUZL 1Q1BA 2B63B 2FNFX 3TN2A 5IY0A 1PFSA 1VS0A 2EYOA 1ZKOA 3J81L 4WORA 1GM5A 4UXJA 3TP8A 1PV4A 2R7ZB 1VQAA 4HGUA 3UEJA 4UPAA 1L2FA 1YNXA 1VQ8A 3S1NH 3BVGA 3LGJA 5CV9A 4ZQ3A 2SGPI 2DY7A 1YNND 1KRSA 4GNXC 2QW7A 4BBSB 3MC0B 3DM1A 5C0XJ 4YWKA 1QNUA 1RD9D 4B3RL 4DV6Q 1M8BA 1A0IA 4KKSA 1EWCA 4OWTB 1P9GA 2D62A 2DY8A 4QB4A 1A2UA 4K6DA 4O42A 5FLXc 2IP6A 4ZYSA 3RZOB 4FF4A 1HA6A 2ICIA 2GVIA 1SNQA 2H5XA 5EBCA 4TQUS 1GD7A 3RLFA 2I5HA 5EKLA 1Y1WH 3ND9A 2UUAQ 2F0JA 4YCWA 1VQ9A 1EOTA 2BDNA 1E2VA 2I5MX 1FJGQ 4GLAC 2X69A 2SGQI 4K2KA 4JCVE 1Q3LA 2KJXA 5BR8L 3I4NG 2XSCA 4ODGA 3PF5A 4WJWA 2MJFB 1E3PA 1I4HA 1EIFA 3RZOH 1U4PA 3KY9A 2E8GA 4EQPA 1CE3A 4XQQA 2WINB 4CDCC 2RBMA 3D4RA 3NENA 5D3IB 9WGAA 1I94L 1WJJA 4IFDG 2HGKA 1E2ZA 4BBSG 3QAHA 1YIJA 1I50B 2Z6KA 3K8AA 5IP7G 3EJIA 1EU3A 3A8JE 2KMOA 1U9RA 3FPUB 3KLSX 2F0PA 1BO0A 1TS4A 4O1PA 1VQFA 1RHPA 2K5HA
chains in the Genus database with same CATH topology
4DR2Q 4I1TA 5EAYA 4HIDA 1GKHA 3GTLH 3CCVA 1Q8KA 1UEBA 4DUZQ 2R92G 3UEYA 2VUMH 2CFMA 4GNXB 1I50H 2PI2A 3CC4A 1HNZL 3PO2H 2DB6A 3S2DH 3GD7A 4DV1L 1E7ZA 1MKHA 1W3SA 4LF4Q 5FJ8H 1IY5A 3PO2G 2UUBL 1OMUA 1SGRI 1XMQL 1V1IA 1Q82C 4HJAA 2MO1A 4YCUA 4A93H 4X65L 1Q46A 4GXTA 2L7XA 1QVCA 2R93G 3HOWG 2PMZE 1PH1A 4GKKQ 1WOCA 2HT1A 1S3OA 3T1YQ 3CCQA 2AHOB 2VZAA 3U50C 2OQ0A 4DV3L 3AFPA 1QUQB 1G6PA 4FDBA 4APVA 3CCMA 3W1BA 4YZCA 1UE1A 4B3SL 4UY8C 3B6YA 1IYJB 1L1OB 2K50A 3HOZG 1HNWQ 2N17A 1M1KC 1VQIA 2JE6I 1CKOA 3CF5A 4A76A 1T9HA 1VQLA 4LF9L 1BBWA 4P71A 1Y1BA 4NXML 1YO7A 4O1OA 4A3GH 3KF6B 3F8TA 1NBWA 4ALPA 1YJWA 1YJNA 1PH7A 4OO1G 3HH2C 1Q81C 3WWVA 1VQ5A 4LF8L 4WJ3M 3BJIA 3E2IA 1UE5A 3PUYA 1CSQA 2WAQE 1X3FA 3ER0A 5FUXA 1XMOQ 5E7NA 3VDUA 3L0IA 1EYGA 2EXDA 2KENA 4LFCL 4JI0Q 4DK6C 4LNQA 1EFWA 3G6EA 4OAUC 1I3QH 1UE7A 3L7ZC 3OYYA 3KDFB 4IPHA 2XTQA 1IY6A 1WYDA 4JI3Q 3CQZH 3BZKA 4GN5A 2XMXA 4DR6Q 3AQQA 4NXMQ 3MEKA 1KC8C 1HH2P 4KI0A 1W2BA 1VQ4A 1TOTA 4WJ4A 1TWCH 3D00A 4OXPA 3CC2A 2NU2I 5EX0A 1PYSB 4BY1H 1Q7YC 4DR6L 1TGSI 1N13A 2JA7G 3HOXG 1NY4A 3DA4A 3OTOQ 5HGIA 3UITA 4A3BG 1SLJA 3IAS1 3P23A 2YUUA 4BBRH 1X9NA 4JI7L 1K9MC 1IBKL 4IPDA 4DV7L 2DGYA 2D0PA 2NU1I 4R4OA 3GTJH 1OTCA 1SGPI 4BY7H 2HIVA 3ERSX 4X66L 2IX1A 4Z7GA 3UGDA 4NV5A 4OVOA 3F2BA 4A3CG 2JA9A 3JAMc 2VQEL 1TBNA 2GKTI 4DPGA 4UP9A 3IRBA 4A3GG 2YTXA 3PIOA 3I4NH 5GQOA 2YTVA 1M8CA 2B63H 1SE8A 4C2MH 3F2CA 4JI1L 4IOCA 2R7DA 2YTYA 3KLWA 2OTJA 3JSBA 3CAMA 3PSIA 3HOXH 3PO3H 3KJPA 2CAZB 1TWAH 5GAHC 4A3EH 4A3KH 4A3LG 1NTGA 4AQYL 2SGDI 2KHIA 1C7YA 4UXHA 3G4SA 4LUVA 1VQCA 2NN6I 2XTIA 2IHEA 3RLOA 4QJFA 1VQMA 2KCMA 3CMEA 2N3SA 5J3BA 2Y0SE 2QQDA 2ROWA 1Z7KB 2MFIA 3L0OA 1ASZA 1G291 2I0QA 1IBKQ 1BMOA 5IP9H 4OWWB 3J81j 2Z0SA 1QZGA 2E2JH 2Q2UA 4LF6Q 2R7ZG 4B3MQ 2UUAL 4GI3C 1P8LA 4QY7A 4A24A 3LJ1A 5ELNA 1J5EL 4L5RC 2N49A 1PTQA 2OD1A 1M90C 3S1QH 3OXGA 1NMGA 4DV2L 1JJCB 1PH4A 2VW9A 4JYAQ 1RL2A 4PZ8A 4P74A 4SGBI 1A62A 3HOVH 1S72A 2RHSB 4FKDA 1D8LA 5EX3A 3STBD 2JAEA 1EQQA 4DR3Q 2OTLA 4DV6L 2UXBL 3SGQI 4YCVA 2E5LQ 3ULLA 3HOVG 3GTQH 2KKMA 2Z6KC 4PG3A 3J81i 3PUXA 3CD6A 4BXXH 4DUYL 1YVCA 4DR4Q 2E2IH 3TRZA 4KHPL 4DR5L 5FUYA 4YZ9A 2PQAB 2A2DA 4RG1A 1G51A 4PMWA 1CSOI 4DR7Q 4YY3L 5GAGC 5IE8A 1PPFI 4P72A 1PH6A 3UE1A 3HKZG 1JE5A 1SRUA 1YI2A 5JJKA 1X54A 2FXQA 2JA8H 2UZ3A 4R4TA 4DV4Q 2WP8J 3CCSA 3DO9A 4DK3C 4YY3Q 1H0ZA 4O2DA 5DLQE 1LR9A 1VQ7A 5HY6A 2F6MB 4DNIA 2CQOA 3KJOA 3G71A 1HZCA 4GNXA 3U58A 2UUCL 5C44G 5BR8Q 3FKIH 4A3LH 4LFBQ 2PNHA 3E59A 1ASYA 4RMFA 3IAM1 4YZDA 3J7ZC 1PYBA 4X65Q 1BBUA 2C35B 1V43A 3S24A 1SROA 4A4IA 1PH5A 2UUBQ 1X56A 5H1SE 1C0AA 2K9HA 2R6GA 2E2HH 4JI4Q 1XTDA 3CC7A 3ICEA 5CCLA 3B4VC 1KL9A 3OVOA 4L9MA 2P22B 5C4JH 1CGII 2JZMA 2JA6H 5DAEA 4A3BH 2RIOA 1B7YB 4DR1Q 1VCIA 3M4OH 2L8EA 3OXFA 2RF4A 5M3FH 1SMXA 5IYBG 2E5LL 1I6HH 4K0KL 4IJHA 5IWAQ 5IYCH 5M5WH 2WB1G 4Z7HA 4A3CH 3J80i 1VQEA 2MO0A 4POFA 2WFWA 5GAEC 4R4IA 4DV7Q 3NBHB 3FC3A 1W4RA 4LFAQ 1OMTA 1TUSA 1Y8FA 2K14A 2AWOA 1TXYA 1YBYA 3HFZB 5M5XH 4A3IH 3SDJA 4A3JG 2LEOA 4KLKA 4X62Q 1IZ6A 2ATWA 1TBRR 2IT1A 2K19A 2AMCB 4NPSA 1AN1I 2NU4I 1PH3A 2VS1A 1X74A 4A3IG 1NMFA 5JJLA 1PJUA 4YWLA 4NV2A 4A3FG 1BKBA 1CT0I 1V1HA 1X3GA 3FKIG 2RHQB 2GKRI 2LXJA 1N33L 2YFBA 4DV1Q 1KQSA 2BH8A 2K5VA 4LF5L 1CHOI 5JHWC 4G76A 5M3FG 4IFDI 2N71A 1M8BA 4IFDJ 5JJIA 2NU3I 2QQEA 4YHHL 1QUQA 1WFQA 5IYDG 3ULPA 1SJ8A 1SN8A 4PL3A 3OTOL 4A75A 1SGNI 3MXNB 3Q8DA 1Z47A 2K5NA 3RN2A 3S1RH 2V53A 1PH9A 4GLVB 1EUJA 4XTCS 3TS2A 1VQJA 1NE3A 4LUOA 1TURA 1L1OA 1K8AC 3I4OA 4JBMA 2K4KA 4JI8Q 2N52A 2OVOA 3GTPH 3M7NA 5LMNW 5IYBH 1HR0L 2A19A 3TREA 4DWLA 4HJ9A 1FGUA 2JA6G 3SGBI 3FP9A 3K81C 1MJCA 4QL5A 3UDXA 4DAMA 2JEBI 4JI6Q 1KXLA 1PVOA 3ZJYC 2KHJA 1HZBA 4DV5Q 3OW2A 2HHHL 4C3IH 4DR4L 3S2HH 2BH2A 3PV0A 3CCRA 1OVOA 5M5YH 2WCYA 1XMOL 5FUVA 2R93H 1LR7A 1TWFH 4Y7NH 3RU0A 3GO5A 4GKJQ 2YFAA 1BUSA 3M85A 4H02A 4BA2I 1XNRQ 3KFUA 2UXCQ 4JG2A 4B6DA 3F4MA 1XA6A 1YU6C 2DIPA 1L1OC 5GROA 3UDGA 2N8NA 5ELOA 2UXDQ 3D31A 4R4QA 4UP7A 4LF9Q 4GOPC 1KBEA 2UUCQ 1K83H 1J5EQ 2ZJRA 3I7FA 2JA5H 3S14H 1KD1C 3LJ0A 2FUG1 2AKWB 1KIXA 3VE5A 3UGLA 3PDNA 3TJQA 2I5LX 4J15A 2BUSA 3I56A 1YJ9A 3UE0A 4LF7L 4LF8Q 2B63G 4X6AH 4DR3L 4BBSH 2UXBQ 1JT8A 4U6RA 1X6OA 1CKNA 4A3DG 2KCTA 4E1PA 3A74A 3S16H 4A3EG 4GS3A 1XPRA 3EBEA 4X66Q 1XPUA 2WB1E 1GO3E 1TWGH 3J81c 1QVFA 3H3VI 4A3FH 3J7A5 3K7UC 5HGQA 1LTLA 4BBRG 1X3EA 3PCOB 2VQFQ 3AYHB 1IBLL 1UWVA 4GN3B 3GTOH 2JW6A 4JI5L 2CJSC 1R79A 3CXCA 1QVGA 4HJ8A 2R7ZH 1HR0W 2JYYA 2ENZA 3KP9A 5CCMA 4AIMA 3F2DA 2VQFL 2XTRA 5LMUQ 1IBLQ 3SEKC 1HZ9A 2HQLA 2KBNA 3GTMH 4A3MH 1H95A 2ZTCA 3E0EA 3STBC 1CT2I 1V1QA 2ARPF 4JI2Q 4G75A 1SGYI 3J80c 3VDPA 4L5QA 4AQYQ 1J6QA 4JC0A 4EX5A 1OYVI 1X4SA 4A3KG 4BY1G 1E22A 2R7FA 3AFQA 2IY5B 2ODDA 4DV0L 1E24A 2KMRA 1E1TA 4IPCA 4B3ML 4AS3A 2OWOA 1U5KA 4LFBL 1CT4I 3M4QA 1VQHA 1CUKA 3T1HQ 2W0TA 2VQEQ 1IW4A 4UP8A 1NUBA 2IHFA 3BU2A 3HOYG 5IP7H 3GTKH 2ENNA 2UU9L 4PZ6A 1SGEI 4OX9Q 2D0OA 3AJFA 1EOVA 2L15A 4JBWA 4IPGA 4QGUA 4NB3A 3H15A 1R9TH 4LF5Q 2A20A 3CXLA 2J9RA 2GN5A 3A5UA 1IXRA 3CCLA 1MIUA 1PHJA 1Z9FA 1YITA 4A3DH 4Q9VA 2PQAA 4BY7G 4KHPQ 3HOZH 3A0JA 1HPTA 2A2CA 1CKMA 3NELA 2JK8A 3PUWA 5C44H 2A8VA 2NVQH 1LM0A 1JB7A 1UUCA 2ZRRA 3F1ZA 1Y1CA 4AYBG 1N36Q 2NZOA 3M3YH 1UVGA 5IYCG 1IL2A 5IP9G 1O7IA 3DLLA 1YHBA 3H0GG 4JI8L 3KYHC 4DV4L 4MNOA 3HOUG 4GOPB 3S1MH 2QA4A 3VDYA 4POGA 1HNXL 3KF6A 4BA1I 4PZ7A 4JYAL 1N9WA 2CWPA 3H0GH 5FJ8G 1SFOH 3W5OA 3UDFA 5IWAL 1CSPA 3FHWA 2Q2HA 1TBQR 2GKVA 1HZAA 2ZJPA 3CCUA 2QEXA 4DV5L 2KMPA 1KMAA 1Y14B 3OL0A 5AJ3L 5K36G 2LXKA 1OXVA 4KHZA 4DAYB 3RLNA 4JBKA 4LF6L 1LR8A 1PA6A 2GVAA 3CPFA 2YYZA 2NVYH 4XIGS 1N36L 3GTGH 1JJGA 3LJ2A 3HOWH 2B0UC 5GADC 1XX6A 4JI4L 1U0LA 1HNWL 1QZHA 1K73C 2VNUD 2EQSA 2NZHA 2B3GA 4UXIA 2LUYA 1HNZQ 3E9IA 5M3MG 1JMCA 1FYBA 5LMNQ 4B3TL 2KMQA 1A8VA 3S15H 4JI1Q 3FBVA 1XBTA 4HJ7A 1YHQA 1XNQQ 1UVFA 2XRCA 3CP0A 5C0XG 1XMQQ 1I94Q 5C3EH 4B3RQ 3UDIA 1N32L 3E9HA 4GOPA 2ASBA 3JC66 4OWXB 2B29A 1NJIC 1SGQI 1S40A 2KCXA 2QQ0A 1VQPA 4Y52H 1E1OA 1VQBA 1YZ6A 2B8TA 1TWHH 1K0RA 2Y0SG 1KRTA 1LYLA 4GKJL 3CCJA 3T1YL 4JI5Q 4JBJA 4BXXG 1PCEA 2QPOA 2PI2E 2L1LB 5IYDH 2J87A 4GLXA 1K3RA 2Q2TA 3M9BA 1TBOA 3I4MG 3U4VA 2ORWA 1OXSC 2MQHA 4EQ5A 4HFVA 1C9OA 3TEHB 4JI6L 2HIXA 3SGIA 2F4VQ 2JEAI 1A63A 4LWCA 2K75A 1FL0A 2SGEI 1B70B 1DGSA 2EIFA 1CKNB 5FLMH 3CCEA 3PO3G 1FAQA 1LUZA 3KDFA 1UE6A 2IX0A 4IJLA 1DS2I 2F4VL 2ZTDA 5C3EG 4LW1A 1X55A 4DR2L 2NVXH 3HKSA 4HEA1 2CCZA 1R0RI 4L5TA 4DUYQ 2ORVA 3I2ZA 4TVAB 1AE3A 1RFHA 3HKZE 2YQPA 2Q2IA 5IT9c 3UFFA 1VQ6A 1Q12A 4R1JA 2UXDL 3PUVA 1V9PA 4X62L 3TS0A 4YWMA 2OCEA 4R4CA 2GVBA 4OX9L 