1U5TC

Structure of the escrt-ii endosomal trafficking complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
198
structure length
178
Chain Sequence
SALPPVYSFPPLYTRQPNSLTRRQQISTWIDIISQYCKTKKIWYMSVDGTSKNLFNNEDIQRSVSQVFIDEIWSQMTKEGKCLPIDQSGRRSSNTTTTRYFILWKSLDSWASLILQWFEDSGKLNQVITLYELSEGDETVNWEFHRMPESLLYYCLKPLCDRNRATMLKDENDKVIAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords appears to be functionally related to SNF7; Snf8p
publication title Structure of ESCRT-II endosomal trafficking complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
total genus 37
structure length 178
sequence length 198
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF05871 ESCRT-II ESCRT-II complex subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1u5tC02
1.10.10.570 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A "Winged helix" DNA-binding domain. Chain C. Domain 1 1u5tC01
3BROA 2M30A 4WXDA 1RI7A 2QUFA 5HS7A 3ZPLA 3FF5A 1FWZA 3GLXA 2L02A 5LRRA 4P9FA 3PQKA 2FSWA 3IRRA 4HBLA 1ZRDA 4FT8A 1U5TA 2JSCA 3HHHA 2VE8A 1R1UA 1XCBA 4A5NA 1J59A 3L7WA 2PMUA 5ERIA 3T1BA 3L2CA 1I1GA 2LF8A 4G6QA 1KYWA 4XLPF 3HHGA 3ZMSA 3KETA 1FYMA 1Q1HA 4ON0A 4G7HF 1SMTA 2VOPA 2F5EA 2DFIA 2A6HF 2OAZA 4ENKA 3ZMUA 2QZ8A 4Y13A 4PDKA 3QOPA 2Y0MA 3T5XA 5D8KB 1R58A 4L9VA 2FMYA 2ADUA 2JPBA 5H20A 3TO9A 2D45A 2R7DA 5CVRA 2FOKA 5D6EA 1G3SA 2OQGA 4KN4X 3R0AA 1FYKA 2DI3A 2HTJA 2YSRA 4HF0A 3FM3A 2RN7A 3RKWA 4G9YA 5ILSA 2DT5A 4WXCA 4OIRF 1O7LA 5LEJA 3I0TA 3GVAA 4DQ2A 4AD9A 4L9NA 3EETA 3RKYA 4LB6B 1JHHA 4O6JA 3V4GA 3F8BA 1R5HA 3J81Z 2JT1A 2Z99A 4LGWA 4YIIA 1YFHA 1CF7A 2VOOA 4S05A 1P4WA 3ZN0A 2K4BA 3KLNA 3GXOA 1ZYRF 1KQ9A 3FX3A 3KP5A 4BNCA 1SD7A 1ZH5A 1LEAA 5DD4A 4KIGA 2FEZA 2GWRA 1IN8A 2RNJA 2R3SA 4RGXA 1SD6A 1JGSA 5TRDA 3C1DA 3K1PA 5J8FA 1ZG1A 1XSVA 4WCGA 2ZO4A 2QQAA 2P5KA 1O57A 4OMYA 1HKQA 1KQ0A 3RKXA 3IHUA 3KP7A 1O7FA 2EFQA 1PUEE 1K79A 2H09A 3J81K 4U88A 3F23A 1XGSA 3HTSB 1S8NA 3KFWX 2H6CA 2WV0A 5DDGA 1J75A 1FOKA 2O3FA 4EJVA 1LVAA 1OYYA 4XBFA 2A61A 5KVRA 6PAXA 4M9SA 4BHBA 3O3KA 3C18A 1P4XA 2X0LA 1T6SA 3P9KA 3LWFA 3I71A 1K6OA 1ZLKA 2OQRA 2LF7A 1XMKA 1KYZA 2G7UA 3IWFA 4HX4A 4HQEA 3F21A 4BXUA 4BHPA 3IKVA 1KU7A 2BGCA 3DP7A 1BI1A 3CJNA 5D5WB 2QBYA 1OMIA 5H6QA 3VB2A 3N97A 2DQRA 4B09A 4N9IA 5A2QZ 1BJAA 1MJ9A 3TOBA 3IWZA 5TJJA 1OR7A 4KDPA 1OKRA 3E5UA 3SZTA 4NHJA 2W24A 1LDJA 4MGRA 1T2KA 1GHCA 4IRIA 2QYOA 2RQPA 2A5YB 2O0YA 5F64A 3F6VA 3FMSA 2HQRA 2Z9OA 4LG0A 2XV4S 3MZHA 2NRAC 5LHHA 1WSUA 1J0RA 5CJ9A 4PCQA 2VXZA 3RYRA 2CQKA 1H0MA 4ZYGA 3NQOA 1HW5A 3CUQA 2J5PA 1IZ1A 2UXXA 2EJRA 1LB2A 4LLNA 1IAWA 4KIBA 5CLSA 1KU2A 5A2QK 4OIQF 3D5LA 2Z5UA 2H27A 1QNTA 1TQMA 4R1HA 4L5IA 4D0PA 3HSRA 1RZ4A 3DPLC 1O3SA 4MEYF 1I27A 5LGUA 3E3VA 2IRFG 3R4KA 1Z7UA 3QPTA 3G3ZA 3SZPA 1G4DA 3WGHA 2AXLA 5E1WA 5ED4A 4M73A 3WTSC 2XAQA 3DQVC 1HKTA 3CLOA 1R22A 3QU3A 1U5TC 1U5TB 4E70A 3L9FA 3WE2A 3E6MA 1XSDA 2B0LA 5KK1A 2P7CB 3K69A 3RJPA 1YLFA 1FSEA 3HSEA 3OV8A 2ACJA 2HYFA 4RGSA 2ESNA 3RPQA 3AAFA 4XLNF 1FNNA 2ZMEB 5D6FA 2EV6A 2EV0A 2L4MA 1TNSA 3HRTA 4HLXA 2W85A 4LD5A 4IRGA 3MEXA 3GFMA 3DFGA 5CVJA 1OYIA 1HBXG 1O3QA 5E8IA 2VODA 4IPAA 3KP4A 1SFXA 1XSXA 4A12A 4BH9A 3MCZA 5L3BA 2VE9A 2IT0A 1BC8C 4U0VA 1FP2A 1XGOA 4EQQA 2H6BA 5BPIA 4ETSA 3GW2A 3BPVA 3H3UA 2DK5A 3ZP5A 3MAJA 3EQLF 4KT5C 2MBFA 3B73A 1LEBA 1J9IA 3DV8A 1DPRA 2JTVA 1D8JA 3O6BB 2G7HA 2EFOA 2PMHA 3GFJA 5DYMA 3QU6A 1O3RA 1T0FA 1WRJA 1R1VA 2DPUA 1CF7B 4R79A 3GX4X 4CYDA 4ENMA 3O2PE 2ETHA 2BBYA 3WTUC 3OOPA 4P96A 1K7AA 4ZZLA 3HIFA 4FX0A 2DAOA 4EM0B 1TBXA 3BP8A 3F8CA 4A2UA 3K9TA 4G6DA 3WG9A 4HA8A 5K5QA 4LMYA 5LRSA 2RVCA 5K5RA 3EYIA 3WTYC 4A0ZA 2LDUA 2L54A 2QM3A 3WU1B 2E7WA 2MH2A 4FX4A 1LDKB 3E6DA 2DPDA 1WKMA 3ULQB 1G3WA 1PP8F 2FU4A 4H0EA 5IT3A 4G8XA 4QLCU 1TQIA 4U7DA 5LEKA 3HUGA 4CDGA 3H92A 3TGNA 2EB7A 2EFWA 4RB3C 5JR3A 3TDUC 1YW9A 4HZFA 2G9WA 3BOQA 3HTUA 2Y75A 1MJAA 4WXHA 2BEOA 2W84A 1QZZA 2RGVA 4YFNF 3HYIA 4WK8F 3VOEA 2XROA 3NEUA 3IC7A 2CGPA 1FPQA 1IUYA 2DU9A 2Z33A 5BMZA 2GIVA 5LGTA 2KIUA 3REOA 2GQQA 4G94A 1T39A 1W7PB 3CDHA 3LA7A 1MD0A 1FYLA 5HLGA 2QBYB 2STTA 2MLKA 1FBSA 3F6OA 3FZVA 2DK8A 4EMSA 3JAMZ 3F3XA 3ZMDA 3I53A 2HOEA 4I0BA 2RDPA 2OA4A 3ABUA 3CTAA 5CYVA 2L4AA 1R36A 2Q0OA 5BQTA 2ZMEA 1I6XA 4LFUA 3M7GA 4UV8A 3N4MA 2P5VA 3T8RA 2A3SA 1KQ8A 5CVVA 3MFKA 1YQAA 5K1YA 1JHFA 3RPUA 1U6GA 4LG0B 3E97A 3WODF 5HDNA 3JSOA 1Y0UA 4ZYEA 5L3DA 4MQ9F 4JQFA 3ABTA 2NNNA 4U7BA 5DUKA 2ISZA 1ZHFA 1QPMA 3FXQA 2IP2A 2IA1A 3ISPA 2EK5A 3CUQC 3CUQB 2HGCA 1UHMA 2KJCA 1SAXA 1YYVA 4N9HA 4IHTA 3FMQA 1YW7A 2E1CA 1UFMA 3JAMK 1ULYA 2FNPA 1RUNA 4I7HA 1IRFA 2XAJA 3F22A 1QGPA 2QLZA 1TW3A 3V8KA 3DEUA 1F1ZA 5E1ZB 1OYWA 4U0WA 1ZAOA 1RNLA 1FZPB 3HOTA 3QRFF 4UV9A 1H9TA 3SXYA 2HFHA 2KRFA 1X3UA 1S3JA 1SFEA 1KA8A 2VT2A 1TNTA 3Q9SA 4NB5A 4NQWA 1J5YA 4XSXF 5ILVA 4ASNA 2V6CA 1IRGA 3C7JA 4CGZA 5FD6A 4IRHA 2VBYA 4M71A 1LQ1A 3EYYA 