1U5KA

Recombinational repair protein reco
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
243
structure length
242
Chain Sequence
RSRTANRSGIVIRRRVTPAGDIIVTLLTPQGKLKAIARGGVKGPLSSSLNLFHHVGVQVYQGPHDLASVKQAVLEGALPTLAEPERYAFAHLMAEFADALFQEGEFSEQAFDLFAASLRGVAHQPDPEWVALVMSYKLLGLAGVIPQTARCARCGAPDPEHPDPLGGQLLCSKCAALPPYPPAVLDFLRHAVRRTVRASFEQPVPSADRPALWRALEKFVTVQVGGVHSWRQLVPSGVPVLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein
publication title A Novel Structure of DNA Repair Protein RecO from Deinococcus radiodurans
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Recombination,replication
total genus 65
structure length 242
sequence length 243
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02565 RecO_C Recombination protein O C terminal
A PF11967 RecO_N Recombination protein O N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.120 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 1u5kA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1u5kA01
3.30.60.100 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1u5kA03
4JI0Q 3F8TA 1LUZA 1QUQA 3UE0A 5LMNQ 1CKNA 1QVGA 4A3IH 1HJPA 3CMEA 1G51A 3PF5A 3I7FA 4A3KH 3M4QA 4A3FH 3HOXG 4C2MH 5IP7G 1XMQQ 2C35B 3FP9A 4L5TA 2NVTH 1YJWA 3U4VA 2UXBL 1OXVA 1G291 2EXDA 4LFAL 4LFCQ 5C4JH 4DR1L 4YHHQ 4A3CG 4YCWA 1YIJA 2MO1A 1WFQA 1BVSA 1Y14B 3PUYA 1X3EA 4DR7Q 2WAQE 2OTJA 2VQFL 1Y1VG 3JC66 3EBEA 2K75A 2Q2TA 2XGTA 4KHZA 5GAGC 1QZHA 4LWCA 4O0AA 2K5VA 4OWXB 2H5XA 3CCRA 5GQOA 3NELA 4A3GG 1X6OA 4QY7A 5C0XG 3AQQA 5IYBH 4DV1L 3G4SA 2R7ZG 1Q1EA 4BXXG 5AJ3L 4C3HH 1NBWA 1P8LA 3BZCA 4HJAA 4GOPB 1FJGQ 3S15H 2B63G 3S1MH 3BU2A 2HHHL 4A3JG 3STBC 3KJOA 5FLMH 3CW2C 1V43A 1VQPA 5IWAQ 2GN5A 2UUCQ 1KXLA 1RL2A 2CCZA 4DKAC 3PO2G 2PNHA 2JA9A 3M4PA 5EAYA 1NMGA 5GROA 3HOUG 2KENA 3OTOQ 4AQYL 4AYBE 3GDEA 1BBWA 1Q8KA 3J7ZC 2ZJPA 4BA1I 1J6QA 1V1QA 5H1SE 3HOWH 3A74A 3J80c 4A3EG 1PH9A 1ASZA 2UU9L 1YHBA 4JYAQ 4LUZA 1JB7A 2Z6KA 2R93G 1E1OA 3T1HQ 1IBLQ 3E9IA 4XTCS 1AE2A 3PGZA 2CKZB 4DV3L 3H0GG 4JI5L 4B3SL 4DV5Q 1JJ2A 4OX9L 3PUWA 1X55A 4PZ6A 4DV0L 1VQ9A 4DR4Q 1AH9A 3PO3H 4GNXC 4BBSG 2VQEQ 2BH8A 3CCUA 1PV4A 5C44H 1T9HA 4R4IA 2VUMG 1D7QA 1N36L 1PFSA 4MZ9A 3UDFA 1MJEA 1HNXQ 1Q81C 3F1ZA 1L2FA 3CQZH 1VQBA 2K14A 2LSSA 2KCTA 3HOXH 5IP7H 2WAQG 3I4MG 3GTJH 2MNAA 1VQMA 1OXTA 1XMQL 2NZHA 4A3CH 1TXYA 4LFCL 1JT8A 1PH2A 4GKKL 2UXDL 1VQDA 5JJKA 1Y1VH 4DR7L 1X56A 3A5UA 2R92H 4JBMA 1J5EQ 1Q12A 4R4TA 4X65Q 1HR0Q 1HNWQ 3CP0A 1UWVA 1LM0A 2QGQA 3ULJA 3CCEA 1XPOA 1VQ7A 1N9WA 4JI6L 4NXNQ 4A3GH 4NXMQ 2R7ZH 1S40A 2V1CC 2ES2A 4BXXH 2YU9H 3FHWA 1M1KC 1Q82C 4P74A 4X62Q 1EQQA 1PH7A 3K0XA 2VS1A 2B63H 4HIDA 4A3JH 1KIXA 4DR3Q 2PI2E 4R4CA 1MKHA 4AYBG 1FJGL 3H3VH 5K36G 2WFWA 4B3ML 2I5MX 4DV4Q 2FXQA 2UUCL 4BBRG 1IL2A 4JV5L 3PO2H 1NY4A 4UP8A 3GTOH 1KL9A 3HOVG 2OTLA 3HOUH 4B3RQ 2R7DA 1QVCA 4DK6C 3S17H 2K5NA 2OCEA 1E1TA 4GLVB 5C3EG 4DV6Q 4KHPQ 4GN5A 4DR2Q 2YTYA 4L5SA 2ZTEA 4QQBX 2Q2IA 1XPUA 3EN2A 4HJ5A 3H15A 1B7YB 1L1OA 5C44G 4A3EH 1VQIA 4DAMA 1BBUA 2I5LX 1VQEA 3CC7A 1EWIA 2R93H 4JYAL 1Z9FA 2UXCL 4JI8Q 1V9PA 1YVCA 3FKIH 4IFDI 2A19A 3H0GH 4JBJA 4IOCA 1SRUA 1ASYA 4LF6Q 1VQNA 5JJLA 1VQGA 4DV5L 4JI2Q 2CFMA 2ZM6Q 3RZOH 4BBSH 2PMZE 3CC4A 2WB1E 3PCOB 1OXSC 3JAMi 2VQEL 2VUMH 3GTPH 1HZAA 2NVXH 4B3TL 1IYJB 2E5LQ 3B6YA 2Y0SE 4DR5Q 2Q2HA 2ZTDA 4X64Q 1HNXL 1XMOQ 1EQRA 3GTQH 3U50C 5DLQE 1RIPA 1IBMQ 1FVIA 4HIKA 1VQOA 3I4MH 4LF8Q 2Z0SA 4QGUA 3PV0A 1E3PA 4X66L 4JI7Q 1Q46A 4X6AH 2JQOA 1KHIA 2K4KA 3MEFA 4LF9L 4LFBL 3RN2A 1A0IA 1YBYA 1L0WA 4GOPA 4UPAA 2EQSA 3TQYA 1WI5A 1NMFA 1X3FA 1VQ6A 1JE5A 1HNZL 2ID0A 3CCVA 1WJJA 2QA4A 5IP9G 2B29A 4UP9A 4X65L 4HIMA 4XIGS 1J5EL 1HR0L 1XNRQ 4DV7L 4LF5L 4NXNL 4KI0A 4DUYQ 3GTGH 3M3YH 1SMXA 3CPWA 1YNXA 4JI3L 4J15A 1WCMG 2ALYB 3D31A 1VQHA 3CAMA 4NPSA 3J81j 3M4OH 4X62L 2DGYA 1HR0W 4PG3A 1HZCA 1A8VA 2MQHA 4DR3L 2ASBA 4JI1Q 1G6PA 2KCMA 3CMAA 3M7NA 4BBRH 3DM3A 4NB3A 3HOVH 1MIUA 3CPFA 5C3EH 4QJFA 4B3RL 2R7FA 4KHPL 1W2BA 4JBKA 4PZ8A 3PUZA 4Y52H 1I50H 1EIFA 4DR2L 5BR8Q 1EUJA 5FJ8G 1KC8C 3EIVA 1N33Q 4RMFA 1E7ZA 1N34Q 4DNIA 3OW2A 1PH6A 2BH2A 3HKSA 2WB1G 2UUBQ 4IJHA 1R9TH 1YZ6A 3STBD 4YCVA 3ERSX 5HY6A 2HT1A 1FGUA 2Y0SG 3ULPA 2UUAQ 2EIFA 3FKIG 3BZKA 4DUZL 1L1OC 3UDGA 2ZM6L 4JI2L 3I2ZA 1P16A 1EFWA 1KQSA 2CWAA 1EYGA 4LF7Q 3DLLA 1X3GA 3KJPA 5M3MG 4GN4B 1SLJA 1KRTA 3W1GA 3UDIA 2E5LL 1TWAH 4K0KL 3CCMA 1K3RA 1I94Q 5J3BA 3T1YQ 1XMOL 1U5KA 4JI0L 1LYLA 4LNQA 4A3DG 1C0AA 2AKWB 3RZDH 5LMNL 3JAMc 2YYZA 4LF8L 1E24A 4JOIA 4JI7L 2IHFA 3F2BA 2JA6G 1PH5A 2MO0A 1IXRA 1PA6A 2NN6I 5LMNW 5LMUQ 3RLFA 3GO5A 1EIYB 3IRBA 4DK3C 1YJNA 4YHHL 1CUKA 1VQFA 5FLXc 4ALPA 2VZAA 4TVAB 2JE6I 4A93G 5IP9H 1XNQQ 4C3JH 1VQKA 1Z47A 1SN8A 2CQOA 2RF4A 1UE6A 3KF6B 4EQ5A 3S16H 2YTVA 2KHIA 1S3OA 1SFOH 2NVQH 1WCMH 5IE8A 4GLAC 1A63A 1MJCA 1Q86C 2KBNA 1UE5A 3ER0A 4DAYB 1NJIC 4B3MQ 2Q2UA 3S2HH 1JMCA 5IYDH 1CKMA 1VQ4A 4IPHA 1OXXK 4R1JA 2F4VQ 2UXBQ 1XPRA 1VS0A 2A8VA 1VQAA 4JBWA 2RHSB 2K5HA 4YCUA 4LFAQ 5IWAL 4DR1Q 3HOYG 3TS0A 3SGIA 2PQAA 4AH6A 3KYHC 3E0EA 3AEVA 1K73C 3WWVA 3PUVA 1Y1WG 1CSQA 2OQKA 2VQFQ 3U58A 1QVFA 5FJ8H 2VL6A 3F2CA 5C4XG 2PI2A 3OTOL 4DR6Q 5BR8L 3S1RH 1OXUA 3CCQA 3RN5A 3D0FA 1I6HH 4YWKA 2N78A 4GN3B 1N34L 3NBHB 3TEHB 4OWTB 4IPGA 1HZBA 5AJ3Q 2XTIA 1TWCH 2NVYH 1S72A 5M3FH 4LF4Q 2JEAI 4IO9A 3T1HL 1IBLL 4BA2I 2HHHQ 2UUAL 2PQAB 2R6GA 3CCJA 3MXNB 1Q7YC 1PH4A 2LXJA 3CCSA 1TWHH 3GTMH 3HOZG 4DR4L 3M9BA 5C0XI 2JA5G 2K52A 3KDFB 5M3MH 2Z6KC 4JC0A 4MTNA 2AHOB 3PUXA 2D62A 3K7AH 1VCIA 1A62A 4AQYQ 1AE3A 2I5HA 2AWOA 2HQLA 4TQUS 3BJUA 3VDYA 3K8AA 2JA8G 4A3DH 4OO1G 4IFDJ 3T1YL 1VQLA 3PF4A 3H3VI 3S14H 1OTCA 1YHAA 3CXCA 1GO3E 2GVBA 4GNXA 4A75A 2HIVA 2E2JH 2JA6H 1IBKQ 3ICEA 1LTLA 1B8AA 1I5FA 3K7UC 4APVA 2JA7G 1WYDA 1B70B 1VQ8A 4B3SQ 5E7NA 4OONA 3ULLA 5LMUL 4JI5Q 4L5RC 4OX9Q 3GTLH 4WJ4A 2YTXA 4DV2Q 4A93H 3GTKH 2N3SA 4YY3Q 1Q1BA 3S24A 3NEMA 3G48A 4IPCA 4P73A 3CC2A 4P72A 1PH3A 1N36Q 4LUOA 3CD6A 1HNWL 3NENA 1JJGA 4FDBA 4GKJL 4AIMA 2AWNA 2D0OA 4RG1A 4NXML 1UE7A 5IYCG 2OQ0A 4GNXB 2IX1A 4Y7NH 2JJQA 2QEXA 2ZJQA 1GKHA 1KD1C 1D8LA 3G6EA 4A3LG 5M5XH 5IYDG 4QL5A 3J81i 2F4VL 3HOYH 1YHQA 2K50A 2A1AA 3HKZE 4DV4L 4GKKQ 1GM5A 1Y1WH 3PSIA 1CSPA 2MFIA 3TREA 2UXDQ 5JEAJ 1K9MC 2IX0A 5C4XH 4KLKA 4PMWA 3ZJYC 1GVPA 4OWWB 4A3BG 4IFDG 2BA0A 3K81C 2HIXA 2IHEA 4ME3A 3RLNA 1QUQB 3UE1A 3M85A 4DV6L 1YJ9A 4UY8C 3S1QH 4JI6Q 4DR6L 1NE3A 1CKNB 3CF5A 1PHJA 1K8AC 2VNUD 1VQJA 1X54A 3E9HA 4JI4Q 1YEZA 1FL0A 5ELNA 3OYYA 4EX5A 3KFUA 4A76A 4LF4L 4JI8L 5M3FG 4LF6L 3L0OA 3KF8B 3UDXA 4DPGA 4P71A 5HGQA 5M5WH 3F2DA 4HIOA 4HJ7A 4A3MG 5GADC 3PIPA 4JG2A 2JA5H 4IJLA 3RNUA 4BY7G 2IY5B 3G71A 3TRZA 2R92G 1DGSA 2RHQB 4BY7H 3I56A 2F3IA 2RCNA 1UEBA 3LGJA 4POFA 2JA8H 1N32L 2L15A 4DR5L 3A0JA 3W1BA 3KF6A 4X64L 1HH2P 4BY1G 2N8NA 5IT9c 3J7A5 1SE8A 1IBML 4P75A 4JV5Q 1JJCB 1M90C 1CKOA 2ATWA 2JA7H 3TS2A 2UXCQ 1IBKL 1WOCA 2WP8J 3L2PA 4GS3A 1C7YA 2ZTCA 2E2IH 4MNOA 1YITA 5JEAG 2IT1A 2D0PA 1TWGH 2OWOA 2YV5A 1UE1A 2AMCB 4LUVA 1KAWA 4O2DA 4DV2L 4YY3L 3A5ZB 3I4NG 2CWPA 4B3TQ 1L1OB 2E8GA 2NZOA 1PYSB 4L5QA 1XNRL 5IYCH 4H02A 3L7ZC 4DUYL 4GOPC 2N49A 4WJ3M 3S2DH 4UP7A 3HKZG 2BA1A 3W5OA 4A3LH 1IZ6A 3AFPA 2JK8A 4X66Q 3RR5A 4A3IG 4IOAA 4YWLA 5IY0A 4YWMA 4A3KG 4LF9Q 4JI1L 4A3FG 3K80C 4LFBQ 2I0QA 1SR3A 4R4OA 5GAHC 4POGA 4OO1I 3AFQA 1GD7A 4A3BH 4JCVE 1KRSA 1XTDA 1YI2A 1HNZQ 3U4ZA 1PYBA 1NTGA 3KDFA 4GKJQ 3J81c 4DV7Q 2E2HH 1K83H 3AYHB 4LF5Q 1BKBA 2F52A 1N33L 1PVOA 4JI3Q 2JEBI 4JI4L 4DV1Q 1VQ5A 1O7IA 1I3QH 5IYBG 2UUBL 3Q8DA 1E22A 1EOVA 4A3MH 5JJIA 1HZ9A 1U0LA 1TWFH 4PZ7A 2LXKA 4OXPA 5FLMG 4HJ8A 3I4OA 3J80i 1SROA 5M5YH 4LF7L 1X65A 3CCLA 4GLXA 1C9OA 1VQCA 1XJVA 4BY1H 3S1NH 2NN6G 1I94L 3RLOA 1K0RA 3KOJA 3HOZH 1H95A 1PH8A 1N32Q 2GVAA 3PIOA 3HOWG 1W3SA 2UU9Q 4R4QA 5C0XJ 2VY3A 3GD7A 2KHJA 5ELOA 4A4IA 2VW9A 4DV3Q 4DUZQ 1K8GA 3HFZB 4C3IH 1PH1A 3KLWA 4DV0Q 2B3GA 4HJ9A 3I4NH 4LW1A 4QIWE 1N8RC 4JOIC 1QZGA 1XNQL 2ZJRA 3PO3G 5GAEC 4K0KQ 3I55A 4IPDA 2DUDA 1X9NA
chains in the Genus database with same CATH superfamily
4RGMA 4L9MA 1LUZA 5C3WA 4DF7A 5C4HA 5LMNQ 1CKNA 1SYCA 2TMPA 4EQPA 4OELB 1PFMA 2A68C 4A3FH 2F0MA 2C35B 3FP9A 1YJWA 3I70A 5KGUA 1G291 4NKLA 2N1AB 4LFCQ 4YHHQ 5M5YB 1B4OA 4DNTB 2NBFA 2G9DA 1Y14B 3PUYA 2WAQE 2TSSA 2FEFA 4WRDA 5CYUA 3MTSA 5DNFA 4V190 4KHZA 3LWEA 1QZHA 4A3EB 2F0VA 4LWCA 1EY6A 3VR2A 3CCRA 2H5XA 2PQ8A 2JYYA 5F2DA 2EYHA 2RA4A 3DO9A 5C0XG 2R7ZG 2K5WA 5EKIA 1Q1EA 5AJ3L 4C3HH 1NBWA 1P8LA 2FU2A 4GOPB 3S15H 3S1MH 3BU2A 4C3IB 3STBC 2SGQI 3ZYYX 1H9JA 4PL3A 2ARPF 1SNOA 4KD3A 4TRDA 1BUSA 1J9OA 3A8KE 2JA9A 3PQIA 3FMCA 1AZPA 3S1RB 3LWUA 3HKZB 2LFNA 1BBWA 2D9UA 5IOCA 1YNJC 2WGCA 1J6QA 3HOWH 1SGPI 1UNSA 3CKIB 3I4MB 1EEID 3A74A 3J80c 4A3IB 2Z4HA 1PH9A 2UU9L 1YHBA 1OMUA 2Z6KA 5CCMA 1CZGA 2K5DA 1JCKB 1AE2A 5D3DA 2CKZB 4DV3L 4A24A 1B44D 2MPMA 3K5MA 4B3SL 4DV5Q 1G2TA 4HN7A 4PZ6A 4DR4Q 3PO3H 4GNXC 4BBSG 2VQEQ 2BH8A 3CCUA 4G7ZC 1EQVA 2JXMB 2HQEA 1HEVA 1HNXQ 1EWHA 1Q81C 1EY4A 2QZGA 1O7ZA 2K14A 2BL8A 4M1UB 4KMUC 1Y1CA 3P75A 4BBRB 1UUCA 4KHVA 1DONA 2EE1A 1XMQL 3HOVB 1TXYA 3JSBA 5DAEA 1JT8A 4GKKL 5JJKA 5KNDA 4DR7L 1ICWA 1HR0Q 3KLSX 1UWVA 1LM0A 2QGQA 4NXNQ 1PDQA 2B2YA 4NXMQ 4BXXH 3FHWA 3MVVA 2PCFB 1STAA 3K0XA 2B63H 1KIXA 5E3FA 2LKVA 4AYBG 1FJGL 2HDLA 5K36G 1B9MA 1PJUA 5A2QL 4RHRA 3PO2H 1WTXA 5CC4A 5HQ8A 4KY6A 2JAEA 4KHPQ 2K5NA 2KCXA 4DR2Q 1C48A 2SEBD 3NQTA 1XPUA 4A3EH 1B7YB 5I9PA 1GHJA 1RJTA 5FK9C 1VQIA 3CC7A 2I5LX 1B2TA 4JYAL 1A15A 2UXCL 2JW6A 1H9KA 1PRTB 1V9PA 2K5QA 2A19A 4JBJA 4LF6Q 1VQNA 2JXDA 1SNQA 2R3ZA 2ZM6Q 5D14A 2QPOA 2PMZE 3CC4A 4F87A 2WB1E 3FPPA 3UEYA 2K9HA 4H7BA 3CU7A 2NVQB 1G2SA 2Q2HA 2CVRA 3UI2A 3LJ1A 1ENAA 1II3A 1IBMQ 1DOMA 4HIKA 1LTBD 1QCBD 1SYEA 3I4MH 4LF8Q 4QGUA 3PV0A 4WJWA 4V0BA 4KY5A 3MEFA 1KHIA 2K4KA 4FYDA 1SGDI 2WIIB 4LMQD 1A0IA 1L0WA 4GOPA 2EQSA 1NMFA 1VQ6A 4R8IA 3S17B 1SGRI 1JQOA 1HDLA 3CXLA 1QG7A 2EYLA 1V1OA 2FJ2A 1XNRQ 2WV6D 4LF5L 3UITA 1SMXA 1WTVA 4NPSA 3CAMA 2R93B 1ZYRC 1TS3A 1HZCA 1A8VA 4BBRH 4DK1A 4NMZA 3HOVH 1SAPA 3C3LA 4ZRZA 2A2DA 2VUMB 3GTPB 2KVMA 4B3RL 4DWLA 1W2BA 4JBKA 4PZ8A 3CHBD 1SE4A 3EIVA 3B55A 3TZDA 4DNIA 2F0HA 3WOFA 3OW2A 1H9RA 2UUBQ 4IJHA 1WTHA 3V05A 1FGUA 1DOKA 3BS1A 3PMFA 5J39A 4ZAIA 1SSOA 2H1EA 3NK9A 1EYGA 1Q9BA 2KOLA 2IW3A 3KJPA 5M3MG 1ILQA 1JWUD 1IW4A 2QQDA 2VB3X 1CT2I 1Q8IA 1I94Q 5J3BA 4DA2A 5FLXL 1XMOL 4JI0L 1LYLA 4LNQA 1E2WA 2AKWB 2B39A 4DNRB 5EKLA 2GKRI 3RU0A 1SGNI 2MJ8A 4DAYA 4JI7L 2JA6G 3HOYB 1V1PB 2SOBA 5IGDA 1JICA 1X74A 3DM1A 1DXMA 2M5XA 3RLFA 1EIYB 1PYWD 1JWMD 4MPIA 2VZAA 2JE6I 4A93G 5IP9H 3S16H 1SMYC 2J0TD 2YTVA 2KHIA 2NVQH 1X32A 1TS2A 5KRUA 2O5JC 1A63A 4WORA 3I90A 1I4QA 2Q2UA 5DEHA 4KJOA 5CV9A 4K14A 1VQ4A 3TO7A 2E74C 1OXXK 4R1JA 2A8VA 2ICEC 2JYOA 3E3XA 