3EN2A 3KF8B 3CW2C 2VL6A 3K7AH 2NN6G 3CMAA 2JA7H 4QIWE 2ALYB 4NXNQ 1N8RC 2JB2A 1Y1VG 4C3HH 4AH6A 4P75A 2OQKA 5JEAG 4HJ5A 3G48A 1N33Q 1N32Q 2K52A 1VQGA 3GDEA 4DV3Q 1XNQL 1AH9A 5FLMG 4NXNL 3NEMA 3DM3A 1FVIA 3BJUA 1IBML 1XNRL 3BZCA 3U4ZA 2ZM6L 3I4MH 4LUZA 1HDLA 1DS3I 4JI0L 4JOIA 2F66B 1Y1WG 4LFCQ 1XPOA 5HQ8A 2YU9H 4DV2Q 3OXLA 1N34L 2F3IA 3JAMi 2DUDA 4JOIC 1BVSA 2N78A 5LMUL 3H3VH 2JA8G 3T1HL 5C4XG 1CGJI 2JJQA 1HJAI 5HI7A 3TQYA 1VQDA 5AJ3Q 4DUZL 2F3CI 3W1GA 2UU9Q 2ZJQA 1Q1BA 2ELIA 2JA5G 2E73A 3MEFA 2FNFX 5IY0A 2QQCA 1EQRA 1PFSA 1VS0A 2YV5A 1Q86C 4LF4L 2P6AC 1GM5A 4AYBE 1I5FA 2XGTA 3I9V1 4UXJA 4JI3L 4AS2A 3PIPA 1PV4A 1VQAA 1IBMQ 2ES2A 3DA3A 4UPAA 1L2FA 1YNXA 2UXCL 4HGUA 3L2PA 3UEJA 5LMNL 1YHAA 1VQ8A 4B3TQ 3S1NH 4GKKL 4A93G 2A1AA 2QGQA 3LGJA 5JEAJ 1MT1A 1SGDI 3KOJA 2ERWA 4OONA 1N34Q 2SGPI 3GOXA 2NU0I 3EIVA 1P16A 2HHHQ 2VY3A 3RR5A 4IO9A 1KRSA 4GNXC 4X64L 1HNXQ 4JV5Q 2N1AB 5C0XJ 5C0XI 1YEZA 4YWKA 2E5RA 1Y1VH 1FJGL 4B3RL 3RZDH 2RCNA 4HIOA 2R92H 4DV6Q 3HOUH 1A0IA 2LSSA 4OWTB 1VQKA 2VUMG 4HIKA 4JI7Q 2D62A 3I55A 4P73A 1VQOA 3HOYH 1KBFA 2JB1A 1KHIA 1RIPA 3PUZA 4GN4B 1VQNA 2V1CA 2JXDA 2NVTH 5FLXc 2IP6A 4DR5Q 2GVIA 1OXUA 2H5XA 2AWNA 4TQUS 4QQBX 1GD7A 1MJEA 3PGZA 3RLFA 4MZ9A 2I5HA 1Y1WH 2UUAQ 4A3JH 4OAVB 4PL5A 4YCWA 2MNAA 1VQ9A 1VDDA 1JJ2A 4LF7Q 2BA1A 2I5MX 1FJGQ 4PL4A 1KAWA 2WAQG 4GLAC 5C4XH 3RN5A 1HR0Q 4IOAA 2CWAA 4JV5L 1D7QA 1FARA 2SGQI 2V6EA 3K80C 4OO1I 4JI2L 4JCVE 1K8GA 1PTRA 2VRWB 5BR8L 3I4NG 2WVJA 4ME3A 4E1RA 3PF5A 1EIYB 2V1CC 4DKAC 4HIMA 4C3JH 1PH2A 2MJFB 3D0FA 1YTPA 1WCMH 1B8AA 1E3PA 4MTNA 1EIFA 4DV0Q 3CPWA 3RZOH 1TIHA 3QTLD 3KY9A 1GVPA 2E8GA 1X65A 1CE3A 3AEVA 3ULJA 4L5SA 3RNUA 1WCMG 1WI5A 3S17H 5LNK1 2F52A 1AE2A 2CKZB 4O0AA 3VA9A 4DR7L 2ID0A 3M4PA 1HJPA 3NENA 1OXXK 2BA0A 3A5ZB 1EWIA 3K0XA 2ZTEA 4X64Q 1WJJA 4A3MG 1I94L 4IFDG 4K0KQ 2M5XA 5FUWA 1PH8A 4BBSG 1YIJA 1L0WA 1SR3A 3QWPA 2Z6KA 4DR1L 2JQOA 3K8AA 5M3MH 5IP7G 2KMOA 4YHHQ 1OXTA 1XJVA 4LFAL 2JB3A 2SGFI 4O1PA 2ZM6Q 3PF4A 3UGIA 1VQFA 2JA1A 1Q1EA 4B3SQ 2K5HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR2 Q;  3GTL H;  5EAY A;  4HID A;  1GKH A;  3CCV A;  1Q8K A;  1UEB A;  4DUZ Q;  2R92 G;  2VUM H;  2CFM A;  4GNX B;  1I50 H;  2PI2 A;  3CC4 A;  1HNZ L;  3PO2 H;  3S2D H;  3GD7 A;  4DV1 L;  1E7Z A;  1MKH A;  1W3S A;  4LF4 Q;  5FJ8 H;  3PO2 G;  2UUB L;  1XMQ L;  1Q82 C;  4HJA A;  2MO1 A;  4YCU A;  4A93 H;  4X65 L;  1Q46 A;  1QVC A;  2R93 G;  3HOW G;  2PMZ E;  1PH1 A;  4GKK Q;  1WOC A;  2HT1 A;  1S3O A;  3T1Y Q;  3CCQ A;  2AHO B;  2VZA A;  3U50 C;  2OQ0 A;  4DV3 L;  3AFP A;  1QUQ B;  1G6P A;  4FDB A;  4APV A;  3CCM A;  3W1B A;  1UE1 A;  4B3S L;  4UY8 C;  3B6Y A;  1IYJ B;  1L1O B;  2K50 A;  3HOZ G;  1HNW Q;  1M1K C;  1VQI A;  2JE6 I;  1CKO A;  3CF5 A;  4A76 A;  1T9H A;  1VQL A;  4LF9 L;  1BBW A;  4P71 A;  4NXM L;  4A3G H;  3KF6 B;  3F8T A;  1NBW A;  4ALP A;  1YJW A;  1YJN A;  1PH7 A;  4OO1 G;  1Q81 C;  3WWV A;  1VQ5 A;  4LF8 L;  4WJ3 M;  1UE5 A;  3PUY A;  1CSQ A;  2WAQ E;  1X3F A;  3ER0 A;  1XMO Q;  5E7N A;  1EYG A;  2EXD A;  2KEN A;  4LFC L;  4JI0 Q;  4DK6 C;  4LNQ A;  1EFW A;  3G6E A;  1I3Q H;  1UE7 A;  3L7Z C;  3OYY A;  3KDF B;  4IPH A;  1WYD A;  4JI3 Q;  3CQZ H;  3BZK A;  4GN5 A;  4DR6 Q;  3AQQ A;  4NXM Q;  1KC8 C;  1HH2 P;  4KI0 A;  1W2B A;  1VQ4 A;  4WJ4 A;  1TWC H;  4OXP A;  3CC2 A;  1PYS B;  4BY1 H;  1Q7Y C;  4DR6 L;  2JA7 G;  3HOX G;  1NY4 A;  3OTO Q;  4A3B G;  1SLJ A;  4BBR H;  1X9N A;  4JI7 L;  1K9M C;  1IBK L;  4IPD A;  4DV7 L;  2DGY A;  2D0P A;  4R4O A;  3GTJ H;  1OTC A;  4BY7 H;  2HIV A;  3ERS X;  4X66 L;  2IX1 A;  3F2B A;  4A3C G;  2JA9 A;  3JAM c;  2VQE L;  4DPG A;  4UP9 A;  3IRB A;  4A3G G;  2YTX A;  3PIO A;  3I4N H;  5GQO A;  2YTV A;  2B63 H;  1SE8 A;  4C2M H;  3F2C A;  4JI1 L;  4IOC A;  2R7D A;  2YTY A;  3KLW A;  2OTJ A;  3CAM A;  3HOX H;  3PSI A;  3PO3 H;  3KJP A;  1TWA H;  5GAH C;  4A3E H;  4A3K H;  4A3L G;  1NTG A;  4AQY L;  2KHI A;  1C7Y A;  3G4S A;  4LUV A;  1VQC A;  2NN6 I;  2XTI A;  2IHE A;  3RLO A;  4QJF A;  1VQM A;  2KCM A;  3CME A;  2N3S A;  5J3B A;  2Y0S E;  2MFI A;  3L0O A;  1ASZ A;  1G29 1;  2I0Q A;  1IBK Q;  5IP9 H;  4OWW B;  3J81 j;  2Z0S A;  1QZG A;  2E2J H;  2Q2U A;  4LF6 Q;  2R7Z G;  4B3M Q;  2UUA L;  1P8L A;  4QY7 A;  5ELN A;  1J5E L;  4L5R C;  2N49 A;  1M90 C;  3S1Q H;  1NMG A;  4DV2 L;  1JJC B;  1PH4 A;  2VW9 A;  4JYA Q;  1RL2 A;  4PZ8 A;  4P74 A;  1A62 A;  3HOV H;  1S72 A;  2RHS B;  1D8L A;  3STB D;  1EQQ A;  4DR3 Q;  2OTL A;  4DV6 L;  2UXB L;  4YCV A;  2E5L Q;  3ULL A;  3HOV G;  3GTQ H;  3J81 i;  2Z6K C;  4PG3 A;  3PUX A;  3CD6 A;  4BXX H;  4DUY L;  1YVC A;  4DR4 Q;  2E2I H;  3TRZ A;  4KHP L;  4DR5 L;  2PQA B;  4RG1 A;  1G51 A;  4PMW A;  4DR7 Q;  4YY3 L;  5GAG C;  5IE8 A;  4P72 A;  1PH6 A;  3UE1 A;  3HKZ G;  1JE5 A;  1SRU A;  1YI2 A;  5JJK A;  1X54 A;  2FXQ A;  2JA8 H;  4R4T A;  4DV4 Q;  2WP8 J;  3CCS A;  4DK3 C;  4YY3 Q;  4O2D A;  5DLQ E;  1VQ7 A;  5HY6 A;  4GNX A;  4DNI A;  2CQO A;  3KJO A;  3G71 A;  1HZC A;  3U58 A;  2UUC L;  5C44 G;  5BR8 Q;  3FKI H;  4A3L H;  4LFB Q;  2PNH A;  1ASY A;  4RMF A;  3J7Z C;  1PYB A;  4X65 Q;  1BBU A;  2C35 B;  1V43 A;  3S24 A;  1SRO A;  4A4I A;  1PH5 A;  2UUB Q;  1X56 A;  5H1S E;  1C0A A;  2R6G A;  2E2H H;  4JI4 Q;  1XTD A;  3CC7 A;  3ICE A;  1KL9 A;  5C4J H;  2JA6 H;  4A3B H;  1B7Y B;  4DR1 Q;  1VCI A;  3M4O H;  2RF4 A;  5M3F H;  1SMX A;  5IYB G;  2E5L L;  1I6H H;  4K0K L;  4IJH A;  5IWA Q;  5IYC H;  5M5W H;  2WB1 G;  4A3C H;  3J80 i;  1VQE A;  2MO0 A;  4POF A;  2WFW A;  5GAE C;  4R4I A;  4DV7 Q;  3NBH B;  4LFA Q;  2K14 A;  2AWO A;  1TXY A;  1YBY A;  3HFZ B;  5M5X H;  4A3I H;  4A3J G;  4KLK A;  4X62 Q;  1IZ6 A;  2ATW A;  2IT1 A;  2AMC B;  4NPS A;  1PH3 A;  2VS1 A;  4A3I G;  1NMF A;  5JJL A;  4YWL A;  4A3F G;  1BKB A;  1X3G A;  3FKI G;  2RHQ B;  2LXJ A;  1N33 L;  4DV1 Q;  1KQS A;  2BH8 A;  2K5V A;  4LF5 L;  5M3F G;  4IFD I;  4IFD J;  5JJI A;  4YHH L;  1QUQ A;  1WFQ A;  5IYD G;  3ULP A;  1SN8 A;  3OTO L;  4A75 A;  3MXN B;  3Q8D A;  1Z47 A;  2K5N A;  3RN2 A;  3S1R H;  1PH9 A;  4GLV B;  1EUJ A;  4XTC S;  3TS2 A;  1VQJ A;  1NE3 A;  4LUO A;  1L1O A;  1K8A C;  3I4O A;  4JBM A;  2K4K A;  4JI8 Q;  3GTP H;  3M7N A;  5LMN W;  5IYB H;  1HR0 L;  2A19 A;  3TRE A;  4HJ9 A;  1FGU A;  2JA6 G;  3FP9 A;  3K81 C;  1MJC A;  4QL5 A;  3UDX A;  4DAM A;  2JEB I;  4JI6 Q;  1KXL A;  1PVO A;  3ZJY C;  2KHJ A;  1HZB A;  4DV5 Q;  3OW2 A;  2HHH L;  4C3I H;  4DR4 L;  3S2H H;  2BH2 A;  3PV0 A;  3CCR A;  5M5Y H;  1XMO L;  2R93 H;  1TWF H;  4Y7N H;  3GO5 A;  4GKJ Q;  3M85 A;  4H02 A;  4BA2 I;  1XNR Q;  3KFU A;  2UXC Q;  4JG2 A;  1L1O C;  5GRO A;  3UDG A;  2N8N A;  5ELO A;  2UXD Q;  3D31 A;  4R4Q A;  4UP7 A;  4LF9 Q;  4GOP C;  2UUC Q;  1K83 H;  1J5E Q;  2ZJR A;  3I7F A;  2JA5 H;  3S14 H;  1KD1 C;  1KIX A;  2AKW B;  2I5L X;  4J15 A;  3I56 A;  1YJ9 A;  3UE0 A;  4LF7 L;  4LF8 Q;  2B63 G;  4X6A H;  4DR3 L;  4BBS H;  2UXB Q;  1JT8 A;  1X6O A;  4A3D G;  1CKN A;  2KCT A;  3A74 A;  3S16 H;  4A3E G;  4GS3 A;  1XPR A;  3EBE A;  4X66 Q;  1XPU A;  2WB1 E;  1GO3 E;  1TWG H;  3J81 c;  1QVF A;  3H3V I;  4A3F H;  3J7A 5;  3K7U C;  5HGQ A;  1LTL A;  4BBR G;  1X3E A;  3PCO B;  2VQF Q;  3AYH B;  1IBL L;  1UWV A;  4GN3 B;  3GTO H;  4JI5 L;  3CXC A;  1QVG A;  4HJ8 A;  2R7Z H;  1HR0 W;  4AIM A;  3F2D A;  2VQF L;  5LMU Q;  1IBL Q;  1HZ9 A;  2HQL A;  2KBN A;  3GTM H;  4A3M H;  1H95 A;  2ZTC A;  3E0E A;  3STB C;  1V1Q A;  4JI2 Q;  3J80 