1WI9A 4HW0A 5HS9A 1HKSA 2J5OA 3WTVC 1SD4A 4L0ZB 4KYWA 1EH6A 2UWMA 1W7PD 4LJZF 4OIPF 1B1BA 4GCVA 4XSZF 1ZG5A 1BC7C 5HDKA 2CSOA 1F4KA 2V1XA 2HWVA 4OOIA 3LAPA 1KGSA 3KEQA 3TO7A 4M6XA 1TLHB 3I64A 4OINF 1SD5A 3ZMTA 2QQ9A 1R5GA 4M6YA 4UXNA 1T38A 2NNYA 1KU9A 1BI2A 5ILUA 4XRFA 1GXPA 2D2WA 1G3TA 2OD5A 3DPTA 3W6JB 2MD5A 2HEOA 5BOXA 4EGYA 1QQIA 4QWQA 1H9GA 3SHFA 3E6BA 2Q8KA 5L3EA 1W7PA 5E18F 1EV7A 1IXSB 1ZRFA 4KNYA 3ML6A 1AWCA 2V1DA 2M5WA 4IJAA 1IXRC 4A5MA 5HS8A 1Z6TA 3J7AO 3JSPA 1XB4A 4BYYA 4MQVA 4O3MA 3I5UA 4MTEA 1LNWA 3F72A 5D5UB 4AWXB 4HV5A 4Y15A 1HW1A 3JW4A 5HVQC 5AIQA 2FE3A 4Q48A 1U8RA 2PN6A 4RB2C 1FX7A 2P7VB 3RYPA 1FBUA 2FXAA 3PFIA 4HYEA 1GXQA 3IKTA 5E8GA 2XAHA 1D8KA 2JZYA 1XDUA 1UCRA 3M8FA 2L3DA 2XKPA 2F5FA 2VN2A 2PQ8A 4O5VA 4HQMA 4I0AA 3ECHA 2GXGA 3K0LA 2K7LA 3BJOA 1B9MA 2KIMA 3V8JA 1REPC 2PEXA 3I58A 2IJLA 3W6KB 2HR3A 2EFNA 2EA2A 1S6LA 2C6YA 4CZZA 1S29A 1XCVA 5H6RA 5LHIA 4OIOF 2DBBA 2IA0A 5E17F 4GXOA 4UVBA 2O03A 2IVMA 3BY6A 4BAYA 1R00A 4DNCA 4MTDA 3D0SA 3LA2A 1STZA 5DV5A 3ELKA 1YS6A 2M45A 4HDUA 4RB0A 4CHUA 2ZMEC 1BI0A 5DEQA 2HTSA 1YG2A 5JHUA 5DUIA 5DCMA 3MQ0A 2JRTA 2HYGD 2M8EA 4Y17A 2ZCWA 1BN5A 4Q5SF 2ZFWA 1V4RA 4M9ZA 4GYGA 2YPRA 4EVIA 3ZMZA 3FXUA 3S2WA 1DP7P 1HQCA 2E7XA 3Q5FA 3K2ZA 2DO7A 3V7CA 1VTNC 1FY7A 5BS6A 2FNAA 2ZNZA 2RC4A 1SFUA 1YS7A 1QZYA 4GYIA 2V9VA 2DQLA 5LBQA 4AIKA 2PBIA 2P5LC 4Z2YA 3DKWA 1ZRCA 3U1DA 1YIOA 2VT3A 4EJUA 4EV0A 2K02A 1ZREA 2ZBKA 3RTRA 4WF2A 1IXCA 1G6NA 1R1TA 4AVPA 2YR2A 2YX4A 1MKMA 3H3ZA 2GXBA 4JBAA 2KJBA 3I4PA 3EUHA 3ECOA 2MC3A 3FXRA 1FSHA 5HLIA 4EJOA 1P6RA 3WTXC 4KA4A 1P2FA 5FLXK 2VC0A 1ON1A 2RV8A 2BYVE 4M74A 3ERED 1BOAA 1PP7U 1XDSA 1MDMA 5J8CA 4RAYA 2VBZA 5CVUA 2LSOA 5FFZA 2CG4A 1JE8A 1XN7A 2BV6A 3MZYA 3NRVA 2MH9A 3VODA 1ZGAA 1Z05A 4UVCA 3M8EA 4KMUX 5ICGA 4LK1F 1ZG3A 2F2EA 4TV7A 4L0YB 1B6AA 1RIOH 3GF2A 1J7KA 1DUXC 1B4AA 1BM9A 3VEPA 4IF4A 1XGMA 3WGGA 2XVCA 5BPDA 1XGNA 2VC1A 4GGGA 2V79A 4Q4ZF 5FD5A 3F8MA 2ZJ2A 3LQRA 3P7NA 2DLLA 4A0YA 1BIBA 3QP6A 1TTYA 4HV6A 4A6EA 2FA5A 1W5TA 1ZGJA 1A04A 1YTYA 4PGGA 3IL2A 2OBPA 1LDDA 2QENA 3J80Z 3WU0A 3LAJA 4I2OA 1HXDA 5L3CA 3KP3A 1USSA 5FGMA 2Q2EA 5DD8A 4BQAA 2QWWA 3I59A 4HF2A 4HX8A 4KN7X 4RS8A 5LHGA 2AS5F 4I09A 4RGUA 1W4MA 2GZWA 1U78A 4CICA 2D1VA 4CO8A 1V3FA 1B9NA 2GA1A 1MGTA 4YFKF 2A6EF 4ENNA 2NYXA 3GFLA 1FP1D 3V7SA 4EM1A 3K1MA 1P4AA 1ZLJA 3ZQ7A 4B8XA 3DXJF 2YU3A 3MWMA 4HX7A 1PDNC 3GFIA 5ICCA 4WX9A 4BHCA 1KU3A 2TDXA 3FMRA 2STWA 2EWNA 3ROUA 3HSFA 3BJAA 2IA2A 2FRHA 2O61A 3JTGA 3J80K 2PG4A 2A68F 1USTA 3JTHA 4LLGF 3T8TA 1BI3A 1HSJA 2DW4A 1E17A 1I5ZA 2IPQX 4GO1A 3RDIA 3WTTC 4L9TA 1NHAA 4N0BA 3TQNA 2CO5A 5D5VB 5LGNA 4LB5A 3FHZA 3F8FA 3P9IA 4LK0F 3R0JA 1OPCA 3GO5A 2RKHA 3E5QA 3I54A 2D1HA 4PZJA 2FMLA 2FF4A 2ZKZA 3GWZA 4LLLA 1IF1A 2VONA 5FO5A 2MA3A 3T0YA 3CUOA 2HQNA 3LSTA 4L9JA 3FWEA 5E1XA 5HDGA 3U2RA 1FC3A 3HRSA 1K78A 2P6SA 2DTRA 3C3WA 4HLYA 1MJBA 2WC2A 1WQ2A 3M1EA 2WWYA 4IHSA 4ESFA 3SQNA 5DCMB 2OU2A 3SFZA 2MLGA 4ENJA 5IT9Z 1XMAA 3QPHA 1IN6A 2H94A 2YX7A 3KP2A 1TW2A 2Z3YA 5E20A 2XAFA 1UB9A 3B02A 3TKYA 3R6SA 4KFCA 2WTEA 2LNBA 4IXAA 5FFXA 1F9NA 4UUVA 2PJPA 1EH7A 4KMFA 2L01A 4MNUA 1Z6RA 1C0WA 1IN4A 3KCCA 2GAUA 1B59A 4OMZA 3L09A 3GUDA 4P55A 3P9CA 4MEXF 2FBIA 5EEGA 1WWXA 1HSTA 2IW5A 3TOAA 1SMYF 2OZUA 2XRNA 2NAZA 1YW8A 3E5XA 2KKOA 2O8XA 4YFXF 2ELHA 2Y48A 3R60A 1R23A 5JVTA 4U0YA 4CXFA 2P4WA 4UVAA 4I98B 4RGRA 1Z9CA 2UZKA 3GEZA 1D5VA 5IT9K 1EH8A 2HS5A 4L5JA 2CW0F 5F6FA 1ODDA 3BPXA 3HRUA 4AIHA 3LQQA 3TO6A 1ZARA 4RB1A 3CO6C 4P5OA 2P6TA 2ZXJA 3ZMVA 2VBXA 2O6GE 2OZ6A 4HOBA 1J2XA 2NS0A 5HLHA 5FB2A 4EJTA 2A69F 3ZN1A 2ZNYA 3KZYA 4YG2F 1MDMB 1R7JA 4I01A 2XIGA 1Z1DA 1IN5A 5EEHA 2E1NA 4YIFA 1JXSA 1GVJA 3V8LA 4AIJA 4FHTA 5D4SA 2PFBA 3BWGA 3K1NA 1YO5C 1QO0D 3M9AA 2COMA 1FT9A 5DCFA 1L0OC 5L3GA 4MHGA 2R7FA 3L00A 3DF8A 2XAGA 3LFKA 4ZYHA 4G7OF 1TQPA 2GA2A 3RI4A 3F8NA 3EDPA 4I02A 3IRQA 3E6CC 3GYHX 1P92A 3KEOA 2XHKA 4K2EA 5D5XB 4WWCA 4RAZA 3QAHA 4HAMA 4M9XA 3U9GA 3FM5A 3I59B 4KUMA 4IVNA 5HOOA 3Q9VA 2QQBA 3BZ6A 3R61A 2M87A 3BDDA 1T98A 3QP5A 1HW2A 4OU0A 3HRMA 2V1UA 4F7ZA 2M1BA 2XASA 2LKPA 4P9UA 5D8LB 4L18B 2A07F 4UHTA 4JK1X 2KIFA 2HDCA 5CVIA 2PLYA 1S7OA 4KIFA 4PGHA 4G7ZF 4S04A 2FBKA 4A0XA 1FLIA 1MZBA 1L3LA 5FLXZ 1U3EM 1G3YA 4ZH4F 1BIAA 1F5TA 1IN7A 2PI0A 4HF1A 2P8TA 3WE3A 1E2XA 2XKOA 2ESHA 2CWEA 2ISYA 1I1SA 1S7AA 3WTWC 2HKXA 1D3YA 2XUBA 2EA4A 1CGPA 4ZZDA 4HDVA 4EJWA 2XGXA 2F5CA 2F5DA 3COAC 1FBQA 1QBJA 1W5SA 2HZTA 3TDZC 1LJ9A 4UNOA 2W57A 1ZN2A 3LA3A 2HKOA 3PQJA 1IW7F 1Z91A 1ONVA 2K4JA 3WTZA 3VFZA 5ICFA 2K27A 5J6XA 2QVOA 3V7RA 4R8HA 5LLQA 3KLOA 1DDNA 5D4RA 3BJ6A 3G73A 5L3FA 3GZ5A 4ESBA 3RIRA 2EV5A 1ON2A 1K78B 4ESJA 1XD7A 2EFPA 4EGZA 2X4HA 3CO7C 5AIPA 2K86A 1DPUA 4A6DA 2W25A 3KP6A 1BBYA 1UHWA 3HOSA 2JPCA 5AONA 2CYYA 4Q47A 3GZ6A 3WGIA 2FBHA 1O3TA 4KICA 2UXNA 5JFRA 5JI6A 1AOYA 5F1RA 4EM2A 4ZYDA 2BE5F 5ICEA 1RUOA 2CFXA 3KZZA 1U2WA 2FQ3A 5K5OA 4M72A 2VBWA 3KE2A