1LTSD 4LFAQ 1NUBA 4YCUA 4DR1Q 2XMXA 2X6LA 1K3BC 1F9QA 1KABA 3N52A 3QWPA 2OQKA 2VQFQ 3U58A 4C1NI 1QVFA 1GJXA 1EIGA 3E2IA 3RN5A 3D0FA 2Z9HA 1Y8NB 4OWTB 1S72A 5M3FH 2Q8RE 3J7YW 3IAM1 4B9XA 3T1HL 4BA2I 2R6GA 3X3MA 3MXNB 1Q7YC 2SGPI 1TWHH 4OEMB 1CT1D 5BN4A 1V8QA 1MJBA 2A74C 2Z6KC 1PFNA 1P9ZA 4MTNA 3PUXA 4BY7G 1SFOB 1AE3A 2I5HA 1WCMB 3BJUA 3VDYA 3K8AA 1QNUA 2O4XA 1GHKA 3H3VI 1G91A 1GUWA 3UGIA 3S2HB 1STHA 1Y8PB 1RDPD 1KNEA 4ZKCB 1YO7A 1LTLA 1I5FA 2JA7G 2FNFX 1WYDA 3QB3A 4G4KA 4J1MA 5E7NA 5FOBB 4JI5Q 5LMUL 3GTLH 2A6HD 1TOTA 4DV2Q 1TUSA 9WGAA 2NYZD 1QILA 4ULLA 1N36Q 3EFXD 3NENA 4OAVB 4FDBA 1I6HB 1HA6A 2G5DA 1HPCA 5IYCG 1SEBD 2OQ0A 4GNXB 2A5HA 3BDCA 1I3QB 5E3QA 1TWCB 1MT1A 4A3LG 2V6EA 4A3MB 1PPFI 2B2YC 1BCPD 3HOYH 1YHQA 3D3RA 2OT2A 3HKZE 1Y1WH 4HEA1 2MFIA 3PSIA 3K58A 4ME5A 5JEAJ 5C4XH 2UVOA 1R0RI 2BA0A 1PTOD 2HIXA 2IHEA 4ME3A 3UGDA 1FNVA 3M85A 4UY8C 1NXUA 2Z4IA 1SYFA 2NU1I 4J8QA 3KLSA 3E9HA 5ELCA 4JI4Q 5CV4A 1IY6A 3HP3A 4EX5A 4EGVA 4C1NK 2CW0C 1OO9B 4LF4L 1ULKA 3KY9A 5M3FG 2NWGA 1SNPA 3KF8B 3L0OA 3UDXA 2FHTA 4P71A 4K2LA 5KNCA 1UEAB 2NU2I 1QJOA 2WCYA 2RHQB 1XBTA 1ONLA 4TSSA 3LGJA 3NHHA 2JA8H 3FSXA 4DR5L 3M4YA 3A0JA 5CBAE 4BY1G 2N8NA 3BYYB 1M90C 1CKOA 2QW7A 1WOCA 2PZWA 4FXKC 1PTOH 1FY7A 1D2BA 5C4JB 1JOQA 2YV5A 4XXEA 1KAWA 3VR5A 4YY3L 1B9NA 4ZK9B 3FNBA 2ZXRA 2OU2A 1LABA 4GOPC 2F0UA 5CCLA 1SYGA 2BA1A 3C1EA 5EJWA 3BDLA 3AMUA 3AFPA 3FVQA 1ML0D 3OWEB 2F0DA 5C5LA 4LF9Q 4JI1L 3HOZB 1AW7A 1HA5A 4LFBQ 1SR3A 1ZXTA 5I2YA 4OO1I 2JA1A 1QE6A 2M00A 1GD7A 4A3BH 1JORA 3MXNA 2HGKA 1YI2A 2I46A 4GKJQ 4DV7Q 2E2HH 1RCVD 3H91A 1BKBA 4H44C 2Z1CA 4JI3Q 2JEBI 1XWEA 4DV1Q 2JSOA 1VQ5A 4E1PA 1DD2A 3NTKA 3C2PA 1I3QH 2QQEA 4FF3A 3Q8DA 5LHY1 4A3MH 1NUCA 1U0LA 2XRQD 1L0XB 2LXKA 2NTTA 4OXPA 3SVMA 3DHQA 2A6ED 1SGYI 1LO5D 1MD2D 1HFNA 1LR8A 4LF7L 1X65A 2ZXOA 4GLXA 2PZTA 1VQCA 2FFKB 3D00A 4B6DA 4X3KA 3KOJA 1PH8A 2GVAA 3PIOA 1W3SA 1MHWC 4R4QA 3OMCA 4YIJA 5C0XJ 2VY3A 4JVZA 2KHJA 5E4WC 2VW9A 3OXFA 2EYMA 1ENFA 5JEAH 1U4MA 4DUZQ 4XYOA 1M4VA 3HFZB 1PH1A 5FUVA 4M8AA 4G76A 1B3QA 3I4NH 3L3OC 1XNQL 2F0KA 4K0KQ 3I55A 4IPDA 2DUDA 5KEEA 5C44G 1WTQA 1F2ZA 1WGCA 4KN7C 3D8GA 3I3CA 2HUGA 3ND9A 1G51A 3I7FA 3A7LA 3HOXG 2X3TA 2K01A 3SDJA 2UXBL 1YNND 1V1IA 3GTOB 1CQVA 1I4XA 2EXDA 5C4JH 1D5XC 1LR9A 3KF8A 2MO1A 5KIXA 1WFQA 2D5DA 4FXGC 1BF4A 4J6HA 5A2QE 1Y1VG 5ELFA 4CDFC 4BS9A 2PO4A 4QIWB 4OWXB 1M8AA 1KMAA 4A3GG 1X6OA 4QY7A 4HGUA 2DNEA 1TBNA 1PZKD 1VMPA 3OSOA 4CDDC 2ODDA 1S5BD 3KJOA 3CW2C 1V43A 1SNCA 5IWAQ 1KXLA 2KA7A 1B1ZA 2CCZA 1BOSA 3HH2C 2QKIC 1XXGA 1WTJA 3P20A 2DB6A 3HOUG 2KENA 2NN6H 2XIWA 3IAS1 1IKLA 3GDEA 1CHOI 1BUVT 1MGSA 2PW7A 2F0PA 5H1SE 1MI2A 2XTQA 2F3WA 1F77A 5EGTA 1ASZA 4A3FB 2OZUA 4LUZA 1JB7A 1EEFD 1IBLQ 1D1KA 3E9IA 4XTCS 3PGZA 1JQYD 2EPBA 3H0GG 2QGMA 3Q23A 2KEEA 4UDUC 1ULMA 4DV0L 3R5BA 3MHBA 2EXZA 4R4IA 1D7QA 1QWYA 1MJEA 1PFSA 2VRWB 2KMPA 1JC7A 3F1ZA 1VQBA 3URYA 1LTID 2LSSA 2KCTA 3D4RA 1TVXA 1SNDA 2WAQG 4MTKA 3GTJH 2M2LA 3S15B 3S1MB 2QDBA 1H9SB 3QAHA 4LFCL 1PH2A 4UXIA 1VQDA 4Z7GA 4XDXA 2NU4I 2CQAA 1X56A 2Q8TA 1J5EQ 4X65Q 1HNWQ 3CP0A 4JI6L 3HOWB 1N9WA 5C0XH 2R7ZH 1GOZA 1M1KC 2ETDA 4X62Q 4CDEC 1EQQA 4K5WA 2CH4A 4B3ML 1FR3A 4IN3A 1MSHA 2FXQA 4DV4Q 1IL2A 4JV5L 1UHAA 3GTOH 4UP8A 3FC3A 3L0IA 1KL9A 2OTLA 3Q0AA 1BBXC 4DK6C 1HQMC 1K8OA 4DV6Q 2YTYA 2ZTEA 4RHSA 4QQBX 1S5CD 3H15A 4DFAA 1BBUA 1EWIA 5FLXE 2R61A 3TP7A 4IFDI 5JJLA 2DNCA 4IOCA 1SRUA 1VQGA 3O13A 4DV5L 3RZOH 4BBSH 2PQEA 3BG3A 4HTHA 4DNCA 1OXSC 2A6HC 3JAMi 2VQEL 2NVXH 4B3TL 1EIHA 3B6YA 2ICIA 1NSNS 3LX0A 3K57A 4X64Q 1HNXL 1Z7TA 1ZKOA 1RIPA 3P7JA 2EJGC 4HR7B 5J8CA 2E76C 2B63B 1E3PA 1MJAA 2K05A 5IGEA 4PNYA 2JZMA 2JQOA 1CA6A 3RN2A 3PO2B 4EVOA 4UPAA 1BCPC 3HZXA 2L8EA 1CFMA 2B2UC 1F9PA 4RA8A 1LT3D 3CCVA 4UP9A 4C3JG 1HR0L 4NXNL 4DUYQ 1PTOC 1YNXA 4J15A 2ALYB 4I1TA 3J81j 3GP7A 1HR0W 1A3TA 4I7AA 5K36H 3ND8A 2ASBA 1G6PA 1O80A 2IJ0A 3T16A 3GTMB 1CTMA 4XQNA 1JOKA 2DJFC 4QJFA 4FF4A 2R7FA 4KHPL 1CZWA 4DR2L 1BCPF 2HCCA 4YZDA 5FJ8G 1KC8C 2KECA 3TMEA 1N33Q 2RLDA 1SYDA 2D2CC 4RMFA 1N34Q 4IURA 1Y69U 1PH6A 2BH2A 2LB7A 3H6MA 2JA6B 2WB1G 1LLRD 4UHVA 1K7TA 1PTOF 1YZ6A 3GV6A 3ERSX 1UUPA 1A2UA 3ULPA 2EIFA 3BZKA 3SEBA 2GIVA 3UDGA 2L7XA 1TQOA 1QNKA 3A8JE 3JAML 2ZM6L 4A93B 1H9SA 5T1IA 1P16A 1Y8FA 3VYUA 3GQBA 1SE3A 4XQJA 1DJRD 3UDIA 1TWAH 2F3VA 5IGCA 1U5KA 1C0AA 1ESRA 3BVGA 3RZDH 1TIHA 3TN2A 1E0BA 1IHZA 5G3LD 2YYZA 4LF8L 1TBQR 3K5OA 3T51B 5CMDA 2BOSA 2K6AA 3IL8A 3L9AX 3GOXA 2QEJC 4ALPA 3VA7A 1VQKA 2CQOA 3KF6B 1UE6A 3R3OA 3DMUA 4GLAC 5JJZA 1M8CA 2KMRA 1HTLD 4MIUA 5COYA 4DAYB 1JMCA 4G7HC 3NBHA 2GA4B 1CKMA 4OGQC 5C3XA 1VQAA 1CQFA 2RHSB 2B8FA 3I73A 4AH6A 3WWVA 1NAPA 3KLRA 2QQCA 1STNA 2A6EC 3F2CA 2PI2A 3OTOL 4WP4A 2K28A 1OXUA 3CCQA 4YWKA 2FMCA 4GN3B 4HSVA 4IPGA 2JA7B 3HEJA 3A56A 5AJ3Q 3TOBA 2JEAI 1G6ZA 5IGFA 3BDOA 3CCSA 3GTMH 2JA5G 3G6JB 3KDFB 3S16B 1PMRA 2KEDA 5M3MH 1HUNA 2W0TA 1TY2A 4IZ8A 3RD4A 2D62A 3UEJA 1VCIA 4TQUS 2HQLA 1RHPA 3MWYW 1HUMA 2PYKA 1VQLA 3KBGA 4HMIA 4X3UA 3OWFA 2F0TA 1OVOA 1KBEA 3CXCA 1GO3E 2E2JH 2JA6H 4F88A 1AZQA 1B8AA 1BDOA 4APVA 2L12A 1E2VA 1D5ZC 2F0QA 3I91A 1VQ8A 3MEHA 4B3SQ 2EZVA 2EYOA 1YNNC 4A93H 2BDOA 3S24A 3G48A 4P73A 3CC2A 1Y1BA 3PDNA 4Q9VA 2AWNA 1UE7A 2RSNA 2IX1A 3SEKC 5TSSA 2GSCA 2ZJQA 5LL6X 1GKHA 1D8LA 2Y0SB 5M3FB 5M5XH 4RGOS 2B2VC 3J81i 3R2TA 3AJFA 1LTAD 3D4DA 1TWHB 4GKKQ 2F03A 3I8ZA 5E3RA 2IX0A 1H0ZA 4KLKA 3ZJYC 1GVPA 5HGIA 5J1ZA 3UE1A 3S1QH 1PLFA 1STBA 2Y0MA 1PHJA 4R8NA 1FL0A 1LT5D 1VDDA 3VA9A 4JI8L 4RKBA 5IT9L 3GTLB 3R2IA 4DPGA 3PF4A 4HIOA 3PIPA 4IJLA 3RNUA 3G71A 3TRZA 1D6EC 1I4RA 1DGSA 4K6LA 1DM0B 1ESFA 4KJNA 4BY7H 2F3IA 2F66B 4E6IA 3D4WA 5ELDA 1LT6D 3KF6A 3V96A 1XYIA 3NP8A 3J7A5 2K32A 4PMCA 1NNXA 1J8IA 1JJCB 2ATWA 2JA7H 2UXCQ 2NVTB 2WP8J 2F0FA 5M9OA 2LY7A 1Y1WB 2FINB 1UE1A 4C3IG 4DV2L 5C4XB 3A5ZB 2E8GA 5I6WA 5IYCH 2N49A 4RFBA 4WJ3M 2EJMA 1GUGA 3HKZG 3W5OA 2SGFI 4A3LH 5JVG3 2JK8A 3J81L 3RR5A 5FO9B 1HJAI 1SDFA 4A3IG 5IY0A 4ZUJA 4A3KG 3C1FA 1KDBA 3K80C 3KBXA 2GVIA 3OIQA 3SK5A 3T56B 2J9RA 2J87A 3VDPA 1KRSA 2JA8B 5EQ0A 3Q24A 3DWAA 3KDFA 1YU6C 4LF5Q 1K83H 3AYHB 3G7LA 2RADA 2F52A 1BCPB 2YQPA 4JI4L 3MXPA 3CRKC 1A3VA 5IYBG 4RGNA 1KLUD 4RKLA 4KK7A 5HGTA 1E22A 1PTOB 2F6MB 1TWFH 3J7AF 5FLMG 3ERQA 3M7GA 3J80i 3IFTA 4KKTA 3CCLA 4KD4A 4BY1H 3S1NH 5FO7B 2RIJA 4IUPA 3OL0A 1K0RA 3TP8A 2HCIA 1H95A 3SK6A 3HOXB 1ET6A 3A7AB 3EQLC 3HG9A 1EL0A 1DS2I 2B2TC 1I6VC 1WKXA 4A3BB 2B3GA 4HJ9A 4LW1A 2IPKD 3BZDB 2ZJRA 2BDNA 2E2HB 2KQ3A 4F7XA 4A3GB 1X9NA 2XTRA 3R93A 4JI0Q 3F8TA 4ZQ3A 2YUUA 2G9HD 2EYJA 2CAZB 1LR7A 1PCEA 2HD3A 1GUTA 1HJPA 2F0SA 2K19A 2OF1A 4C2MH 5IP7G 2NVTH 4OIJA 3U4VA 2JBWA 3VDUA 1RF2D 1CA5A 4A3CG 3HOUB 1YIJA 1X3QA 1TURA 2QSBA 2L5TA 1X3EA 2K75A 2XGTA 2PZUA 1E2ZA 5GAGC 3DA4A 4O0AA 2JB3A 2EY5A 5GQOA 4DV1L 4HMJA 3MXGA 3H0GB 3BZCA 2QF7A 1Q3LA 2SNMA 2HHHL 4A3JG 1STEA 3J80L 2UUCQ 5CV5A 1Q90A 3I4NB 3FVVA 4DKAC 2PNHA 3M4PA 3KUPA 5EAYA 2F0GA 4AQYL 2FUG1 1FNWA 3MA2B 1Q8KA 2DY8A 4MN3A 3J7ZC 2ZJPA 4BA1I 4ILWA 2CH4W 1V1QA 1ICFB 3RMHA 1EYCA 1KLGD 4OAUC 1RODA 3TO9A 4KKSA 4O1PA 2R93G 1E1OA 3T1HQ 1EU4A 2HDMA 2M9VA 3K5NA 3SXHA 2FMMA 4OX9L 3QOLA 2VXWA 5D65A 1TGSI 3R8BA 1PV4A 5C44H 1T9HA 1PXUA 4O1NA 2VUMG 3EVQA 3J7AV 3M3YB 3EA6A 3UDFA 2XWJB 1PTQA 1U9RA 1ULNA 2DY7A 5EPKA 3HOXH 3D6CA 1PZID 2B2UA 2XRSD 1CHPD 5EKKA 3U9SA 2K33A 1TKWB 3BVMA 3T4AC 2MNAA 4TKOB 1TU2B 1S5ED 2UXDL 3VR3A 2KKMA 1Y1VH 1N13A 3BVZA 3A5UA 1I50B 4FF1A 2R92H 1TY0A 4JBMA 3QTLD 1Q12A 3LJ0A 2EOTA 3TZUA 1VQ7A 4A3GH 1BMOA 2KHSA 1S40A 2V1CC 3NUCA 1Q82C 3EJIA 1R9TB 1X4SA 2QDLA 4HIDA 1XX6A 4DR3Q 1MKHA 3OW7A 1SE2A 1HRJA 2CWHA 2RVLA 3LJ2A 3HOUH 2R7DA 2OCEA 4GLVB 1JWSD 3JAME 5C3EG 5HI7A 4GN5A 4L5SA 2Q2IA 2L1LB 1TS5A 1SGEI 3ITPA 3EN2A 4YZ9A 3NTIA 4DAMA 1VQEA 3GTJB 1T5EA 1PTRA 4K2KA 5DAUA 2N52A 3FKIH 2IL8A 3H0GH 5I9OA 4XYQA 4Q0FA 2CFMA 4RGTA 4JI2Q 2EYPA 1U4LA 2MGSA 2WKCA 3E0JA 1WTOA 3PCOB 2Q8IB 2NB0A 3E6ZX 3IKJA 1BQQT 2F4IA 2E5LQ 2Y0SE 4DR5Q 3SGBI 2H4OA 1JR0D 2ZTDA 2PPBC 2R7ZB 1EQRA 1B50A 4N9TA 4B9WA 1FVIA 1VQOA 4IUNA 4IQZA 4X3SA 4QMGA 4X66L 5I6YA 1Q46A 2B2WA 3MZ5A 4X6AH 3BYTB 1MBYA 4FKDA 4HAEA 1YBYA 4XQQA 3D6WA 4CBVA 3TQYA 1WI5A 2RDHA 5IGBA 1X3FA 1GUOA 1R4QB 1HNZL 1CSOI 2ID0A 5D3IB 1WJJA 2ZRRA 1J5EL 4X65L 2RSOA 2R92G 3M3YH 4FXDA 3GTGH 2WB1B 4N8X1 1WCMG 3E59A 4RCOA 4PQXA 3M4OH 4X62L 2DGYA 4RAUC 2J7ZA 3ONAB 1IW7D 3MC0B 4JI1Q 3M7NA 2WVJA 2F0JA 3RZOB 1A2TA 3WOEA 4FO2A 4BBSB 2MP1A 1U4PA 1CGII 3TDQA 3CPFA 5DM73 1VF7A 1CGJI 2V4DA 4R9WA 4DXFA 2NVXB 1ZEQX 3PUZA 1I50H 5BR8Q 1EUJA 1FGBD 1E7ZA 1MJ9A 1ZYRD 2N88A 2L55A 1EY0A 4AMLA 1R9TH 4IALA 2E75C 5HY6A 4GI3C 2NU0I 2UUAQ 2K7VA 2RBMA 3FKIG 1AN1I 1L1OC 3HGBA 4EQNA 3GTKB 3I2ZA 3TJQA 2X6GA 3QWNA 4LF7Q 5LNK1 3DLLA 1KDCA 3W1GA 1T5XD 3S9WA 2BCOA 3CCMA 1K3RA 4ZUIA 2X69A 2AQ2B 3T1YQ 2C5CA 4Y7NB 4A3DG 5LMNL 2DJGC 3VA5A 4WFN3 2A2CA 4AYBB 4JOIA 2RQXA 2IP6A 2IHFA 3F2BA 2MO0A 1IXRA 1PA6A 2NN6I 5LMNW 1YJNA 4YHHL 2OVOA 2NTSA 1VQFA 5FLXc 4N8FA 1XNQQ 4C3JH 1SN8A 1TDPA 4KTAA 4ABNA 2B2VA 1HPTA 5I2XA 4KV6A 5IE8A 1MJCA 4H0LC 1Q86C 2E73A 4K8IA 5IYDH 4RCNA 1RTOA 1KDAA 2F4VQ 2UXBQ 1WTRA 1VS0A 2RDGA 3BJIA 5IODA 1LACA 2SNSA 2JA5B 4JBWA 5CGKA 1S20A 2K5HA 3F2UA 1DOLA 1PZJD 3TS0A 2PQAA 3NWSA 3KYHC 3E0EA 5IT9E 3PUVA 1QOHA 5FJ8H 1TWAB 2VL6A 3OVOA 4DR6Q 3TSSA 5JPMC 3RZDB 4LK1C 1N34L 3NBHB 3TEHB 1HZBA 1TR5A 4O1OA 3NWTA 1UAPA 1EYAA 4GZYC 3U9OA 3DWQA 1TWGB 4UAIA 4PV1C 1PH4A 2LXJA 1TBOA 4U68A 3HOZG 3M9BA 5C0XI 4DR4L 2K52A 4JC0A 1N32Q 3LNNA 2AHOB 4NV5A 4CDCC 1A62A 2NZ1D 2B8TA 1BO0A 1ET9A 1JE4A 3S14H 1OTCA 4IUVA 2ZXPA 2HIVA 1IBKQ 4YZCA 3K7UC 5FKAC 1I4PA 1WD0A 1B70B 4ZKBB 4L5RC 4OONA 3ULLA 3J81E 2YTXA 1SBBB 3GTKH 2N3SA 3NEMA 4IPCA 3FBVA 3NSWA 4HEDA 4CJ1B 4LUOA 1JJGA 3FPUB 4AIMA 3SE0A 4IUQA 4RG1A 2D0OA 4NXML 4Y7NH 2JJQA 5I4DA 1KD1C 1QB5D 3G6EA 3AB9A 1RTNA 5IYDG 1CE3A 4QL5A 4AS2A 1HTPA 1CSPA 3TREA 5M3MB 4OWWB 4PMWA 4EQOA 5IGGA 4IFDG 1EY5A 1QUQB 4JI6Q 2F3CI 2SGDI 1VQJA 2IWHA 1YEZA 1WD1A 1P9GA 5ELNA 3KFUA 2E2JB 5FO8B 1XX8A 4XT3B 1CI3M 4A76A 1C4QA 1TIID 4LF6L 3I72A 4KN4C 5M5WH 4B3MQ 4QB4A 1Z6HA 4JV5Q 2JA5H 2IY5B 5GADC 4JG2A 2JB2A 3PIO3 2N17A 3C46A 3I56A 2QILA 2RCNA 4POFA 2BUSA 1MSGA 2L9HA 4HCEA 1F9SA 2L15A 3W1BA 3HRZC 1HH2P 5JPNC 1I4GA 2B2TA 1SE8A 1IBML 2CW0D 1A3UA 4P75A 5M5XB 4A3KB 2O2LD 3TS2A 2V53A 1C7YA 2F0IA 2IT1A 2D0PA 1TWGH 2OWOA 1FYCA 2AMCB 4O2DA 3IAYA 1D1IA 3N6RA 4B3TQ 2B2WC 3S1QB 1JB3A 4OIKA 1STGA 1K28A 2NZOA 1PYSB 4L5QA 1XNRL 4H02A 1VDZA 3S2DH 3TBIB 4G7OC 5C4ZA 1OYVI 3K0YA 1HFGA 1D5MC 2F0EA 4IOAA 4YWLA 4YWMA 1FAQA 4A3FG 2K04A 2I0QA 5GAHC 3VE5A 4BY7B 3J80E 1WVLA 3CRLC 3UOEA 3P1HA 3OOCA 5HURA 4LJZC 4ZCKA 3NBIA 4AS3A 2UUBL 4FP5D 1EOVA 4C3HG 5JJIA 1HZ9A 1NR2A 2OXPA 1F2MA 2EYFA 3IFDA 3MFGA 4CJ2C 5M5YH 3I9V1 3W3AA 1K0SA 3CQZB 