c;  4L5Q A;  4AQY Q;  1J6Q A;  4JC0 A;  4EX5 A;  4A3K G;  4BY1 G;  1E22 A;  2R7F A;  3AFQ A;  2IY5 B;  4DV0 L;  1E24 A;  1E1T A;  4IPC A;  4B3M L;  2OWO A;  1U5K A;  4LFB L;  3M4Q A;  1VQH A;  1CUK A;  3T1H Q;  2VQE Q;  4UP8 A;  2IHF A;  3BU2 A;  3HOY G;  5IP7 H;  3GTK H;  2UU9 L;  4PZ6 A;  4OX9 Q;  2D0O A;  1EOV A;  2L15 A;  4JBW A;  3H15 A;  4IPG A;  4QGU A;  4NB3 A;  1R9T H;  1Q86 C;  4LF5 Q;  2GN5 A;  3A5U A;  1IXR A;  3CCL A;  1MIU A;  1PHJ A;  1Z9F A;  1YIT A;  4A3D H;  4BY7 G;  2PQA A;  4KHP Q;  3HOZ H;  3A0J A;  1CKM A;  3NEL A;  3PUW A;  2JK8 A;  5C44 H;  2A8V A;  2NVQ H;  1LM0 A;  1JB7 A;  3F1Z A;  4AYB G;  1N36 Q;  2NZO A;  3M3Y H;  5IYC G;  1IL2 A;  5IP9 G;  1O7I A;  3DLL A;  1YHB A;  3H0G G;  4JI8 L;  3KYH C;  4DV4 L;  4MNO A;  3HOU G;  4GOP B;  3S1M H;  2QA4 A;  3VDY A;  4POG A;  1HNX L;  3KF6 A;  4BA1 I;  4PZ7 A;  4JYA L;  1N9W A;  2CWP A;  3H0G H;  5FJ8 G;  1SFO H;  3W5O A;  3UDF A;  5IWA L;  1CSP A;  3FHW A;  2Q2H A;  1HZA A;  2ZJP A;  3CCU A;  2QEX A;  4DV5 L;  1Y14 B;  5AJ3 L;  5K36 G;  1OXV A;  2LXK A;  4KHZ A;  4DAY B;  3RLN A;  4JBK A;  4LF6 L;  1PA6 A;  2GVA A;  3CPF A;  2YYZ A;  2NVY H;  4XIG S;  1N36 L;  3GTG H;  1JJG A;  3HOW H;  5GAD C;  4JI4 L;  1U0L A;  1HNW L;  1QZH A;  1K73 C;  2VNU D;  2EQS A;  2NZH A;  2B3G A;  1HNZ Q;  3E9I A;  5M3M G;  1JMC A;  5LMN Q;  4B3T L;  1A8V A;  3S15 H;  4JI1 Q;  4HJ7 A;  1YHQ A;  1XNQ Q;  3CP0 A;  5C0X G;  1XMQ Q;  1I94 Q;  5C3E H;  4B3R Q;  3UDI A;  1N32 L;  3E9H A;  4GOP A;  2ASB A;  3JC6 6;  4OWX B;  2B29 A;  1NJI C;  1S40 A;  1VQP A;  4Y52 H;  1E1O A;  1VQB A;  1YZ6 A;  1TWH H;  1K0R A;  2Y0S G;  1KRT A;  1LYL A;  4GKJ L;  3CCJ A;  3T1Y L;  4JI5 Q;  4JBJ A;  4BXX G;  2PI2 E;  5IYD H;  4GLX A;  1K3R A;  2Q2T A;  3M9B A;  3I4M G;  3U4V A;  1OXS C;  2MQH A;  4EQ5 A;  1C9O A;  3TEH B;  4JI6 L;  2JEA I;  2HIX A;  3SGI A;  2F4V Q;  1A63 A;  4LWC A;  2K75 A;  1FL0 A;  1B70 B;  1DGS A;  2EIF A;  1CKN B;  5FLM H;  3CCE A;  3PO3 G;  1LUZ A;  3KDF A;  1UE6 A;  2IX0 A;  4IJL A;  2F4V L;  2ZTD A;  5C3E G;  4LW1 A;  1X55 A;  4DR2 L;  2NVX H;  3HKS A;  2CCZ A;  4L5T A;  4DUY Q;  3I2Z A;  4TVA B;  1AE3 A;  3HKZ E;  2Q2I A;  5IT9 c;  1VQ6 A;  1Q12 A;  4R1J A;  2UXD L;  3PUV A;  1V9P A;  4X62 L;  3TS0 A;  4YWM A;  2OCE A;  4R4C A;  2GVB A;  4OX9 L;  3EN2 A;  3KF8 B;  3CW2 C;  2VL6 A;  3K7A H;  2NN6 G;  3CMA A;  2JA7 H;  4QIW E;  2ALY B;  4NXN Q;  1N8R C;  1Y1V G;  4C3H H;  5JEA G;  4AH6 A;  4P75 A;  2OQK A;  4HJ5 A;  1K8G A;  3G48 A;  1N33 Q;  1N32 Q;  2K52 A;  1VQG A;  3GDE A;  4DV3 Q;  1XNQ L;  1AH9 A;  5FLM G;  4NXN L;  3NEM A;  3DM3 A;  1FVI A;  3BJU A;  1IBM L;  1XNR L;  3BZC A;  3U4Z A;  2ZM6 L;  3I4M H;  4LUZ A;  4JI0 L;  4JOI A;  1Y1W G;  4LFC Q;  1XPO A;  2YU9 H;  4DV2 Q;  1N34 L;  2F3I A;  3JAM i;  2DUD A;  4JOI C;  1BVS A;  2N78 A;  5LMU L;  3H3V H;  2JA8 G;  3T1H L;  5C4X G;  2JJQ A;  3TQY A;  1VQD A;  5AJ3 Q;  4DUZ L;  3W1G A;  2UU9 Q;  2ZJQ A;  1Q1B A;  2JA5 G;  3MEF A;  5IY0 A;  1EQR A;  1PFS A;  1VS0 A;  2YV5 A;  4LF4 L;  1GM5 A;  4AYB E;  1I5F A;  2XGT A;  4JI3 L;  3PIP A;  1PV4 A;  1VQA A;  1IBM Q;  2ES2 A;  4UPA A;  2UXC L;  1L2F A;  1YNX A;  3L2P A;  5LMN L;  1YHA A;  1VQ8 A;  4B3T Q;  3S1N H;  4GKK L;  4A93 G;  2A1A A;  2QGQ A;  3LGJ A;  5JEA J;  3KOJ A;  4OON A;  1N34 Q;  3EIV A;  1P16 A;  2HHH Q;  2VY3 A;  3RR5 A;  4IO9 A;  1KRS A;  4GNX C;  4X64 L;  1HNX Q;  4JV5 Q;  5C0X J;  5C0X I;  1YEZ A;  4YWK A;  1Y1V H;  1FJG L;  4B3R L;  3RZD H;  2RCN A;  4HIO A;  2R92 H;  4DV6 Q;  3HOU H;  1A0I A;  2LSS A;  4OWT B;  1VQK A;  2VUM G;  4HIK A;  4JI7 Q;  2D62 A;  3I55 A;  4P73 A;  1VQO A;  3HOY H;  1RIP A;  1KHI A;  3PUZ A;  4GN4 B;  1VQN A;  2NVT H;  5FLX c;  4DR5 Q;  1OXU A;  2H5X A;  2AWN A;  4TQU S;  4QQB X;  1GD7 A;  1MJE A;  3PGZ A;  3RLF A;  4MZ9 A;  2I5H A;  1Y1W H;  2UUA Q;  4A3J H;  4YCW A;  2MNA A;  1VQ9 A;  1JJ2 A;  4LF7 Q;  2BA1 A;  2I5M X;  1FJG Q;  3RN5 A;  1KAW A;  2WAQ G;  4GLA C;  5C4X H;  1HR0 Q;  4IOA A;  4JV5 L;  2CWA A;  1D7Q A;  3K80 C;  4OO1 I;  4JI2 L;  4JCV E;  5BR8 L;  3I4N G;  4ME3 A;  3PF5 A;  1EIY B;  2V1C C;  4DKA C;  4HIM A;  4C3J H;  1PH2 A;  3D0F A;  1WCM H;  1B8A A;  1E3P A;  4MTN A;  1EIF A;  4DV0 Q;  3CPW A;  3RZO H;  1GVP A;  1X65 A;  2E8G A;  3AEV A;  3ULJ A;  4L5S A;  3RNU A;  1WCM G;  1WI5 A;  3S17 H;  2F52 A;  1AE2 A;  2CKZ B;  4O0A A;  4DR7 L;  2ID0 A;  3M4P A;  1HJP A;  3NEN A;  1OXX K;  2BA0 A;  3A5Z B;  1EWI A;  3K0X A;  2ZTE A;  4X64 Q;  1WJJ A;  4A3M G;  1I94 L;  4IFD G;  4K0K Q;  1PH8 A;  4BBS G;  1YIJ A;  1L0W A;  1SR3 A;  2Z6K A;  4DR1 L;  2JQO A;  3K8A A;  5M3M H;  5IP7 G;  4YHH Q;  1OXT A;  1XJV A;  4LFA L;  2ZM6 Q;  3PF4 A;  1VQF A;  1Q1E A;  4B3S Q;  2K5H A; 
#chains in the Genus database with same CATH topology
 4DK0 A;  3GTL H;  2JN4 A;  1S5C D;  3I91 A;  3DWQ A;  2O5I C;  2R92 G;  3UEY A;  2X3T A;  1HUN A;  1I50 H;  1AFP A;  3S2D H;  5CV5 A;  2WV6 D;  1MKH A;  1W6K A;  4G4K A;  1SGR I;  1XMQ L;  1Q82 C;  2L7X A;  1F9S A;  1TWG B;  1YNJ C;  1EEI D;  1UEA B;  3KK7 A;  2OQ0 A;  4OHJ A;  3OMG A;  4DV3 L;  1LLR D;  2NWG A;  1KNA A;  1UE1 A;  5ELE A;  4XXE A;  4UY8 C;  3H3V C;  3CF5 A;  1Y1B A;  1TVX A;  1DOL A;  2GA4 B;  2WKD A;  4O1O A;  4A3G H;  1JC7 A;  1YJN A;  4LF8 L;  2KED A;  1WTH A;  1EYA A;  1XMO Q;  3TZD A;  1LT3 D;  1EYG A;  5IT9 L;  4RHR A;  4LNQ A;  4DK6 C;  1EFW A;  2F3V A;  3DEO A;  2PYK A;  4OAU C;  1IY6 A;  1WYD A;  4OIJ A;  1EU4 A;  3BZK A;  2R92 B;  3MEK A;  1TWC H;  3D00 A;  2A6H D;  3A56 A;  5CV7 A;  3K59 A;  4E6I A;  2BE5 D;  1N13 A;  1B9N A;  3PO2 B;  4A3B G;  4BBR H;  1I4Q A;  1IBK L;  1E2W A;  2DGY A;  4R4O A;  1OTC A;  4K5W A;  2XWB B;  5E4W C;  5E4X A;  4DU9 A;  1BQQ T;  4A3C G;  2GKT I;  4AML A;  5KIX A;  2V4D A;  3PIO A;  2YTV A;  2B63 H;  1SE8 A;  2OTJ A;  1CGI I;  2R7D A;  2YTY A;  4QCL A;  2B2W A;  1DJR D;  1TWA H;  1NTG A;  1C7Y A;  4UXH A;  3G4S A;  1TS3 A;  4HMI A;  4QJF A;  2KCM A;  2MFI A;  2I46 A;  3L0O A;  5DM6 3;  1LAB A;  5T1I A;  1JOO A;  4Q5V A;  1ASZ A;  2Q2U A;  3BYT B;  4GI3 C;  4B3M Q;  4A24 A;  1EYC A;  1NMG A;  4IUT A;  1K8O A;  4MTK A;  3OIP A;  2VW9 A;  4JYA Q;  3MXP A;  5EX3 A;  3STB D;  1K3B C;  3I4L A;  4YCV A;  2E5L Q;  3HOV G;  3J81 i;  3E0J A;  3W2D A;  3PUX A;  3CD6 A;  2Q8T A;  2F0K A;  2E2I H;  2Y0M A;  4XQN A;  1GHK A;  2LS0 1;  3S17 B;  2A2D A;  4AYB B;  5IE8 A;  3RUZ A;  1SRU A;  4G7Z C;  1YI2 A;  3K5O A;  2JA8 H;  3NXW A;  1ULN A;  2EZV A;  2BL7 A;  3T13 A;  4TKO B;  4YY3 Q;  5ELB A;  3FKI B;  1D5M C;  5DLQ E;  1VQ7 A;  4JW0 A;  2F6M B;  1I3Q B;  2CQO A;  4DNI A;  3U58 A;  4A3L H;  1LTI D;  3D3R A;  2PPB C;  4RH6 A;  2HDM A;  4RMF A;  4YZD A;  3J7Z C;  3T4A C;  4X65 Q;  1JR0 D;  1BBU A;  4FXK C;  5E3P A;  1V43 A;  1SRO A;  5LHY 1;  1PTO C;  2R6G A;  5CC4 A;  1TWH B;  3EVQ A;  2HCI A;  5CCL A;  1ENF A;  1EY8 A;  4L9M A;  5C4J H;  3S1M B;  2E76 C;  4ID6 A;  1B7Y B;  3M4O H;  5M3F H;  5IYB G;  4IJH A;  1QIL A;  3K6O A;  2NVQ B;  5KYI A;  5IYC H;  4A3C H;  3Q6S A;  5EPL A;  4CBV A;  4DV7 Q;  3JAM E;  3FC3 A;  2VXW A;  1F2M A;  4LFA Q;  3TZU A;  4A3I H;  2LEO A;  4X62 Q;  4NPS A;  2K19 A;  1AN1 I;  3VDP A;  1ZXT A;  1PH3 A;  2B2V A;  2VS1 A;  1NAP A;  5JJL A;  1PJU A;  2K03 A;  4NV2 A;  4A3F G;  1PFB A;  1V1H A;  1Y8P B;  1KTK A;  2RHQ B;  2LXJ A;  1U4M A;  1KQS A;  2BH8 A;  2K5V A;  1CHO I;  4X3S A;  4G76 A;  4XT3 B;  2DJF