chains in the Genus database with same CATH superfamily
3BROA 2CUJA 2M30A 4LOCA 4CYCA 4WXDA 1RI7A 2QUFA 3A0HC 4UB8C 5HS7A 3TL4X 2DMNA 3J7AY 2FUG2 3ZPLA 2Y9YA 2LC2A 3FF5A 1VQNI 1FWZA 3GLXA 2L02A 4X0GA 5LRRA 4P9FA 3PQKA 2FSWA 3IRRA 3K4JA 3M07A 4HBLA 1K83J 1MMDA 2JVHA 1ZRDA 4RDUA 1A5JA 4FT8A 2E1MB 2NXNB 1U5TA 2JSCA 3MD2A 2FD5A 3HHHA 2VE8A 3TP0A 3OYCA 2W7NA 1R1UA 1XCBA 3CZ6A 4A5NA 4JYKA 4NDLA 4DOZA 1J59A 3L7WA 2PMUA 5J1RA 2F5VA 3ZXSA 5ERIA 3T1BA 2DA1A 3L2CA 1I1GA 2LF8A 2F6CA 1UZCA 3CCYA 1KYWA 4G6QA 5M3FJ 3QODA 3W2WA 4XLPF 3HHGA 3ZMSA 5EG0A 3KETA 4UY8I 1FYMA 1Q1HA 4DGWB 4ON0A 1A6IA 5TGTA 4G7HF 2XSJC 1WCMJ 1Z67A 2A05A 3CP2A 1SMTA 2VOPA 1U9OA 2QA4I 2F5EA 3HXLA 4XL9A 2DFIA 2EQRA 2A6HF 2OAZA 4ENKA 2W4SA 3ZMUA 3ABKH 2QZ8A 2LLKA 2ELKA 4Y13A 2OCEA 4PDKA 3QOPA 1UHSA 3GTLJ 1ZKGA 2Y0MA 3T5XA 2HOAA 3AL0B 4PJJA 5D8KB 1R6RA 1R58A 4XLEA 3GZNB 5BNGA 1MH4A 4L9VA 2FMYA 2ADUA 1X1CA 2JPBA 5H20A 5GPCA 4XONA 2VPLA 2AQEA 4XKBA 3TO9A 2D45A 2M2EA 2R7DA 5CVRA 1K4SA 2V6EA 4UB6C 2FOKA 3BG6A 1G3SA 2OQGA 5D6EA 4KN4X 3OYDA 3R0AA 3FIWA 4BU2A 1FYKA 1Y0NA 1EA3A 2DI3A 3PUBA 2HTJA 2YSRA 4HF0A 2HDDA 2IS2A 4LIUA 2EINH 3FM3A 1GV5A 3S1NJ 2RN7A 2ZXIA 1YHQI 3RKWA 4G9YA 2PJRB 1XMXA 5ILSA 1U8BA 2DT5A 3OYHA 2O9LA 2FQ4A 3AG4H 2BW3A 4WXCA 4OIRF 1R71A 1O7LA 2Z1DA 5LEJA 2P81A 3I0TA 2ZFUA 1MSEC 3GVAA 4DQ2A 4AD9A 1GV2A 4C3HJ 4L9NA 3EETA 3RKYA 5F08A 4LB6B 1JHHA 5GTHC 3MKYB 2BY3A 4O6JA 3V4GA 3F8BA 1R5HA 3J81Z 2JT1A 1BA5A 3OSFA 2Z99A 4LGWA 1TWHJ 1DP3A 4YIIA 1YFHA 1CF7A 2VOOA 4S05A 1P4WA 3ZN0A 1MNEA 2K4BA 3KLNA 2R4GA 3S1MJ 3G4SI 3GXOA 3B6CA 4RAGA 5E79C 5IYDJ 1QHGA 1ZYRF 1F43A 4B47A 2CFOA 1KQ9A 3FX3A 3KP5A 4BNCA 1S9HA 1SD7A 2JJ7A 1ZH5A 1LEAA 5DD4A 1D0YA 2ZJRF 4KIGA 3CC2I 2FEZA 2GWRA 1IN8A 2RNJA 2R3SA 4RGXA 1SD6A 4Y3OA 2QCOA 2KZGA 2JRMA 1JGSA 5TRDA 3C1DA 5F0HA 3K1PA 5F27A 3QPLA 1Z0XA 2JA8J 5J8FA 1PVEA 1ZG1A 1XSVA 3I56I 1EKEA 1G2HA 3P5JA 3FK7A 5B1BH 3OWTA 4WCGA 2CW7A 1T56A 2ZO4A 2QQAA 3SYTA 5FKKA 3BC8A 2P5KA 4XKVA 1O57A 2KT0A 2VJ4A 1HC8A 4OMYA 2KL4A 1HKQA 5CKTA 1KQ0A 1MMNA 3RKXA 3E0JB 1TC3C 3IHUA 5JVGF 2NVYJ 3KP7A 1DU0A 1O7FA 4V19K 3HOYJ 2EFQA 1AHDP 1PUEE 1K79A 2H09A 3IH2A 3J81K 3HPHA 4U88A 3PFYA 3F23A 1FOWA 2V9KA 4AYBN 4BL0B 5EYRA 1XGSA 3HTSB 1JT6A 1SVLA 1JTYA 3FXLA 4A3EJ 1S8NA 3KFWX 2H6CA 2WV0A 5DDGA 1J75A 3BTIA 1FOKA 2O3FA 3H5NA 3LFUA 4EJVA 1LVAA 1OYYA 4XBFA 2LK2A 2O8KA 2K3FA 4KT6A 1LKXA 1T95A 2A61A 1ENHA 5KVRA 6PAXA 3MKWB 3UKGA 5CPRB 4M9SA 4BHBA 3L2UA 3O3KA 3C18A 1P4XA 2X0LA 1T6SA 3P9KA 3LWFA 3I71A 1K6OA 3S3OA 1ZLKA 2TCTA 2BY1A 2RQQA 2V9PA 2OQRA 2Z2SB 4RA2A 3DTIA 2LF7A 1TZLA 1XMKA 1QRYA 3C2BA 3NARA 1X2MA 1KYZA 2G7UA 3IWFA 4D5FA 5B5EC 4HX4A 4HQEA 3F21A 4BXUA 3RKQA 4BHPA 3BR5A 4RM3A 3IKVA 1KU7A 1V55H 3EUAA 1MBHA 4ZC3A 2BGCA 3DP7A 2VJJA 4A3MJ 1I3QJ 1AA7A 1BI1A 3CJNA 2LBFB 3HG9A 1Y39A 5D5WB 4B48A 4DBQA 2QBYA 1OMIA 3H1CA 5H6QA 3CCRI 3VB2A 3N97A 2DQRA 4B09A 3PJRA 4N9IA 5A2QZ 1BJAA 3SFIA 2H8RA 1MJ9A 3TOBA 3IWZA 5TJJA 1OR7A 4KDPA 1OKRA 3E5UA 4EATA 4GFBA 3SZTA 4NHJA 4XKWA 2KRHA 4NNJA 4RBOA 2W24A 2BVLA 3J7YJ 2DOAA 1LDJA 4MGRA 2VQCA 1T2KA 2K9QA 4E7KA 1GHCA 2DFEA 1ETVA 4XICA 4IRIA 2QYOA 2RQPA 3S14J 2A5YB 2WB1A 2O0YA 2HI3A 3L1PA 3K70D 5F64A 2UV1A 3F6VA 3FMSA 2W48A 5K7HA 2HQRA 3HPGA 2Z9OA 2E71A 3K4LA 4LG0A 4IQ4A 3G71I 2XV4S 2MABA 4PSWA 3MZHA 3W6VA 5GAEJ 2NRAC 2O5RA 5LHHA 2IGOA 1WSUA 1J0RA 4A3DJ 5CJ9A 3JRFA 4PCQA 1GUUA 2VXZA 2LY2A 5CQEA 3RYRA 2CQKA 5K7FA 1H0MA 3BR2A 2VQLA 2HQAA 4G6TB 3ZQCA 2ZSHB 4ZYGA 3JREA 3K4KA 1OCZH 3F9KA 3NQOA 1HW5A 3CUQA 2J5PA 3DWLE 1IZ1A 2UXXA 2EJRA 1LB2A 4F93B 2ELJA 3S32A 4LLNA 5IOYA 3K10A 1IAWA 1S5LC 1FMWA 4KIBA 5CLSA 1KU2A 5A2QK 4OIQF 4BS9A 4YRVA 1RKTA 1E0EA 3H5AA 4B3XA 3D5LA 2Z5UA 1P7IA 2XSDC 2H27A 4DIQA 1QNTA 2DODA 1MMSA 2M8GX 3TBIA 5IYCJ 1TQMA 2PX9A 2GXAA 2COBA 4R1HA 3CCEI 4L5IA 4D0PA 2DN0A 2Y9ZA 1ETWA 5FRNA 4DYCA 3HSRA 3KX2A 1RZ4A 3DPLC 4CYCB 1O3SA 4MEYF 1I27A 4XLAA 5LGUA 3E3VA 2EZHA 4LG3A 2IRFG 2R7XA 3R4KA 1Z7UA 3QPTA 3G3ZA 3SZPA 1JKRC 4ZDLA 1OLTA 1VQ6I 1R49A 3WGHA 2AXLA 1G4DA 5E1WA 1AU7A 2IGNA 5ED4A 4M73A 2EZLA 1K4TA 3WTSC 2XAQA 1ITYA 1XX5A 3DQVC 3CCQI 2R93J 5J3LA 4MFDA 3HOXJ 1FIPA 1HKTA 3CLOA 1R22A 3QU3A 3OYFA 4B4CA 1U5TC 1U5TB 3S3MA 5HNFA 2CQQA 4E70A 1HLVA 3L9FA 1I39A 3WE2A 1JGGA 3S15J 3E6MA 1VQOI 1IGNA 2EIJH 1XSDA 3JR9A 1X1DA 1ERDA 2B0LA 2XPWA 5KK1A 1MBEA 4BDYA 2P7CB 3K69A 3RJPA 3DCFA 2HPIA 4BXXJ 5EG0B 3ZQFA 4M6VA 1ORKA 1FSEA 1YLFA 1MMAA 3HSEA 3TW6A 3OV8A 2ACJA 1PUFB 1HDPA 2EPFA 2OPTA 2HYFA 3CMYA 3FXJA 1NG7A 1X4OA 4RGSA 2ESNA 3RPQA 5FROA 3OYLA 3AAFA 4MFEA 3BCBA 4XLNF 1FNNA 2ZMEB 3JRBA 5D6FA 2EV6A 2EV0A 3H9JA 2L4MA 1TNSA 3HRTA 4HLXA 2W85A 4LD5A 2MG4A 3DBRB 1ZQ3P 4IRGA 2BHYA 3MEXA 3GFMA 3DFGA 1IRXA 1OYIA 5CVJA 4XK4A 4IZZA 1HBXG 1O3QA 5E8IA 1R4MB 2VI6A 2VODA 5FKNA 4C2UA 1PJRA 4IPAA 3KP4A 1SFXA 4IEJA 3TW7A 1OFCX 2OJED 5FLVA 3GTMJ 3S2HJ 1XSXA 4J01A 2DMQA 