1I94L 2A20A 3VR4A 3HOWG 2UU9Q 2NU3I 1VF5C 3GD7A 2VB2X 1EY7A 2EY1A 4Q5VA 4DV3Q 4C3IH 1BNZA 2E2DC 2Z6BA 3KLWA 2B8GA 5EPJA 3SHLA 4FF2A 2DKVA 4QIWE 4DU9A 4JOIC 5C5MA 3PO3G 1HXYD 5GAEC 4UXJA 1K83B 2F0LA 4QUFA 1L1OB 3S1RH 4ZLTF 1LV9A 2YU9B 1QUQA 3UE0A 1QVGA 4IUTA 4A3IH 3CMEA 3PF5A 1C8CA 5EX0A 4A3KH 4A3JB 3M4QA 1W4RA 2EY2A 4B08A 3VYSA 1TWFB 1XMQQ 4L5TA 4OVOA 5FUYA 1ILPA 1EY8A 2X52A 1OXVA 1IW7C 5E4XA 4LFAL 4DAVA 4DR1L 2V1CA 4YCWA 1SJHD 1BVSA 4DR7Q 2OTJA 2VQFL 4BY1B 4G75A 2KUMA 3S1NB 1EZ6A 3EBEA 3JC66 2Q2TA 4JW0A 5BN3A 2EJFC 5NUCA 2XSCA 1FARA 2K5VA 3NELA 3AQQA 5IYBH 2ERWA 4IUUA 3G4SA 4BXXG 4K6DA 4HJAA 1FJGQ 2ZT9C 2B63G 2KMQA 5FLMH 1VQPA 3K5LA 2GN5A 2K03A 2OD1A 5AFWA 1RL2A 3PO2G 2XN9C 1NMGA 4K5XA 5GROA 1PRTD 4CKCA 4F8MA 3OTOQ 2XWBB 4AYBE 1FYBA 1RD9D 5A35A 3GTQB 1HQRD 2GKTI 5FUWA 2L0CA 3QR8A 3X3NA 4A3EG 5J8FA 5EX3A 2N55A 4JYAQ 4C2MB 2AUJD 4JI5L 1OMTA 1JJ2A 3PUWA 1X55A 4L63B 1VQ9A 1AH9A 3A8IE 4PMBA 3KK7A 3NE5B 4BWGB 2RC4A 2E5RA 1N36L 4MZ9A 3OIPA 2JN4A 5C6AA 1L2FA 1CT0I 3CQZH 5K5PA 2WACA 2LEOA 4QCLA 5IP7H 3I4MG 2QQ0A 1G8ZD 2RKSA 2ORVA 1VQMA 4NP5A 1OXTA 2DIPA 1Y8OB 2A73B 2NZHA 1B53A 4A3CH 2MHVA 4LAAA 5CV8A 5C3EB 4HFVA 2KMOA 4R4TA 3UFFA 3CCEA 3OMGA 3ULJA 2ELIA 1XPOA 3OHXC 5CV6A 3T13A 2ES2A 4SGBI 2YU9H 1BR9A 4P74A 3DEOA 2JP1A 1PH7A 5J22A 2VS1A 4CKEA 4A3JH 2PI2E 4R4CA 3Q22A 3H3VH 1AFPA 1ENCA 2WFWA 2I5MX 3SK4A 2UUCL 5E3PA 4BBRG 4OL7A 1LT4D 1NY4A 5JAVA 3HOVG 3NXWA 5C44B 4B3RQ 1QVCA 3TP5A 3S17H 1R79A 1E1TA 1L0YB 1CT4I 1IY5A 2MUYA 5EBDA 1LTRD 1H9MA 2A69D 4HJ5A 1L1OA 2RIOA 4JK1C 1HCZA 2PNRC 4U6RA 2BE5D 2R93H 4CJ0B 2DN8A 1Z9FA 4DAPA 4JI8Q 2K1BA 3WDNA 1U4RA 1YVCA 1TS4A 1ASYA 4Z9CB 2YFBA 1SNMA 1YTPA 3OPOA 4HCSA 1Y1VB 2R92B 2VUMH 4X3TA 3GTPH 1JOOA 2CWFA 1HZAA 4O42A 1IYJB 1WTPA 1XMOQ 3GTQH 4PL5A 1KBFA 3B4VC 3U50C 5DLQE 2ORWA 1SJED 3OXLA 4KY7A 1FNUA 1A6XA 2GKVA 2AQ1B 2Z0SA 4P2CB 4JI7Q 1IKMA 3NTHA 5DM63 4LF9L 4RWSC 4LFBL 3EROA 5CBEE 1AP0A 1JE5A 4GXTA 2ENBA 1RKNA 2QA4A 3FSYA 5IP9G 2B29A 1STYA 4HIMA 4GKJL 4XIGS 1K7UA 4DV7L 4KI0A 3E5SA 1WGTA 3CPWA 1VMCA 3MFYA 2OEOA 4JI3L 1RFHA 1XA6A 1KAAA 3D31A 1VQHA 2RCFA 2A68D 1S4ZA 2NVYB 1K7VA 1EWCA 3HS0C 3FKIB 4NW2A 4PG3A 2MQHA 4DR3L 2EDGA 2KCMA 3CMAA 1AN8A 3DM3A 1EFID 4NB3A 1MIUA 1CK1A 3I4LA 3MAQA 5C3EH 1O7YA 3K7AB 4Y52H 4A3DB 1EIFA 1DS3I 3SR1A 1NR4A 3H94A 2WAQB 3R5AA 3HKSA 1I4HA 1CHQD 5FUXA 1GUNA 3STBD 4YCVA 2HT1A 2Y0SG 4DUZL 5CORA 1V1PA 4XT1B 4JI2L 1Z7KB 2EY6A 1EFWA 1KQSA 2CWAA 1X3GA 1YNJD 4GN4B 1SLJA 1KRTA 2E5LL 4OO1H 3GTGB 4K0KL 3Q6SA 4UXHA 2J4XA 3M4OB 5CV7A 1EZ8A 3A54A 3JAMc 1E24A 2KCCA 1PH5A 5LMUQ 3W2DA 2C9OA 3GO5A 2LUYA 1W6KA 3IRBA 4DK3C 1CUKA 5G3LF 4TVAB 4HSPA 2EVBA 1HHVA 1Z47A 4EQ5A 2RF4A 3DWPA 5KNBA 1S3OA 3TO6A 1SFOH 2O5IC 1WCMH 2UZ3A 3QG1A 2KBNA 1UE5A 3ER0A 4ID6A 1NJIC 3S2HH 1R4PB 4IPHA 5BN5A 1XPRA 3R5DA 1CM9A 5IWAL 3HOYG 3SGIA 1EYDA 4K8JA 3AEVA 1K73C 5JVH3 1CSQA 1Y1WG 4DN4M 5C4XG 4U673 5BR8L 4JPBW 5EPLA 1SYBA 1I6HH 1O78A 2CHBD 2N78A 3PIP3 2B0UC 1KTKA 3NPPA 2I07B 2RDFA 4E1RA 3P23A 7WGAA 2XTIA 1TWCH 2NVYH 4LF4Q 2ENNA 4IO9A 1IBLL 3UGLA 2E2IB 4G57A 2HHHQ 2UUAL 2PQAB 3CCJA 2XNAC 3GV3A 1PFBA 1EY9A 4C3JB 2XVSA 1DYQA 2AQ3B 1F2YA 3AU7A 3K7AH 3QIAA 4AQYQ 2AWOA 2JA8G 2ROWA 4A3DH 4IFDJ 4OO1G 3T1YL 2YFAA 3VYTA 1O7LA 1GXDC 1YHAA 2L4NA 1EQTA 4A75A 2GVBA 4GNXA 5JHWC 4L6TB 1NCVA 4KKUA 3ICEA 1F2LA 3F4MA 2L11A 4OX9Q 2LS01 4WJ4A 3KP9A 5ELBA 2N71A 2PW5A 1Q1BA 4YY3Q 1SJ8A 1S5DD 5LL6S 4P72A 4ZYSA 4FNFA 1PH3A 3CD6A 1HNWL 2PMZB 2XRCA 2JB1A 4ODGA 2F0NA 2F0WA 4C56C 2QEXA 3A55A 1W6JA 1LTTD 2MJFB 1AEXA 1WTWA 2F4VL 1DZ1A 1EOTA 2K50A 4I7ZC 2A1AA 2KJXA 4DV4L 1GM5A 2UXDQ 1K9MC 2LMCB 4OHJA 4A3BG 3MXUA 3RLNA 3K81C 2F1MA 4DV6L 2ENZA 3R5CA 1YJ9A 4DR6L 1PRTC 1NE3A 1CKNB 3CF5A 1K8AC 1X54A 3DA3A 4DK0A 3S14B 3OYYA 1K8MA 4QUCA 2SGEI 2L1BA 3FRPB 3MEKA 3SK8A 5EBCA 3T53B 4CKBA 3F2DA 4A3MG 5HGQA 4HJ7A 3HOZH 4RH6A 2P6AC 2CWGA 5L37A 3FEWX 2SDFA 1UEBA 1XTCD 4MHEA 1N32L 3K59A 3H3VC 4X64L 1KNAA 1UVGA 5IT9c 4FVMA 1IL8A 3DEPA 3SDZA 4NDXA 3DXJC 5T1GA 3SGQI 1PRTF 1IBKL 4DXGA 3L2PA 4PL4A 3NQIA 4GS3A 5ISRA 1DCZA 1UVFA 2ZTCA 2E2IH 4MNOA 1YITA 3DUZA 5JEAG 1LTGD 4LUVA 3I4NG 2CWPA 1M8BA 4DGZA 2KCNA 1F9RA 3TOAA 3RUZA 5KYLA 4DUYL 3L7ZC 4S3SA 4Z7HA 4UP7A 1IYVA 5KYIA 1IZ6A 1TT2A 4CHTB 2IX3A 4C3HB 4X66Q 2F0OA 5M5WB 2WINB 4R4OA 4CGYB 4POGA 5ELEA 1TBRR 3AFQA 4JCVE 1SMYD 4IFDH 2P22B 1SGQI 1XTDA 2WKDA 1HNZQ 3U4ZA 4NV2A 1PYBA 1NTGA 3J81c 4I65A 1N33L 1PVOA 3K6OA 1O7IA 3FDTA 2A69C 2Z8LA 4N9PA 2BE5C 5IIFA 3QJYA 4H13C 4PZ7A 2NUCA 3VR6A 4HJ8A 3PO3B 3I4OA 5CR3A 5E1FA 1SROA 4QF4A 5JOBA 3OXGA 1Z2IA 1C9OA 1V1HA 1SXTA 4K5VA 1XJVA 2QCPX 2NN6G 1S5FD 3S2DB 3QOJA 3V2TA 3RLOA 1EU3A 4L8JA 2ZW3A 1IYUA 1FD7D 3QO2A 1BXTA 2P5ZX 2BL7A 1B3AA 3TP6A 2AUKA 3H09A 5ELOA 4A4IA 3VYRA 1K8GA 2CJSC 1X3PA 4DV0Q 1GUSA 1N8RC 1QZGA 2VNUD
chains in the Genus database with same CATH topology
4L9MA 1LUZA 5LMNQ 1CKNA 4A3FH 2C35B 3FP9A 1YJWA 1G291 2N1AB 4LFCQ 4YHHQ 1Y14B 3PUYA 2WAQE 4KHZA 1QZHA 4LWCA 3CCRA 2H5XA 2JYYA 5C0XG 3DO9A 2R7ZG 1Q1EA 5AJ3L 4C3HH 1NBWA 1P8LA 4GOPB 3S15H 3S1MH 3BU2A 3STBC 2SGQI 4PL3A 2ARPF 1BUSA 2JA9A 1BBWA 1J6QA 3HOWH 1SGPI 3A74A 3J80c 1PH9A 2UU9L 1YHBA 1OMUA 2Z6KA 5CCMA 1AE2A 2CKZB 4DV3L 4A24A 4B3SL 4DV5Q 4PZ6A 4DR4Q 3PO3H 4GNXC 4BBSG 2VQEQ 2BH8A 3CCUA 1HNXQ 1Q81C 2K14A 1Y1CA 1UUCA 1XMQL 1TXYA 3JSBA 5DAEA 1JT8A 4GKKL 5JJKA 4DR7L 1HR0Q 1UWVA 1LM0A 2QGQA 4NXNQ 4NXMQ 4BXXH 3FHWA 3K0XA 2B63H 1KIXA 4AYBG 1FJGL 5K36G 1PJUA 3PO2H 5HQ8A 2JAEA 4KHPQ 2K5NA 2KCXA 4DR2Q 1XPUA 4A3EH 1B7YB 1VQIA 3CC7A 2I5LX 4JYAL 2UXCL 2JW6A 1V9PA 2A19A 4JBJA 4LF6Q 1VQNA 2JXDA 2ZM6Q 2QPOA 2PMZE 3CC4A 3UEYA 2WB1E 2K9HA 2Q2HA 3LJ1A 1IBMQ 4HIKA 3I4MH 4LF8Q 4QGUA 3PV0A 3MEFA 1KHIA 2K4KA 1SGDI 1A0IA 1L0WA 4GOPA 2EQSA 1NMFA 1VQ6A 1SGRI 1HDLA 3CXLA 1XNRQ 4LF5L 3UITA 1SMXA 4NPSA 3CAMA 1HZCA 1A8VA 4BBRH 3HOVH 2A2DA 4B3RL 4DWLA 1W2BA 4JBKA 4PZ8A 3EIVA 4DNIA 3OW2A 2UUBQ 4IJHA 1FGUA 1EYGA 3KJPA 5M3MG 1IW4A 2QQDA 1CT2I 1I94Q 5J3BA 1XMOL 4JI0L 1LYLA 4LNQA 2AKWB 2GKRI 3RU0A 1SGNI 4JI7L 2JA6G 1X74A 2M5XA 3RLFA 1EIYB 2VZAA 2JE6I 4A93G 5IP9H 3S16H 2YTVA 2KHIA 2NVQH 1A63A 2Q2UA 1VQ4A 1OXXK 4R1JA 2A8VA 1NUBA 4LFAQ 4YCUA 4DR1Q 2XMXA 3QWPA 2OQKA 2VQFQ 3U58A 1QVFA 3E2IA 3RN5A 3D0FA 4OWTB 1S72A 5M3FH 3IAM1 3T1HL 4BA2I 2R6GA 3MXNB 1Q7YC 2SGPI 1TWHH 2Z6KC 4MTNA 3PUXA 4BY7G 1AE3A 2I5HA 3BJUA 3VDYA 3K8AA 3H3VI 3UGIA 1YO7A 1LTLA 1I5FA 2JA7G 2FNFX 1WYDA 3GTLH 5E7NA 4JI5Q 5LMUL 1TOTA 4DV2Q 1TUSA 1N36Q 3NENA 4OAVB 4FDBA 5IYCG 2OQ0A 4GNXB 1MT1A 4A3LG 2V6EA 1PPFI 3HOYH 1YHQA 3HKZE 1Y1WH 4HEA1 2MFIA 3PSIA 5JEAJ 5C4XH 1R0RI 2BA0A 3UGDA 2HIXA 2IHEA 4ME3A 3M85A 4UY8C 2NU1I 3E9HA 4JI4Q 1IY6A 4EX5A 4LF4L 3KY9A 5M3FG 3L0OA 3KF8B 3UDXA 4P71A 2NU2I 2WCYA 2RHQB 1XBTA 3LGJA 2JA8H 4DR5L 3A0JA 4BY1G 2N8NA 1M90C 1CKOA 1WOCA 2YV5A 1KAWA 4YY3L 4GOPC 5CCLA 2BA1A 3AFPA 4LF9Q 4JI1L 4LFBQ 1SR3A 4OO1I 2JA1A 1GD7A 4A3BH 1YI2A 4GKJQ 4DV7Q 2E2HH 1BKBA 4JI3Q 2JEBI 4DV1Q 1VQ5A 4E1PA 1I3QH 2QQEA 3Q8DA 4A3MH 1U0LA 2LXKA 4OXPA 1SGYI 1LR8A 4LF7L 1X65A 4GLXA 1VQCA 3D00A 4B6DA 3KOJA 1PH8A 2GVAA 3PIOA 1W3SA 4R4QA 5C0XJ 2VY3A 2KHJA 2VW9A 3OXFA 4DUZQ 3HFZB 1PH1A 5FUVA 4G76A 3I4NH 1XNQL 4K0KQ 3I55A 5C44G 4IPDA 2DUDA 1G51A 3I7FA 3HOXG 2UXBL 3SDJA 1V1IA 2EXDA 5C4JH 1LR9A 2MO1A 1WFQA 1Y1VG 4OWXB 1KMAA 4A3GG 1X6OA 4QY7A 4HGUA 1TBNA 2ODDA 3KJOA 3CW2C 1V43A 5IWAQ 1KXLA 2CCZA 3HH2C 2DB6A 3HOUG 2KENA 3IAS1 3GDEA 1CHOI 5H1SE 2XTQA 1ASZA 4LUZA 1JB7A 1IBLQ 3E9IA 4XTCS 3PGZA 3H0GG 4DV0L 4R4IA 1D7QA 1MJEA 1PFSA 2VRWB 2KMPA 3F1ZA 1VQBA 2LSSA 2KCTA 2WAQG 3GTJH 4LFCL 1PH2A 4UXIA 1VQDA 4Z7GA 2NU4I 1X56A 1J5EQ 4X65Q 1HNWQ 3CP0A 4JI6L 1N9WA 2R7ZH 1M1KC 4X62Q 1EQQA 4B3ML 1IL2A 4DV4Q 2FXQA 4JV5L 3GTOH 4UP8A 3FC3A 1KL9A 3L0IA 2OTLA 4DK6C 4DV6Q 2YTYA 2ZTEA 4QQBX 3H15A 1BBUA 1EWIA 4IFDI 5JJLA 4IOCA 1SRUA 1VQGA 4DV5L 3RZOH 4BBSH 1OXSC 3JAMi 2VQEL 2NVXH 4B3TL 3B6YA 4X64Q 1HNXL 1RIPA 1E3PA 2JZMA 2JQOA 3RN2A 4UPAA 2L8EA 3CCVA 4UP9A 1HR0L 4NXNL 4DUYQ 1YNXA 4J15A 2ALYB 4I1TA 3J81j 1HR0W 2ASBA 1G6PA 4QJFA 2R7FA 4KHPL 4DR2L 4YZDA 5FJ8G 1KC8C 1N33Q 4RMFA 1N34Q 1PH6A 2BH2A 2WB1G 1YZ6A 3ERSX 3ULPA 2EIFA 3BZKA 3UDGA 2L7XA 2ZM6L 1P16A 1Y8FA 3UDIA 1TWAH 1U5KA 1C0AA 3RZDH 1TIHA 2YYZA 4LF8L 1TBQR 3GOXA 4ALPA 1VQKA 2CQOA 3KF6B 1UE6A 4GLAC 1M8CA 2KMRA 4DAYB 1JMCA 1CKMA 1VQAA 2RHSB 4AH6A 3WWVA 2QQCA 3F2CA 2PI2A 3OTOL 1OXUA 3CCQA 4YWKA 4GN3B 4IPGA 5AJ3Q 2JEAI 3CCSA 3GTMH 2JA5G 3KDFB 2W0TA 5M3MH 3UEJA 2D62A 1VCIA 4TQUS 2HQLA 1VQLA 1OVOA 1KBEA 3CXCA 1GO3E 2E2JH 2JA6H 1B8AA 4APVA 1VQ8A 4B3SQ 4A93H 3S24A 3G48A 4P73A 3CC2A 1Y1BA 3PDNA 4Q9VA 2AWNA 1UE7A 2IX1A 3SEKC 2ZJQA 1GKHA 1D8LA 5M5XH 3J81i 3AJFA 4GKKQ 2IX0A 1H0ZA 4KLKA 3ZJYC 1GVPA 5HGIA 3UE1A 3S1QH 1PHJA 1FL0A 1VDDA 3VA9A 4JI8L 4DPGA 3PF4A 4HIOA 3PIPA 4IJLA 3RNUA 3G71A 3TRZA 1DGSA 4BY7H 2F3IA 2F66B 3KF6A 3J7A5 1JJCB 2ATWA 2JA7H 2UXCQ 2WP8J 1UE1A 4DV2L 3A5ZB 2E8GA 5IYCH 2N49A 4WJ3M 3HKZG 3W5OA 2SGFI 4A3LH 2JK8A 3RR5A 1HJAI 4A3IG 5IY0A 4A3KG 3K80C 2GVIA 2J9RA 2J87A 3VDPA 1KRSA 3KDFA 1YU6C 4LF5Q 1K83H 3AYHB 2F52A 2YQPA 4JI4L 5IYBG 1E22A 2F6MB 1TWFH 5FLMG 3J80i 3CCLA 4BY1H 3S1NH 3OL0A 1K0RA 1H95A 1DS2I 2B3GA 4HJ9A 4LW1A 2ZJRA 1X9NA 2XTRA 4JI0Q 3F8TA 2YUUA 1LR7A 2CAZB 1PCEA 1HJPA 2K19A 4C2MH 5IP7G 2NVTH 3U4VA 3VDUA 4A3CG 1YIJA 1TURA 1X3EA 2K75A 2XGTA 5GAGC 3DA4A 4O0AA 2JB3A 5GQOA 4DV1L 3BZCA 2HHHL 4A3JG 2UUCQ 4DKAC 2PNHA 3M4PA 5EAYA 4AQYL 2FUG1 1Q8KA 3J7ZC 2ZJPA 4BA1I 1V1QA 4OAUC 4O1PA 2R93G 1E1OA 3T1HQ 4OX9L 1TGSI 1PV4A 5C44H 1T9HA 2VUMG 3UDFA 1PTQA 3HOXH 2MNAA 2UXDL 2KKMA 1Y1VH 1N13A 3A5UA 2R92H 4JBMA 3QTLD 1Q12A 3LJ0A 1VQ7A 4A3GH 1BMOA 1S40A 2V1CC 1Q82C 1X4SA 4HIDA 1XX6A 4DR3Q 1MKHA 3LJ2A 3HOUH 2R7DA 2OCEA 4GLVB 5C3EG 5HI7A 4GN5A 4L5SA 2Q2IA 2L1LB 1SGEI 3EN2A 4YZ9A 4DAMA 1VQEA 1PTRA 2N52A 3FKIH 3H0GH 4JI2Q 2CFMA 3PCOB 2E5LQ 3SGBI 2Y0SE 4DR5Q 2ZTDA 1EQRA 1FVIA 1VQOA 4X66L 1Q46A 4X6AH 4FKDA 1YBYA 3TQYA 1WI5A 1X3FA 1HNZL 1CSOI 2ID0A 1WJJA 2ZRRA 1J5EL 4X65L 2R92G 3M3YH 3GTGH 1WCMG 3E59A 3M4OH 4X62L 2DGYA 4JI1Q 3M7NA 2WVJA 1CGII 3CPFA 1CGJI 3PUZA 1I50H 5BR8Q 1EUJA 1E7ZA 1R9TH 5HY6A 4GI3C 2NU0I 2UUAQ 3FKIG 1AN1I 1L1OC 3I2ZA 3TJQA 4LF7Q 5LNK1 3DLLA 3W1GA 3CCMA 1K3RA 3T1YQ 4A3DG 5LMNL 2A2CA 4JOIA 2IP6A 2IHFA 3F2BA 2MO0A 1IXRA 1PA6A 2NN6I 5LMNW 1YJNA 4YHHL 2OVOA 1VQFA 5FLXc 1XNQQ 4C3JH 1SN8A 1HPTA 5IE8A 1MJCA 2E73A 1Q86C 5IYDH 2F4VQ 2UXBQ 3BJIA 1VS0A 4JBWA 2K5HA 3TS0A 2PQAA 3KYHC 3E0EA 3PUVA 5FJ8H 2VL6A 3OVOA 4DR6Q 1N34L 3NBHB 3TEHB 1HZBA 4O1OA 1PH4A 1TBOA 2LXJA 3HOZG 4DR4L 3M9BA 5C0XI 2K52A 4JC0A 1N32Q 2AHOB 4NV5A 1A62A 2B8TA 3S14H 1OTCA 2HIVA 1IBKQ 4YZCA 3K7UC 1B70B 4L5RC 4OONA 3ULLA 2YTXA 3GTKH 2N3SA 3NEMA 4IPCA 3FBVA 4LUOA 1JJGA 4AIMA 4RG1A 2D0OA 4NXML 4Y7NH 2JJQA 1KD1C 3G6EA 5IYDG 1CE3A 4QL5A 