C;  3ULP A;  1SJ8 A;  4A75 A;  1L0Y B;  1SGN I;  2KUM A;  4GLV B;  3PMF A;  1TUR A;  1L1O A;  3I4O A;  1A3U A;  2OVO A;  3NPP A;  2O5J C;  2IWH A;  3TRE A;  1BBX C;  2YU9 B;  1DYQ A;  4DAM A;  2RLD A;  2JEB I;  4JI6 Q;  4DV5 Q;  1ROD A;  4FXG C;  4ZLT F;  5EKI A;  5IIF A;  3GTJ B;  1TY2 A;  5J39 A;  3GO5 A;  1RTN A;  1EIG A;  4WP4 A;  4H02 A;  2L55 A;  2PZT A;  3DHQ A;  4QF4 A;  4C3H G;  1YU6 C;  1UAP A;  1O78 A;  4LF9 Q;  2B8G A;  2OU2 A;  5C4X B;  1KBE A;  1SXT A;  4C3I G;  2ZJR A;  3IL8 A;  1EQV A;  2AKW B;  5M5W B;  1KIX A;  4ZKB B;  3PDN A;  3TJQ A;  2I5L X;  5I2Y A;  3I56 A;  2ZXP A;  4A3D G;  3MWY W;  3T51 B;  3A74 A;  2EY2 A;  3CRK C;  5IGC A;  3J81 c;  4JPB W;  4A3F H;  1LTL A;  4Q0F A;  3S16 B;  3BS1 A;  1X3E A;  2K28 A;  1IBL L;  2G9D A;  2QSB A;  1S4Z A;  5CBE E;  2XRS D;  3CXC A;  2JYY A;  5IGF A;  5CCM A;  1CZG A;  3KP9 A;  2XTR A;  1QWY A;  4F8M A;  1CT2 I;  2ARP F;  2VUM B;  1JE4 A;  1T5E A;  4C56 C;  4AQY Q;  1OYV I;  1X4S A;  4A3K G;  1E22 A;  2R7F A;  3ND8 A;  4DV0 L;  4DGZ A;  2KMR A;  1STA A;  1MHW C;  4B3M L;  4AS3 A;  2OWO A;  1U5K A;  4LFB L;  4KN4 C;  1J8I A;  1CUK A;  3QOL A;  2VQE Q;  4K2L A;  5M3M B;  4UP8 A;  3BU2 A;  5EGT A;  4C3I B;  3A8K E;  1HHV A;  2D0O A;  4IN3 A;  4JBW A;  4FP5 D;  4K14 A;  4QGU A;  4WJ4 A;  2A20 A;  4LAA A;  1SYE A;  3R8B A;  3I4N B;  2BDO A;  1B53 A;  3I72 A;  3CCL A;  5F2D A;  1MIU A;  1Z9F A;  4A3D H;  4H44 C;  2PQA A;  2NVQ H;  1UUC A;  2LY7 A;  1Y1C A;  2ZRR A;  5IYC G;  2ZT9 C;  1KLG D;  2JXM B;  1O7I A;  4DV4 L;  1YHB A;  2X52 A;  1SMY D;  4GOP B;  4OO1 H;  3KF6 A;  2E2J B;  2ZXR A;  2CWP A;  3BVM A;  3H0G H;  1G91 A;  2PQ8 A;  1TBQ R;  2RDH A;  3CKI B;  4DV5 L;  1KLU D;  2F0G A;  1EY9 A;  1Y14 B;  1OXV A;  2NBF A;  3JAM L;  3CPF A;  1NR4 A;  2NVY H;  2YYZ A;  3I90 A;  3D4D A;  5KND A;  3OW7 A;  3LJ2 A;  1N36 L;  1UNS A;  2B0U C;  5GAD C;  1FNW A;  5JVG 3;  1HNW L;  4ZUI A;  1Z6H A;  4IUU A;  2EQS A;  2LUY A;  1F9P A;  5M3M G;  3H6M A;  5COY A;  1FYB A;  5LMN Q;  3HGB A;  3C46 A;  4JI1 Q;  2H4O A;  1XBT A;  1LTG D;  4DAY A;  1K7V A;  2RA4 A;  2QDB A;  1N32 L;  2ASB A;  1NJI C;  4OWX B;  4Y52 H;  1E1O A;  4XT1 B;  1TWH H;  1BCP D;  1TS2 A;  2LMC B;  4RFB A;  4GKJ L;  1PCE A;  1B3Q A;  2L1L B;  4A3J B;  5IYD H;  2J87 A;  1XX8 A;  1TBO A;  1LT6 D;  4QIW B;  1EYD A;  1E0B A;  3AB9 A;  3GV6 A;  4BS9 A;  2JA8 B;  1CQF A;  1C9O A;  4WFN 3;  2HIX A;  1STG A;  4DF7 A;  2SGE I;  1B70 B;  5FLM H;  2VB2 X;  3FRP B;  3KDF A;  4LW1 A;  1ET6 A;  2CCZ A;  5AFW A;  3LWE A;  4J1M A;  1RDP D;  2ORV A;  4TVA B;  1AE3 A;  1RFH A;  1RF2 D;  1VQ6 A;  4R1J A;  2HQE A;  4CJ2 C;  4TRD A;  5E3F A;  2OCE A;  2X6L A;  4R4C A;  2RSO A;  1TR5 A;  4NXN Q;  1O80 A;  1N33 Q;  1K7U A;  4P75 A;  2OQK A;  3VYR A;  5D14 A;  1KAB A;  1XNQ L;  4IUQ A;  3NEM A;  2LB7 A;  3GQB A;  4KMU C;  3U4Z A;  1SYB A;  3I4M H;  2XN9 C;  1XPO A;  5HQ8 A;  1HTP A;  5ISR A;  3JAM i;  2DUD A;  5EJW A;  2NB0 A;  2JA8 G;  1HJA I;  5AJ3 Q;  3W1G A;  3FPP A;  1B9M A;  2BE5 C;  2E73 A;  3MEF A;  4B9X A;  4R9W A;  1HUM A;  4FF3 A;  1AZQ A;  3TP6 A;  2YV5 A;  5CV6 A;  2P6A C;  4AYB E;  3VA5 A;  3I9V 1;  4DXF A;  4AS2 A;  1GUT A;  2ES2 A;  1XXG A;  3L2P A;  2QKI C;  2QGQ A;  1SGD I;  3IFT A;  3G6J B;  4OON A;  1N34 Q;  3GOX A;  1MJ9 A;  1P16 A;  3SE0 A;  4IO9 A;  1F9Q A;  1Z7T A;  4X64 L;  1H9S A;  2E5R A;  1S5E D;  2R92 H;  4OGQ C;  1D5Z C;  4CHT B;  2EY6 A;  3I55 A;  3HOY H;  1VQN A;  5CV4 A;  1I4G A;  2AWN A;  4QQB X;  4MZ9 A;  4UDU C;  1EZ8 A;  4OAV B;  5A35 A;  1AZP A;  1PRT D;  3A7A B;  1A3T A;  1JJ2 A;  4GZY C;  1HR0 Q;  1KAW A;  2WAQ G;  3KF8 A;  5C4X H;  4IOA A;  3K80 C;  4OO1 I;  3J7A F;  4ME3 A;  4E1R A;  5E3Q A;  1PH2 A;  4HIM A;  3GTG B;  2A74 C;  3D0F A;  5FOB B;  3BVZ A;  2O4X A;  1TU2 B;  3CPW A;  3QTL D;  1GVP A;  1JCK B;  3AEV A;  3ULJ A;  4L5S A;  3O13 A;  3SK5 A;  1BF4 A;  3M4P A;  5EQ0 A;  1HJP A;  1ILP A;  1OXX K;  3A5Z B;  4X64 Q;  1EWI A;  3NTH A;  1EZ6 A;  2ZTE A;  2M5X A;  4K0K Q;  3K7A B;  1WVL A;  4DR1 L;  2JYO A;  3OHX C;  5M3M H;  4LFA L;  2FJ2 A;  2JB3 A;  4ZCK A;  2SGF I;  2ZM6 Q;  3E5S A;  3C2P A;  3CCV A;  1Q8K A;  4KY7 A;  4XDX A;  2CWG A;  4GNX B;  2DB6 A;  3CC4 A;  4RGN A;  1K7T A;  4IQZ A;  1F9R A;  2WAQ B;  3GD7 A;  4YIJ A;  4LF4 Q;  3PO2 G;  1OMU A;  1V1I A;  4KKU A;  2NVX B;  2MO1 A;  4X65 L;  1Q46 A;  4CDD C;  2KA7 A;  1QB5 D;  2F0M A;  2PMZ E;  3E3X A;  1AN8 A;  1S3O A;  3T1Y Q;  2VZA A;  5TSS A;  2J7Z A;  3B6Y A;  3PQI A;  2K50 A;  1M1K C;  1VQI A;  2JE6 I;  1CKO A;  3CU7 A;  5C4H A;  1T9H A;  2SEB D;  4A76 A;  1VQL A;  4LF9 L;  1MJB A;  5IGD A;  4NXM L;  3F8T A;  4KY5 A;  2Z6B A;  4ALP A;  4OO1 G;  1C48 A;  1UE5 A;  1CSQ A;  3GTK B;  3TOA A;  1X3F A;  4F7X A;  2AQ2 B;  3VDU A;  2KEN A;  2B2W C;  3X3N A;  1BDO A;  1SSO A;  2NYZ D;  5IGE A;  2PW5 A;  4DR6 Q;  3SEB A;  4NXM Q;  1HH2 P;  3MVV A;  1S5D D;  5IT9 E;  3CC2 A;  1WTQ A;  4V0B A;  1Q7Y C;  2F0H A;  3MFY A;  3HOX G;  3DA4 A;  5HGI A;  1SLJ A;  2B2U A;  2Z1C A;  4IPD A;  2EYM A;  2D0P A;  3GTJ H;  1YNJ D;  3L3O C;  1SGP I;  4EQO A;  4BY7 H;  3UGD A;  5JVH 3;  4RKL A;  3WDN A;  1PTO B;  5KRU A;  4RCN A;  2YTX A;  1HTL D;  5GQO A;  5I9O A;  4C2M H;  4JI1 L;  5C0X H;  1XWE A;  3CAM A;  3HOX H;  3PSI A;  4A3E H;  2DKV A;  2KHI A;  2LFN A;  2XTI A;  1VQM A;  4NKL A;  2N3S A;  3FMC A;  5J3B A;  2Z8L A;  2CW0 D;  3S9W A;  4QMG A;  1M8A A;  5IP9 H;  1BMO A;  2Z0S A;  2MP1 A;  3DWP A;  5ELN A;  4DNR B;  4R8N A;  2QDL A;  2FFK B;  4FF2 A;  4PZ8 A;  1PRT B;  4P74 A;  1A62 A;  1TT2 A;  2BOS A;  2OTL A;  3NWS A;  1STN A;  3TME A;  2UXB L;  3ULL A;  5CR3 A;  2Z6K C;  4PG3 A;  1BNZ A;  3D6W A;  1WTW A;  4DR4 Q;  1FNV A;  4RGO S;  4DR5 L;  1CSO I;  1PPF I;  3NP8 A;  4PMW A;  2EJG C;  3EA6 A;  5GAG C;  1XTC D;  2F0N A;  1JE5 A;  3HKZ G;  3MTS A;  2NVT B;  1G8Z D;  1B1Z A;  2A68 C;  4DK3 C;  5M5Y B;  1H0Z A;  2L4N A;  4RA8 A;  2V1C A;  4GNX A;  4P2C B;  3G71 A;  5C44 G;  1BCP C;  2L11 A;  3E59 A;  3K0Y A;  3IAM 1;  4EQN A;  3S24 A;  3FNB A;  1SYD A;  1X56 A;  5H1S E;  3S14 B;  2B39 A;  4JI4 Q;  4RHS A;  2FMM A;  1EIH A;  4HTH A;  2JA6 H;  1SYG A;  2RIO A;  2L8E A;  3R93 A;  1HRJ A;  2WGC A;  4HR7 B;  1M4V A;  4Z7H A;  2WB1 G;  5M5W H;  4NW2 A;  4U68 A;  4POF A;  5CBA E;  4H0L C;  1TY0 A;  1Y8F A;  2K5Q A;  1DXM A;  1TXY A;  2J0T D;  3SDJ A;  4A3J G;  4C3H B;  2ATW A;  1TBR R;  1IHZ A;  1VMP A;  2AMC B;  2IT1 A;  3GV3 A;  3H09 A;  1WD0 A;  1BKB A;  1X3G A;  1KDB A;  3S15 B;  4KV6 A;  3PO3 B;  4LF5 L;  2K7V A;  5JHW C;  1PXU A;  2NU3 I;  2FEF A;  4A3D B;  2QQE A;  3FEW X;  1QUQ A;  1SE2 A;  5IYD G;  1GHJ A;  3J7Y W;  3EFX D;  3Q8D A;  1Z47 A;  2K5N A;  2EYH A;  1EUJ A;  4B9W A;  1VMC A;  1VQJ A;  4LUO A;  3NWT A;  1K8A C;  1DZ1 A;  3GTP H;  1MI2 A;  1TDP A;  2RVL A;  1U4L A;  3VR6 A;  1EY0 A;  3K81 C;  1G2S A;  4QL5 A;  1NR2 A;  3UDX A;  3IFD A;  3ZJY C;  4JV5 L;  4C3I H;  5FUV A;  3PV0 A;  2VB3 X;  1XMO L;  3G7L A;  1LR7 A;  3DWA A;  2KCC A;  1TWF H;  1MSH A;  3RU0 A;  2PZW A;  1X32 A;  4N9P A;  1QNK A;  4BA2 I;  1XNR Q;  1ESR A;  1Y1W B;  3MFG A;  3VYU A;  1L1O C;  4WRD A;  5GRO A;  2N8N A;  2K01 A;  4FO2 A;  4R4Q A;  3RD4 A;  3T56 B;  1K83 H;  1A6X A;  1J5E Q;  2GKR I;  2X6G A;  3I7F A;  1P9Z A;  2QEJ C;  1B44 D;  1Z2I A;  3UE0 A;  1EFI D;  5I2X A;  2B63 G;  4DR3 L;  2BL8 A;  4Y7N B;  2KCT A;  3HG9 A;  4E1P A;  1SNO