4A12A 4BH9A 3MCZA 5L3BA 4FCYA 2ECCA 2PMZA 2VE9A 2ID6A 2IT0A 1BC8C 4U0VA 1FP2A 3A02A 2IGKA 1XGOA 4EQQA 2H6BA 3BLYA 5BPIA 4ETSA 3GW2A 3BPVA 1MNMC 3H3UA 2DK5A 2HNHA 3OYBA 4CCNA 3MAJA 3ZP5A 2YS9A 2WY7Q 5IYBJ 2OCCH 1D1AA 3EQLF 4KT5C 2MBFA 1T08B 3B73A 1LEBA 3WHBA 1J9IA 3DV8A 4CUGA 1R4NB 1RESA 4AUXA 1DPRA 2JTVA 1D8JA 2VQGA 2HVRA 3HOVJ 4AYBA 1P9QC 1V5EA 5EZGA 3O6BB 2G7HA 1KZHA 2EFOA 2PMHA 3GFJA 5DYMA 3QU6A 1BW5A 4W1UA 1O3RA 1T0FA 1WRJA 1R1VA 2DPUA 2LVSA 1CF7B 4R79A 3GX4X 4PUSA 1ZR4A 4CYDA 3K4CA 1M1EB 4ENMA 4MO7A 3O2PE 2ETHA 2DYSH 2RREA 2BBYA 2MFZA 3WTUC 2Z16A 3OOPA 3CMMA 3DLLF 2CV0A 2QSFX 4P96A 1K7AA 4ZZLA 3HIFA 4RMNA 1WJBA 4FX0A 2EZIA 4B1RA 4FTHA 2DAOA 4ANJA 2P0WA 2K9MA 4EM0B 1TBXA 3BP8A 3F8CA 3M1CA 4OAYA 4A2UA 3K9TA 2OC6A 2GBYA 4G6DA 5J40A 3DBHB 4HEA2 3WG9A 4HA8A 2X6YA 1NK3P 3OYKA 3DEWA 3RQIA 1D5YA 5K5QA 1NH3A 3OIPA 4LMYA 5LRSA 2N8GA 2RVCA 1Z21A 5K5RA 3EYIA 3CCMI 1IO2A 3WTYC 3GTQJ 3SEQA 1YRNA 3CESA 4A0ZA 3Q0UA 2LDUA 1LPQA 2L54A 2QM3A 1LE8A 1S7EA 3WU1B 2E7WA 2MH2A 2XC7A 4FX4A 1LDKB 1MH3A 4XM3A 1WJFA 3E6DA 2DPDA 1WKMA 1F36A 3ULQB 1G3WA 1UMQA 1VI0A 1YJWI 2LTPA 1WJAA 1PP8F 2FU4A 1Z3XA 3CQZJ 5IT3A 4H0EA 3BG3A 4G8XA 4QLCU 3LSPA 5HLTA 3FHNA 3QYBA 1TQIA 4ZTJA 3OR2C 3PO3J 4I99C 2ZJPF 4U7DA 4HSRA 3BTJA 1Y56A 5LEKA 3HUGA 1JI8A 4CDGA 3H92A 3TGNA 2EB7A 2EFWA 2XB5A 2CUZA 3AG3H 4UUSA 4C3JJ 3H9QA 2VL8A 3RCOA 2ZC2A 4RB3C 5JR3A 3TDUC 1YW9A 4HZFA 2G9WA 5J1YA 3BOQA 3HTUA 2Y75A 3AFHA 1MJAA 4WXHA 4CZCA 2BEOA 2W84A 1QZZA 2RGVA 4YFNF 2M7AA 4C2MJ 2L0KA 3HYIA 5GTIC 4WK8F 2G0EA 3KPHA 2DMTA 3VOEA 2XROA 3NEUA 3IC7A 4NUBA 2JUGA 3A4CA 2CGPA 2LKSA 2WB1N 1B72A 4IHXA 2MW8A 1FPQA 2E60A 3OS0A 1IUYA 3ZQLA 4D1QA 3KYLA 2X1DA 2VIXA 2DU9A 3S8PA 2Z33A 4XQFA 2JA5J 5BMZA 2E1MC 2GIVA 3H0DA 5LGTA 3RPUD 1X1BA 3VYTB 4BEHB 2KIUA 3REOA 2GQQA 4G94A 1T39A 1W7PB 3CDHA 3LA7A 1MD0A 3W2AA 1FYLA 5HLGA 2QBYB 1WGXA 3OIQA 4BGDA 1UAAA 2STTA 2MLKA 1FBSA 3F6OA 3FZVA 2DK8A 4EMSA 3C2GA 2QEXI 1SAUA 3JAMZ 3F3XA 1PYVA 3I53A 3ZMDA 1OR7C 4FQGA 2HOEA 4XN0A 4I0BA 2RDPA 2OA4A 3ABUA 1PUFA 3CTAA 5CYVA 4YELA 2L4AA 4BXFA 3JRIA 1R36A 2GLOA 2F4MB 4C30A 3I4NJ 4YEJA 2Q0OA 5BQTA 2LOOA 2ZMEA 1I6XA 4ZDPA 4LFUA 1GT0C 2NVXJ 3LSGA 3M7GA 5GADJ 4UV8A 2VKDA 2P5VA 3T8RA 3N4MA 2A3SA 3I9V2 1SFKA 3MZ8A 1KQ8A 3HOZJ 5CVVA 3MFKA 1K61A 1YQAA 5K1YA 2V26A 5KAIC 3AL0C 2RNGA 1JHFA 3RPUA 1U6GA 4LG0B 3HZJA 3E97A 2WAQA 3WODF 5HDNA 3JSOA 1Y0UA 4ZYEA 4MIMA 5L3DA 4MQ9F 4JQFA 3ABTA 2NNNA 4U7BA 5DUKA 1S72I 1CQTA 2ISZA 1ZHFA 1QPMA 3FXQA 4PFOA 4BE0A 2M34A 1NG6A 2IP2A 4PJ0C 2IA1A 3ISPA 3NAUA 2EK5A 4U87A 3BR1A 2R7RA 4LITA 3CUQC 3CUQB 1RR8C 4N4NB 2HGCA 1UHMA 2VPRA 3FISA 1B8IA 2KJCA 1SAXA 1YYVA 5M5XJ 4N9HA 5B1AH 1N75A 4IHTA 3FMQA 1XPXA 1K6YA 1YW7A 2QKMB 1UFMA 2E1CA 2F48A 2NS7A 2CU7A 3JAMK 1ULYA 2FNPA 1RUNA 2R5YA 1VQ9I 3K70C 2Y0SA 4I7HA 1IRFA 2E35A 2XAJA 3F22A 5CQGA 2GOMA 3S3NA 3S17J 1OISA 4DZPA 3DU5A 3O8HA 1E3HA 1QGPA 2CQNA 1BJZA 2EZKA 4F91B 2QLZA 1TW3A 3V8KA 3C2HA 2HOTA 3DEUA 3JRAA 1F1ZA 1FTZA 2E2HJ 2AQFA 3DEEA 5E1ZB 5C44J 1D1BA 2LD5A 3CC7I 1OYWA 4U0WA 1ZAOA 1RNLA 3K4MA 1FZPB 4F55A 3HOTA 3G6EI 4B44A 2O7OA 3QRFF 4UV9A 5J47A 2EIMH 1IRZA 1H9TA 4BJ5C 1P7JA 2PMZN 3SXYA 3EUKL 3A2KA 3CJTB 2HFHA 2KRFA 1X3UA 1S3JA 1SFEA 1RKWA 1KA8A 2HZDA 2VT2A 1QPIA 1TNTA 3Q9SA 4NB5A 4NQWA 1J5YA 4E7ZA 2F4OB 3ZR8X 1YJ9I 4XSXF 5ILVA 4ASNA 2V6CA 1IRGA 1ETYA 4FETA 3C7JA 3M8JA 4CGZA 1T33A 4IRHA 4M71A 2VBYA 3ABLH 5FD6A 2XAUA 2ZJQF 1LQ1A 3EYYA 1WI9A 4HW0A 2R5ZA 5HS9A 4IHVA 1HKSA 2DA3A 2KMUA 2WAFA 3VYSB 2H1LA 2J5OA 3WTVC 1SD4A 4L0ZB 4KYWA 1EH6A 2UWMA 2TRTA 2KHMA 3PNTA 2BOLA 2A5WA 1QZEA 1W7PD 4LJZF 4OIPF 3H9GA 1JKPC 1B1BA 4GCVA 4XSZF 1ZG5A 1BC7C 5HDKA 2CSOA 1Z3YA 1F4KA 1ZELA 2KPMA 1TWAJ 1BR4A 1WZ2A 2HVSA 3BZKA 2V1XA 2HWVA 4OOIA 4AVZA 3LAPA 2KZVA 2NVUB 1KGSA 3KEQA 4XR6A 3SDGA 3TO7A 2LFBA 4M6XA 1TLHB 3LL7A 1RRJA 3TP3A 3I64A 4OINF 1SD5A 3ZMTA 4BKXA 1MBKA 2V7FA 2QQ9A 4ZJZA 2DA5A 1R5GA 1VQ8I 4M6YA 4UXNA 1T38A 2QF7A 1KU9A 1BI2A 2NNYA 1VQ5I 5ILUA 2HOSA 4XRFA 1GXPA 2D2WA 1G3TA 2OD5A 3DPTA 3W6JB 3BR3A 2MD5A 2HEOA 2JA7J 4BEHA 1ETKA 5BOXA 2E2IJ 1QQIA 4QWQA 4EGYA 1H9GA 3SHFA 3E6BA 3WU2C 3GTOJ 2Q8KA 3E7LA 4M3GA 4ZTFA 2IS4A 2GIZA 1W7PA 5L3EA 2K40A 2FOWA 3PSIA 4CCJA 5E18F 1EV7A 2X51A 1IXSB 1T0FC 1ZRFA 4KNYA 3ML6A 2UUZA 3VYUB 4UUTA 2HPMA 1AWCA 1OJLA 2M5WA 2V1DA 3F0CA 1IXRC 3HKZA 4IJAA 5EZHA 4A5MA 4B3AA 5FJ8J 5HS8A 1OCOH 5C4JJ 1Z6TA 5M5YJ 4IKFA 4QSHA 3J7AO 3JSPA 1XB4A 4JX6A 4BYYA 1X58A 2L2OA 4MQVA 2HXIA 2XDVA 4ABZA 4O3MA 3I5UA 4MTEA 2Y31A 3HBLA 2DJIA 1LNWA 3S93A 4Y52J 1YX5A 3F72A 3HJEA 4BY7J 5D5UB 4AWXB 5B3SH 3L2WA 4HV5A 2ZXHA 4Y15A 3K4NA 1HW1A 2YUSA 3JW4A 5HVQC 5AIQA 1H88C 2FE3A 2D5VA 4Q48A 4V2GA 1U8RA 1YRNB 4A3KJ 2CJJA 3IAM2 3ZQHA 1LE8B 2PN6A 4RB2C 3TEDA 1FX7A 1D0XA 3V42A 2X6OA 2P7VB 1IV6A 3RYPA 5C4XJ 1FBUA 1HDDC 5FKLA 2FXAA 2R7VA 3PFIA 4HYEA 4DW6A 2W00A 4PK4A 1GXQA 3IKTA 5E8GA 2XAHA 1OCPA 1W36D 1D8KA 4BQQA 2JZYA 