4AS2A 1CSPA 3TREA 4OWWB 4PMWA 4IFDG 1QUQB 4JI6Q 2F3CI 2SGDI 1VQJA 1YEZA 5ELNA 3KFUA 4A76A 4LF6L 5M5WH 4B3MQ 4JV5Q 2IY5B 2JA5H 5GADC 4JG2A 2JB2A 2N17A 3I56A 2RCNA 4POFA 2BUSA 2L15A 3W1BA 1HH2P 1SE8A 1IBML 4P75A 3TS2A 2V53A 1C7YA 2IT1A 2D0PA 1TWGH 2OWOA 2AMCB 4O2DA 4B3TQ 2NZOA 1PYSB 4L5QA 1XNRL 4H02A 3S2DH 1OYVI 4IOAA 4YWLA 4YWMA 1FAQA 4A3FG 2I0QA 5GAHC 3VE5A 4AS3A 2UUBL 1EOVA 5JJIA 1HZ9A 5M5YH 3I9V1 1I94L 2A20A 3HOWG 2UU9Q 2NU3I 3GD7A 4DV3Q 4C3IH 3KLWA 4QIWE 4JOIC 3PO3G 5GAEC 4UXJA 3S1RH 1L1OB 1QUQA 3UE0A 1QVGA 4A3IH 3CMEA 3PF5A 5EX0A 4A3KH 3M4QA 1W4RA 4OVOA 1XMQQ 4L5TA 5FUYA 1OXVA 4LFAL 4DR1L 2V1CA 4YCWA 1BVSA 4DR7Q 2OTJA 2VQFL 4G75A 3JC66 3EBEA 2Q2TA 1FARA 2K5VA 3NELA 3AQQA 5IYBH 2ERWA 3G4SA 4BXXG 4HJAA 1FJGQ 2KMQA 2B63G 5FLMH 1VQPA 2GN5A 2OD1A 1RL2A 3PO2G 1NMGA 5GROA 3OTOQ 4AYBE 1FYBA 2GKTI 5FUWA 4A3EG 5EX3A 4JYAQ 4JI5L 1OMTA 1JJ2A 3PUWA 1X55A 1VQ9A 1AH9A 2E5RA 1N36L 4MZ9A 1L2FA 1CT0I 3CQZH 2LEOA 5IP7H 3I4MG 2QQ0A 2ORVA 1VQMA 1OXTA 2DIPA 2NZHA 4A3CH 4HFVA 2KMOA 4R4TA 3UFFA 3CCEA 2ELIA 3ULJA 1XPOA 4SGBI 2ES2A 2YU9H 4P74A 1PH7A 2VS1A 4A3JH 2PI2E 4R4CA 3H3VH 2WFWA 2I5MX 2UUCL 4BBRG 1NY4A 3HOVG 4B3RQ 1QVCA 3S17H 1R79A 1E1TA 1CT4I 1IY5A 4HJ5A 1L1OA 2RIOA 4U6RA 2R93H 1Z9FA 4JI8Q 1YVCA 1ASYA 2YFBA 1YTPA 2VUMH 3GTPH 1HZAA 1IYJB 1XMOQ 3GTQH 4PL5A 1KBFA 3B4VC 3U50C 5DLQE 2ORWA 3OXLA 2GKVA 2Z0SA 4JI7Q 4LF9L 4LFBL 1JE5A 4GXTA 2QA4A 5IP9G 2B29A 4HIMA 4GKJL 4XIGS 4DV7L 4KI0A 3CPWA 1RFHA 4JI3L 1XA6A 3D31A 1VQHA 4PG3A 2MQHA 4DR3L 2KCMA 3CMAA 3DM3A 4NB3A 1MIUA 5C3EH 4Y52H 1EIFA 1DS3I 3HKSA 5FUXA 3STBD 4YCVA 2HT1A 2Y0SG 4DUZL 4JI2L 1Z7KB 1EFWA 1KQSA 2CWAA 1X3GA 4GN4B 1SLJA 1KRTA 2E5LL 4K0KL 4UXHA 3JAMc 1E24A 1PH5A 5LMUQ 3GO5A 2LUYA 3IRBA 4DK3C 1CUKA 4TVAB 1Z47A 4EQ5A 2RF4A 1S3OA 1SFOH 1WCMH 2UZ3A 2KBNA 1UE5A 3ER0A 1NJIC 3S2HH 4IPHA 1XPRA 5IWAL 3HOYG 3SGIA 3AEVA 1K73C 1Y1WG 1CSQA 5C4XG 5BR8L 1I6HH 2N78A 2B0UC 4E1RA 3P23A 2XTIA 1TWCH 2NVYH 4LF4Q 2ENNA 4IO9A 1IBLL 3UGLA 2HHHQ 2UUAL 2PQAB 3CCJA 3K7AH 4AQYQ 2AWOA 2JA8G 2ROWA 4A3DH 4IFDJ 4OO1G 3T1YL 2YFAA 1YHAA 4A75A 2GVBA 4GNXA 5JHWC 3ICEA 3F4MA 4OX9Q 4WJ4A 3KP9A 2N71A 4YY3Q 1Q1BA 1SJ8A 4P72A 1PH3A 3CD6A 1HNWL 2XRCA 2JB1A 2QEXA 2MJFB 2F4VL 2K50A 2A1AA 4DV4L 1GM5A 2UXDQ 1K9MC 4A3BG 3RLNA 3K81C 4DV6L 2ENZA 1YJ9A 4DR6L 1NE3A 1CKNB 3CF5A 1K8AC 1X54A 3DA3A 3OYYA 2SGEI 3MEKA 3F2DA 4A3MG 5HGQA 4HJ7A 3HOZH 2P6AC 1UEBA 1N32L 4X64L 1UVGA 5IT9c 3SGQI 1IBKL 3L2PA 4PL4A 4GS3A 1UVFA 2ZTCA 2E2IH 4MNOA 1YITA 5JEAG 4LUVA 3I4NG 2CWPA 1M8BA 4DUYL 3L7ZC 4Z7HA 4UP7A 1IZ6A 4X66Q 4R4OA 4POGA 1TBRR 3AFQA 4JCVE 2P22B 1SGQI 1XTDA 1HNZQ 3U4ZA 4NV2A 1PYBA 1NTGA 3J81c 1N33L 1PVOA 1O7IA 4PZ7A 4HJ8A 3I4OA 1SROA 3OXGA 1C9OA 1V1HA 1XJVA 2NN6G 3RLOA 5ELOA 4A4IA 1K8GA 2CJSC 4DV0Q 1N8RC 1QZGA 2VNUD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI0 Q;  3F8T A;  1LUZ A;  1QUQ A;  3UE0 A;  5LMN Q;  1CKN A;  1QVG A;  4A3I H;  1HJP A;  3CME A;  1G51 A;  3PF5 A;  3I7F A;  4A3K H;  3M4Q A;  4A3F H;  3HOX G;  4C2M H;  5IP7 G;  1XMQ Q;  2C35 B;  3FP9 A;  4L5T A;  2NVT H;  1YJW A;  3U4V A;  2UXB L;  1OXV A;  1G29 1;  2EXD A;  4LFA L;  4LFC Q;  5C4J H;  4DR1 L;  4YHH Q;  4A3C G;  4YCW A;  1YIJ A;  2MO1 A;  1WFQ A;  1BVS A;  1Y14 B;  3PUY A;  1X3E A;  4DR7 Q;  2WAQ E;  2OTJ A;  2VQF L;  1Y1V G;  3JC6 6;  3EBE A;  2K75 A;  2Q2T A;  2XGT A;  4KHZ A;  5GAG C;  1QZH A;  4LWC A;  4O0A A;  2K5V A;  4OWX B;  2H5X A;  3CCR A;  5GQO A;  3NEL A;  4A3G G;  1X6O A;  4QY7 A;  5C0X G;  3AQQ A;  5IYB H;  4DV1 L;  3G4S A;  2R7Z G;  1Q1E A;  4BXX G;  5AJ3 L;  4C3H H;  1NBW A;  1P8L A;  3BZC A;  4HJA A;  4GOP B;  1FJG Q;  3S15 H;  2B63 G;  3S1M H;  3BU2 A;  2HHH L;  4A3J G;  3STB C;  3KJO A;  5FLM H;  3CW2 C;  1V43 A;  1VQP A;  5IWA Q;  2GN5 A;  2UUC Q;  1KXL A;  1RL2 A;  2CCZ A;  4DKA C;  3PO2 G;  2PNH A;  2JA9 A;  3M4P A;  5EAY A;  1NMG A;  5GRO A;  3HOU G;  2KEN A;  3OTO Q;  4AQY L;  4AYB E;  3GDE A;  1BBW A;  1Q8K A;  3J7Z C;  2ZJP A;  4BA1 I;  1J6Q A;  1V1Q A;  5H1S E;  3HOW H;  3A74 A;  3J80 c;  4A3E G;  1PH9 A;  1ASZ A;  2UU9 L;  1YHB A;  4JYA Q;  4LUZ A;  1JB7 A;  2Z6K A;  2R93 G;  1E1O A;  3T1H Q;  1IBL Q;  3E9I A;  4XTC S;  1AE2 A;  3PGZ A;  2CKZ B;  4DV3 L;  3H0G G;  4JI5 L;  4B3S L;  4DV5 Q;  1JJ2 A;  4OX9 L;  3PUW A;  1X55 A;  4PZ6 A;  4DV0 L;  1VQ9 A;  4DR4 Q;  1AH9 A;  3PO3 H;  4GNX C;  4BBS G;  2VQE Q;  2BH8 A;  3CCU A;  1PV4 A;  5C44 H;  1T9H A;  4R4I A;  2VUM G;  1D7Q A;  1N36 L;  1PFS A;  4MZ9 A;  3UDF A;  1MJE A;  1HNX Q;  1Q81 C;  3F1Z A;  1L2F A;  3CQZ H;  1VQB A;  2K14 A;  2LSS A;  2KCT A;  3HOX H;  5IP7 H;  2WAQ G;  3I4M G;  3GTJ H;  2MNA A;  1VQM A;  1OXT A;  1XMQ L;  2NZH A;  4A3C H;  1TXY A;  4LFC L;  1JT8 A;  1PH2 A;  4GKK L;  2UXD L;  1VQD A;  5JJK A;  1Y1V H;  4DR7 L;  1X56 A;  3A5U A;  2R92 H;  4JBM A;  1J5E Q;  1Q12 A;  4R4T A;  4X65 Q;  1HR0 Q;  1HNW Q;  3CP0 A;  1UWV A;  1LM0 A;  2QGQ A;  3ULJ A;  3CCE A;  1XPO A;  1VQ7 A;  1N9W A;  4JI6 L;  4NXN Q;  4A3G H;  4NXM Q;  2R7Z H;  1S40 A;  2V1C C;  2ES2 A;  4BXX H;  2YU9 H;  3FHW A;  1M1K C;  1Q82 C;  4P74 A;  4X62 Q;  1EQQ A;  1PH7 A;  3K0X A;  2VS1 A;  2B63 H;  4HID A;  4A3J H;  1KIX A;  4DR3 Q;  2PI2 E;  4R4C A;  1MKH A;  4AYB G;  1FJG L;  3H3V H;  5K36 G;  2WFW A;  4B3M L;  2I5M X;  4DV4 Q;  2FXQ A;  2UUC L;  4BBR G;  1IL2 A;  4JV5 L;  3PO2 H;  1NY4 A;  4UP8 A;  3GTO H;  1KL9 A;  3HOV G;  2OTL A;  3HOU H;  4B3R Q;  2R7D A;  1QVC A;  4DK6 C;  3S17 H;  2K5N A;  2OCE A;  1E1T A;  4GLV B;  5C3E G;  4DV6 Q;  4KHP Q;  4GN5 A;  4DR2 Q;  2YTY A;  4L5S A;  2ZTE A;  4QQB X;  2Q2I A;  1XPU A;  3EN2 A;  4HJ5 A;  3H15 A;  1B7Y B;  1L1O A;  5C44 G;  4A3E H;  1VQI A;  4DAM A;  1BBU A;  2I5L X;  1VQE A;  3CC7 A;  1EWI A;  2R93 H;  4JYA L;  1Z9F A;  2UXC L;  4JI8 Q;  1V9P A;  1YVC A;  3FKI H;  4IFD I;  2A19 A;  3H0G H;  4JBJ A;  4IOC A;  1SRU A;  1ASY A;  4LF6 Q;  1VQN A;  5JJL A;  1VQG A;  4DV5 L;  4JI2 Q;  2CFM A;  2ZM6 Q;  3RZO H;  4BBS H;  2PMZ E;  3CC4 A;  2WB1 E;  3PCO B;  1OXS C;  3JAM i;  2VQE L;  2VUM H;  3GTP H;  1HZA A;  2NVX H;  4B3T L;  1IYJ B;  2E5L Q;  3B6Y A;  2Y0S E;  4DR5 Q;  2Q2H A;  2ZTD A;  4X64 Q;  1HNX L;  1XMO Q;  1EQR A;  3GTQ H;  3U50 C;  5DLQ E;  1RIP A;  1IBM Q;  1FVI A;  4HIK A;  1VQO A;  3I4M H;  4LF8 Q;  2Z0S A;  4QGU A;  3PV0 A;  1E3P A;  4X66 L;  4JI7 Q;  1Q46 A;  4X6A H;  2JQO A;  1KHI A;  2K4K A;  3MEF A;  4LF9 L;  4LFB L;  3RN2 A;  1A0I A;  1YBY A;  1L0W A;  4GOP A;  4UPA A;  2EQS A;  3TQY A;  1WI5 A;  1NMF A;  1X3F A;  1VQ6 A;  1JE5 A;  1HNZ L;  2ID0 A;  3CCV A;  1WJJ A;  2QA4 A;  5IP9 G;  2B29 A;  4UP9 A;  4X65 L;  4HIM A;  4XIG S;  1J5E L;  1HR0 L;  1XNR Q;  4DV7 L;  4LF5 L;  4NXN L;  4KI0 A;  4DUY Q;  3GTG H;  3M3Y H;  1SMX A;  3CPW A;  1YNX A;  4JI3 L;  4J15 A;  1WCM G;  2ALY B;  3D31 A;  1VQH A;  3CAM A;  4NPS A;  3J81 j;  3M4O H;  4X62 L;  2DGY A;  1HR0 W;  4PG3 A;  1HZC A;  1A8V A;  2MQH A;  4DR3 L;  2ASB A;  4JI1 Q;  1G6P A;  2KCM A;  3CMA A;  3M7N A;  4BBR H;  3DM3 A;  4NB3 A;  3HOV H;  1MIU A;  3CPF A;  5C3E H;  4QJF A;  4B3R L;  2R7F A;  4KHP L;  1W2B A;  4JBK A;  4PZ8 A;  3PUZ A;  4Y52 H;  1I50 H;  1EIF A;  4DR2 L;  5BR8 Q;  1EUJ A;  5FJ8 G;  1KC8 C;  3EIV A;  1N33 Q;  4RMF A;  1E7Z A;  1N34 Q;  4DNI A;  3OW2 A;  1PH6 A;  2BH2 A;  3HKS A;  2WB1 G;  2UUB Q;  4IJH A;  1R9T H;  1YZ6 A;  3STB D;  4YCV A;  3ERS X;  5HY6 A;  2HT1 A;  1FGU A;  2Y0S G;  3ULP A;  2UUA Q;  2EIF A;  3FKI G;  3BZK A;  4DUZ L;  1L1O C;  3UDG A;  2ZM6 L;  4JI2 L;  3I2Z A;  1P16 A;  1EFW A;  1KQS A;  2CWA A;  1EYG A;  4LF7 Q;  3DLL A;  1X3G A;  3KJP A;  5M3M G;  4GN4 B;  1SLJ A;  1KRT A;  3W1G A;  3UDI A;  2E5L L;  1TWA H;  4K0K L;  3CCM A;  1K3R A;  1I94 Q;  5J3B A;  3T1Y Q;  1XMO L;  1U5K A;  4JI0 L;  1LYL A;  4LNQ A;  4A3D G;  1C0A A;  2AKW B;  3RZD H;  5LMN L;  3JAM c;  2YYZ A;  4LF8 L;  1E24 A;  4JOI A;  4JI7 L;  2IHF A;  3F2B A;  2JA6 G;  1PH5 A;  2MO0 A;  1IXR A;  1PA6 A;  2NN6 I;  5LMN W;  5LMU Q;  3RLF A;  3GO5 A;  1EIY B;  3IRB A;  4DK3 C;  1YJN A;  4YHH L;  1CUK A;  1VQF A;  5FLX c;  4ALP A;  2VZA A;  4TVA B;  2JE6 I;  4A93 G;  5IP9 H;  1XNQ Q;  4C3J H;  1VQK A;  1Z47 A;  1SN8 A;  2CQO A;  2RF4 A;  1UE6 A;  3KF6 B;  4EQ5 A;  3S16 H;  2YTV A;  2KHI A;  1S3O A;  1SFO H;  2NVQ H;  1WCM H;  5IE8 A;  4GLA C;  1A63 A;  1MJC A;  1Q86 C;  2KBN A;  1UE5 A;  3ER0 A;  4DAY B;  1NJI C;  4B3M Q;  2Q2U A;  3S2H H;  1JMC A;  5IYD H;  1CKM A;  1VQ4 A;  4IPH A;  1OXX K;  4R1J A;  2F4V Q;  2UXB Q;  1XPR A;  1VS0 A;  2A8V A;  1VQA A;  4JBW A;  2RHS B;  2K5H A;  4YCU A;  4LFA Q;  5IWA L;  4DR1 Q;  3HOY G;  3TS0 A;  3SGI A;  2PQA A;  4AH6 A;  3KYH C;  3E0E A;  3AEV A;  1K73 C;  3WWV A;  3PUV A;  1Y1W G;  1CSQ A;  2OQK A;  2VQF Q;  3U58 A;  1QVF A;  5FJ8 H;  2VL6 A;  3F2C A;  5C4X G;  2PI2 A;  3OTO L;  4DR6 Q;  5BR8 L;  3S1R H;  1OXU A;  3CCQ A;  3RN5 A;  3D0F A;  1I6H H;  4YWK A;  2N78 A;  4GN3 B;  1N34 L;  3NBH B;  3TEH B;  4OWT B;  4IPG A;  1HZB A;  5AJ3 Q;  2XTI A;  1TWC H;  2NVY H;  1S72 A;  5M3F H;  4LF4 Q;  2JEA I;  4IO9 A;  3T1H L;  1IBL L;  4BA2 I;  2HHH Q;  2UUA L;  2PQA B;  2R6G A;  3CCJ A;  3MXN B;  1Q7Y C;  1PH4 A;  2LXJ A;  3CCS A;  1TWH H;  3GTM H;  3HOZ G;  4DR4 L;  3M9B A;  5C0X I;  2JA5 G;  2K52 A;  3KDF B;  5M3M H;  2Z6K C;  4JC0 A;  4MTN A;  2AHO B;  3PUX A;  2D62 A;  3K7A H;  1VCI A;  1A62 A;  4AQY Q;  1AE3 A;  2I5H A;  2AWO A;  2HQL A;  4TQU S;  3BJU A;  3VDY A;  3K8A A;  2JA8 G;  4A3D H;  4OO1 G;  4IFD J;  3T1Y L;  1VQL A;  3PF4 A;  3H3V I;  3S14 H;  1OTC A;  1YHA A;  3CXC A;  1GO3 E;  2GVB A;  4GNX A;  4A75 A;  2HIV A;  2E2J H;  2JA6 H;  1IBK Q;  3ICE A;  1LTL A;  1B8A A;  1I5F A;  3K7U C;  4APV A;  2JA7 G;  1WYD A;  1B70 B;  1VQ8 A;  4B3S Q;  5E7N A;  4OON A;  3ULL A;  5LMU L;  4JI5 Q;  4L5R C;  4OX9 Q;  3GTL H;  4WJ4 A;  2YTX A;  4DV2 Q;  4A93 H;  3GTK H;  2N3S A;  4YY3 Q;  1Q1B A;  3S24 A;  3NEM A;  3G48 A;  4IPC A;  4P73 A;  3CC2 A;  4P72 A;  1PH3 A;  1N36 Q;  4LUO A;  3CD6 A;  1HNW L;  3NEN A;  1JJG A;  4FDB A;  4GKJ L;  4AIM A;  2AWN A;  2D0O A;  4RG1 A;  4NXM L;  1UE7 A;  5IYC G;  2OQ0 A;  4GNX B;  2IX1 A;  4Y7N H;  2JJQ A;  2QEX A;  2ZJQ A;  1GKH A;  1KD1 C;  1D8L A;  3G6E A;  4A3L G;  5M5X H;  5IYD G;  4QL5 A;  3J81 i;  2F4V L;  3HOY H;  1YHQ A;  2K50 A;  2A1A A;  3HKZ E;  4DV4 L;  4GKK Q;  1GM5 A;  1Y1W H;  3PSI A;  1CSP A;  2MFI A;  3TRE A;  2UXD Q;  5JEA J;  1K9M C;  2IX0 A;  5C4X H;  4KLK A;  4PMW A;  3ZJY C;  1GVP A;  4OWW B;  4A3B G;  4IFD G;  2BA0 A;  3K81 C;  2HIX A;  2IHE A;  4ME3 A;  3RLN A;  1QUQ B;  3UE1 A;  3M85 A;  4DV6 L;  1YJ9 A;  4UY8 C;  