A;  1QJO A;  2WB1 E;  1GO3 E;  1SJE D;  1I4P A;  3H3V I;  3J7A 5;  5HGQ A;  4BBR G;  3CRL C;  2VQF Q;  5FLX E;  1SFO B;  2QIL A;  2CJS C;  3WOF A;  1R79 A;  1QVG A;  2R7Z H;  1HR0 W;  2WKC A;  3HRZ C;  5LMU Q;  4A3M H;  2A73 B;  2A68 D;  2ZTC A;  1V1Q A;  4JI2 Q;  3QIA A;  3UI2 A;  3J80 c;  4Z9C B;  1TKW B;  2A6H C;  2OD1 A;  3HP3 A;  4JC0 A;  5EKK A;  4BY1 G;  3AFQ A;  1HFG A;  1HFN A;  2ZXO A;  2IL8 A;  1D1K A;  1VQH A;  3T1H Q;  3F2U A;  1STE A;  4L8J A;  1LTR D;  3TOB A;  3NUC A;  1NUB A;  2IHF A;  2QZG A;  2DNE A;  5IP7 H;  4OX9 Q;  2L15 A;  5FK9 C;  2K1B A;  4UXI A;  1T5X D;  3SR1 A;  2E75 C;  2J9R A;  3HS0 C;  1V1O A;  1PHJ A;  3TBI B;  1JOK A;  2EE1 A;  4K5V A;  2EYP A;  2NTS A;  3A0J A;  4A3E B;  3NEL A;  2JK8 A;  2D5D A;  2EVB A;  1MBY A;  4ULL A;  3H0G G;  3KYH C;  4MNO A;  1D5X C;  3S1M H;  1B50 A;  4BA1 I;  2PW7 A;  4PZ7 A;  4JYA L;  1N9W A;  1SFO H;  5CYU A;  1WTX A;  1EY7 A;  3UDF A;  5IWA L;  1IW7 C;  3N52 A;  2GKV A;  2ZJP A;  2KMP A;  4JK1 C;  2IJ0 A;  4DAY B;  1QG7 A;  4BY1 B;  2GVA A;  4XIG S;  5K36 H;  1JJG A;  4FYD A;  3TDQ A;  4OIK A;  1CTM A;  4I65 A;  2ICE C;  1K73 C;  3IAY A;  2VNU D;  1IKM A;  2B3G A;  3E9I A;  4MHE A;  4B3T L;  1FNU A;  1UVF A;  2XWJ B;  3CP0 A;  5C0X G;  1I94 Q;  4UAI A;  5C3E H;  3E9H A;  4GOP A;  2B29 A;  2QQ0 A;  4C1N K;  1ULM A;  3X3M A;  1VQB A;  1K0R A;  1H9K A;  3W3A A;  1KRT A;  4DFA A;  1LYL A;  3CCJ A;  2IW3 A;  4JBJ A;  4BXX G;  3V05 A;  4DA2 A;  3FVQ A;  1LT4 D;  2CH4 A;  2ETD A;  3I4M G;  2ORW A;  1OXS C;  2G9H D;  4HFV A;  3SGI A;  4LWC A;  2K75 A;  2EIF A;  1CA5 A;  1CKN B;  1Q8I A;  3Q24 A;  4IJL A;  2F0E A;  2SNM A;  2ZTD A;  4HEA 1;  1X3Q A;  3GTP B;  2QGM A;  1DOK A;  3I2Z A;  3MXG A;  1EY4 A;  2Q2I A;  1BOS A;  1Q12 A;  2K33 A;  1LO5 D;  1TWA B;  3K5M A;  4X62 L;  2B2V C;  1SBB B;  3M7G A;  1NXU A;  4OX9 L;  2GVB A;  3A7L A;  1A15 A;  3KF8 B;  3K7A H;  2ALY B;  2JB2 A;  4C3H H;  1QE6 A;  1D1I A;  4H13 C;  1AH9 A;  5C4Z A;  1R9T B;  4IUR A;  5FLM G;  2K5W A;  4NXN L;  3DM3 A;  4ZAI A;  1XNR L;  3BZC A;  2ZM6 L;  5FO7 B;  4C3J G;  2FU2 A;  4JOI A;  2AUK A;  3OXL A;  3I4M B;  3H3V H;  1O7Y A;  3TQY A;  1JWU D;  2F3C I;  4ZK9 B;  2UU9 Q;  2ZJQ A;  3NBI A;  1BCP B;  1EQR A;  1EEF D;  4RAU C;  4LF4 L;  1I5F A;  4ILW A;  2EPB A;  1IBM Q;  5IGG A;  3DA3 A;  2UXC L;  3PIP 3;  1PRT F;  4B3T Q;  1YHA A;  1MT1 A;  2A1A A;  2OF1 A;  2ERW A;  4HMJ A;  2NU0 I;  1ICW A;  1ML0 D;  2HHH Q;  2VY3 A;  5EPJ A;  5C0X I;  3R5C A;  4ZRZ A;  3RZD H;  4N9T A;  1EQT A;  3HOU H;  1HEV A;  1C4Q A;  2LSS A;  1KBF A;  4JI7 Q;  3TP7 A;  1K83 B;  2JB1 A;  1RIP A;  3PUZ A;  2OZU A;  1JWS D;  2JXD A;  2NVT H;  4DR5 Q;  1OXU A;  2EYL A;  1MJE A;  4ZKC B;  4C1N I;  4A3J H;  5C3X A;  2E2I B;  4CKE A;  1VDD A;  2F03 A;  4LF7 Q;  4UHV A;  4PL4 A;  3RN5 A;  1XX6 A;  1LV9 A;  2CWA A;  4DNC A;  4JI2 L;  2WVJ A;  2B2T A;  2KCN A;  4IFD H;  1EIY B;  2Z4H A;  4DKA C;  4C3J H;  3QR8 A;  1WCM H;  4DV0 Q;  2A5H A;  1X65 A;  1DCZ A;  1RJT A;  3RNU A;  1WI5 A;  2SNS A;  5LNK 1;  4A93 B;  2CKZ B;  4O0A A;  3NK9 A;  3HOU B;  5M5X B;  1PFN A;  4EGV A;  1PH8 A;  1SR3 A;  1WTR A;  2JQO A;  2IX3 A;  4YHH Q;  1OXT A;  1XJV A;  2M2L A;  5JPN C;  1DD2 A;  2F0V A;  3UGI A;  3DUZ A;  4B3S Q;  2ROW A;  4DR2 Q;  1GKH A;  1JOQ A;  1DM0 B;  1PZK D;  4DUZ Q;  1UHA A;  4A3F B;  1TQO A;  2JSO A;  2PI2 A;  1HNZ L;  3PO2 H;  4DV1 L;  4K8I A;  3HOX B;  1IY5 A;  1U4R A;  2UUB L;  1I6H B;  5FUW A;  2MHV A;  4YCU A;  4HJA A;  4A93 H;  4GXT A;  1PLF A;  1QVC A;  2XIW A;  2R93 G;  3HOW G;  3N6R A;  2HT1 A;  2AHO B;  3U50 C;  1QUQ B;  4FDB A;  4APV A;  3W1B A;  1WCM B;  3DXJ C;  4YZC A;  4MPI A;  1EY6 A;  3WOE A;  5EBD A;  2N17 A;  1BR9 A;  1BBW A;  2A6E C;  1YO7 A;  1ESF A;  2B2U C;  2N55 A;  3KF6 B;  1NBW A;  2KQ3 A;  2R61 A;  3HH2 C;  5KNB A;  3E2I A;  3WWV A;  1TWC B;  4WJ3 M;  3ER0 A;  5FUX A;  1IKL A;  1AEX A;  2EXD A;  3ONA B;  4JI0 Q;  3G6E A;  1G6Z A;  3VA7 A;  3VYT A;  4IPH A;  3OYY A;  4OL7 A;  4FXD A;  4JI3 Q;  2AQ1 B;  2OXP A;  4GN5 A;  4KI0 A;  1TOT A;  1W2B A;  4OXP A;  1PYS B;  4BY1 H;  1WTV A;  1TGS I;  4DR6 L;  4RKB A;  2YUU A;  3IAS 1;  2HDL A;  4JI7 L;  1K9M C;  4DV7 L;  2R93 B;  2NU1 I;  2HIV A;  2K32 A;  3ERS X;  4NV5 A;  2JA9 A;  3JAM c;  4UP9 A;  4A3G G;  3I4N H;  3VYS A;  3UFF A;  3KLW A;  4KD3 A;  3PO3 H;  3KJP A;  2CAZ B;  5GAH C;  2SGD I;  4PMB A;  4ZUJ A;  1G2T A;  5C44 B;  1VQC A;  2IHE A;  3CME A;  2MPM A;  4A3K B;  2Y0S E;  2QQD A;  1Z7K B;  2EYJ A;  3S1R B;  2I0Q A;  5DNF A;  1KDC A;  1QZG A;  2E2J H;  2R7Z G;  2UUA L;  3K5L A;  3LJ1 A;  3HZX A;  4L5R C;  5K5P A;  3LX0 A;  1M90 C;  3S1Q H;  1O7L A;  4DV2 L;  1JJC B;  3I70 A;  1NCV A;  4ME5 A;  1RKN A;  3D4W A;  1UUP A;  2XVS A;  2K5D A;  5J8C A;  1GUO A;  2RHS B;  4FKD A;  2JAE A;  1EQQ A;  4DR3 Q;  2GIV A;  4DV6 L;  2SOB A;  3SGQ I;  2KKM A;  2XNA C;  1X3P A;  1LAC A;  1YVC A;  4DUY L;  1VDZ A;  4CDF C;  3TRZ A;  3C1E A;  5FUY A;  4YZ9 A;  3CQZ B;  4RG1 A;  1G51 A;  3RMH A;  3PIO 3;  1PH6 A;  1Q90 A;  5JJK A;  5LL6 S;  2UZ3 A;  4LK1 C;  1D2B A;  3OWE B;  4DV4 Q;  3TP5 A;  2WP8 J;  3I3C A;  4O2D A;  1GJX A;  5C4J B;  3FSY A;  3S1N B;  1F2Z A;  3KJO A;  1HZC A;  2UUC L;  5BR8 Q;  1WKX A;  1ASY A;  3OMC A;  2C35 B;  1PH5 A;  2B2Y C;  1C0A A;  1LTA D;  2E2H H;  5I6W A;  1XTD A;  1II3 A;  3ICE A;  1H9J A;  3B4V C;  3OVO A;  2P22 B;  2M00 A;  5DAE A;  4H7B A;  4A3M B;  5C5L A;  1VCI A;  1RCV D;  2RF4 A;  4F87 A;  2A6E D;  2E5L L;  3MHB A;  1EWH A;  3NHH A;  1GUN A;  1VQE A;  2WFW A;  4R4I A;  1W4R A;  4OEL B;  1TUS A;  1AW7 A;  2K14 A;  2E2H B;  1YBY A;  3HFZ B;  5M5X H;  2RAD A;  4FVM A;  1TS5 A;  2NU4 I;  4CKB A;  3K57 A;  1MJA A;  2UVO A;  3DEP A;  5LL6 X;  2DJG C;  4HCS A;  1N33 L;  2YFB A;  3J81 E;  4DV1 Q;  1R4P B;  3TO6 A;  5M3F G;  3T53 B;  4IFD J;  4YHH L;  3R3O A;  3OTO L;  4PL3 A;  2EOT A;  2V53 A;  3GP7 A;  1CQV A;  3RN2 A;  1PH9 A;  5A2Q L;  2RCF A;  4BBR B;  1STH A;  4FF1 A;  1NE3 A;  2CHB D;  4JBM A;  2N52 A;  1GOZ A;  5LMN W;  1HR0 L;  1JWM D;  4DWL A;  2TMP A;  1ENA A;  2JA6 G;  3SGB I;  1PVO A;  3M4Y A;  2HHH L;  1HZB A;  3S2H H;  4NMZ A;  1OVO A;  5M5Y H;  1NSN S;  4GKJ Q;  3M85 A;  2PZU A;  2UXC Q;  4JG2 A;  3F4M A;  1XA6 A;  2DIP A;  5JEA H;  5ELO A;  2N88 A;  3P1H A;  2UXD Q;  4UP7 A;  4A3I B;  4GOP C;  1CFM A;  1LTS D;  2UUC Q;  3VR3 A;  3HOY B;  3S14 H;  3VE5 A;  2FUG 1;  3GTM B;  4LF8 Q;  4LF7 L;  1IYU A;  2UXB Q;  1SNP A;  4U6R A;  1X6O A;  1CKN A;  3D6C A;  4A3B B;  2K04 A;  4IUP A;  4A3E G;  4GS3 A;  4X66 Q;  2EDG A;  3V96 A;  1TWG H;  2CQA A;  1VF5 C;  3H0G B;  4JI5 L;  3R5B A;  1S20 A;  4HJ8 A;  2EJF C;  4QUF A;  4V19 0;  2ENZ A;  4AIM A;  3F2D A;  2VQF L;  1ONL A;  3SEK C;  1HZ9 A;  2HQL A;  3GTM H;  2AUJ D;  2JA6 B;  3E0E A;  1W6J A;  1MGS A;  2NZ1 D;  1ULK A;  4G75 A;  2L5T A;  1J6Q A;  2IY5 B;  2ODD A;  3C3L A;  1CT4 I;  4O1N A;  1GXD C;  4KKT A;  2W0T A;  1VF7 A;  3MEH A;  5JJZ A;  4L63 B;  3HOY G;  2A69 D;  2UU9 L;  4B08 A;  1SGE I;  2K6A A;  3AJF A;  1EOV A;  3SHL A;  3CXL A;  4IPG A;  1CHQ D;  1R9T H;  1I4X A;  4JVZ A;  2GN5 A;  3A5U A;  1SNM A;  1IXR A;  3HOV B;  1MD2 D;  3TSS A;  2FMC A;  1YIT A;  4Q9V A;  4BY7 G;  3I73 A;  4KHP Q;  2A2C A;  1JOR A;  3PUW A;  2A8V A;  5C44 H;  1IYV A;  1EL0 A;  1JB7 A;  1QOH A;  2CW0 C;  1N36 Q;  2F0D A;  2NZO A;  3M3Y H;  1UVG A;  1BCP F;  1F2Y A;  5IP9 