3CCJI 1XDUA 4HNTA 1ETQA 1UCRA 3W3CA 4DYQA 1IC8A 4A3BJ 3M8FA 3ZGKA 3CJQB 2WY8Q 3CDLA 2JQ7A 3HUGB 1TP4A 5C3EJ 2L3DA 4GDFA 2I8DA 2XKPA 3HL2A 2F5FA 4UUSB 3A01A 2VN2A 2AHQA 1SANA 5EGOA 3HGYA 1TWFJ 3DKXA 1JUPA 1OCCH 1U9NA 2R7SA 2PQ8A 4O5VA 4HQMA 4I0AA 3ECHA 2GXGA 3GLLA 2X1EA 2MYSA 1E3OC 3K0LA 3NWTA 2K7LA 3BJOA 2NOGA 5F0CA 1B9MA 1W5CC 1SVMA 3KYCB 2KIMA 1SFOJ 1LFBA 3V8JA 1B72B 1VQMI 2OTLI 1REPC 2PEXA 3KEYA 3I58A 4F92B 2IJLA 3W6KB 2HR3A 3KIOA 4E6KG 2EFNA 2EA2A 2WAQN 2M0MA 2XPVA 1S6LA 1XC5A 2C6YA 4CZZA 1S29A 1XCVA 2VKVA 4E4HA 5H6RA 5LHIA 4OIOF 2DBBA 3PIOF 2YU9J 2IA0A 5E17F 4GXOA 4UVBA 2O03A 2IVMA 3BY6A 4BAYA 1BW6A 1R00A 4E7HA 4DNCA 2Y30A 4MTDA 3D0SA 3LA2A 3SZGA 1STZA 4D5CA 5DV5A 1VZ0A 3ELKA 1YS6A 3FBIB 4RM2A 2M45A 3K7AJ 1HF0A 4HDUA 4CSWA 3VPRA 5DM6F 2Q2EB 4RB0A 1X3ZB 5F1JA 2ID3A 2ZMEC 4CHUA 2KFDA 1BI0A 3QYFA 5DEQA 1FTTA 4HPQA 2HTSA 4HNVA 2Y0SN 1YG2A 5JHUA 1Y1VJ 3GMEA 2QSGX 4BJ6C 5DUIA 4BBSJ 1HCRA 4ITVA 2OV7A 3GCMA 1WH5A 5DCMA 3HOWJ 3CDIA 1TWCJ 2JRTA 3MQ0A 4Y7NJ 3PUFA 1WJEA 3ZQQA 4XRSG 3HEFA 4ZYAA 4ZDOA 2HYGD 3A0BC 1UJ8A 2M8EA 1Y8QB 2BVMA 3DPUA 4C9YA 2EILH 4Y17A 2Q1ZB 5EJCA 2ZCWA 4KITB 1BN5A 2VUMJ 4Q5SF 3LOCA 3QWLA 2ZFWA 1V4RA 4M9ZA 1JTXA 4GYGA 2YPRA 3ABMH 1I50J 4EVIA 3OIOA 3ZMZA 3FXUA 3UNGC 3HM5A 2VKHA 3I55I 4II3A 3OYGA 2VJ5A 3H36A 3S2WA 1DP7P 4M3FA 1HQCA 2E7XA 5KAFC 3Q5FA 4IO9F 3N05A 1B8IB 3K2ZA 2DO7A 3W2VA 1JT0A 3V7CA 1VTNC 1VFCA 2H8WA 1FY7A 5BS6A 3HC7A 4XKCA 2HYJA 4V2FA 2FNAA 2ZNZA 2RC4A 3BG7A 1SFUA 1YS7A 1QZYA 4JX5A 2K9NA 3AG1H 4M3DA 4GYIA 1AKHA 2R5YB 1POGA 2CUEA 3OYMA 3FDYA 4XOTA 2V9VA 4XLCA 2DMPA 3S2DJ 2DQLA 5IPAA 3M4OJ 1VQ4I 5LBQA 1RC9A 1H8AC 2CV1A 4AIKA 1N78A 4L5EA 4PJNA 2CH0A 2PBIA 2P5LC 1O4XA 3JRHA 4Z2YA 5GAHJ 1LFPA 1X4PA 3CCLI 2VJIA 3DKWA 2QKLB 3X2QH 1ZRCA 3U1DA 5E3OA 3PIPF 5LD2C 1KONA 4FASD 2DTZA 1YIOA 2VT3A 1RETA 4EJUA 4EV0A 2K02A 1ZREA 2ZBKA 2M4KA 3RTRA 3CF5F 2DA4A 3D1NI 1BL0A 1UG2A 3LSKA 4WF2A 1IXCA 3FXOA 4B43A 4XORA 2GOXB 4S0HB 3VDXA 1G6NA 1R1TA 3QOEA 3ESWB 1XTAA 4AVPA 5EF6A 2XF5A 2YR2A 3H0GJ 1BR1A 2B63J 3CCVI 2NOJB 4QPQA 3PO2J 2YX4A 4NQWB 1MKMA 3H3ZA 5IOZA 2GXBA 4JBAA 2KJBA 4C3IJ 1EF4A 3I4PA 1IJWC 3EUHA 3ECOA 2MC3A 3ZQIA 2OF7A 5FRMA 3FXRA 1FSHA 3L2VA 4BE2A 3CD6I 5HLIA 1DQUA 1D1CA 4EJOA 1P6RA 3WTXC 1DGWY 4KA4A 2R5ZB 2B7EA 5FLMJ 3JCUC 1P2FA 5FLXK 2DDBA 2VC0A 1ON1A 1A31A 5FKOA 4CCOA 3I3LA 5JHFA 2RV8A 2BYVE 1BR2A 4M74A 3PNVA 1FOXA 3ERED 4G12A 1BOAA 3ZOBA 2WA0A 1PP7U 1XDSA 3DKYA 1MDMA 5J8CA 4RAYA 4BQNA 4OWRB 2VBZA 5CVUA 1JKOC 4IQJA 1NK2P 3OL4A 1NTCA 1MSFC 2LSOA 3HKZN 5GPAA 5FFZA 3H35A 2L7ZA 2CG4A 1JE8A 1FIAA 1XN7A 1GVDA 2BV6A 3MZYA 3NRVA 3CMAI 2MH9A 2NVQJ 5F04A 4KJZA 3VODA 1ZGAA 3CP8A 1Z05A 1G59A 3NWSA 4UVCA 4HSTA 3M8EA 1ACIA 5DM7F 4KMUX 4BE1A 5ICGA 4LK1F 2F4IA 1ZG3A 2F2EA 4TV7A 4L0YB 9ANTA 1B6AA 1RIOH 4RLFA 3FK6A 2EIKH 1TT5B 1VQ7I 3GF2A 1J7KA 4M3BA 4D9JA 1DUXC 1B4AA 3AG2H 1BM9A 3Q3SA 4II2A 3VEPA 4IF4A 4AC0A 3OYIA 1TL8A 4CA0A 3RZOJ 1XGMA 1QVUA 2W1OA 3WGGA 2L9NA 2XVCA 5BPDA 4HRIA 1U0JA 2QQ8A 5E3NA 2NS8A 2L9VA 1XGNA 2MC4A 2VC1A 4GGGA 2V79A 2R92J 4Q4ZF 5FD5A 2E5NA 3F8MA 3RZDJ 2ZJ2A 3LQRA 3P7NA 2DLLA 4N4OB 4A0YA 1BIBA 3QP6A 4AIDA 1TTYA 4HV6A 4JOMA 2LRDA 4A6EA 3Q0WA 2FA5A 1W5TA 1ZGJA 1A04A 1FMVA 3OY9A 1YTYA 3H5RA 4PGGA 2OBPA 3IL2A 1Y1WJ 1LDDA 2QENA 4A69C 3J80Z 3WU0A 3VSKA 3FXKA 2CRGA 3PL8A 3LAJA 4IL6C 4I2OA 1HXDA 5L3CA 3KP3A 1MIJA 1XG1A 3S1QJ 1USSA 5FGMA 2Q2EA 3FKIJ 5DD8A 4BQAA 2QWWA 3CC4I 5B66C 5EEAA 5H2FC 5E3MA 3I59A 3PM1A 4RLQA 2MD0A 5JLXA 4HX8A 4HF2A 4KN7X 2XRLA 1TWGJ 3IUOA 4RS8A 5LHGA 2AS5F 4Z6YA 4RAFA 4I09A 3FBNB 3IH3A 4RGUA 4XLFA 4KISA 3GTKJ 1W4MA 4PJMA 2GZWA 1U78A 3OYEA 2HXOA 3OYAA 3G2BA 2M3AA 4CICA 2D1VA 5DTDA 3OS2A 4D7NA 4CO8A 1V3FA 1B9NA 2GA1A 1MGTA 3EPZA 1JUMA 2JN6A 4BJTA 1Y6IA 4YFKF 3SJMA 4IOCF 3WG7H 2A6EF 4ENNA 4E7IA 1I6HJ 5FKMA 2VXDA 2LR8A 1ETXA 2NYXA 1FP1D 3GFLA 3V7SA 2I10A 4EM1A 3MKZA 3K1MA 4F52A 1YE9A 4Y4RA 1P4AA 1ZLJA 3A1YA 3ZQ7A 4B8XA 2JMWA 5HNHA 3DXJF 2JSPA 2BHZA 2XGDA 3LSRA 2YU3A 1WJDA 3MWMA 4HX7A 1PDNC 3GFIA 2DOFA 2CW8A 5ICCA 4WX9A 4BHCA 1X2NA 1KU3A 3OOUA 2TDXA 3FMRA 2STWA 2EWNA 3ROUA 3HSFA 3BR0A 3BJAA 3BT9A 2IA2A 3DTEA 2FRHA 1VF9A 3HOUJ 2OUMA 3JTGA 3MMYB 2O61A 3BG5A 4EEFG 3J80K 3IH4A 2PG4A 1R9TJ 2A68F 1USTA 2I5UA 3JTHA 2RAEA 2X6WA 4LLGF 3ONQA 3A01B 3T8TA 1BI3A 2JUCA 5EGOB 1HSJA 2DW4A 1E17A 1JJ8C 3VWBA 1I5ZA 4A3JJ 2CQXA 2E2JJ 2IPQX 4QIWN 4GO1A 3RDIA 3WTTC 1JKQC 4X6AJ 1WH7A 4L9TA 1NHAA 4DYRA 4CCMA 4N0BA 1J09A 3TQNA 3CJRB 2L9SA 2CO5A 2V4JC 2WV1A 5D5VB 5LGNA 4LB5A 3FHZA 1UELB 3F8FA 3P9IA 3OYNA 4LK0F 1H89C 3R0JA 1XS9A 1OQYA 1WI3A 4P1WA 2OTJI 1OPCA 2K9SA 2KIQA 3GO5A 2L7KA 3HGGA 4FE4A 4I6ZA 1W36C 2RKHA 5LFAA 2BY2A 3E5QA 3I54A 2D1HA 4DJAA 3OSGA 1YITI 4XLHA 2R7UA 2ZXWH 2QSHX 4PZJA 2FMLA 2FF4A 2ZKZA 3GWZA 4LLLA 5F0FA 1N77A 3BTCA 1IF1A 1UG0A 3KYDB 3K2AA 2R7TA 3CF2A 5J1UA 2MGQA 2VONA 5FO5A 3GTGJ 2MA3A 3BQYA 4FISA 3T0YA 4XOPA 2LY9A 4E7LA 