3S1Q H;  4JI6 Q;  4DR6 L;  1NE3 A;  1CKN B;  3CF5 A;  1PHJ A;  1K8A C;  2VNU D;  1VQJ A;  1X54 A;  3E9H A;  4JI4 Q;  1YEZ A;  1FL0 A;  5ELN A;  3OYY A;  4EX5 A;  3KFU A;  4A76 A;  4LF4 L;  4JI8 L;  5M3F G;  4LF6 L;  3L0O A;  3KF8 B;  3UDX A;  4DPG A;  4P71 A;  5HGQ A;  5M5W H;  3F2D A;  4HIO A;  4HJ7 A;  4A3M G;  5GAD C;  3PIP A;  4JG2 A;  2JA5 H;  4IJL A;  3RNU A;  4BY7 G;  2IY5 B;  3G71 A;  3TRZ A;  2R92 G;  1DGS A;  2RHQ B;  4BY7 H;  3I56 A;  2F3I A;  2RCN A;  1UEB A;  3LGJ A;  4POF A;  2JA8 H;  1N32 L;  2L15 A;  4DR5 L;  3A0J A;  3W1B A;  3KF6 A;  4X64 L;  1HH2 P;  4BY1 G;  2N8N A;  5IT9 c;  3J7A 5;  1SE8 A;  1IBM L;  4P75 A;  4JV5 Q;  1JJC B;  1M90 C;  1CKO A;  2ATW A;  2JA7 H;  3TS2 A;  2UXC Q;  1IBK L;  1WOC A;  2WP8 J;  3L2P A;  4GS3 A;  1C7Y A;  2ZTC A;  2E2I H;  4MNO A;  1YIT A;  5JEA G;  2IT1 A;  2D0P A;  1TWG H;  2OWO A;  2YV5 A;  1UE1 A;  2AMC B;  4LUV A;  1KAW A;  4O2D A;  4DV2 L;  4YY3 L;  3A5Z B;  3I4N G;  2CWP A;  4B3T Q;  1L1O B;  2E8G A;  2NZO A;  1PYS B;  4L5Q A;  1XNR L;  5IYC H;  4H02 A;  3L7Z C;  4DUY L;  4GOP C;  2N49 A;  4WJ3 M;  3S2D H;  4UP7 A;  3HKZ G;  2BA1 A;  3W5O A;  4A3L H;  1IZ6 A;  3AFP A;  2JK8 A;  4X66 Q;  3RR5 A;  4A3I G;  4IOA A;  4YWL A;  5IY0 A;  4YWM A;  4A3K G;  4LF9 Q;  4JI1 L;  4A3F G;  3K80 C;  4LFB Q;  2I0Q A;  1SR3 A;  4R4O A;  5GAH C;  4POG A;  4OO1 I;  3AFQ A;  1GD7 A;  4A3B H;  4JCV E;  1KRS A;  1XTD A;  1YI2 A;  1HNZ Q;  3U4Z A;  1PYB A;  1NTG A;  3KDF A;  4GKJ Q;  3J81 c;  4DV7 Q;  2E2H H;  1K83 H;  3AYH B;  4LF5 Q;  1BKB A;  2F52 A;  1N33 L;  1PVO A;  4JI3 Q;  2JEB I;  4JI4 L;  4DV1 Q;  1VQ5 A;  1O7I A;  1I3Q H;  5IYB G;  2UUB L;  3Q8D A;  1E22 A;  1EOV A;  4A3M H;  5JJI A;  1HZ9 A;  1U0L A;  1TWF H;  4PZ7 A;  2LXK A;  4OXP A;  5FLM G;  4HJ8 A;  3I4O A;  3J80 i;  1SRO A;  5M5Y H;  4LF7 L;  1X65 A;  3CCL A;  4GLX A;  1C9O A;  1VQC A;  1XJV A;  4BY1 H;  3S1N H;  2NN6 G;  1I94 L;  3RLO A;  1K0R A;  3KOJ A;  3HOZ H;  1H95 A;  1PH8 A;  1N32 Q;  2GVA A;  3PIO A;  3HOW G;  1W3S A;  2UU9 Q;  4R4Q A;  5C0X J;  2VY3 A;  3GD7 A;  2KHJ A;  5ELO A;  4A4I A;  2VW9 A;  4DV3 Q;  4DUZ Q;  1K8G A;  3HFZ B;  4C3I H;  1PH1 A;  3KLW A;  4DV0 Q;  2B3G A;  4HJ9 A;  3I4N H;  4LW1 A;  4QIW E;  1N8R C;  4JOI C;  1QZG A;  1XNQ L;  2ZJR A;  3PO3 G;  5GAE C;  4K0K Q;  3I55 A;  4IPD A;  2DUD A;  1X9N A; 
#chains in the Genus database with same CATH topology
 4RGM A;  4L9M A;  1LUZ A;  5C3W A;  4DF7 A;  5C4H A;  5LMN Q;  1CKN A;  1SYC A;  2TMP A;  4EQP A;  4OEL B;  1PFM A;  2A68 C;  4A3F H;  2F0M A;  2C35 B;  3FP9 A;  1YJW A;  3I70 A;  5KGU A;  1G29 1;  4NKL A;  2N1A B;  4LFC Q;  4YHH Q;  5M5Y B;  1B4O A;  4DNT B;  2NBF A;  2G9D A;  1Y14 B;  3PUY A;  2WAQ E;  2TSS A;  2FEF A;  4WRD A;  5CYU A;  3MTS A;  5DNF A;  4V19 0;  4KHZ A;  3LWE A;  1QZH A;  4A3E B;  2F0V A;  4LWC A;  1EY6 A;  3VR2 A;  3CCR A;  2H5X A;  2PQ8 A;  2JYY A;  5F2D A;  2EYH A;  2RA4 A;  3DO9 A;  5C0X G;  2R7Z G;  2K5W A;  5EKI A;  1Q1E A;  5AJ3 L;  4C3H H;  1NBW A;  1P8L A;  2FU2 A;  4GOP B;  3S15 H;  3S1M H;  3BU2 A;  4C3I B;  3STB C;  2SGQ I;  3ZYY X;  1H9J A;  4PL3 A;  2ARP F;  1SNO A;  4KD3 A;  4TRD A;  1BUS A;  1J9O A;  3A8K E;  2JA9 A;  3PQI A;  3FMC A;  1AZP A;  3S1R B;  3LWU A;  3HKZ B;  2LFN A;  1BBW A;  2D9U A;  5IOC A;  1YNJ C;  2WGC A;  1J6Q A;  3HOW H;  1SGP I;  1UNS A;  3CKI B;  3I4M B;  1EEI D;  3A74 A;  3J80 c;  4A3I B;  2Z4H A;  1PH9 A;  2UU9 L;  1YHB A;  1OMU A;  2Z6K A;  5CCM A;  1CZG A;  2K5D A;  1JCK B;  1AE2 A;  5D3D A;  2CKZ B;  4DV3 L;  4A24 A;  1B44 D;  2MPM A;  3K5M A;  4B3S L;  4DV5 Q;  1G2T A;  4HN7 A;  4PZ6 A;  4DR4 Q;  3PO3 H;  4GNX C;  4BBS G;  2VQE Q;  2BH8 A;  3CCU A;  4G7Z C;  1EQV A;  2JXM B;  2HQE A;  1HEV A;  1HNX Q;  1EWH A;  1Q81 C;  1EY4 A;  2QZG A;  1O7Z A;  2K14 A;  2BL8 A;  4M1U B;  4KMU C;  1Y1C A;  3P75 A;  4BBR B;  1UUC A;  4KHV A;  1DON A;  2EE1 A;  1XMQ L;  3HOV B;  1TXY A;  3JSB A;  5DAE A;  1JT8 A;  4GKK L;  5JJK A;  5KND A;  4DR7 L;  1ICW A;  1HR0 Q;  3KLS X;  1UWV A;  1LM0 A;  2QGQ A;  4NXN Q;  1PDQ A;  2B2Y A;  4NXM Q;  4BXX H;  3FHW A;  3MVV A;  2PCF B;  1STA A;  3K0X A;  2B63 H;  1KIX A;  5E3F A;  2LKV A;  4AYB G;  1FJG L;  2HDL A;  5K36 G;  1B9M A;  1PJU A;  5A2Q L;  4RHR A;  3PO2 H;  1WTX A;  5CC4 A;  5HQ8 A;  4KY6 A;  2JAE A;  4KHP Q;  2K5N A;  2KCX A;  4DR2 Q;  1C48 A;  2SEB D;  3NQT A;  1XPU A;  4A3E H;  1B7Y B;  5I9P A;  1GHJ A;  1RJT A;  5FK9 C;  1VQI A;  3CC7 A;  2I5L X;  1B2T A;  4JYA L;  1A15 A;  2UXC L;  2JW6 A;  1H9K A;  1PRT B;  1V9P A;  2K5Q A;  2A19 A;  4JBJ A;  4LF6 Q;  1VQN A;  2JXD A;  1SNQ A;  2R3Z A;  2ZM6 Q;  5D14 A;  2QPO A;  2PMZ E;  3CC4 A;  4F87 A;  2WB1 E;  3FPP A;  3UEY A;  2K9H A;  4H7B A;  3CU7 A;  2NVQ B;  1G2S A;  2Q2H A;  2CVR A;  3UI2 A;  3LJ1 A;  1ENA A;  1II3 A;  1IBM Q;  1DOM A;  4HIK A;  1LTB D;  1QCB D;  1SYE A;  3I4M H;  4LF8 Q;  4QGU A;  3PV0 A;  4WJW A;  4V0B A;  4KY5 A;  3MEF A;  1KHI A;  2K4K A;  4FYD A;  1SGD I;  2WII B;  4LMQ D;  1A0I A;  1L0W A;  4GOP A;  2EQS A;  1NMF A;  1VQ6 A;  4R8I A;  3S17 B;  1SGR I;  1JQO A;  1HDL A;  3CXL A;  1QG7 A;  2EYL A;  1V1O A;  2FJ2 A;  1XNR Q;  2WV6 D;  4LF5 L;  3UIT A;  1SMX A;  1WTV A;  4NPS A;  3CAM A;  2R93 B;  1ZYR C;  1TS3 A;  1HZC A;  1A8V A;  4BBR H;  4DK1 A;  4NMZ A;  3HOV H;  1SAP A;  3C3L A;  4ZRZ A;  2A2D A;  2VUM B;  3GTP B;  2KVM A;  4B3R L;  4DWL A;  1W2B A;  4JBK A;  4PZ8 A;  3CHB D;  1SE4 A;  3EIV A;  3B55 A;  3TZD A;  4DNI A;  2F0H A;  3WOF A;  3OW2 A;  1H9R A;  2UUB Q;  4IJH A;  1WTH A;  3V05 A;  1FGU A;  1DOK A;  3BS1 A;  3PMF A;  5J39 A;  4ZAI A;  1SSO A;  2H1E A;  3NK9 A;  1EYG A;  1Q9B A;  2KOL A;  2IW3 A;  3KJP A;  5M3M G;  1ILQ A;  1JWU D;  1IW4 A;  2QQD A;  2VB3 X;  1CT2 I;  1Q8I A;  1I94 Q;  5J3B A;  4DA2 A;  5FLX L;  1XMO L;  4JI0 L;  1LYL A;  4LNQ A;  1E2W A;  2AKW B;  2B39 A;  4DNR B;  5EKL A;  2GKR I;  3RU0 A;  1SGN I;  2MJ8 A;  4DAY A;  4JI7 L;  2JA6 G;  3HOY B;  1V1P B;  2SOB A;  5IGD A;  1JIC A;  1X74 A;  3DM1 A;  1DXM A;  2M5X A;  3RLF A;  1EIY B;  1PYW D;  1JWM D;  4MPI A;  2VZA A;  2JE6 I;  4A93 G;  5IP9 H;  3S16 H;  1SMY C;  2J0T D;  2YTV A;  2KHI A;  2NVQ H;  1X32 A;  1TS2 A;  5KRU A;  2O5J C;  1A63 A;  4WOR A;  3I90 A;  1I4Q A;  2Q2U A;  5DEH A;  4KJO A;  5CV9 A;  4K14 A;  1VQ4 A;  3TO7 A;  2E74 C;  1OXX K;  4R1J A;  2A8V A;  2ICE C;  2JYO A;  3E3X A;  1LTS D;  4LFA Q;  1NUB A;  4YCU A;  4DR1 Q;  2XMX A;  2X6L A;  1K3B C;  1F9Q A;  1KAB A;  3N52 A;  3QWP A;  2OQK A;  2VQF Q;  3U58 A;  4C1N I;  1QVF A;  1GJX A;  1EIG A;  3E2I A;  3RN5 A;  3D0F A;  2Z9H A;  1Y8N B;  4OWT B;  1S72 A;  5M3F H;  2Q8R E;  3J7Y W;  3IAM 1;  4B9X A;  3T1H L;  4BA2 I;  2R6G A;  3X3M A;  3MXN B;  1Q7Y C;  2SGP I;  1TWH H;  4OEM B;  1CT1 D;  5BN4 A;  1V8Q A;  1MJB A;  2A74 C;  2Z6K C;  1PFN A;  1P9Z A;  4MTN A;  3PUX A;  4BY7 G;  1SFO B;  1AE3 A;  2I5H A;  1WCM B;  3BJU A;  3VDY A;  3K8A A;  1QNU A;  2O4X A;  1GHK A;  3H3V I;  1G91 A;  1GUW A;  3UGI A;  3S2H B;  1STH A;  1Y8P B;  1RDP D;  1KNE A;  4ZKC B;  1YO7 A;  1LTL A;  1I5F A;  2JA7 G;  2FNF X;  1WYD A;  3QB3 A;  4G4K A;  4J1M A;  5E7N A;  5FOB B;  4JI5 Q;  5LMU L;  3GTL H;  2A6H D;  1TOT A;  4DV2 Q;  1TUS A;  9WGA A;  2NYZ D;  1QIL A;  4ULL A;  1N36 Q;  3EFX D;  3NEN A;  4OAV B;  4FDB A;  1I6H B;  1HA6 A;  2G5D A;  1HPC A;  5IYC G;  1SEB D;  2OQ0 A;  4GNX B;  2A5H A;  3BDC A;  1I3Q B;  5E3Q A;  1TWC B;  1MT1 A;  4A3L G;  2V6E A;  4A3M B;  1PPF I;  2B2Y C;  1BCP D;  3HOY H;  1YHQ A;  3D3R A;  2OT2 A;  3HKZ E;  1Y1W H;  4HEA 1;  2MFI A;  3PSI A;  3K58 A;  4ME5 A;  5JEA J;  5C4X H;  2UVO A;  1R0R I;  2BA0 A;  1PTO D;  2HIX A;  2IHE A;  4ME3 A;  3UGD A;  1FNV A;  3M85 A;  4UY8 C;  1NXU A;  2Z4I A;  1SYF A;  2NU1 I;  4J8Q A;  3KLS A;  3E9H A;  5ELC A;  4JI4 Q;  5CV4 A;  1IY6 A;  3HP3 A;  4EX5 A;  4EGV A;  4C1N K;  2CW0 C;  1OO9 B;  4LF4 L;  1ULK A;  3KY9 A;  5M3F G;  2NWG A;  1SNP A;  3KF8 B;  3L0O A;  3UDX A;  2FHT A;  4P71 A;  4K2L A;  5KNC A;  1UEA B;  2NU2 I;  1QJO A;  2WCY A;  2RHQ B;  1XBT A;  1ONL A;  4TSS A;  3LGJ A;  3NHH A;  2JA8 H;  3FSX A;  4DR5 L;  3M4Y A;  3A0J A;  5CBA E;  4BY1 G;  2N8N A;  3BYY B;  1M90 C;  1CKO A;  2QW7 A;  1WOC A;  2PZW A;  4FXK C;  1PTO H;  1FY7 A;  1D2B A;  5C4J B;  1JOQ A;  2YV5 A;  4XXE A;  1KAW A;  3VR5 A;  4YY3 L;  1B9N A;  4ZK9 B;  3FNB A;  2ZXR A;  2OU2 A;  1LAB A;  4GOP C;  2F0U A;  5CCL A;  1SYG A;  2BA1 A;  3C1E A;  5EJW A;  3BDL A;  3AMU A;  3AFP A;  3FVQ A;  1ML0 D;  3OWE B;  2F0D A;  5C5L A;  4LF9 Q;  4JI1 L;  3HOZ B;  1AW7 A;  1HA5 A;  4LFB Q;  1SR3 A;  1ZXT A;  5I2Y A;  4OO1 I;  2JA1 A;  1QE6 A;  2M00 A;  1GD7 A;  4A3B H;  1JOR A;  3MXN A;  2HGK A;  1YI2 A;  2I46 A;  4GKJ Q;  4DV7 Q;  2E2H H;  1RCV D;  3H91 A;  1BKB A;  4H44 C;  2Z1C A;  4JI3 Q;  2JEB I;  1XWE A;  4DV1 Q;  2JSO A;  1VQ5 A;  4E1P A;  1DD2 A;  3NTK A;  3C2P A;  1I3Q H;  2QQE A;  4FF3 A;  3Q8D A;  5LHY 1;  4A3M H;  1NUC A;  1U0L A;  2XRQ D;  1L0X B;  2LXK A;  2NTT A;  4OXP A;  3SVM A;  3DHQ A;  2A6E D;  1SGY I;  1LO5 D;  1MD2 D;  1HFN A;  1LR8 A;  4LF7 L;  1X65 A;  2ZXO A;  4GLX A;  2PZT A;  1VQC A;  2FFK B;  3D00 A;  4B6D A;  4X3K A;  3KOJ A;  1PH8 A;  2GVA A;  3PIO A;  1W3S A;  1MHW C;  4R4Q A;  3OMC A;  4YIJ A;  5C0X J;  2VY3 A;  4JVZ A;  2KHJ A;  5E4W C;  2VW9 A;  3OXF A;  2EYM A;  1ENF A;  5JEA H;  1U4M A;  4DUZ Q;  4XYO A;  1M4V A;  3HFZ B;  1PH1 A;  5FUV A;  4M8A A;  4G76 A;  1B3Q A;  3I4N H;  3L3O C;  1XNQ L;  2F0K A;  4K0K Q;  3I55 A;  4IPD A;  2DUD A;  5KEE A;  5C44 G;  1WTQ A;  1F2Z A;  1WGC A;  4KN7 C;  3D8G A;  3I3C A;  2HUG A;  3ND9 A;  1G51 A;  3I7F A;  3A7L A;  3HOX G;  2X3T A;  2K01 A;  3SDJ A;  2UXB L;  1YNN D;  1V1I A;  3GTO B;  1CQV A;  1I4X A;  2EXD A;  5C4J H;  1D5X C;  1LR9 A;  3KF8 A;  2MO1 A;  5KIX A;  1WFQ A;  2D5D A;  4FXG C;  1BF4 A;  4J6H A;  5A2Q E;  1Y1V G;  5ELF A;  4CDF C;  4BS9 A;  2PO4 A;  4QIW B;  4OWX B;  1M8A A;  1KMA A;  4A3G G;  1X6O A;  4QY7 A;  4HGU A;  2DNE A;  1TBN A;  1PZK D;  1VMP A;  3OSO A;  4CDD C;  2ODD A;  1S5B D;  3KJO A;  3CW2 C;  1V43 A;  1SNC A;  5IWA Q;  1KXL A;  2KA7 A;  1B1Z A;  2CCZ A;  1BOS A;  3HH2 C;  2QKI C;  1XXG A;  1WTJ A;  3P20 A;  2DB6 A;  3HOU G;  2KEN A;  2NN6 H;  2XIW A;  3IAS 1;  1IKL A;  3GDE A;  1CHO I;  1BUV T;  1MGS A;  2PW7 A;  2F0P A;  5H1S E;  1MI2 A;  2XTQ A;  2F3W A;  1F77 A;  5EGT A;  1ASZ A;  4A3F B;  2OZU A;  4LUZ A;  1JB7 A;  1EEF D;  1IBL Q;  1D1K A;  3E9I A;  4XTC S;  3PGZ A;  1JQY D;  2EPB A;  3H0G G;  2QGM A;  3Q23 A;  2KEE A;  4UDU C;  1ULM