G;  3DLL A;  4JI8 L;  1IL2 A;  3HOU G;  5E3R A;  3VDY A;  1SDF A;  4EVO A;  2A69 C;  5JOB A;  1CSP A;  3FHW A;  2Q2H A;  2QEX A;  1STY A;  3D8G A;  1KMA A;  1HQM C;  3CHB D;  3OL0 A;  1V1P A;  2F0T A;  5AJ3 L;  5K36 G;  3K58 A;  2LXK A;  1R4Q B;  4KHZ A;  4LF6 L;  3RLN A;  1PA6 A;  3BDL A;  1CA6 A;  3ITP A;  1K8M A;  1KNE A;  3NQI A;  1U0L A;  1GUS A;  1QZH A;  1D6E C;  1SE3 A;  2NZH A;  1Y8N B;  1HNZ Q;  3S15 H;  4R8I A;  3FBV A;  1XNQ Q;  2XRC A;  5E1F A;  1HPC A;  1HA5 A;  2FHT A;  4B3R Q;  2F0U A;  1CI3 M;  3UGL A;  2KCX A;  1SGQ I;  4BY7 B;  2D2C C;  1YZ6 A;  4X3K A;  2F0L A;  3NQT A;  2L12 A;  1K3R A;  4GLX A;  3M9B A;  1ZEQ X;  2MJ8 A;  1IL8 A;  4JI6 L;  3TEH B;  2JEA I;  1A63 A;  3BDO A;  1FAQ A;  5T1G A;  1LUZ A;  2LKV A;  1KDA A;  4BWG B;  1FD7 D;  5ELF A;  2TSS A;  5C3E G;  1X55 A;  4DR2 L;  3AMU A;  3AU7 A;  3KBG A;  4DUY Q;  2F4I A;  2YQP A;  4KN7 C;  2RDG A;  3TS0 A;  4YWM A;  4LMQ D;  3EN2 A;  2O2L D;  3CW2 C;  5CGK A;  2NN6 G;  2JA7 H;  5KGU A;  2E74 C;  1Q9B A;  4XYQ A;  1N8R C;  1K8G A;  4AH6 A;  4HJ5 A;  1N32 Q;  4MIU A;  4NDX A;  1AP0 A;  4IUV A;  4KJO A;  5ELD A;  4RWS C;  1HDL A;  4LUZ A;  1DS3 I;  4LFC Q;  2F66 B;  1SEB D;  2YU9 H;  3J80 L;  2F3I A;  1BVS A;  3QOJ A;  1CHP D;  3T1H L;  3S2D B;  5C4X G;  1CGJ I;  1PZJ D;  2ENB A;  4K6L A;  2ELI A;  2JA5 G;  4I7A A;  3GTL B;  1PYW D;  1B4O A;  2QQC A;  1ET9 A;  2XGT A;  4JI3 L;  3PIP A;  1RTO A;  3FVV A;  5LMN L;  4GKK L;  3V2T A;  4A93 G;  2OEO A;  5JEA J;  4K8J A;  3KOJ A;  4DXG A;  7WGA A;  3EIV A;  3NTI A;  4JV5 Q;  3RR5 A;  2N1A B;  3Q22 A;  1HNX Q;  3Q23 A;  1YEZ A;  1Y1V H;  1FJG L;  2RCN A;  4HIO A;  2CWH A;  1VQK A;  2VUM G;  4M1U B;  4HIK A;  3S2H B;  3QO2 A;  3KBX A;  4I7Z C;  4P73 A;  1VQO A;  3J7A V;  1WGC A;  1KHI A;  4GN4 B;  5BN4 A;  4X3U A;  3SXH A;  3PGZ A;  3OOC A;  4KJN A;  4PL5 A;  1O7Z A;  2MNA A;  2BA1 A;  1LTB D;  1FAR A;  3SK4 A;  1D7Q A;  2F3W A;  2V6E A;  2VRW B;  1CT1 D;  1K28 A;  1PTR A;  3B55 A;  2V1C C;  3QWN A;  1YTP A;  3HOW B;  1FY7 A;  1B8A A;  4MTN A;  4X3T A;  1HXY D;  1TIH A;  4J6H A;  3L9A X;  3QJY A;  1WCM G;  2DN8 A;  3S17 H;  2F52 A;  3HOZ B;  1AE2 A;  3VA9 A;  4DR7 L;  4KHV A;  2ID0 A;  1DOM A;  1ENC A;  2BA0 A;  3K0X A;  2H1E A;  4A3M G;  1PFM A;  4DNT B;  4CJ1 B;  5A2Q E;  5JAV A;  1L0W A;  3QWP A;  3EQL C;  3SDZ A;  2WB1 B;  2BCO A;  2FIN B;  1QCB D;  5G3L F;  1H9R A;  4RGM A;  3PF4 A;  2JA1 A;  1Q1E A;  3KLS A;  2F0O A;  4I1T A;  5EAY A;  4HID A;  5DAU A;  3NSW A;  1FR3 A;  2CH4 W;  1UEB A;  4KK7 A;  5BN3 A;  2I07 B;  2VUM H;  2CFM A;  1XYI A;  3NE5 B;  1BXT A;  1E7Z A;  3P75 A;  1JQY D;  1W3S A;  5M3F B;  5FJ8 H;  4KD4 A;  2F0F A;  3ERQ A;  1PH1 A;  4GKK Q;  1WOC A;  5IGB A;  3CCQ A;  1CM9 A;  3AFP A;  1G6P A;  3TO7 A;  1JIC A;  5I9P A;  3CCM A;  3MAQ A;  4B3S L;  5J22 A;  1HNW Q;  1IYJ B;  1L1O B;  3HOZ G;  3MXU A;  4HSV A;  5G3L D;  4A3G B;  5EX0 A;  4NP5 A;  5I4D A;  3BDC A;  2EXZ A;  5IOC A;  4P71 A;  3KUP A;  1Y69 U;  3SVM A;  1SE4 A;  2RIJ A;  1A2T A;  3SK6 A;  1YJW A;  1PH7 A;  3OXF A;  1Q81 C;  1VQ5 A;  3BJI A;  2Z4I A;  3PUY A;  4QUC A;  2Q8R E;  2WAQ E;  4OEM B;  1OO9 B;  4DN4 M;  5E7N A;  5JPM C;  3L0I A;  4LFC L;  5HUR A;  2K05 A;  1HQR D;  1I3Q H;  1UE7 A;  3L7Z C;  3KDF B;  2XTQ A;  3CQZ H;  2XMX A;  3RZD B;  3AQQ A;  1KC8 C;  1VQ4 A;  3LWU A;  3A54 A;  2NU2 I;  3QB3 A;  2NVY B;  2NN6 H;  2JA7 G;  1NY4 A;  3OTO Q;  3UIT A;  3P23 A;  3BG3 A;  3QG1 A;  1X9N A;  4G57 A;  2KEC A;  5C6A A;  2Q8I B;  2PO4 A;  1CZW A;  1ICF B;  2WAC A;  4X66 L;  2IX1 A;  4Z7G A;  4OVO A;  3F2B A;  2VQE L;  5EPK A;  1TBN A;  3FDT A;  4DPG A;  3IRB A;  5COR A;  1M8C A;  3F2C A;  4IOC A;  3JSB A;  4A3K H;  2RKS A;  4A3L G;  4AQY L;  3LNN A;  4LUV A;  2NN6 I;  3RLO A;  3HEJ A;  5J1Z A;  1G29 1;  2D9U A;  3OWF A;  1IBK Q;  3IKJ A;  4OWW B;  3J81 j;  4LF6 Q;  5FO8 B;  1P8L A;  4QY7 A;  4U67 3;  2EY5 A;  1ILQ A;  1J5E L;  1PZI D;  2N49 A;  5KEE A;  1PTQ A;  3Q0A A;  1PH4 A;  1FGB D;  4HCE A;  4RCO A;  1RL2 A;  4SGB I;  3R5A A;  3HOV H;  3ZYY X;  1S72 A;  5C5M A;  1D8L A;  1LTT D;  3GTQ H;  1PTO H;  2F1M A;  2EYF A;  2F0I A;  4BXX H;  2HUG A;  4KHP L;  2MUY A;  2J4X A;  2JBW A;  2PQA B;  3I8Z A;  3OXG A;  4DR7 Q;  4YY3 L;  4P72 A;  3UE1 A;  2B8F A;  1X54 A;  2FXQ A;  1B2T A;  4CKC A;  4R4T A;  3KLR A;  4KTA A;  1S5F D;  3CCS A;  3DO9 A;  2KHS A;  3J80 E;  1SNC A;  3MXN A;  1LR9 A;  4PMC A;  2PNR C;  5HY6 A;  3DMU A;  3FKI H;  4IZ8 A;  4LFB Q;  2PNH A;  4RGT A;  4G7H C;  1PYB A;  2C5C A;  4A4I A;  2K9H A;  2UUB Q;  2CVR A;  3TO9 A;  4F88 A;  3CC7 A;  5FKA C;  1KL9 A;  3VR5 A;  1J9O A;  3GTQ B;  2JZM A;  1F2L A;  2F0S A;  4A3B H;  4DR1 Q;  5L37 A;  1SMX A;  3URY A;  1I6H H;  4K0K L;  2HCC A;  5IWA Q;  4CDE C;  3J80 i;  2F0W A;  2MO0 A;  1H9S B;  2XRQ D;  4DK1 A;  2GSC A;  5CMD A;  5GAE C;  3NBH B;  3C1F A;  4IUN A;  1K0S A;  1OMT A;  2B2Y A;  2AWO A;  2RSN A;  1V8Q A;  4KLK A;  1IZ6 A;  2RQX A;  1X74 A;  4A3I G;  1NMF A;  1SAP A;  4YWL A;  1CT0 I;  1PRT C;  3FKI G;  2DNC A;  4IAL A;  5DEH A;  2Z9H A;  4XQJ A;  2N71 A;  4IFD I;  5JJI A;  1B3A A;  1WFQ A;  1SN8 A;  4CGY B;  2QCP X;  3MXN B;  3S1R H;  1WTO A;  4XTC S;  3TS2 A;  4FNF A;  1SMY C;  2K4K A;  4JI8 Q;  3M7N A;  1PDQ A;  2AQ3 B;  3P20 A;  5IYB H;  2A19 A;  2KOL A;  4HJ9 A;  1FGU A;  3FP9 A;  1MJC A;  1TII D;  1KXL A;  2RDF A;  2E2D C;  2KHJ A;  3OW2 A;  4DR4 L;  2BH2 A;  3CCR A;  2WCY A;  4ABN A;  2R93 H;  4Y7N H;  5KNC A;  1BUS A;  2YFA A;  1WGT A;  3KFU A;  2OT2 A;  4HN7 A;  4C3J B;  4B6D A;  2SDF A;  3UDG A;  4LJZ C;  3D31 A;  3H91 A;  2JA5 H;  1KD1 C;  3LJ0 A;  2PQE A;  1JB3 A;  4CJ0 B;  1EY5 A;  3SK8 A;  2F0Q A;  4J15 A;  1PTO F;  1YJ9 A;  1L0X B;  3BYY B;  4X6A H;  2BUS A;  2CWF A;  1HCZ A;  4BBS H;  3OSO A;  4XYO A;  1JT8 A;  2EJM A;  1TWF B;  3S16 H;  3M4O B;  1XPR A;  1ZYR D;  3EBE A;  3R2T A;  1XPU A;  5D3D A;  4HED A;  1SJH D;  1QVF A;  4G7O C;  3K7U C;  1H9M A;  3PCO B;  1A3V A;  2JW6 A;  2L1B A;  2PCF B;  1UWV A;  3AYH B;  4GN3 B;  3VR4 A;  3GTO H;  1YNN C;  4DAP A;  3H94 A;  4MN3 A;  3T16 A;  1FYC A;  2G5D A;  1LT5 D;  3BZD B;  1IBL Q;  5J8F A;  2KBN A;  1H95 A;  3STB C;  3P7J A;  2MGS A;  3MZ5 A;  1SGY I;  1I6V C;  1NNX A;  3MA2 B;  5DM7 3;  4L5Q A;  2WII B;  4EX5 A;  5CV8 A;  4L6T B;  1E24 A;  1E1T A;  1PTO D;  4IPC A;  2L0C A;  5KYL A;  2JP1 A;  3M4Q A;  3R2I A;  1Y8O B;  5C3W A;  1BUV T;  1IW4 A;  4HAE A;  1WD1 A;  3GTK H;  2ENN A;  1JQO A;  4PZ6 A;  1GUW A;  1Q86 C;  1HPT A;  3H15 A;  3R5D A;  5IOD A;  4LF5 Q;  4NB3 A;  3OIQ A;  3VR2 A;  5BN5 A;  3M3Y B;  3HOZ H;  2Y0S B;  1CKM A;  1LM0 A;  1SYF A;  3F1Z A;  4AYB G;  4K5X A;  3HKZ B;  3E6Z X;  2P5Z X;  4N8X 1;  2KVM A;  2QA4 A;  4POG A;  1HNX L;  3A8I E;  5FLX L;  2L9H A;  3U9S A;  2R3Z A;  5FJ8 G;  3GTO B;  5HGT A;  1F77 A;  3W5O A;  1HZA A;  2KEE A;  5D65 A;  3CCU A;  1WTP A;  2EY1 A;  1GUG A;  5C3E B;  2M9V A;  4JBK A;  1LR8 A;  3GTG H;  1DON A;  3HOW H;  1SND A;  2NUC A;  4JI4 L;  3K5N A;  2B2T C;  1ZYR C;  1JMC A;  1I4R A;  2KMQ A;  1A8V A;  1Y1V B;  4HJ7 A;  1YHQ A;  3ERO A;  2PMZ B;  1S5B D;  1XMQ Q;  1V1P B;  3UDI A;  3NTK A;  3JC6 6;  1CK1 A;  1S40 A;  1VQP A;  2HD3 A;  3FSX A;  2B8T A;  2Y0S G;  4JI5 Q;  2C9O A;  3T1Y L;  2QPO A;  2PI2 E;  2Q2T A;  3U4V A;  1IW7 D;  2MQH A;  1WTJ A;  4EQ5 A;  3NBH A;  4S3S A;  3S1Q B;  2F4V Q;  1SYC A;  1FL0 A;  1DGS A;  3PO3 