3ASOH 3CUOA 2HQNA 3LSTA 4L9JA 3FWEA 5E1XA 5HDGA 4NC6A 1FC3A 3HRSA 3U2RA 2P6SA 2DTRA 1K78A 2CV2A 3C3WA 3LMMA 2V1NA 5KNLA 4W97A 4HLYA 3A03A 1MJBA 2WC2A 1WQ2A 3M1EA 3L2QA 2HVQA 2WWYA 3AKZA 4IOAF 3U1KA 4IHSA 4ESFA 2X48A 4NC7A 3SQNA 4XIDA 5DCMB 3SDBA 3G1MA 2OU2A 3SFZA 2MLGA 4ENJA 2HDWA 5IT9Z 1XMAA 3QPHA 1IN6A 2H94A 2YX7A 1MW7A 1TW2A 2EBIA 3KP2A 2Z3YA 5E20A 3J7ZI 2ICWG 2XAFA 1UB9A 2JA2A 3B02A 5KCMA 3TKYA 4NC8A 4A3GJ 3R6SA 5M5WJ 4BBRJ 5KHDA 4KFCA 2VASA 3RQ4A 5DS9A 2WTEA 3LSJA 2LNBA 4IXAA 5FFXA 1OCRH 1F9NA 4UUVA 2JK3A 2PJPA 3GTJJ 1X1PA 2IS6A 1EH7A 4KMFA 2L01A 4MNUA 4BUPA 1Z6RA 2VKEA 1C0WA 4JP0A 1IN4A 4E7JA 3KCCA 4Y33A 1YIJI 2EH3A 3MN2A 2GAUA 1B59A 2Y2ZA 4OMZA 2LP0A 3O8GA 3S1RJ 3L09A 2M7BA 2MSYA 3GUDA 1E3PA 4P55A 4CCLA 3IAS2 3IV5A 3P9CA 4MEXF 2FBIA 4MLOA 2LYCA 5EEGA 3JRDA 1W0UA 1AKHB 1WWXA 2Y69H 1HSTA 5GP9A 2CUFA 2IW5A 1T8IA 3TOAA 1SMYF 5E3LA 2OZUA 2CMPA 2XRNA 4DZJA 2NAZA 1YW8A 3D5SC 3E5XA 2KKOA 2O8XA 2R7QA 4YFXF 2ELHA 4YIRX 2Y48A 3R60A 5EDNA 4XNFA 1R23A 1VQPI 2IEKA 2XB0X 5JVTA 4U0YA 2XPUA 4CXFA 2XGEA 2P4WA 4UVAA 4I98B 4RGRA 1OCTC 2LMDA 1Z9CA 2UZKA 2HU9A 3GEZA 1D5VA 3ZRGA 3BZCA 5IT9K 3GBGA 2HQ5A 3DLAA 3JRCA 1QA6A 3ZCOA 1Z7LA 1EH8A 2HS5A 2DXIA 4L5JA 4J00A 1WPKA 2E34A 2R7WA 2CW0F 5F6FA 1ODDA 2DJNA 1RPWA 3BPXA 1WFXA 1APLC 2K5CA 2XF6A 5K7ZA 1D0ZA 3ASNH 3HRUA 1MBFA 4AIHA 3LQQA 1IUFA 2DOEA 4HG2A 3TO6A 2K9LA 1ZARA 4CCKA 4RB1A 1ZGWA 2E36A 4HNUA 3CO6C 4P5OA 3VSLA 1X1AA 2DT6A 2P6TA 2ZXJA 3ZMVA 2H1KA 3EUHC 1GDTA 3RSNA 3HB9A 2VBXA 2LG4A 2O6GE 2OZ6A 4HOBA 4A3CJ 1J2XA 2NS0A 1X19A 2DT7B 2GM4A 1LFUP 2X6XA 5HLHA 5FB2A 4EJTA 4C2TA 2DFFA 2A69F 1I3AA 2VQHA 3ZN1A 2E1OA 3S16J 2ZNYA 3KZYA 2PJRA 2QGUA 2WBMA 4YG2F 1MDMB 1R7JA 2DA2A 2LREA 4I01A 2XIGA 1G8XA 4JX4A 4IHYA 1Z1DA 1IN5A 5EEHA 4A3FJ 2E1NA 4YIFA 3CMEI 1Z77A 3KZIC 1JXSA 1GVJA 3V8LA 4AIJA 1IDZA 4GRIA 4FHTA 1JJ6C 1HA8A 1FJLA 3LNQA 4A3LJ 1X3WB 5D4SA 2PFBA 2XGCA 3BWGA 3K1NA 1YO5C 1QO0D 3M9AA 2COMA 2M4GA 2ZB9A 1LUJB 1FT9A 5J4YA 2VB6A 5IY5H 5DCFA 4I76A 2ME6A 4QTRA 1TT0A 2JA6J 1L0OC 2NVTJ 5L3GA 2K3PA 1Q1VA 3G1LA 4MHGA 1MNDA 2R7FA 3L00A 3DF8A 1ZK8A 2XAGA 1N25A 3UR3C 2R7OA 2E19A 3LFKA 3HDDA 4ZYHA 2X1CA 2KDZA 4G7OF 2L7MP 1TQPA 3DBLB 2GA2A 3D5RC 4FE7A 1WVRA 4QPOA 3RI4A 2FX0A 2M0CA 1IG7A 4IHWA 4LIVA 3BG9A 1W1WE 3F8NA 3EDPA 1FEXA 4XN3A 3MKLA 4I02A 4OAZA 2IS1A 3IRQA 3DU6A 3E6CC 4DBRA 3QQAA 4PSXA 4X1EA 1P92A 3KEOA 3PNYA 3GYHX 2XHKA 1LVKA 2AXTC 4K2EA 5JLWA 5D5XB 4F3QA 2L9RA 4WWCA 2JWTA 4RAZA 1HOMA 4PFPA 3G1OA 3FXMA 3QAHA 4HAMA 4M9XA 3U9GA 3IP4B 3H3VK 2KISA 4XRMA 1MBGA 3FM5A 3I59B 4KUMA 1VNDA 1ZTRA 3ERMA 3MVPA 4IVNA 5HOOA 3Q9VA 5IP7J 2KQRA 2QQBA 4BDZA 1W0TA 1SVOA 2LY1A 3OL3A 2DMUA 3BZ6A 3R61A 2DA6A 3U21A 1VQLI 1V5FA 2KLOA 3BCAA 2M87A 3BDDA 1DGRM 1T98A 2BY0A 1R5ID 2X9DA 3QP5A 1HW2A 4OU0A 3HRMA 3K6GA 2V1UA 4F7ZA 1QU3A 2M1BA 2XASA 4BY1J 3K4BA 2IXSA 5IP9J 2LKPA 4P9UA 3I4MJ 4IX7A 5D8LB 4E7SA 1A6QA 2KDOA 4L18B 2A07F 4UHTA 1BOBA 2BXZA 4JK1X 2KIFA 1ZR2A 2HDCA 5CVIA 2E5ZA 3BQZA 3L2RA 4BQOA 3CCUI 2PLYA 1S7OA 4KIFA 4PGHA 2R7ZJ 4G7ZF 2BZTA 4S04A 2FBKA 3QYEA 5M3MJ 4XMYA 3SEZA 1GLNA 2L5QA 4A0XA 3CCSI 1FLIA 1MZBA 1V54H 3BR6A 1L3LA 1YI2I 5FLXZ 2ME0A 1U3EM 1G3YA 4ZH4F 1BIAA 1F5TA 1IN7A 2PI0A 4HF1A 2P8TA 3WE3A 2BW3B 1E2XA 4A3IJ 2XKOA 2ESHA 2CWEA 2ISYA 5GAGJ 3VYRB 1YOVB 2IBDA 3LSMA 1I1SA 1S7AA 3WTWC 2HKXA 1D3YA 2XUBA 3DTKA 4BACA 1YX3A 2LH9A 2EA4A 4J19A 5TISC 3WHCA 1SC7A 1CGPA 4ZZDA 4HDVA 2X85A 4EJWA 2LBFA 2XGXA 3B6AA 5J4VA 2F5CA 2L7FP 2F5DA 3COAC 1FBQA 1QBJA 3E1SA 3Q0VA 1A36A 2ZSIB 1FOYA 1W5SA 1WJ5A 1ETOA 2HZTA 3TDZC 1LJ9A 4UNOA 2DFHA 2W57A 4A93J 1ZN2A 1V5GA 2VLAA 2DCEA 3LA3A 1IV8A 2HKOA 3PQJA 1IW7F 3BTLA 1Z91A 2WADA 4XRSA 1ONVA 2K4JA 3WTZA 3JRGA 3VFZA 5ICFA 2K27A 2BXYA 2AO9A 5J6XA 2QVOA 3V7RA 5HODA 4R8HA 5LLQA 2W82A 1IDYA 1JUSA 3M3YJ 2A6TA 4CH7A 4PJLA 2IGMA 1DU6A 3KLOA 3FKJA 4H4KC 3CLQA 1DDNA 5D4RA 3BJ6A 4AM3A 3OMYA 3G73A 5L3FA 3GZ5A 4ESBA 3RIRA 2EV5A 1ON2A 1K78B 4ESJA 1XD7A 2EFPA 2X4HA 3CO7C 4EGZA 1SEUA 5AIPA 3PSFA 2K86A 1QHHD 1DPUA 4A6DA 2W25A 3KP6A 1BBYA 4M3EA 2DDAA 4NBQA 1MMGA 3GTPJ 1UHWA 3HOSA 3TMOA 1MBJA 2FJ1A 2KP6A 2JPCA 5AONA 2CYYA 4Q47A 3GZ6A 1QVTA 2CS3A 3ZQGA 2DA7A 2ECBA 3WGIA 4D7MA 1RR7A 2FBHA 3OYJA 2R0QC 1VQKI 3LSHA 1YJNI 1O3TA 3QPSA 2XF7A 4KICA 2UXNA 5JFRA 5JI6A 1AOYA 5F1RA 1Y8RB 2JVGA 2K85A 3LSIA 4EM2A 4ZYDA 1WJCA 2BE5F 5ICEA 2CQ7A 2DYRH 4AU7A 1RUOA 3OR1C 2CFXA 3KZZA 1U2WA 2FQ3A 5IP6A 2LKXA 2WAEA 3OS1A 5K5OA 4M72A 2M9HA 2IAIA 2KRCA 1EJ9A 2VBWA 2B9SA 3KE2A 1WHUA 1A35A
chains in the Genus database with same CATH topology