A;  4DV0 L;  3R5B A;  3MHB A;  2EXZ A;  4R4I A;  1D7Q A;  1QWY A;  1MJE A;  1PFS A;  2VRW B;  2KMP A;  1JC7 A;  3F1Z A;  1VQB A;  3URY A;  1LTI D;  2LSS A;  2KCT A;  3D4R A;  1TVX A;  1SND A;  2WAQ G;  4MTK A;  3GTJ H;  2M2L A;  3S15 B;  3S1M B;  2QDB A;  1H9S B;  3QAH A;  4LFC L;  1PH2 A;  4UXI A;  1VQD A;  4Z7G A;  4XDX A;  2NU4 I;  2CQA A;  1X56 A;  2Q8T A;  1J5E Q;  4X65 Q;  1HNW Q;  3CP0 A;  4JI6 L;  3HOW B;  1N9W A;  5C0X H;  2R7Z H;  1GOZ A;  1M1K C;  2ETD A;  4X62 Q;  4CDE C;  1EQQ A;  4K5W A;  2CH4 A;  4B3M L;  1FR3 A;  4IN3 A;  1MSH A;  2FXQ A;  4DV4 Q;  1IL2 A;  4JV5 L;  1UHA A;  3GTO H;  4UP8 A;  3FC3 A;  3L0I A;  1KL9 A;  2OTL A;  3Q0A A;  1BBX C;  4DK6 C;  1HQM C;  1K8O A;  4DV6 Q;  2YTY A;  2ZTE A;  4RHS A;  4QQB X;  1S5C D;  3H15 A;  4DFA A;  1BBU A;  1EWI A;  5FLX E;  2R61 A;  3TP7 A;  4IFD I;  5JJL A;  2DNC A;  4IOC A;  1SRU A;  1VQG A;  3O13 A;  4DV5 L;  3RZO H;  4BBS H;  2PQE A;  3BG3 A;  4HTH A;  4DNC A;  1OXS C;  2A6H C;  3JAM i;  2VQE L;  2NVX H;  4B3T L;  1EIH A;  3B6Y A;  2ICI A;  1NSN S;  3LX0 A;  3K57 A;  4X64 Q;  1HNX L;  1Z7T A;  1ZKO A;  1RIP A;  3P7J A;  2EJG C;  4HR7 B;  5J8C A;  2E76 C;  2B63 B;  1E3P A;  1MJA A;  2K05 A;  5IGE A;  4PNY A;  2JZM A;  2JQO A;  1CA6 A;  3RN2 A;  3PO2 B;  4EVO A;  4UPA A;  1BCP C;  3HZX A;  2L8E A;  1CFM A;  2B2U C;  1F9P A;  4RA8 A;  1LT3 D;  3CCV A;  4UP9 A;  4C3J G;  1HR0 L;  4NXN L;  4DUY Q;  1PTO C;  1YNX A;  4J15 A;  2ALY B;  4I1T A;  3J81 j;  3GP7 A;  1HR0 W;  1A3T A;  4I7A A;  5K36 H;  3ND8 A;  2ASB A;  1G6P A;  1O80 A;  2IJ0 A;  3T16 A;  3GTM B;  1CTM A;  4XQN A;  1JOK A;  2DJF C;  4QJF A;  4FF4 A;  2R7F A;  4KHP L;  1CZW A;  4DR2 L;  1BCP F;  2HCC A;  4YZD A;  5FJ8 G;  1KC8 C;  2KEC A;  3TME A;  1N33 Q;  2RLD A;  1SYD A;  2D2C C;  4RMF A;  1N34 Q;  4IUR A;  1Y69 U;  1PH6 A;  2BH2 A;  2LB7 A;  3H6M A;  2JA6 B;  2WB1 G;  1LLR D;  4UHV A;  1K7T A;  1PTO F;  1YZ6 A;  3GV6 A;  3ERS X;  1UUP A;  1A2U A;  3ULP A;  2EIF A;  3BZK A;  3SEB A;  2GIV A;  3UDG A;  2L7X A;  1TQO A;  1QNK A;  3A8J E;  3JAM L;  2ZM6 L;  4A93 B;  1H9S A;  5T1I A;  1P16 A;  1Y8F A;  3VYU A;  3GQB A;  1SE3 A;  4XQJ A;  1DJR D;  3UDI A;  1TWA H;  2F3V A;  5IGC A;  1U5K A;  1C0A A;  1ESR A;  3BVG A;  3RZD H;  1TIH A;  3TN2 A;  1E0B A;  1IHZ A;  5G3L D;  2YYZ A;  4LF8 L;  1TBQ R;  3K5O A;  3T51 B;  5CMD A;  2BOS A;  2K6A A;  3IL8 A;  3L9A X;  3GOX A;  2QEJ C;  4ALP A;  3VA7 A;  1VQK A;  2CQO A;  3KF6 B;  1UE6 A;  3R3O A;  3DMU A;  4GLA C;  5JJZ A;  1M8C A;  2KMR A;  1HTL D;  4MIU A;  5COY A;  4DAY B;  1JMC A;  4G7H C;  3NBH A;  2GA4 B;  1CKM A;  4OGQ C;  5C3X A;  1VQA A;  1CQF A;  2RHS B;  2B8F A;  3I73 A;  4AH6 A;  3WWV A;  1NAP A;  3KLR A;  2QQC A;  1STN A;  2A6E C;  3F2C A;  2PI2 A;  3OTO L;  4WP4 A;  2K28 A;  1OXU A;  3CCQ A;  4YWK A;  2FMC A;  4GN3 B;  4HSV A;  4IPG A;  2JA7 B;  3HEJ A;  3A56 A;  5AJ3 Q;  3TOB A;  2JEA I;  1G6Z A;  5IGF A;  3BDO A;  3CCS A;  3GTM H;  2JA5 G;  3G6J B;  3KDF B;  3S16 B;  1PMR A;  2KED A;  5M3M H;  1HUN A;  2W0T A;  1TY2 A;  4IZ8 A;  3RD4 A;  2D62 A;  3UEJ A;  1VCI A;  4TQU S;  2HQL A;  1RHP A;  3MWY W;  1HUM A;  2PYK A;  1VQL A;  3KBG A;  4HMI A;  4X3U A;  3OWF A;  2F0T A;  1OVO A;  1KBE A;  3CXC A;  1GO3 E;  2E2J H;  2JA6 H;  4F88 A;  1AZQ A;  1B8A A;  1BDO A;  4APV A;  2L12 A;  1E2V A;  1D5Z C;  2F0Q A;  3I91 A;  1VQ8 A;  3MEH A;  4B3S Q;  2EZV A;  2EYO A;  1YNN C;  4A93 H;  2BDO A;  3S24 A;  3G48 A;  4P73 A;  3CC2 A;  1Y1B A;  3PDN A;  4Q9V A;  2AWN A;  1UE7 A;  2RSN A;  2IX1 A;  3SEK C;  5TSS A;  2GSC A;  2ZJQ A;  5LL6 X;  1GKH A;  1D8L A;  2Y0S B;  5M3F B;  5M5X H;  4RGO S;  2B2V C;  3J81 i;  3R2T A;  3AJF A;  1LTA D;  3D4D A;  1TWH B;  4GKK Q;  2F03 A;  3I8Z A;  5E3R A;  2IX0 A;  1H0Z A;  4KLK A;  3ZJY C;  1GVP A;  5HGI A;  5J1Z A;  3UE1 A;  3S1Q H;  1PLF A;  1STB A;  2Y0M A;  1PHJ A;  4R8N A;  1FL0 A;  1LT5 D;  1VDD A;  3VA9 A;  4JI8 L;  4RKB A;  5IT9 L;  3GTL B;  3R2I A;  4DPG A;  3PF4 A;  4HIO A;  3PIP A;  4IJL A;  3RNU A;  3G71 A;  3TRZ A;  1D6E C;  1I4R A;  1DGS A;  4K6L A;  1DM0 B;  1ESF A;  4KJN A;  4BY7 H;  2F3I A;  2F66 B;  4E6I A;  3D4W A;  5ELD A;  1LT6 D;  3KF6 A;  3V96 A;  1XYI A;  3NP8 A;  3J7A 5;  2K32 A;  4PMC A;  1NNX A;  1J8I A;  1JJC B;  2ATW A;  2JA7 H;  2UXC Q;  2NVT B;  2WP8 J;  2F0F A;  5M9O A;  2LY7 A;  1Y1W B;  2FIN B;  1UE1 A;  4C3I G;  4DV2 L;  5C4X B;  3A5Z B;  2E8G A;  5I6W A;  5IYC H;  2N49 A;  4RFB A;  4WJ3 M;  2EJM A;  1GUG A;  3HKZ G;  3W5O A;  2SGF I;  4A3L H;  5JVG 3;  2JK8 A;  3J81 L;  3RR5 A;  5FO9 B;  1HJA I;  1SDF A;  4A3I G;  5IY0 A;  4ZUJ A;  4A3K G;  3C1F A;  1KDB A;  3K80 C;  3KBX A;  2GVI A;  3OIQ A;  3SK5 A;  3T56 B;  2J9R A;  2J87 A;  3VDP A;  1KRS A;  2JA8 B;  5EQ0 A;  3Q24 A;  3DWA A;  3KDF A;  1YU6 C;  4LF5 Q;  1K83 H;  3AYH B;  3G7L A;  2RAD A;  2F52 A;  1BCP B;  2YQP A;  4JI4 L;  3MXP A;  3CRK C;  1A3V A;  5IYB G;  4RGN A;  1KLU D;  4RKL A;  4KK7 A;  5HGT A;  1E22 A;  1PTO B;  2F6M B;  1TWF H;  3J7A F;  5FLM G;  3ERQ A;  3M7G A;  3J80 i;  3IFT A;  4KKT A;  3CCL A;  4KD4 A;  4BY1 H;  3S1N H;  5FO7 B;  2RIJ A;  4IUP A;  3OL0 A;  1K0R A;  3TP8 A;  2HCI A;  1H95 A;  3SK6 A;  3HOX B;  1ET6 A;  3A7A B;  3EQL C;  3HG9 A;  1EL0 A;  1DS2 I;  2B2T C;  1I6V C;  1WKX A;  4A3B B;  2B3G A;  4HJ9 A;  4LW1 A;  2IPK D;  3BZD B;  2ZJR A;  2BDN A;  2E2H B;  2KQ3 A;  4F7X A;  4A3G B;  1X9N A;  2XTR A;  3R93 A;  4JI0 Q;  3F8T A;  4ZQ3 A;  2YUU A;  2G9H D;  2EYJ A;  2CAZ B;  1LR7 A;  1PCE A;  2HD3 A;  1GUT A;  1HJP A;  2F0S A;  2K19 A;  2OF1 A;  4C2M H;  5IP7 G;  2NVT H;  4OIJ A;  3U4V A;  2JBW A;  3VDU A;  1RF2 D;  1CA5 A;  4A3C G;  3HOU B;  1YIJ A;  1X3Q A;  1TUR A;  2QSB A;  2L5T A;  1X3E A;  2K75 A;  2XGT A;  2PZU A;  1E2Z A;  5GAG C;  3DA4 A;  4O0A A;  2JB3 A;  2EY5 A;  5GQO A;  4DV1 L;  4HMJ A;  3MXG A;  3H0G B;  3BZC A;  2QF7 A;  1Q3L A;  2SNM A;  2HHH L;  4A3J G;  1STE A;  3J80 L;  2UUC Q;  5CV5 A;  1Q90 A;  3I4N B;  3FVV A;  4DKA C;  2PNH A;  3M4P A;  3KUP A;  5EAY A;  2F0G A;  4AQY L;  2FUG 1;  1FNW A;  3MA2 B;  1Q8K A;  2DY8 A;  4MN3 A;  3J7Z C;  2ZJP A;  4BA1 I;  4ILW A;  2CH4 W;  1V1Q A;  1ICF B;  3RMH A;  1EYC A;  1KLG D;  4OAU C;  1ROD A;  3TO9 A;  4KKS A;  4O1P A;  2R93 G;  1E1O A;  3T1H Q;  1EU4 A;  2HDM A;  2M9V A;  3K5N A;  3SXH A;  2FMM A;  4OX9 L;  3QOL A;  2VXW A;  5D65 A;  1TGS I;  3R8B A;  1PV4 A;  5C44 H;  1T9H A;  1PXU A;  4O1N A;  2VUM G;  3EVQ A;  3J7A V;  3M3Y B;  3EA6 A;  3UDF A;  2XWJ B;  1PTQ A;  1U9R A;  1ULN A;  2DY7 A;  5EPK A;  3HOX H;  3D6C A;  1PZI D;  2B2U A;  2XRS D;  1CHP D;  5EKK A;  3U9S A;  2K33 A;  1TKW B;  3BVM A;  3T4A C;  2MNA A;  4TKO B;  1TU2 B;  1S5E D;  2UXD L;  3VR3 A;  2KKM A;  1Y1V H;  1N13 A;  3BVZ A;  3A5U A;  1I50 B;  4FF1 A;  2R92 H;  1TY0 A;  4JBM A;  3QTL D;  1Q12 A;  3LJ0 A;  2EOT A;  3TZU A;  1VQ7 A;  4A3G H;  1BMO A;  2KHS A;  1S40 A;  2V1C C;  3NUC A;  1Q82 C;  3EJI A;  1R9T B;  1X4S A;  2QDL A;  4HID A;  1XX6 A;  4DR3 Q;  1MKH A;  3OW7 A;  1SE2 A;  1HRJ A;  2CWH A;  2RVL A;  3LJ2 A;  3HOU H;  2R7D A;  2OCE A;  4GLV B;  1JWS D;  3JAM E;  5C3E G;  5HI7 A;  4GN5 A;  4L5S A;  2Q2I A;  2L1L B;  1TS5 A;  1SGE I;  3ITP A;  3EN2 A;  4YZ9 A;  3NTI A;  4DAM A;  1VQE A;  3GTJ B;  1T5E A;  1PTR A;  4K2K A;  5DAU A;  2N52 A;  3FKI H;  2IL8 A;  3H0G H;  5I9O A;  4XYQ A;  4Q0F A;  2CFM A;  4RGT A;  4JI2 Q;  2EYP A;  1U4L A;  2MGS A;  2WKC A;  3E0J A;  1WTO A;  3PCO B;  2Q8I B;  2NB0 A;  3E6Z X;  3IKJ A;  1BQQ T;  2F4I A;  2E5L Q;  2Y0S E;  4DR5 Q;  3SGB I;  2H4O A;  1JR0 D;  2ZTD A;  2PPB C;  2R7Z B;  1EQR A;  1B50 A;  4N9T A;  4B9W A;  1FVI A;  1VQO A;  4IUN A;  4IQZ A;  4X3S A;  4QMG A;  4X66 L;  5I6Y A;  1Q46 A;  2B2W A;  3MZ5 A;  4X6A H;  3BYT B;  1MBY A;  4FKD A;  4HAE A;  1YBY A;  4XQQ A;  3D6W A;  4CBV A;  3TQY A;  1WI5 A;  2RDH A;  5IGB A;  1X3F A;  1GUO A;  1R4Q B;  1HNZ L;  1CSO I;  2ID0 A;  5D3I B;  1WJJ A;  2ZRR A;  1J5E L;  4X65 L;  2RSO A;  2R92 G;  3M3Y H;  4FXD A;  3GTG H;  2WB1 B;  4N8X 1;  1WCM G;  3E59 A;  4RCO A;  4PQX A;  3M4O H;  4X62 L;  2DGY A;  4RAU C;  2J7Z A;  3ONA B;  1IW7 D;  3MC0 B;  4JI1 Q;  3M7N A;  2WVJ A;  2F0J A;  3RZO B;  1A2T A;  3WOE A;  4FO2 A;  4BBS B;  2MP1 A;  1U4P A;  1CGI I;  3TDQ A;  3CPF A;  5DM7 3;  1VF7 A;  1CGJ I;  2V4D A;  4R9W A;  4DXF A;  2NVX B;  1ZEQ X;  3PUZ A;  1I50 H;  5BR8 Q;  1EUJ A;  1FGB D;  1E7Z A;  1MJ9 A;  1ZYR D;  2N88 A;  2L55 A;  1EY0 A;  4AML A;  1R9T H;  4IAL A;  2E75 C;  5HY6 A;  4GI3 C;  2NU0 I;  2UUA Q;  2K7V A;  2RBM A;  3FKI G;  1AN1 I;  1L1O C;  3HGB A;  4EQN A;  3GTK B;  3I2Z A;  3TJQ A;  2X6G A;  3QWN A;  4LF7 Q;  5LNK 1;  3DLL A;  1KDC A;  3W1G A;  1T5X D;  3S9W A;  2BCO A;  3CCM A;  1K3R A;  4ZUI A;  2X69 A;  2AQ2 B;  3T1Y Q;  2C5C A;  4Y7N B;  4A3D G;  5LMN L;  2DJG C;  3VA5 A;  4WFN 3;  2A2C A;  4AYB B;  4JOI A;  2RQX A;  2IP6 A;  2IHF A;  3F2B A;  2MO0 A;  1IXR A;  1PA6 A;  2NN6 I;  5LMN W;  1YJN A;  4YHH L;  2OVO A;  2NTS A;  1VQF A;  5FLX c;  4N8F A;  1XNQ Q;  4C3J H;  1SN8 A;  1TDP A;  4KTA A;  4ABN A;  2B2V A;  1HPT A;  5I2X A;  4KV6 A;  5IE8 A;  1MJC A;  4H0L C;  1Q86 C;  2E73 A;  4K8I A;  5IYD H;  4RCN A;  1RTO A;  1KDA A;  2F4V Q;  2UXB Q;  1WTR A;  1VS0 A;  2RDG A;  3BJI A;  5IOD A;  1LAC A;  2SNS A;  2JA5 B;  4JBW A;  5CGK A;  1S20 A;  2K5H A;  3F2U A;  1DOL A;  1PZJ D;  3TS0 A;  2PQA A;  3NWS A;  3KYH C;  3E0E A;  5IT9 E;  3PUV A;  1QOH A;  5FJ8 H;  1TWA B;  2VL6 A;  3OVO A;  4DR6 Q;  3TSS A;  5JPM C;  3RZD B;  4LK1 C;  1N34 L;  3NBH B;  3TEH B;  1HZB A;  1TR5 A;  4O1O A;  3NWT A;  1UAP A;  1EYA A;  4GZY C;  3U9O A;  3DWQ A;  1TWG B;  4UAI A;  4PV1 C;  1PH4 A;  2LXJ A;  1TBO A;  4U68 A;  3HOZ G;  3M9B A;  5C0X I;  4DR4 L;  2K52 A;  4JC0 A;  1N32 Q;  3LNN A;  2AHO B;  4NV5 A;  4CDC C;  1A62 A;  2NZ1 D;  2B8T A;  1BO0 A;  1ET9 A;  1JE4 A;  3S14 H;  1OTC A;  4IUV A;  2ZXP A;  2HIV A;  1IBK Q;  4YZC A;  3K7U C;  5FKA C;  1I4P A;  1WD0 A;  1B70 B;  4ZKB B;  4L5R C;  4OON A;  3ULL A;  3J81 E;  2YTX A;  1SBB B;  3GTK H;  2N3S A;  3NEM A;  4IPC A;  3FBV A;  3NSW A;  4HED A;  4CJ1 B;  4LUO A;  1JJG A;  3FPU B;  4AIM A;  3SE0 A;  4IUQ A;  4RG1 A;  2D0O A;  4NXM L;  4Y7N H;  2JJQ A;  5I4D A;  1KD1 C;  1QB5 D;  3G6E A;  3AB9 A;  1RTN A;  5IYD G;  1CE3 A;  4QL5 A;  4AS2 A;  1HTP A;  1CSP A;  3TRE A;  5M3M B;  4OWW B;  4PMW A;  4EQO A;  5IGG A;  4IFD G;  1EY5 A;  1QUQ B;  4JI6 Q;  2F3C I;  2SGD I;  1VQJ A;  2IWH A;  1YEZ A;  1WD1 A;  1P9G A;  5ELN A;  3KFU A;  2E2J B;  5FO8 B;  1XX8 A;  4XT3 B;  