G;  3CCE A;  2JA5 B;  4TSS A;  1UE6 A;  2IX0 A;  1DS2 I;  2F4V L;  4PV1 C;  1MSG A;  1C8C A;  2NVX H;  3UOE A;  3HKS A;  1R0R I;  4HSP A;  4L5T A;  4KY6 A;  4J8Q A;  1KAA A;  3HKZ E;  5IT9 c;  4N8F A;  2UXD L;  3PUV A;  1V9P A;  2RC4 A;  2IPK D;  3U9O A;  3OPO A;  2VL6 A;  5NUC A;  4DAV A;  2NTT A;  3CMA A;  1STB A;  4PNY A;  4QIW E;  1Y1V G;  5JEA G;  3G48 A;  2K52 A;  2JA7 B;  1VQG A;  3GDE A;  4DV3 Q;  5I6Y A;  1FVI A;  3A55 A;  3BJU A;  5ELC A;  1IBM L;  2ZW3 A;  4C2M B;  4M8A A;  1Y1W G;  4JI0 L;  4DV2 Q;  1N34 L;  5LMU L;  1PMR A;  2N78 A;  4JOI C;  1NUC A;  2JJQ A;  2QF7 A;  5HI7 A;  1VQD A;  5FO9 B;  4PQX A;  5M9O A;  4DUZ L;  1Q1B A;  2B63 B;  2FNF X;  3TN2 A;  5IY0 A;  1PFS A;  1VS0 A;  2EYO A;  1ZKO A;  3J81 L;  4WOR A;  1GM5 A;  4UXJ A;  3TP8 A;  1PV4 A;  2R7Z B;  1VQA A;  4HGU A;  3UEJ A;  4UPA A;  1L2F A;  1YNX A;  1VQ8 A;  3S1N H;  3BVG A;  3LGJ A;  5CV9 A;  4ZQ3 A;  2SGP I;  2DY7 A;  1YNN D;  1KRS A;  4GNX C;  2QW7 A;  4BBS B;  3MC0 B;  3DM1 A;  5C0X J;  4YWK A;  1QNU A;  1RD9 D;  4B3R L;  4DV6 Q;  1M8B A;  1A0I A;  4KKS A;  1EWC A;  4OWT B;  1P9G A;  2D62 A;  2DY8 A;  4QB4 A;  1A2U A;  4K6D A;  4O42 A;  5FLX c;  2IP6 A;  4ZYS A;  3RZO B;  4FF4 A;  1HA6 A;  2ICI A;  2GVI A;  1SNQ A;  2H5X A;  5EBC A;  4TQU S;  1GD7 A;  3RLF A;  2I5H A;  5EKL A;  1Y1W H;  3ND9 A;  2UUA Q;  2F0J A;  4YCW A;  1VQ9 A;  1EOT A;  2BDN A;  1E2V A;  2I5M X;  1FJG Q;  4GLA C;  2X69 A;  2SGQ I;  4K2K A;  4JCV E;  1Q3L A;  2KJX A;  5BR8 L;  3I4N G;  2XSC A;  4ODG A;  3PF5 A;  4WJW A;  2MJF B;  1E3P A;  1I4H A;  1EIF A;  3RZO H;  1U4P A;  3KY9 A;  2E8G A;  4EQP A;  1CE3 A;  4XQQ A;  2WIN B;  4CDC C;  2RBM A;  3D4R A;  3NEN A;  5D3I B;  9WGA A;  1I94 L;  1WJJ A;  4IFD G;  2HGK A;  1E2Z A;  4BBS G;  3QAH A;  1YIJ A;  1I50 B;  2Z6K A;  3K8A A;  5IP7 G;  3EJI A;  1EU3 A;  3A8J E;  2KMO A;  1U9R A;  3FPU B;  3KLS X;  2F0P A;  1BO0 A;  1TS4 A;  4O1P A;  1VQF A;  1RHP A;  2K5H A; 
#chains in the Genus database with same CATH homology
 4DR2 Q;  4I1T A;  5EAY A;  4HID A;  1GKH A;  3GTL H;  3CCV A;  1Q8K A;  1UEB A;  4DUZ Q;  2R92 G;  3UEY A;  2VUM H;  2CFM A;  4GNX B;  1I50 H;  2PI2 A;  3CC4 A;  1HNZ L;  3PO2 H;  2DB6 A;  3S2D H;  3GD7 A;  4DV1 L;  1E7Z A;  1MKH A;  1W3S A;  4LF4 Q;  5FJ8 H;  1IY5 A;  3PO2 G;  2UUB L;  1OMU A;  1SGR I;  1XMQ L;  1V1I A;  1Q82 C;  4HJA A;  2MO1 A;  4YCU A;  4A93 H;  4X65 L;  1Q46 A;  4GXT A;  2L7X A;  1QVC A;  2R93 G;  3HOW G;  2PMZ E;  1PH1 A;  4GKK Q;  1WOC A;  2HT1 A;  1S3O A;  3T1Y Q;  3CCQ A;  2AHO B;  2VZA A;  3U50 C;  2OQ0 A;  4DV3 L;  3AFP A;  1QUQ B;  1G6P A;  4FDB A;  4APV A;  3CCM A;  3W1B A;  4YZC A;  1UE1 A;  4B3S L;  4UY8 C;  3B6Y A;  1IYJ B;  1L1O B;  2K50 A;  3HOZ G;  1HNW Q;  2N17 A;  1M1K C;  1VQI A;  2JE6 I;  1CKO A;  3CF5 A;  4A76 A;  1T9H A;  1VQL A;  4LF9 L;  1BBW A;  4P71 A;  1Y1B A;  4NXM L;  1YO7 A;  4O1O A;  4A3G H;  3KF6 B;  3F8T A;  1NBW A;  4ALP A;  1YJW A;  1YJN A;  1PH7 A;  4OO1 G;  3HH2 C;  1Q81 C;  3WWV A;  1VQ5 A;  4LF8 L;  4WJ3 M;  3BJI A;  3E2I A;  1UE5 A;  3PUY A;  1CSQ A;  2WAQ E;  1X3F A;  3ER0 A;  5FUX A;  1XMO Q;  5E7N A;  3VDU A;  3L0I A;  1EYG A;  2EXD A;  2KEN A;  4LFC L;  4JI0 Q;  4DK6 C;  4LNQ A;  1EFW A;  3G6E A;  4OAU C;  1I3Q H;  1UE7 A;  3L7Z C;  3OYY A;  3KDF B;  4IPH A;  2XTQ A;  1IY6 A;  1WYD A;  4JI3 Q;  3CQZ H;  3BZK A;  4GN5 A;  2XMX A;  4DR6 Q;  3AQQ A;  4NXM Q;  3MEK A;  1KC8 C;  1HH2 P;  4KI0 A;  1W2B A;  1VQ4 A;  1TOT A;  4WJ4 A;  1TWC H;  3D00 A;  4OXP A;  3CC2 A;  2NU2 I;  5EX0 A;  1PYS B;  4BY1 H;  1Q7Y C;  4DR6 L;  1TGS I;  1N13 A;  2JA7 G;  3HOX G;  1NY4 A;  3DA4 A;  3OTO Q;  5HGI A;  3UIT A;  4A3B G;  1SLJ A;  3IAS 1;  3P23 A;  2YUU A;  4BBR H;  1X9N A;  4JI7 L;  1K9M C;  1IBK L;  4IPD A;  4DV7 L;  2DGY A;  2D0P A;  2NU1 I;  4R4O A;  3GTJ H;  1OTC A;  1SGP I;  4BY7 H;  2HIV A;  3ERS X;  4X66 L;  2IX1 A;  4Z7G A;  3UGD A;  4NV5 A;  4OVO A;  3F2B A;  4A3C G;  2JA9 A;  3JAM c;  2VQE L;  1TBN A;  2GKT I;  4DPG A;  4UP9 A;  3IRB A;  4A3G G;  2YTX A;  3PIO A;  3I4N H;  5GQO A;  2YTV A;  1M8C A;  2B63 H;  1SE8 A;  4C2M H;  3F2C A;  4JI1 L;  4IOC A;  2R7D A;  2YTY A;  3KLW A;  2OTJ A;  3JSB A;  3CAM A;  3PSI A;  3HOX H;  3PO3 H;  3KJP A;  2CAZ B;  1TWA H;  5GAH C;  4A3E H;  4A3K H;  4A3L G;  1NTG A;  4AQY L;  2SGD I;  2KHI A;  1C7Y A;  4UXH A;  3G4S A;  4LUV A;  1VQC A;  2NN6 I;  2XTI A;  2IHE A;  3RLO A;  4QJF A;  1VQM A;  2KCM A;  3CME A;  2N3S A;  5J3B A;  2Y0S E;  2QQD A;  2ROW A;  1Z7K B;  2MFI A;  3L0O A;  1ASZ A;  1G29 1;  2I0Q A;  1IBK Q;  1BMO A;  5IP9 H;  4OWW B;  3J81 j;  2Z0S A;  1QZG A;  2E2J H;  2Q2U A;  4LF6 Q;  2R7Z G;  4B3M Q;  2UUA L;  4GI3 C;  1P8L A;  4QY7 A;  4A24 A;  3LJ1 A;  5ELN A;  1J5E L;  4L5R C;  2N49 A;  1PTQ A;  2OD1 A;  1M90 C;  3S1Q H;  3OXG A;  1NMG A;  4DV2 L;  1JJC B;  1PH4 A;  2VW9 A;  4JYA Q;  1RL2 A;  4PZ8 A;  4P74 A;  4SGB I;  1A62 A;  3HOV H;  1S72 A;  2RHS B;  4FKD A;  1D8L A;  5EX3 A;  3STB D;  2JAE A;  1EQQ A;  4DR3 Q;  2OTL A;  4DV6 L;  2UXB L;  3SGQ I;  4YCV A;  2E5L Q;  3ULL A;  3HOV G;  3GTQ H;  2KKM A;  2Z6K C;  4PG3 A;  3J81 i;  3PUX A;  3CD6 A;  4BXX H;  4DUY L;  1YVC A;  4DR4 Q;  2E2I H;  3TRZ A;  4KHP L;  4DR5 L;  5FUY A;  4YZ9 A;  2PQA B;  2A2D A;  4RG1 A;  1G51 A;  4PMW A;  1CSO I;  4DR7 Q;  4YY3 L;  5GAG C;  5IE8 A;  1PPF I;  4P72 A;  1PH6 A;  3UE1 A;  3HKZ G;  1JE5 A;  1SRU A;  1YI2 A;  5JJK A;  1X54 A;  2FXQ A;  2JA8 H;  2UZ3 A;  4R4T A;  4DV4 Q;  2WP8 J;  3CCS A;  3DO9 A;  4DK3 C;  4YY3 Q;  1H0Z A;  4O2D A;  5DLQ E;  1LR9 A;  1VQ7 A;  5HY6 A;  2F6M B;  4DNI A;  2CQO A;  3KJO A;  3G71 A;  1HZC A;  4GNX A;  3U58 A;  2UUC L;  5C44 G;  5BR8 Q;  3FKI H;  4A3L H;  4LFB Q;  2PNH A;  3E59 A;  1ASY A;  4RMF A;  3IAM 1;  4YZD A;  3J7Z C;  1PYB A;  4X65 Q;  1BBU A;  2C35 B;  1V43 A;  3S24 A;  1SRO A;  4A4I A;  1PH5 A;  2UUB Q;  1X56 A;  5H1S E;  1C0A A;  2K9H A;  2R6G A;  2E2H H;  4JI4 Q;  1XTD A;  3CC7 A;  3ICE A;  5CCL A;  3B4V C;  1KL9 A;  3OVO A;  4L9M A;  2P22 B;  5C4J H;  1CGI I;  2JZM A;  2JA6 H;  5DAE A;  4A3B H;  2RIO A;  1B7Y B;  4DR1 Q;  1VCI A;  3M4O H;  2L8E A;  3OXF A;  2RF4 A;  5M3F H;  1SMX A;  5IYB G;  2E5L L;  1I6H H;  4K0K L;  4IJH A;  5IWA Q;  5IYC H;  5M5W H;  2WB1 G;  4Z7H A;  4A3C H;  3J80 i;  1VQE A;  2MO0 A;  4POF A;  2WFW A;  5GAE C;  4R4I A;  4DV7 Q;  3NBH B;  3FC3 A;  1W4R A;  4LFA Q;  1OMT A;  1TUS A;  1Y8F A;  2K14 A;  2AWO A;  1TXY A;  1YBY A;  3HFZ B;  5M5X H;  4A3I H;  3SDJ A;  4A3J G;  2LEO A;  4KLK A;  4X62 Q;  1IZ6 A;  2ATW A;  1TBR R;  2IT1 A;  2K19 A;  2AMC B;  4NPS A;  1AN1 I;  2NU4 I;  1PH3 A;  2VS1 A;  1X74 A;  4A3I G;  1NMF A;  5JJL A;  1PJU A;  4YWL A;  4NV2 A;  4A3F G;  1BKB A;  1CT0 I;  1V1H A;  1X3G A;  3FKI G;  2RHQ B;  2GKR I;  2LXJ A;  1N33 L;  2YFB A;  4DV1 Q;  1KQS A;  2BH8 A;  2K5V A;  4LF5 L;  1CHO I;  5JHW C;  4G76 A;  5M3F G;  4IFD I;  2N71 A;  1M8B A;  4IFD J;  5JJI A;  2NU3 I;  2QQE A;  4YHH L;  1QUQ A;  1WFQ A;  5IYD G;  3ULP A;  1SJ8 A;  1SN8 A;  4PL3 A;  3OTO L;  4A75 A;  1SGN I;  3MXN B;  3Q8D A;  1Z47 A;  2K5N A;  3RN2 A;  3S1R H;  2V53 A;  1PH9 A;  4GLV B;  1EUJ A;  4XTC S;  3TS2 A;  1VQJ A;  1NE3 A;  4LUO A;  1TUR A;  1L1O A;  1K8A C;  3I4O A;  4JBM A;  2K4K A;  4JI8 Q;  2N52 A;  2OVO A;  3GTP H;  3M7N A;  5LMN W;  5IYB H;  1HR0 L;  2A19 A;  3TRE A;  4DWL A;  4HJ9 A;  1FGU A;  2JA6 G;  3SGB I;  3FP9 A;  3K81 C;  1MJC