3BROA 2M30A 4WXDA 1RI7A 2QUFA 5HS7A 3ZPLA 3FF5A 1FWZA 3GLXA 2L02A 5LRRA 4P9FA 3PQKA 2FSWA 3IRRA 4HBLA 1ZRDA 4FT8A 1U5TA 2JSCA 3HHHA 2VE8A 1R1UA 1XCBA 4A5NA 1J59A 3L7WA 2PMUA 5ERIA 3T1BA 3L2CA 1I1GA 2LF8A 4G6QA 1KYWA 4XLPF 3HHGA 3ZMSA 3KETA 1FYMA 1Q1HA 4ON0A 4G7HF 1SMTA 2VOPA 2F5EA 2DFIA 2A6HF 2OAZA 4ENKA 3ZMUA 2QZ8A 4Y13A 4PDKA 3QOPA 2Y0MA 3T5XA 5D8KB 1R58A 4L9VA 2FMYA 2ADUA 2JPBA 5H20A 3TO9A 2D45A 2R7DA 5CVRA 2FOKA 5D6EA 1G3SA 2OQGA 4KN4X 3R0AA 1FYKA 2DI3A 2HTJA 2YSRA 4HF0A 3FM3A 2RN7A 3RKWA 4G9YA 5ILSA 2DT5A 4WXCA 4OIRF 1O7LA 5LEJA 3I0TA 3GVAA 4DQ2A 4AD9A 4L9NA 3EETA 3RKYA 4LB6B 1JHHA 4O6JA 3V4GA 3F8BA 1R5HA 3J81Z 2JT1A 2Z99A 4LGWA 4YIIA 1YFHA 1CF7A 2VOOA 4S05A 1P4WA 3ZN0A 2K4BA 3KLNA 3GXOA 1ZYRF 1KQ9A 3FX3A 3KP5A 4BNCA 1SD7A 1ZH5A 1LEAA 5DD4A 4KIGA 2FEZA 2GWRA 1IN8A 2RNJA 2R3SA 4RGXA 1SD6A 1JGSA 5TRDA 3C1DA 3K1PA 5J8FA 1ZG1A 1XSVA 4WCGA 2ZO4A 2QQAA 2P5KA 1O57A 4OMYA 1HKQA 1KQ0A 3RKXA 3IHUA 3KP7A 1O7FA 2EFQA 1PUEE 1K79A 2H09A 3J81K 4U88A 3F23A 1XGSA 3HTSB 1S8NA 3KFWX 2H6CA 2WV0A 5DDGA 1J75A 1FOKA 2O3FA 4EJVA 1LVAA 1OYYA 4XBFA 2A61A 5KVRA 6PAXA 4M9SA 4BHBA 3O3KA 3C18A 1P4XA 2X0LA 1T6SA 3P9KA 3LWFA 3I71A 1K6OA 1ZLKA 2OQRA 2LF7A 1XMKA 1KYZA 2G7UA 3IWFA 4HX4A 4HQEA 3F21A 4BXUA 4BHPA 3IKVA 1KU7A 2BGCA 3DP7A 1BI1A 3CJNA 5D5WB 2QBYA 1OMIA 5H6QA 3VB2A 3N97A 2DQRA 4B09A 4N9IA 5A2QZ 1BJAA 1MJ9A 3TOBA 3IWZA 5TJJA 1OR7A 4KDPA 1OKRA 3E5UA 3SZTA 4NHJA 2W24A 1LDJA 4MGRA 1T2KA 1GHCA 4IRIA 2QYOA 2RQPA 2A5YB 2O0YA 5F64A 3F6VA 3FMSA 2HQRA 2Z9OA 4LG0A 2XV4S 3MZHA 2NRAC 5LHHA 1WSUA 1J0RA 5CJ9A 4PCQA 2VXZA 3RYRA 2CQKA 1H0MA 4ZYGA 3NQOA 1HW5A 3CUQA 2J5PA 1IZ1A 2UXXA 2EJRA 1LB2A 4LLNA 1IAWA 4KIBA 5CLSA 1KU2A 5A2QK 4OIQF 3D5LA 2Z5UA 2H27A 1QNTA 1TQMA 4R1HA 4L5IA 4D0PA 3HSRA 1RZ4A 3DPLC 1O3SA 4MEYF 1I27A 5LGUA 3E3VA 2IRFG 3R4KA 1Z7UA 3QPTA 3G3ZA 3SZPA 1G4DA 3WGHA 2AXLA 5E1WA 5ED4A 4M73A 3WTSC 2XAQA 3DQVC 1HKTA 3CLOA 1R22A 3QU3A 1U5TC 1U5TB 4E70A 3L9FA 3WE2A 3E6MA 1XSDA 2B0LA 5KK1A 2P7CB 3K69A 3RJPA 1YLFA 1FSEA 3HSEA 3OV8A 2ACJA 2HYFA 4RGSA 2ESNA 3RPQA 3AAFA 4XLNF 1FNNA 2ZMEB 5D6FA 2EV6A 2EV0A 2L4MA 1TNSA 3HRTA 4HLXA 2W85A 4LD5A 4IRGA 3MEXA 3GFMA 3DFGA 5CVJA 1OYIA 1HBXG 1O3QA 5E8IA 2VODA 4IPAA 3KP4A 1SFXA 1XSXA 4A12A 4BH9A 3MCZA 5L3BA 2VE9A 2IT0A 1BC8C 4U0VA 1FP2A 1XGOA 4EQQA 2H6BA 5BPIA 4ETSA 3GW2A 3BPVA 3H3UA 2DK5A 3ZP5A 3MAJA 3EQLF 4KT5C 2MBFA 3B73A 1LEBA 1J9IA 3DV8A 1DPRA 2JTVA 1D8JA 3O6BB 2G7HA 2EFOA 2PMHA 3GFJA 5DYMA 3QU6A 1O3RA 1T0FA 1WRJA 1R1VA 2DPUA 1CF7B 4R79A 3GX4X 4CYDA 4ENMA 3O2PE 2ETHA 2BBYA 3WTUC 3OOPA 4P96A 1K7AA 4ZZLA 3HIFA 4FX0A 2DAOA 4EM0B 1TBXA 3BP8A 3F8CA 4A2UA 3K9TA 4G6DA 3WG9A 4HA8A 5K5QA 4LMYA 5LRSA 2RVCA 5K5RA 3EYIA 3WTYC 4A0ZA 2LDUA 2L54A 2QM3A 3WU1B 2E7WA 2MH2A 4FX4A 1LDKB 3E6DA 2DPDA 1WKMA 3ULQB 1G3WA 1PP8F 2FU4A 4H0EA 5IT3A 4G8XA 4QLCU 1TQIA 4U7DA 5LEKA 3HUGA 4CDGA 3H92A 3TGNA 2EB7A 2EFWA 4RB3C 5JR3A 3TDUC 1YW9A 4HZFA 2G9WA 3BOQA 3HTUA 2Y75A 1MJAA 4WXHA 2BEOA 2W84A 1QZZA 2RGVA 4YFNF 3HYIA 4WK8F 3VOEA 2XROA 3NEUA 3IC7A 2CGPA 1FPQA 1IUYA 2DU9A 2Z33A 5BMZA 2GIVA 5LGTA 2KIUA 3REOA 2GQQA 4G94A 1T39A 1W7PB 3CDHA 3LA7A 1MD0A 1FYLA 5HLGA 2QBYB 2STTA 2MLKA 1FBSA 3F6OA 3FZVA 2DK8A 4EMSA 3JAMZ 3F3XA 3ZMDA 3I53A 2HOEA 4I0BA 2RDPA 2OA4A 3ABUA 3CTAA 5CYVA 2L4AA 1R36A 2Q0OA 5BQTA 2ZMEA 1I6XA 4LFUA 3M7GA 4UV8A 3N4MA 2P5VA 3T8RA 2A3SA 1KQ8A 5CVVA 3MFKA 1YQAA 5K1YA 1JHFA 3RPUA 1U6GA 4LG0B 3E97A 3WODF 5HDNA 3JSOA 1Y0UA 4ZYEA 5L3DA 4MQ9F 4JQFA 3ABTA 2NNNA 4U7BA 5DUKA 2ISZA 1ZHFA 1QPMA 3FXQA 2IP2A 2IA1A 3ISPA 2EK5A 3CUQC 3CUQB 2HGCA 1UHMA 2KJCA 1SAXA 1YYVA 4N9HA 4IHTA 3FMQA 1YW7A 2E1CA 1UFMA 3JAMK 1ULYA 2FNPA 1RUNA 4I7HA 1IRFA 2XAJA 3F22A 1QGPA 2QLZA 1TW3A 3V8KA 3DEUA 1F1ZA 5E1ZB 1OYWA 4U0WA 1ZAOA 1RNLA 1FZPB 3HOTA 3QRFF 4UV9A 1H9TA 3SXYA 2HFHA 2KRFA 1X3UA 1S3JA 1SFEA 1KA8A 2VT2A 1TNTA 3Q9SA 4NB5A 4NQWA 1J5YA 4XSXF 5ILVA 4ASNA 2V6CA 1IRGA 3C7JA 4CGZA 5FD6A 4IRHA 2VBYA 4M71A 1LQ1A 3EYYA 1WI9A 4HW0A 5HS9A 1HKSA 2J5OA 3WTVC 1SD4A 4L0ZB 4KYWA 1EH6A 2UWMA 1W7PD 4LJZF 4OIPF 1B1BA 4GCVA 4XSZF 1ZG5A 1BC7C 5HDKA 2CSOA 1F4KA 2V1XA 2HWVA 4OOIA 3LAPA 1KGSA 3KEQA 3TO7A 4M6XA 1TLHB 3I64A 4OINF 1SD5A 3ZMTA 2QQ9A 1R5GA 4M6YA 4UXNA 1T38A 2NNYA 1KU9A 1BI2A 5ILUA 4XRFA 1GXPA 2D2WA 1G3TA 2OD5A 3DPTA 3W6JB 2MD5A 2HEOA 5BOXA 4EGYA 1QQIA 4QWQA 1H9GA 3SHFA 3E6BA 2Q8KA 5L3EA 1W7PA 5E18F 1EV7A 1IXSB 1ZRFA 4KNYA 3ML6A 1AWCA 2V1DA 2M5WA 4IJAA 1IXRC 4A5MA 5HS8A 1Z6TA 3J7AO 3JSPA 1XB4A 4BYYA 4MQVA 4O3MA 3I5UA 4MTEA 1LNWA 3F72A 5D5UB 4AWXB 4HV5A 4Y15A 1HW1A 3JW4A 5HVQC 5AIQA 2FE3A 4Q48A 1U8RA 2PN6A 4RB2C 1FX7A 2P7VB 3RYPA 1FBUA 2FXAA 3PFIA 4HYEA 1GXQA 3IKTA 5E8GA 2XAHA 1D8KA 2JZYA 1XDUA 1UCRA 3M8FA 2L3DA 2XKPA 2F5FA 2VN2A 2PQ8A 4O5VA 4HQMA 4I0AA 3ECHA 2GXGA 3K0LA 2K7LA 3BJOA 1B9MA 2KIMA 3V8JA 1REPC 2PEXA 3I58A 2IJLA 3W6KB 2HR3A 2EFNA 2EA2A 1S6LA 2C6YA 4CZZA 1S29A 1XCVA 5H6RA 5LHIA 4OIOF 2DBBA 2IA0A 5E17F 4GXOA 4UVBA 2O03A 2IVMA 3BY6A 4BAYA 1R00A 4DNCA 4MTDA 3D0SA 3LA2A 1STZA 5DV5A 3ELKA 1YS6A 2M45A 4HDUA 4RB0A 4CHUA 2ZMEC 1BI0A 5DEQA 2HTSA 1YG2A 5JHUA 5DUIA 5DCMA 3MQ0A 2JRTA 2HYGD 2M8EA 4Y17A 2ZCWA 1BN5A 4Q5SF 2ZFWA 1V4RA 4M9ZA 4GYGA 2YPRA 4EVIA 3ZMZA 3FXUA 3S2WA 1DP7P 1HQCA 2E7XA 3Q5FA 3K2ZA 2DO7A 3V7CA 1VTNC 1FY7A 