1CI3 M;  4A76 A;  1C4Q A;  1TII D;  4LF6 L;  3I72 A;  4KN4 C;  5M5W H;  4B3M Q;  4QB4 A;  1Z6H A;  4JV5 Q;  2JA5 H;  2IY5 B;  5GAD C;  4JG2 A;  2JB2 A;  3PIO 3;  2N17 A;  3C46 A;  3I56 A;  2QIL A;  2RCN A;  4POF A;  2BUS A;  1MSG A;  2L9H A;  4HCE A;  1F9S A;  2L15 A;  3W1B A;  3HRZ C;  1HH2 P;  5JPN C;  1I4G A;  2B2T A;  1SE8 A;  1IBM L;  2CW0 D;  1A3U A;  4P75 A;  5M5X B;  4A3K B;  2O2L D;  3TS2 A;  2V53 A;  1C7Y A;  2F0I A;  2IT1 A;  2D0P A;  1TWG H;  2OWO A;  1FYC A;  2AMC B;  4O2D A;  3IAY A;  1D1I A;  3N6R A;  4B3T Q;  2B2W C;  3S1Q B;  1JB3 A;  4OIK A;  1STG A;  1K28 A;  2NZO A;  1PYS B;  4L5Q A;  1XNR L;  4H02 A;  1VDZ A;  3S2D H;  3TBI B;  4G7O C;  5C4Z A;  1OYV I;  3K0Y A;  1HFG A;  1D5M C;  2F0E A;  4IOA A;  4YWL A;  4YWM A;  1FAQ A;  4A3F G;  2K04 A;  2I0Q A;  5GAH C;  3VE5 A;  4BY7 B;  3J80 E;  1WVL A;  3CRL C;  3UOE A;  3P1H A;  3OOC A;  5HUR A;  4LJZ C;  4ZCK A;  3NBI A;  4AS3 A;  2UUB L;  4FP5 D;  1EOV A;  4C3H G;  5JJI A;  1HZ9 A;  1NR2 A;  2OXP A;  1F2M A;  2EYF A;  3IFD A;  3MFG A;  4CJ2 C;  5M5Y H;  3I9V 1;  3W3A A;  1K0S A;  3CQZ B;  1I94 L;  2A20 A;  3VR4 A;  3HOW G;  2UU9 Q;  2NU3 I;  1VF5 C;  3GD7 A;  2VB2 X;  1EY7 A;  2EY1 A;  4Q5V A;  4DV3 Q;  4C3I H;  1BNZ A;  2E2D C;  2Z6B A;  3KLW A;  2B8G A;  5EPJ A;  3SHL A;  4FF2 A;  2DKV A;  4QIW E;  4DU9 A;  4JOI C;  5C5M A;  3PO3 G;  1HXY D;  5GAE C;  4UXJ A;  1K83 B;  2F0L A;  4QUF A;  1L1O B;  3S1R H;  4ZLT F;  1LV9 A;  2YU9 B;  1QUQ A;  3UE0 A;  1QVG A;  4IUT A;  4A3I H;  3CME A;  3PF5 A;  1C8C A;  5EX0 A;  4A3K H;  4A3J B;  3M4Q A;  1W4R A;  2EY2 A;  4B08 A;  3VYS A;  1TWF B;  1XMQ Q;  4L5T A;  4OVO A;  5FUY A;  1ILP A;  1EY8 A;  2X52 A;  1OXV A;  1IW7 C;  5E4X A;  4LFA L;  4DAV A;  4DR1 L;  2V1C A;  4YCW A;  1SJH D;  1BVS A;  4DR7 Q;  2OTJ A;  2VQF L;  4BY1 B;  4G75 A;  2KUM A;  3S1N B;  1EZ6 A;  3EBE A;  3JC6 6;  2Q2T A;  4JW0 A;  5BN3 A;  2EJF C;  5NUC A;  2XSC A;  1FAR A;  2K5V A;  3NEL A;  3AQQ A;  5IYB H;  2ERW A;  4IUU A;  3G4S A;  4BXX G;  4K6D A;  4HJA A;  1FJG Q;  2ZT9 C;  2B63 G;  2KMQ A;  5FLM H;  1VQP A;  3K5L A;  2GN5 A;  2K03 A;  2OD1 A;  5AFW A;  1RL2 A;  3PO2 G;  2XN9 C;  1NMG A;  4K5X A;  5GRO A;  1PRT D;  4CKC A;  4F8M A;  3OTO Q;  2XWB B;  4AYB E;  1FYB A;  1RD9 D;  5A35 A;  3GTQ B;  1HQR D;  2GKT I;  5FUW A;  2L0C A;  3QR8 A;  3X3N A;  4A3E G;  5J8F A;  5EX3 A;  2N55 A;  4JYA Q;  4C2M B;  2AUJ D;  4JI5 L;  1OMT A;  1JJ2 A;  3PUW A;  1X55 A;  4L63 B;  1VQ9 A;  1AH9 A;  3A8I E;  4PMB A;  3KK7 A;  3NE5 B;  4BWG B;  2RC4 A;  2E5R A;  1N36 L;  4MZ9 A;  3OIP A;  2JN4 A;  5C6A A;  1L2F A;  1CT0 I;  3CQZ H;  5K5P A;  2WAC A;  2LEO A;  4QCL A;  5IP7 H;  3I4M G;  2QQ0 A;  1G8Z D;  2RKS A;  2ORV A;  1VQM A;  4NP5 A;  1OXT A;  2DIP A;  1Y8O B;  2A73 B;  2NZH A;  1B53 A;  4A3C H;  2MHV A;  4LAA A;  5CV8 A;  5C3E B;  4HFV A;  2KMO A;  4R4T A;  3UFF A;  3CCE A;  3OMG A;  3ULJ A;  2ELI A;  1XPO A;  3OHX C;  5CV6 A;  3T13 A;  2ES2 A;  4SGB I;  2YU9 H;  1BR9 A;  4P74 A;  3DEO A;  2JP1 A;  1PH7 A;  5J22 A;  2VS1 A;  4CKE A;  4A3J H;  2PI2 E;  4R4C A;  3Q22 A;  3H3V H;  1AFP A;  1ENC A;  2WFW A;  2I5M X;  3SK4 A;  2UUC L;  5E3P A;  4BBR G;  4OL7 A;  1LT4 D;  1NY4 A;  5JAV A;  3HOV G;  3NXW A;  5C44 B;  4B3R Q;  1QVC A;  3TP5 A;  3S17 H;  1R79 A;  1E1T A;  1L0Y B;  1CT4 I;  1IY5 A;  2MUY A;  5EBD A;  1LTR D;  1H9M A;  2A69 D;  4HJ5 A;  1L1O A;  2RIO A;  4JK1 C;  1HCZ A;  2PNR C;  4U6R A;  2BE5 D;  2R93 H;  4CJ0 B;  2DN8 A;  1Z9F A;  4DAP A;  4JI8 Q;  2K1B A;  3WDN A;  1U4R A;  1YVC A;  1TS4 A;  1ASY A;  4Z9C B;  2YFB A;  1SNM A;  1YTP A;  3OPO A;  4HCS A;  1Y1V B;  2R92 B;  2VUM H;  4X3T A;  3GTP H;  1JOO A;  2CWF A;  1HZA A;  4O42 A;  1IYJ B;  1WTP A;  1XMO Q;  3GTQ H;  4PL5 A;  1KBF A;  3B4V C;  3U50 C;  5DLQ E;  2ORW A;  1SJE D;  3OXL A;  4KY7 A;  1FNU A;  1A6X A;  2GKV A;  2AQ1 B;  2Z0S A;  4P2C B;  4JI7 Q;  1IKM A;  3NTH A;  5DM6 3;  4LF9 L;  4RWS C;  4LFB L;  3ERO A;  5CBE E;  1AP0 A;  1JE5 A;  4GXT A;  2ENB A;  1RKN A;  2QA4 A;  3FSY A;  5IP9 G;  2B29 A;  1STY A;  4HIM A;  4GKJ L;  4XIG S;  1K7U A;  4DV7 L;  4KI0 A;  3E5S A;  1WGT A;  3CPW A;  1VMC A;  3MFY A;  2OEO A;  4JI3 L;  1RFH A;  1XA6 A;  1KAA A;  3D31 A;  1VQH A;  2RCF A;  2A68 D;  1S4Z A;  2NVY B;  1K7V A;  1EWC A;  3HS0 C;  3FKI B;  4NW2 A;  4PG3 A;  2MQH A;  4DR3 L;  2EDG A;  2KCM A;  3CMA A;  1AN8 A;  3DM3 A;  1EFI D;  4NB3 A;  1MIU A;  1CK1 A;  3I4L A;  3MAQ A;  5C3E H;  1O7Y A;  3K7A B;  4Y52 H;  4A3D B;  1EIF A;  1DS3 I;  3SR1 A;  1NR4 A;  3H94 A;  2WAQ B;  3R5A A;  3HKS A;  1I4H A;  1CHQ D;  5FUX A;  1GUN A;  3STB D;  4YCV A;  2HT1 A;  2Y0S G;  4DUZ L;  5COR A;  1V1P A;  4XT1 B;  4JI2 L;  1Z7K B;  2EY6 A;  1EFW A;  1KQS A;  2CWA A;  1X3G A;  1YNJ D;  4GN4 B;  1SLJ A;  1KRT A;  2E5L L;  4OO1 H;  3GTG B;  4K0K L;  3Q6S A;  4UXH A;  2J4X A;  3M4O B;  5CV7 A;  1EZ8 A;  3A54 A;  3JAM c;  1E24 A;  2KCC A;  1PH5 A;  5LMU Q;  3W2D A;  2C9O A;  3GO5 A;  2LUY A;  1W6K A;  3IRB A;  4DK3 C;  1CUK A;  5G3L F;  4TVA B;  4HSP A;  2EVB A;  1HHV A;  1Z47 A;  4EQ5 A;  2RF4 A;  3DWP A;  5KNB A;  1S3O A;  3TO6 A;  1SFO H;  2O5I C;  1WCM H;  2UZ3 A;  3QG1 A;  2KBN A;  1UE5 A;  3ER0 A;  4ID6 A;  1NJI C;  3S2H H;  1R4P B;  4IPH A;  5BN5 A;  1XPR A;  3R5D A;  1CM9 A;  5IWA L;  3HOY G;  3SGI A;  1EYD A;  4K8J A;  3AEV A;  1K73 C;  5JVH 3;  1CSQ A;  1Y1W G;  4DN4 M;  5C4X G;  4U67 3;  5BR8 L;  4JPB W;  5EPL A;  1SYB A;  1I6H H;  1O78 A;  2CHB D;  2N78 A;  3PIP 3;  2B0U C;  1KTK A;  3NPP A;  2I07 B;  2RDF A;  4E1R A;  3P23 A;  7WGA A;  2XTI A;  1TWC H;  2NVY H;  4LF4 Q;  2ENN A;  4IO9 A;  1IBL L;  3UGL A;  2E2I B;  4G57 A;  2HHH Q;  2UUA L;  2PQA B;  3CCJ A;  2XNA C;  3GV3 A;  1PFB A;  1EY9 A;  4C3J B;  2XVS A;  1DYQ A;  2AQ3 B;  1F2Y A;  3AU7 A;  3K7A H;  3QIA A;  4AQY Q;  2AWO A;  2JA8 G;  2ROW A;  4A3D H;  4IFD J;  4OO1 G;  3T1Y L;  2YFA A;  3VYT A;  1O7L A;  1GXD C;  1YHA A;  2L4N A;  1EQT A;  4A75 A;  2GVB A;  4GNX A;  5JHW C;  4L6T B;  1NCV A;  4KKU A;  3ICE A;  1F2L A;  3F4M A;  2L11 A;  4OX9 Q;  2LS0 1;  4WJ4 A;  3KP9 A;  5ELB A;  2N71 A;  2PW5 A;  1Q1B A;  4YY3 Q;  1SJ8 A;  1S5D D;  5LL6 S;  4P72 A;  4ZYS A;  4FNF A;  1PH3 A;  3CD6 A;  1HNW L;  2PMZ B;  2XRC A;  2JB1 A;  4ODG A;  2F0N A;  2F0W A;  4C56 C;  2QEX A;  3A55 A;  1W6J A;  1LTT D;  2MJF B;  1AEX A;  1WTW A;  2F4V L;  1DZ1 A;  1EOT A;  2K50 A;  4I7Z C;  2A1A A;  2KJX A;  4DV4 L;  1GM5 A;  2UXD Q;  1K9M C;  2LMC B;  4OHJ A;  4A3B G;  3MXU A;  3RLN A;  3K81 C;  2F1M A;  4DV6 L;  2ENZ A;  3R5C A;  1YJ9 A;  4DR6 L;  1PRT C;  1NE3 A;  1CKN B;  3CF5 A;  1K8A C;  1X54 A;  3DA3 A;  4DK0 A;  3S14 B;  3OYY A;  1K8M A;  4QUC A;  2SGE I;  2L1B A;  3FRP B;  3MEK A;  3SK8 A;  5EBC A;  3T53 B;  4CKB A;  3F2D A;  4A3M G;  5HGQ A;  4HJ7 A;  3HOZ H;  4RH6 A;  2P6A C;  2CWG A;  5L37 A;  3FEW X;  2SDF A;  1UEB A;  1XTC D;  4MHE A;  1N32 L;  3K59 A;  3H3V C;  4X64 L;  1KNA A;  1UVG A;  5IT9 c;  4FVM A;  1IL8 A;  3DEP A;  3SDZ A;  4NDX A;  3DXJ C;  5T1G A;  3SGQ I;  1PRT F;  1IBK L;  4DXG A;  3L2P A;  4PL4 A;  3NQI A;  4GS3 A;  5ISR A;  1DCZ A;  1UVF A;  2ZTC A;  2E2I H;  4MNO A;  1YIT A;  3DUZ A;  5JEA G;  1LTG D;  4LUV A;  3I4N G;  2CWP A;  1M8B A;  4DGZ A;  2KCN A;  1F9R A;  3TOA A;  3RUZ A;  5KYL A;  4DUY L;  3L7Z C;  4S3S A;  4Z7H A;  4UP7 A;  1IYV A;  5KYI A;  1IZ6 A;  1TT2 A;  4CHT B;  2IX3 A;  4C3H B;  4X66 Q;  2F0O A;  5M5W B;  2WIN B;  4R4O A;  4CGY B;  4POG A;  5ELE A;  1TBR R;  3AFQ A;  4JCV E;  1SMY D;  4IFD H;  2P22 B;  1SGQ I;  1XTD A;  2WKD A;  1HNZ Q;  3U4Z A;  4NV2 A;  1PYB A;  1NTG A;  3J81 c;  4I65 A;  1N33 L;  1PVO A;  3K6O A;  1O7I A;  3FDT A;  2A69 C;  2Z8L A;  4N9P A;  2BE5 C;  5IIF A;  3QJY A;  4H13 C;  4PZ7 A;  2NUC A;  3VR6 A;  4HJ8 A;  3PO3 B;  3I4O A;  5CR3 A;  5E1F A;  1SRO A;  4QF4 A;  5JOB A;  3OXG A;  1Z2I A;  1C9O A;  1V1H A;  1SXT A;  4K5V A;  1XJV A;  2QCP X;  2NN6 G;  1S5F D;  3S2D B;  3QOJ A;  3V2T A;  3RLO A;  1EU3 A;  4L8J A;  2ZW3 A;  1IYU A;  1FD7 D;  3QO2 A;  1BXT A;  2P5Z X;  2BL7 A;  1B3A A;  3TP6 A;  2AUK A;  3H09 A;  5ELO A;  4A4I A;  3VYR A;  1K8G A;  2CJS C;  1X3P A;  4DV0 Q;  1GUS A;  1N8R C;  1QZG A;  2VNU D; 
#chains in the Genus database with same CATH homology
 4L9M A;  1LUZ A;  5LMN Q;  1CKN A;  4A3F H;  2C35 B;  3FP9 A;  1YJW A;  1G29 1;  2N1A B;  4LFC Q;  4YHH Q;  1Y14 B;  3PUY A;  2WAQ E;  4KHZ A;  1QZH A;  4LWC A;  3CCR A;  2H5X A;  2JYY A;  5C0X G;  3DO9 A;  2R7Z G;  1Q1E A;  5AJ3 L;  4C3H H;  1NBW A;  1P8L A;  4GOP B;  3S15 H;  3S1M H;  3BU2 A;  3STB C;  2SGQ I;  4PL3 A;  2ARP F;  1BUS A;  2JA9 A;  1BBW A;  1J6Q A;  3HOW H;  1SGP I;  3A74 A;  3J80 c;  1PH9 A;  2UU9 L;  1YHB A;  1OMU A;  2Z6K A;  5CCM A;  1AE2 A;  2CKZ B;  4DV3 L;  4A24 A;  4B3S L;  4DV5 Q;  4PZ6 A;  4DR4 Q;  3PO3 H;  4GNX C;  4BBS G;  2VQE Q;  2BH8 A;  3CCU A;  1HNX Q;  1Q81 C;  2K14 A;  1Y1C A;  1UUC A;  1XMQ L;  1TXY A;  3JSB A;  5DAE A;  1JT8 A;  4GKK L;  5JJK A;  4DR7 L;  1HR0 Q;  1UWV A;  1LM0 A;  2QGQ A;  4NXN Q;  4NXM Q;  4BXX H;  3FHW A;  3K0X A;  2B63 H;  1KIX A;  4AYB G;  1FJG L;  5K36 G;  1PJU A;  3PO2 H;  5HQ8 A;  2JAE A;  4KHP Q;  2K5N A;  2KCX A;  4DR2 Q;  1XPU A;  4A3E H;  1B7Y B;  1VQI A;  3CC7 A;  2I5L X;  4JYA L;  2UXC L;  2JW6 A;  1V9P A;  2A19 A;  4JBJ A;  4LF6 Q;  1VQN A;  2JXD A;  2ZM6 Q;  2QPO A;  2PMZ E;  3CC4 A;  3UEY A;  2WB1 E;  2K9H A;  2Q2H A;  3LJ1 A;  1IBM Q;  4HIK A;  3I4M H;  4LF8 Q;  4QGU A;  3PV0 A;  3MEF A;  1KHI A;  2K4K A;  1SGD I;  1A0I A;  1L0W A;  4GOP A;  2EQS A;  1NMF A;  1VQ6 A;  1SGR I;  1HDL A;  3CXL A;  1XNR Q;  4LF5 L;  3UIT A;  1SMX A;  4NPS A;  3CAM A;  1HZC A;  1A8V A;  4BBR H;  3HOV H;  2A2D A;  4B3R L;  4DWL A;  1W2B A;  4JBK A;  4PZ8 A;  3EIV A;  4DNI A;  3OW2 A;  2UUB Q;  4IJH A;  1FGU A;  1EYG A;  3KJP A;  5M3M G;  1IW4 A;  2QQD A;  1CT2 I;  1I94 Q;  5J3B A;  1XMO L;  4JI0 L;  1LYL A;  4LNQ A;  2AKW B;  2GKR I;  3RU0 A;  1SGN I;  4JI7 L;  2JA6 G;  1X74 A;  2M5X A;  3RLF A;  1EIY B;  2VZA A;  2JE6 I;  4A93 G;  5IP9 H;  3S16 H;  2YTV A;  2KHI A;  2NVQ H;  1A63 A;  2Q2U A;  1VQ4 A;  1OXX K;  4R1J A;  2A8V A;  1NUB A;  4LFA Q;  4YCU A;  4DR1 Q;  2XMX A;  3QWP A;  2OQK A;  2VQF Q;  3U58 A;  1QVF A;  3E2I A;  3RN5 A;  3D0F A;  4OWT B;  1S72 A;  5M3F H;  3IAM 1;  3T1H L;  4BA2 I;  2R6G A;  3MXN B;  1Q7Y C;  2SGP I;  1TWH H;  2Z6K C;  4MTN A;  3PUX A;  4BY7 G;  1AE3 A;  2I5H A;  3BJU A;  3VDY A;  3K8A A;  3H3V I;  3UGI A;  1YO7 A;  1LTL A;  1I5F A;  2JA7 G;  2FNF X;  1WYD A;  3GTL H;  5E7N