A;  4QL5 A;  3UDX A;  4DAM A;  2JEB I;  4JI6 Q;  1KXL A;  1PVO A;  3ZJY C;  2KHJ A;  1HZB A;  4DV5 Q;  3OW2 A;  2HHH L;  4C3I H;  4DR4 L;  3S2H H;  2BH2 A;  3PV0 A;  3CCR A;  1OVO A;  5M5Y H;  2WCY A;  1XMO L;  5FUV A;  2R93 H;  1LR7 A;  1TWF H;  4Y7N H;  3RU0 A;  3GO5 A;  4GKJ Q;  2YFA A;  1BUS A;  3M85 A;  4H02 A;  4BA2 I;  1XNR Q;  3KFU A;  2UXC Q;  4JG2 A;  4B6D A;  3F4M A;  1XA6 A;  1YU6 C;  2DIP A;  1L1O C;  5GRO A;  3UDG A;  2N8N A;  5ELO A;  2UXD Q;  3D31 A;  4R4Q A;  4UP7 A;  4LF9 Q;  4GOP C;  1KBE A;  2UUC Q;  1K83 H;  1J5E Q;  2ZJR A;  3I7F A;  2JA5 H;  3S14 H;  1KD1 C;  3LJ0 A;  2FUG 1;  2AKW B;  1KIX A;  3VE5 A;  3UGL A;  3PDN A;  3TJQ A;  2I5L X;  4J15 A;  2BUS A;  3I56 A;  1YJ9 A;  3UE0 A;  4LF7 L;  4LF8 Q;  2B63 G;  4X6A H;  4DR3 L;  4BBS H;  2UXB Q;  1JT8 A;  4U6R A;  1X6O A;  1CKN A;  4A3D G;  2KCT A;  4E1P A;  3A74 A;  3S16 H;  4A3E G;  4GS3 A;  1XPR A;  3EBE A;  4X66 Q;  1XPU A;  2WB1 E;  1GO3 E;  1TWG H;  3J81 c;  1QVF A;  3H3V I;  4A3F H;  3J7A 5;  3K7U C;  5HGQ A;  1LTL A;  4BBR G;  1X3E A;  3PCO B;  2VQF Q;  3AYH B;  1IBL L;  1UWV A;  4GN3 B;  3GTO H;  2JW6 A;  4JI5 L;  2CJS C;  1R79 A;  3CXC A;  1QVG A;  4HJ8 A;  2R7Z H;  1HR0 W;  2JYY A;  2ENZ A;  3KP9 A;  5CCM A;  4AIM A;  3F2D A;  2VQF L;  2XTR A;  5LMU Q;  1IBL Q;  3SEK C;  1HZ9 A;  2HQL A;  2KBN A;  3GTM H;  4A3M H;  1H95 A;  2ZTC A;  3E0E A;  3STB C;  1CT2 I;  1V1Q A;  2ARP F;  4JI2 Q;  4G75 A;  1SGY I;  3J80 c;  3VDP A;  4L5Q A;  4AQY Q;  1J6Q A;  4JC0 A;  4EX5 A;  1OYV I;  1X4S A;  4A3K G;  4BY1 G;  1E22 A;  2R7F A;  3AFQ A;  2IY5 B;  2ODD A;  4DV0 L;  1E24 A;  2KMR A;  1E1T A;  4IPC A;  4B3M L;  4AS3 A;  2OWO A;  1U5K A;  4LFB L;  1CT4 I;  3M4Q A;  1VQH A;  1CUK A;  3T1H Q;  2W0T A;  2VQE Q;  1IW4 A;  4UP8 A;  1NUB A;  2IHF A;  3BU2 A;  3HOY G;  5IP7 H;  3GTK H;  2ENN A;  2UU9 L;  4PZ6 A;  1SGE I;  4OX9 Q;  2D0O A;  3AJF A;  1EOV A;  2L15 A;  4JBW A;  4IPG A;  4QGU A;  4NB3 A;  3H15 A;  1R9T H;  4LF5 Q;  2A20 A;  3CXL A;  2J9R A;  2GN5 A;  3A5U A;  1IXR A;  3CCL A;  1MIU A;  1PHJ A;  1Z9F A;  1YIT A;  4A3D H;  4Q9V A;  2PQA A;  4BY7 G;  4KHP Q;  3HOZ H;  3A0J A;  1HPT A;  2A2C A;  1CKM A;  3NEL A;  2JK8 A;  3PUW A;  5C44 H;  2A8V A;  2NVQ H;  1LM0 A;  1JB7 A;  1UUC A;  2ZRR A;  3F1Z A;  1Y1C A;  4AYB G;  1N36 Q;  2NZO A;  3M3Y H;  1UVG A;  5IYC G;  1IL2 A;  5IP9 G;  1O7I A;  3DLL A;  1YHB A;  3H0G G;  4JI8 L;  3KYH C;  4DV4 L;  4MNO A;  3HOU G;  4GOP B;  3S1M H;  2QA4 A;  3VDY A;  4POG A;  1HNX L;  3KF6 A;  4BA1 I;  4PZ7 A;  4JYA L;  1N9W A;  2CWP A;  3H0G H;  5FJ8 G;  1SFO H;  3W5O A;  3UDF A;  5IWA L;  1CSP A;  3FHW A;  2Q2H A;  1TBQ R;  2GKV A;  1HZA A;  2ZJP A;  3CCU A;  2QEX A;  4DV5 L;  2KMP A;  1KMA A;  1Y14 B;  3OL0 A;  5AJ3 L;  5K36 G;  2LXK A;  1OXV A;  4KHZ A;  4DAY B;  3RLN A;  4JBK A;  4LF6 L;  1LR8 A;  1PA6 A;  2GVA A;  3CPF A;  2YYZ A;  2NVY H;  4XIG S;  1N36 L;  3GTG H;  1JJG A;  3LJ2 A;  3HOW H;  2B0U C;  5GAD C;  1XX6 A;  4JI4 L;  1U0L A;  1HNW L;  1QZH A;  1K73 C;  2VNU D;  2EQS A;  2NZH A;  2B3G A;  4UXI A;  2LUY A;  1HNZ Q;  3E9I A;  5M3M G;  1JMC A;  1FYB A;  5LMN Q;  4B3T L;  2KMQ A;  1A8V A;  3S15 H;  4JI1 Q;  3FBV A;  1XBT A;  4HJ7 A;  1YHQ A;  1XNQ Q;  1UVF A;  2XRC A;  3CP0 A;  5C0X G;  1XMQ Q;  1I94 Q;  5C3E H;  4B3R Q;  3UDI A;  1N32 L;  3E9H A;  4GOP A;  2ASB A;  3JC6 6;  4OWX B;  2B29 A;  1NJI C;  1SGQ I;  1S40 A;  2KCX A;  2QQ0 A;  1VQP A;  4Y52 H;  1E1O A;  1VQB A;  1YZ6 A;  2B8T A;  1TWH H;  1K0R A;  2Y0S G;  1KRT A;  1LYL A;  4GKJ L;  3CCJ A;  3T1Y L;  4JI5 Q;  4JBJ A;  4BXX G;  1PCE A;  2QPO A;  2PI2 E;  2L1L B;  5IYD H;  2J87 A;  4GLX A;  1K3R A;  2Q2T A;  3M9B A;  1TBO A;  3I4M G;  3U4V A;  2ORW A;  1OXS C;  2MQH A;  4EQ5 A;  4HFV A;  1C9O A;  3TEH B;  4JI6 L;  2HIX A;  3SGI A;  2F4V Q;  2JEA I;  1A63 A;  4LWC A;  2K75 A;  1FL0 A;  2SGE I;  1B70 B;  1DGS A;  2EIF A;  1CKN B;  5FLM H;  3CCE A;  3PO3 G;  1FAQ A;  1LUZ A;  3KDF A;  1UE6 A;  2IX0 A;  4IJL A;  1DS2 I;  2F4V L;  2ZTD A;  5C3E G;  4LW1 A;  1X55 A;  4DR2 L;  2NVX H;  3HKS A;  4HEA 1;  2CCZ A;  1R0R I;  4L5T A;  4DUY Q;  2ORV A;  3I2Z A;  4TVA B;  1AE3 A;  1RFH A;  3HKZ E;  2YQP A;  2Q2I A;  5IT9 c;  3UFF A;  1VQ6 A;  1Q12 A;  4R1J A;  2UXD L;  3PUV A;  1V9P A;  4X62 L;  3TS0 A;  4YWM A;  2OCE A;  4R4C A;  2GVB A;  4OX9 L;  3EN2 A;  3KF8 B;  3CW2 C;  2VL6 A;  3K7A H;  2NN6 G;  3CMA A;  2JA7 H;  4QIW E;  2ALY B;  4NXN Q;  1N8R C;  2JB2 A;  1Y1V G;  4C3H H;  4AH6 A;  4P75 A;  2OQK A;  5JEA G;  4HJ5 A;  3G48 A;  1N33 Q;  1N32 Q;  2K52 A;  1VQG A;  3GDE A;  4DV3 Q;  1XNQ L;  1AH9 A;  5FLM G;  4NXN L;  3NEM A;  3DM3 A;  1FVI A;  3BJU A;  1IBM L;  1XNR L;  3BZC A;  3U4Z A;  2ZM6 L;  3I4M H;  4LUZ A;  1HDL A;  1DS3 I;  4JI0 L;  4JOI A;  2F66 B;  1Y1W G;  4LFC Q;  1XPO A;  5HQ8 A;  2YU9 H;  4DV2 Q;  3OXL A;  1N34 L;  2F3I A;  3JAM i;  2DUD A;  4JOI C;  1BVS A;  2N78 A;  5LMU L;  3H3V H;  2JA8 G;  3T1H L;  5C4X G;  1CGJ I;  2JJQ A;  1HJA I;  5HI7 A;  3TQY A;  1VQD A;  5AJ3 Q;  4DUZ L;  2F3C I;  3W1G A;  2UU9 Q;  2ZJQ A;  1Q1B A;  2ELI A;  2JA5 G;  2E73 A;  3MEF A;  2FNF X;  5IY0 A;  2QQC A;  1EQR A;  1PFS A;  1VS0 A;  2YV5 A;  1Q86 C;  4LF4 L;  2P6A C;  1GM5 A;  4AYB E;  1I5F A;  2XGT A;  3I9V 1;  4UXJ A;  4JI3 L;  4AS2 A;  3PIP A;  1PV4 A;  1VQA A;  1IBM Q;  2ES2 A;  3DA3 A;  4UPA A;  1L2F A;  1YNX A;  2UXC L;  4HGU A;  3L2P A;  3UEJ A;  5LMN L;  1YHA A;  1VQ8 A;  4B3T Q;  3S1N H;  4GKK L;  4A93 G;  2A1A A;  2QGQ A;  3LGJ A;  5JEA J;  1MT1 A;  1SGD I;  3KOJ A;  2ERW A;  4OON A;  1N34 Q;  2SGP I;  3GOX A;  2NU0 I;  3EIV A;  1P16 A;  2HHH Q;  2VY3 A;  3RR5 A;  4IO9 A;  1KRS A;  4GNX C;  4X64 L;  1HNX Q;  4JV5 Q;  2N1A B;  5C0X J;  5C0X I;  1YEZ A;  4YWK A;  2E5R A;  1Y1V H;  1FJG L;  4B3R L;  3RZD H;  2RCN A;  4HIO A;  2R92 H;  4DV6 Q;  3HOU H;  1A0I A;  2LSS A;  4OWT B;  1VQK A;  2VUM G;  4HIK A;  4JI7 Q;  2D62 A;  3I55 A;  4P73 A;  1VQO A;  3HOY H;  1KBF A;  2JB1 A;  1KHI A;  1RIP A;  3PUZ A;  4GN4 B;  1VQN A;  2V1C A;  2JXD A;  2NVT H;  5FLX c;  2IP6 A;  4DR5 Q;  2GVI A;  1OXU A;  2H5X A;  2AWN A;  4TQU S;  4QQB X;  1GD7 A;  1MJE A;  3PGZ A;  3RLF A;  4MZ9 A;  2I5H A;  1Y1W H;  2UUA Q;  4A3J H;  4OAV B;  4PL5 A;  4YCW A;  2MNA A;  1VQ9 A;  1VDD A;  1JJ2 A;  4LF7 Q;  2BA1 A;  2I5M X;  1FJG Q;  4PL4 A;  1KAW A;  2WAQ G;  4GLA C;  5C4X H;  3RN5 A;  1HR0 Q;  4IOA A;  2CWA A;  4JV5 L;  1D7Q A;  1FAR A;  2SGQ I;  2V6E A;  3K80 C;  4OO1 I;  4JI2 L;  4JCV E;  1K8G A;  1PTR A;  2VRW B;  5BR8 L;  3I4N G;  2WVJ A;  4ME3 A;  4E1R A;  3PF5 A;  1EIY B;  2V1C C;  4DKA C;  4HIM A;  4C3J H;  1PH2 A;  2MJF B;  3D0F A;  1YTP A;  1WCM H;  1B8A A;  1E3P A;  4MTN A;  1EIF A;  4DV0 Q;  3CPW A;  3RZO H;  1TIH A;  3QTL D;  3KY9 A;  1GVP A;  2E8G A;  1X65 A;  1CE3 A;  3AEV A;  3ULJ A;  4L5S A;  3RNU A;  1WCM G;  1WI5 A;  3S17 H;  5LNK 1;  2F52 A;  1AE2 A;  2CKZ B;  4O0A A;  3VA9 A;  4DR7 L;  2ID0 A;  3M4P A;  1HJP A;  3NEN A;  1OXX K;  2BA0 A;  3A5Z B;  1EWI A;  3K0X A;  2ZTE A;  4X64 Q;  1WJJ A;  4A3M G;  1I94 L;  4IFD G;  4K0K Q;  2M5X A;  5FUW A;  1PH8 A;  4BBS G;  1YIJ A;  1L0W A;  1SR3 A;  3QWP A;  2Z6K A;  4DR1 L;  2JQO A;  3K8A A;  5M3M H;  5IP7 G;  2KMO A;  4YHH Q;  1OXT A;  1XJV A;  4LFA L;  2JB3 A;  2SGF I;  4O1P A;  2ZM6 Q;  3PF4 A;  3UGI A;  1VQF A;  2JA1 A;  1Q1E A;  4B3S Q;  2K5H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...