A;  4JI5 Q;  5LMU L;  1TOT A;  4DV2 Q;  1TUS A;  1N36 Q;  3NEN A;  4OAV B;  4FDB A;  5IYC G;  2OQ0 A;  4GNX B;  1MT1 A;  4A3L G;  2V6E A;  1PPF I;  3HOY H;  1YHQ A;  3HKZ E;  1Y1W H;  4HEA 1;  2MFI A;  3PSI A;  5JEA J;  5C4X H;  1R0R I;  2BA0 A;  3UGD A;  2HIX A;  2IHE A;  4ME3 A;  3M85 A;  4UY8 C;  2NU1 I;  3E9H A;  4JI4 Q;  1IY6 A;  4EX5 A;  4LF4 L;  3KY9 A;  5M3F G;  3L0O A;  3KF8 B;  3UDX A;  4P71 A;  2NU2 I;  2WCY A;  2RHQ B;  1XBT A;  3LGJ A;  2JA8 H;  4DR5 L;  3A0J A;  4BY1 G;  2N8N A;  1M90 C;  1CKO A;  1WOC A;  2YV5 A;  1KAW A;  4YY3 L;  4GOP C;  5CCL A;  2BA1 A;  3AFP A;  4LF9 Q;  4JI1 L;  4LFB Q;  1SR3 A;  4OO1 I;  2JA1 A;  1GD7 A;  4A3B H;  1YI2 A;  4GKJ Q;  4DV7 Q;  2E2H H;  1BKB A;  4JI3 Q;  2JEB I;  4DV1 Q;  1VQ5 A;  4E1P A;  1I3Q H;  2QQE A;  3Q8D A;  4A3M H;  1U0L A;  2LXK A;  4OXP A;  1SGY I;  1LR8 A;  4LF7 L;  1X65 A;  4GLX A;  1VQC A;  3D00 A;  4B6D A;  3KOJ A;  1PH8 A;  2GVA A;  3PIO A;  1W3S A;  4R4Q A;  5C0X J;  2VY3 A;  2KHJ A;  2VW9 A;  3OXF A;  4DUZ Q;  3HFZ B;  1PH1 A;  5FUV A;  4G76 A;  3I4N H;  1XNQ L;  4K0K Q;  3I55 A;  5C44 G;  4IPD A;  2DUD A;  1G51 A;  3I7F A;  3HOX G;  2UXB L;  3SDJ A;  1V1I A;  2EXD A;  5C4J H;  1LR9 A;  2MO1 A;  1WFQ A;  1Y1V G;  4OWX B;  1KMA A;  4A3G G;  1X6O A;  4QY7 A;  4HGU A;  1TBN A;  2ODD A;  3KJO A;  3CW2 C;  1V43 A;  5IWA Q;  1KXL A;  2CCZ A;  3HH2 C;  2DB6 A;  3HOU G;  2KEN A;  3IAS 1;  3GDE A;  1CHO I;  5H1S E;  2XTQ A;  1ASZ A;  4LUZ A;  1JB7 A;  1IBL Q;  3E9I A;  4XTC S;  3PGZ A;  3H0G G;  4DV0 L;  4R4I A;  1D7Q A;  1MJE A;  1PFS A;  2VRW B;  2KMP A;  3F1Z A;  1VQB A;  2LSS A;  2KCT A;  2WAQ G;  3GTJ H;  4LFC L;  1PH2 A;  4UXI A;  1VQD A;  4Z7G A;  2NU4 I;  1X56 A;  1J5E Q;  4X65 Q;  1HNW Q;  3CP0 A;  4JI6 L;  1N9W A;  2R7Z H;  1M1K C;  4X62 Q;  1EQQ A;  4B3M L;  1IL2 A;  4DV4 Q;  2FXQ A;  4JV5 L;  3GTO H;  4UP8 A;  3FC3 A;  1KL9 A;  3L0I A;  2OTL A;  4DK6 C;  4DV6 Q;  2YTY A;  2ZTE A;  4QQB X;  3H15 A;  1BBU A;  1EWI A;  4IFD I;  5JJL A;  4IOC A;  1SRU A;  1VQG A;  4DV5 L;  3RZO H;  4BBS H;  1OXS C;  3JAM i;  2VQE L;  2NVX H;  4B3T L;  3B6Y A;  4X64 Q;  1HNX L;  1RIP A;  1E3P A;  2JZM A;  2JQO A;  3RN2 A;  4UPA A;  2L8E A;  3CCV A;  4UP9 A;  1HR0 L;  4NXN L;  4DUY Q;  1YNX A;  4J15 A;  2ALY B;  4I1T A;  3J81 j;  1HR0 W;  2ASB A;  1G6P A;  4QJF A;  2R7F A;  4KHP L;  4DR2 L;  4YZD A;  5FJ8 G;  1KC8 C;  1N33 Q;  4RMF A;  1N34 Q;  1PH6 A;  2BH2 A;  2WB1 G;  1YZ6 A;  3ERS X;  3ULP A;  2EIF A;  3BZK A;  3UDG A;  2L7X A;  2ZM6 L;  1P16 A;  1Y8F A;  3UDI A;  1TWA H;  1U5K A;  1C0A A;  3RZD H;  1TIH A;  2YYZ A;  4LF8 L;  1TBQ R;  3GOX A;  4ALP A;  1VQK A;  2CQO A;  3KF6 B;  1UE6 A;  4GLA C;  1M8C A;  2KMR A;  4DAY B;  1JMC A;  1CKM A;  1VQA A;  2RHS B;  4AH6 A;  3WWV A;  2QQC A;  3F2C A;  2PI2 A;  3OTO L;  1OXU A;  3CCQ A;  4YWK A;  4GN3 B;  4IPG A;  5AJ3 Q;  2JEA I;  3CCS A;  3GTM H;  2JA5 G;  3KDF B;  2W0T A;  5M3M H;  3UEJ A;  2D62 A;  1VCI A;  4TQU S;  2HQL A;  1VQL A;  1OVO A;  1KBE A;  3CXC A;  1GO3 E;  2E2J H;  2JA6 H;  1B8A A;  4APV A;  1VQ8 A;  4B3S Q;  4A93 H;  3S24 A;  3G48 A;  4P73 A;  3CC2 A;  1Y1B A;  3PDN A;  4Q9V A;  2AWN A;  1UE7 A;  2IX1 A;  3SEK C;  2ZJQ A;  1GKH A;  1D8L A;  5M5X H;  3J81 i;  3AJF A;  4GKK Q;  2IX0 A;  1H0Z A;  4KLK A;  3ZJY C;  1GVP A;  5HGI A;  3UE1 A;  3S1Q H;  1PHJ A;  1FL0 A;  1VDD A;  3VA9 A;  4JI8 L;  4DPG A;  3PF4 A;  4HIO A;  3PIP A;  4IJL A;  3RNU A;  3G71 A;  3TRZ A;  1DGS A;  4BY7 H;  2F3I A;  2F66 B;  3KF6 A;  3J7A 5;  1JJC B;  2ATW A;  2JA7 H;  2UXC Q;  2WP8 J;  1UE1 A;  4DV2 L;  3A5Z B;  2E8G A;  5IYC H;  2N49 A;  4WJ3 M;  3HKZ G;  3W5O A;  2SGF I;  4A3L H;  2JK8 A;  3RR5 A;  1HJA I;  4A3I G;  5IY0 A;  4A3K G;  3K80 C;  2GVI A;  2J9R A;  2J87 A;  3VDP A;  1KRS A;  3KDF A;  1YU6 C;  4LF5 Q;  1K83 H;  3AYH B;  2F52 A;  2YQP A;  4JI4 L;  5IYB G;  1E22 A;  2F6M B;  1TWF H;  5FLM G;  3J80 i;  3CCL A;  4BY1 H;  3S1N H;  3OL0 A;  1K0R A;  1H95 A;  1DS2 I;  2B3G A;  4HJ9 A;  4LW1 A;  2ZJR A;  1X9N A;  2XTR A;  4JI0 Q;  3F8T A;  2YUU A;  1LR7 A;  2CAZ B;  1PCE A;  1HJP A;  2K19 A;  4C2M H;  5IP7 G;  2NVT H;  3U4V A;  3VDU A;  4A3C G;  1YIJ A;  1TUR A;  1X3E A;  2K75 A;  2XGT A;  5GAG C;  3DA4 A;  4O0A A;  2JB3 A;  5GQO A;  4DV1 L;  3BZC A;  2HHH L;  4A3J G;  2UUC Q;  4DKA C;  2PNH A;  3M4P A;  5EAY A;  4AQY L;  2FUG 1;  1Q8K A;  3J7Z C;  2ZJP A;  4BA1 I;  1V1Q A;  4OAU C;  4O1P A;  2R93 G;  1E1O A;  3T1H Q;  4OX9 L;  1TGS I;  1PV4 A;  5C44 H;  1T9H A;  2VUM G;  3UDF A;  1PTQ A;  3HOX H;  2MNA A;  2UXD L;  2KKM A;  1Y1V H;  1N13 A;  3A5U A;  2R92 H;  4JBM A;  3QTL D;  1Q12 A;  3LJ0 A;  1VQ7 A;  4A3G H;  1BMO A;  1S40 A;  2V1C C;  1Q82 C;  1X4S A;  4HID A;  1XX6 A;  4DR3 Q;  1MKH A;  3LJ2 A;  3HOU H;  2R7D A;  2OCE A;  4GLV B;  5C3E G;  5HI7 A;  4GN5 A;  4L5S A;  2Q2I A;  2L1L B;  1SGE I;  3EN2 A;  4YZ9 A;  4DAM A;  1VQE A;  1PTR A;  2N52 A;  3FKI H;  3H0G H;  4JI2 Q;  2CFM A;  3PCO B;  2E5L Q;  3SGB I;  2Y0S E;  4DR5 Q;  2ZTD A;  1EQR A;  1FVI A;  1VQO A;  4X66 L;  1Q46 A;  4X6A H;  4FKD A;  1YBY A;  3TQY A;  1WI5 A;  1X3F A;  1HNZ L;  1CSO I;  2ID0 A;  1WJJ A;  2ZRR A;  1J5E L;  4X65 L;  2R92 G;  3M3Y H;  3GTG H;  1WCM G;  3E59 A;  3M4O H;  4X62 L;  2DGY A;  4JI1 Q;  3M7N A;  2WVJ A;  1CGI I;  3CPF A;  1CGJ I;  3PUZ A;  1I50 H;  5BR8 Q;  1EUJ A;  1E7Z A;  1R9T H;  5HY6 A;  4GI3 C;  2NU0 I;  2UUA Q;  3FKI G;  1AN1 I;  1L1O C;  3I2Z A;  3TJQ A;  4LF7 Q;  5LNK 1;  3DLL A;  3W1G A;  3CCM A;  1K3R A;  3T1Y Q;  4A3D G;  5LMN L;  2A2C A;  4JOI A;  2IP6 A;  2IHF A;  3F2B A;  2MO0 A;  1IXR A;  1PA6 A;  2NN6 I;  5LMN W;  1YJN A;  4YHH L;  2OVO A;  1VQF A;  5FLX c;  1XNQ Q;  4C3J H;  1SN8 A;  1HPT A;  5IE8 A;  1MJC A;  2E73 A;  1Q86 C;  5IYD H;  2F4V Q;  2UXB Q;  3BJI A;  1VS0 A;  4JBW A;  2K5H A;  3TS0 A;  2PQA A;  3KYH C;  3E0E A;  3PUV A;  5FJ8 H;  2VL6 A;  3OVO A;  4DR6 Q;  1N34 L;  3NBH B;  3TEH B;  1HZB A;  4O1O A;  1PH4 A;  1TBO A;  2LXJ A;  3HOZ G;  4DR4 L;  3M9B A;  5C0X I;  2K52 A;  4JC0 A;  1N32 Q;  2AHO B;  4NV5 A;  1A62 A;  2B8T A;  3S14 H;  1OTC A;  2HIV A;  1IBK Q;  4YZC A;  3K7U C;  1B70 B;  4L5R C;  4OON A;  3ULL A;  2YTX A;  3GTK H;  2N3S A;  3NEM A;  4IPC A;  3FBV A;  4LUO A;  1JJG A;  4AIM A;  4RG1 A;  2D0O A;  4NXM L;  4Y7N H;  2JJQ A;  1KD1 C;  3G6E A;  5IYD G;  1CE3 A;  4QL5 A;  4AS2 A;  1CSP A;  3TRE A;  4OWW B;  4PMW A;  4IFD G;  1QUQ B;  4JI6 Q;  2F3C I;  2SGD I;  1VQJ A;  1YEZ A;  5ELN A;  3KFU A;  4A76 A;  4LF6 L;  5M5W H;  4B3M Q;  4JV5 Q;  2IY5 B;  2JA5 H;  5GAD C;  4JG2 A;  2JB2 A;  2N17 A;  3I56 A;  2RCN A;  4POF A;  2BUS A;  2L15 A;  3W1B A;  1HH2 P;  1SE8 A;  1IBM L;  4P75 A;  3TS2 A;  2V53 A;  1C7Y A;  2IT1 A;  2D0P A;  1TWG H;  2OWO A;  2AMC B;  4O2D A;  4B3T Q;  2NZO A;  1PYS B;  4L5Q A;  1XNR L;  4H02 A;  3S2D H;  1OYV I;  4IOA A;  4YWL A;  4YWM A;  1FAQ A;  4A3F G;  2I0Q A;  5GAH C;  3VE5 A;  4AS3 A;  2UUB L;  1EOV A;  5JJI A;  1HZ9 A;  5M5Y H;  3I9V 1;  1I94 L;  2A20 A;  3HOW G;  2UU9 Q;  2NU3 I;  3GD7 A;  4DV3 Q;  4C3I H;  3KLW A;  4QIW E;  4JOI C;  3PO3 G;  5GAE C;  4UXJ A;  3S1R H;  1L1O B;  1QUQ A;  3UE0 A;  1QVG A;  4A3I H;  3CME A;  3PF5 A;  5EX0 A;  4A3K H;  3M4Q A;  1W4R A;  4OVO A;  1XMQ Q;  4L5T A;  5FUY A;  1OXV A;  4LFA L;  4DR1 L;  2V1C A;  4YCW A;  1BVS A;  4DR7 Q;  2OTJ A;  2VQF L;  4G75 A;  3JC6 6;  3EBE A;  2Q2T A;  1FAR A;  2K5V A;  3NEL A;  3AQQ A;  5IYB H;  2ERW A;  3G4S A;  4BXX G;  4HJA A;  1FJG Q;  2KMQ A;  2B63 G;  5FLM H;  1VQP A;  2GN5 A;  2OD1 A;  1RL2 A;  3PO2 G;  1NMG A;  5GRO A;  3OTO Q;  4AYB E;  1FYB A;  2GKT I;  5FUW A;  4A3E G;  5EX3 A;  4JYA Q;  4JI5 L;  1OMT A;  1JJ2 A;  3PUW A;  1X55 A;  1VQ9 A;  1AH9 A;  2E5R A;  1N36 L;  4MZ9 A;  1L2F A;  1CT0 I;  3CQZ H;  2LEO A;  5IP7 H;  3I4M G;  2QQ0 A;  2ORV A;  1VQM A;  1OXT A;  2DIP A;  2NZH A;  4A3C H;  4HFV A;  2KMO A;  4R4T A;  3UFF A;  3CCE A;  2ELI A;  3ULJ A;  1XPO A;  4SGB I;  2ES2 A;  2YU9 H;  4P74 A;  1PH7 A;  2VS1 A;  4A3J H;  2PI2 E;  4R4C A;  3H3V H;  2WFW A;  2I5M X;  2UUC L;  4BBR G;  1NY4 A;  3HOV G;  4B3R Q;  1QVC A;  3S17 H;  1R79 A;  1E1T A;  1CT4 I;  1IY5 A;  4HJ5 A;  1L1O A;  2RIO A;  4U6R A;  2R93 H;  1Z9F A;  4JI8 Q;  1YVC A;  1ASY A;  2YFB A;  1YTP A;  2VUM H;  3GTP H;  1HZA A;  1IYJ B;  1XMO Q;  3GTQ H;  4PL5 A;  1KBF A;  3B4V C;  3U50 C;  5DLQ E;  2ORW A;  3OXL A;  2GKV A;  2Z0S A;  4JI7 Q;  4LF9 L;  4LFB L;  1JE5 A;  4GXT A;  2QA4 A;  5IP9 G;  2B29 A;  4HIM A;  4GKJ L;  4XIG S;  4DV7 L;  4KI0 A;  3CPW A;  1RFH A;  4JI3 L;  1XA6 A;  3D31 A;  1VQH A;  4PG3 A;  2MQH A;  4DR3 L;  2KCM A;  3CMA A;  3DM3 A;  4NB3 A;  1MIU A;  5C3E H;  4Y52 H;  1EIF A;  1DS3 I;  3HKS A;  5FUX A;  3STB D;  4YCV A;  2HT1 A;  2Y0S G;  4DUZ L;  4JI2 L;  1Z7K B;  1EFW A;  1KQS A;  2CWA A;  1X3G A;  4GN4 B;  1SLJ A;  1KRT A;  2E5L L;  4K0K L;  4UXH A;  3JAM c;  1E24 A;  1PH5 A;  5LMU Q;  3GO5 A;  2LUY A;  3IRB A;  4DK3 C;  1CUK A;  4TVA B;  1Z47 A;  4EQ5 A;  2RF4 A;  1S3O A;  1SFO H;  1WCM H;  2UZ3 A;  2KBN A;  1UE5 A;  3ER0 A;  1NJI C;  3S2H H;  4IPH A;  1XPR A;  5IWA L;  3HOY G;  3SGI A;  3AEV A;  1K73 C;  1Y1W G;  1CSQ A;  5C4X G;  5BR8 L;  1I6H H;  2N78 A;  2B0U C;  4E1R A;  3P23 A;  2XTI A;  1TWC H;  2NVY H;  4LF4 Q;  2ENN A;  4IO9 A;  1IBL L;  3UGL A;  2HHH Q;  2UUA L;  2PQA B;  3CCJ A;  3K7A H;  4AQY Q;  2AWO A;  2JA8 G;  2ROW A;  4A3D H;  4IFD J;  4OO1 G;  3T1Y L;  2YFA A;  1YHA A;  4A75 A;  2GVB A;  4GNX A;  5JHW C;  3ICE A;  3F4M A;  4OX9 Q;  4WJ4 A;  3KP9 A;  2N71 A;  4YY3 Q;  1Q1B A;  1SJ8 A;  4P72 A;  1PH3 A;  3CD6 A;  1HNW L;  2XRC A;  2JB1 A;  2QEX A;  2MJF B;  2F4V L;  2K50 A;  2A1A A;  4DV4 L;  1GM5 A;  2UXD Q;  1K9M C;  4A3B G;  3RLN A;  3K81 C;  4DV6 L;  2ENZ A;  1YJ9 A;  4DR6 L;  1NE3 A;  1CKN B;  3CF5 A;  1K8A C;  1X54 A;  3DA3 A;  3OYY A;  2SGE I;  3MEK A;  3F2D A;  4A3M G;  5HGQ A;  4HJ7 A;  3HOZ H;  2P6A C;  1UEB A;  1N32 L;  4X64 L;  1UVG A;  5IT9 c;  3SGQ I;  1IBK L;  3L2P A;  4PL4 A;  4GS3 A;  1UVF A;  2ZTC A;  2E2I H;  4MNO A;  1YIT A;  5JEA G;  4LUV A;  3I4N G;  2CWP A;  1M8B A;  4DUY L;  3L7Z C;  4Z7H A;  4UP7 A;  1IZ6 A;  4X66 Q;  4R4O A;  4POG A;  1TBR R;  3AFQ A;  4JCV E;  2P22 B;  1SGQ I;  1XTD A;  1HNZ Q;  3U4Z A;  4NV2 A;  1PYB A;  1NTG A;  3J81 c;  1N33 L;  1PVO A;  1O7I A;  4PZ7 A;  4HJ8 A;  3I4O A;  1SRO A;  3OXG A;  1C9O A;  1V1H A;  1XJV A;  2NN6 G;  3RLO A;  5ELO A;  4A4I A;  1K8G A;  2CJS C;  4DV0 Q;  1N8R C;  1QZG A;  2VNU D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...