5BS6A 2FNAA 2ZNZA 2RC4A 1SFUA 1YS7A 1QZYA 4GYIA 2V9VA 2DQLA 5LBQA 4AIKA 2PBIA 2P5LC 4Z2YA 3DKWA 1ZRCA 3U1DA 1YIOA 2VT3A 4EJUA 4EV0A 2K02A 1ZREA 2ZBKA 3RTRA 4WF2A 1IXCA 1G6NA 1R1TA 4AVPA 2YR2A 2YX4A 1MKMA 3H3ZA 2GXBA 4JBAA 2KJBA 3I4PA 3EUHA 3ECOA 2MC3A 3FXRA 1FSHA 5HLIA 4EJOA 1P6RA 3WTXC 4KA4A 1P2FA 5FLXK 2VC0A 1ON1A 2RV8A 2BYVE 4M74A 3ERED 1BOAA 1PP7U 1XDSA 1MDMA 5J8CA 4RAYA 2VBZA 5CVUA 2LSOA 5FFZA 2CG4A 1JE8A 1XN7A 2BV6A 3MZYA 3NRVA 2MH9A 3VODA 1ZGAA 1Z05A 4UVCA 3M8EA 4KMUX 5ICGA 4LK1F 1ZG3A 2F2EA 4TV7A 4L0YB 1B6AA 1RIOH 3GF2A 1J7KA 1DUXC 1B4AA 1BM9A 3VEPA 4IF4A 1XGMA 3WGGA 2XVCA 5BPDA 1XGNA 2VC1A 4GGGA 2V79A 4Q4ZF 5FD5A 3F8MA 2ZJ2A 3LQRA 3P7NA 2DLLA 4A0YA 1BIBA 3QP6A 1TTYA 4HV6A 4A6EA 2FA5A 1W5TA 1ZGJA 1A04A 1YTYA 4PGGA 3IL2A 2OBPA 1LDDA 2QENA 3J80Z 3WU0A 3LAJA 4I2OA 1HXDA 5L3CA 3KP3A 1USSA 5FGMA 2Q2EA 5DD8A 4BQAA 2QWWA 3I59A 4HF2A 4HX8A 4KN7X 4RS8A 5LHGA 2AS5F 4I09A 4RGUA 1W4MA 2GZWA 1U78A 4CICA 2D1VA 4CO8A 1V3FA 1B9NA 2GA1A 1MGTA 4YFKF 2A6EF 4ENNA 2NYXA 3GFLA 1FP1D 3V7SA 4EM1A 3K1MA 1P4AA 1ZLJA 3ZQ7A 4B8XA 3DXJF 2YU3A 3MWMA 4HX7A 1PDNC 3GFIA 5ICCA 4WX9A 4BHCA 1KU3A 2TDXA 3FMRA 2STWA 2EWNA 3ROUA 3HSFA 3BJAA 2IA2A 2FRHA 2O61A 3JTGA 3J80K 2PG4A 2A68F 1USTA 3JTHA 4LLGF 3T8TA 1BI3A 1HSJA 2DW4A 1E17A 1I5ZA 2IPQX 4GO1A 3RDIA 3WTTC 4L9TA 1NHAA 4N0BA 3TQNA 2CO5A 5D5VB 5LGNA 4LB5A 3FHZA 3F8FA 3P9IA 4LK0F 3R0JA 1OPCA 3GO5A 2RKHA 3E5QA 3I54A 2D1HA 4PZJA 2FMLA 2FF4A 2ZKZA 3GWZA 4LLLA 1IF1A 2VONA 5FO5A 2MA3A 3T0YA 3CUOA 2HQNA 3LSTA 4L9JA 3FWEA 5E1XA 5HDGA 3U2RA 1FC3A 3HRSA 1K78A 2P6SA 2DTRA 3C3WA 4HLYA 1MJBA 2WC2A 1WQ2A 3M1EA 2WWYA 4IHSA 4ESFA 3SQNA 5DCMB 2OU2A 3SFZA 2MLGA 4ENJA 5IT9Z 1XMAA 3QPHA 1IN6A 2H94A 2YX7A 3KP2A 1TW2A 2Z3YA 5E20A 2XAFA 1UB9A 3B02A 3TKYA 3R6SA 4KFCA 2WTEA 2LNBA 4IXAA 5FFXA 1F9NA 4UUVA 2PJPA 1EH7A 4KMFA 2L01A 4MNUA 1Z6RA 1C0WA 1IN4A 3KCCA 2GAUA 1B59A 4OMZA 3L09A 3GUDA 4P55A 3P9CA 4MEXF 2FBIA 5EEGA 1WWXA 1HSTA 2IW5A 3TOAA 1SMYF 2OZUA 2XRNA 2NAZA 1YW8A 3E5XA 2KKOA 2O8XA 4YFXF 2ELHA 2Y48A 3R60A 1R23A 5JVTA 4U0YA 4CXFA 2P4WA 4UVAA 4I98B 4RGRA 1Z9CA 2UZKA 3GEZA 1D5VA 5IT9K 1EH8A 2HS5A 4L5JA 2CW0F 5F6FA 1ODDA 3BPXA 3HRUA 4AIHA 3LQQA 3TO6A 1ZARA 4RB1A 3CO6C 4P5OA 2P6TA 2ZXJA 3ZMVA 2VBXA 2O6GE 2OZ6A 4HOBA 1J2XA 2NS0A 5HLHA 5FB2A 4EJTA 2A69F 3ZN1A 2ZNYA 3KZYA 4YG2F 1MDMB 1R7JA 4I01A 2XIGA 1Z1DA 1IN5A 5EEHA 2E1NA 4YIFA 1JXSA 1GVJA 3V8LA 4AIJA 4FHTA 5D4SA 2PFBA 3BWGA 3K1NA 1YO5C 1QO0D 3M9AA 2COMA 1FT9A 5DCFA 1L0OC 5L3GA 4MHGA 2R7FA 3L00A 3DF8A 2XAGA 3LFKA 4ZYHA 4G7OF 1TQPA 2GA2A 3RI4A 3F8NA 3EDPA 4I02A 3IRQA 3E6CC 3GYHX 1P92A 3KEOA 2XHKA 4K2EA 5D5XB 4WWCA 4RAZA 3QAHA 4HAMA 4M9XA 3U9GA 3FM5A 3I59B 4KUMA 4IVNA 5HOOA 3Q9VA 2QQBA 3BZ6A 3R61A 2M87A 3BDDA 1T98A 3QP5A 1HW2A 4OU0A 3HRMA 2V1UA 4F7ZA 2M1BA 2XASA 2LKPA 4P9UA 5D8LB 4L18B 2A07F 4UHTA 4JK1X 2KIFA 2HDCA 5CVIA 2PLYA 1S7OA 4KIFA 4PGHA 4G7ZF 4S04A 2FBKA 4A0XA 1FLIA 1MZBA 1L3LA 5FLXZ 1U3EM 1G3YA 4ZH4F 1BIAA 1F5TA 1IN7A 2PI0A 4HF1A 2P8TA 3WE3A 1E2XA 2XKOA 2ESHA 2CWEA 2ISYA 1I1SA 1S7AA 3WTWC 2HKXA 1D3YA 2XUBA 2EA4A 1CGPA 4ZZDA 4HDVA 4EJWA 2XGXA 2F5CA 2F5DA 3COAC 1FBQA 1QBJA 1W5SA 2HZTA 3TDZC 1LJ9A 4UNOA 2W57A 1ZN2A 3LA3A 2HKOA 3PQJA 1IW7F 1Z91A 1ONVA 2K4JA 3WTZA 3VFZA 5ICFA 2K27A 5J6XA 2QVOA 3V7RA 4R8HA 5LLQA 3KLOA 1DDNA 5D4RA 3BJ6A 3G73A 5L3FA 3GZ5A 4ESBA 3RIRA 2EV5A 1ON2A 1K78B 4ESJA 1XD7A 2EFPA 4EGZA 2X4HA 3CO7C 5AIPA 2K86A 1DPUA 4A6DA 2W25A 3KP6A 1BBYA 1UHWA 3HOSA 2JPCA 5AONA 2CYYA 4Q47A 3GZ6A 3WGIA 2FBHA 1O3TA 4KICA 2UXNA 5JFRA 5JI6A 1AOYA 5F1RA 4EM2A 4ZYDA 2BE5F 5ICEA 1RUOA 2CFXA 3KZZA 1U2WA 2FQ3A 5K5OA 4M72A 2VBWA 3KE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BRO A;  2M30 A;  4WXD A;  1RI7 A;  2QUF A;  5HS7 A;  3ZPL A;  3FF5 A;  1FWZ A;  3GLX A;  2L02 A;  5LRR A;  4P9F A;  3PQK A;  2FSW A;  3IRR A;  4HBL A;  1ZRD A;  4FT8 A;  1U5T A;  2JSC A;  3HHH A;  2VE8 A;  1R1U A;  1XCB A;  4A5N A;  1J59 A;  3L7W A;  2PMU A;  5ERI A;  3T1B A;  3L2C A;  1I1G A;  2LF8 A;  4G6Q A;  1KYW A;  4XLP F;  3HHG A;  3ZMS A;  3KET A;  1FYM A;  1Q1H A;  4ON0 A;  4G7H F;  1SMT A;  2VOP A;  2F5E A;  2DFI A;  2A6H F;  2OAZ A;  4ENK A;  3ZMU A;  2QZ8 A;  4Y13 A;  4PDK A;  3QOP A;  2Y0M A;  3T5X A;  5D8K B;  1R58 A;  4L9V A;  2FMY A;  2ADU A;  2JPB A;  5H20 A;  3TO9 A;  2D45 A;  2R7D A;  5CVR A;  2FOK A;  5D6E A;  1G3S A;  2OQG A;  4KN4 X;  3R0A A;  1FYK A;  2DI3 A;  2HTJ A;  2YSR A;  4HF0 A;  3FM3 A;  2RN7 A;  3RKW A;  4G9Y A;  5ILS A;  2DT5 A;  4WXC A;  4OIR F;  1O7L A;  5LEJ A;  3I0T A;  3GVA A;  4DQ2 A;  4AD9 A;  4L9N A;  3EET A;  3RKY A;  4LB6 B;  1JHH A;  4O6J A;  3V4G A;  3F8B A;  1R5H A;  3J81 Z;  2JT1 A;  2Z99 A;  4LGW A;  4YII A;  1YFH A;  1CF7 A;  2VOO A;  4S05 A;  1P4W A;  3ZN0 A;  2K4B A;  3KLN A;  3GXO A;  1ZYR F;  1KQ9 A;  3FX3 A;  3KP5 A;  4BNC A;  1SD7 A;  1ZH5 A;  1LEA A;  5DD4 A;  4KIG A;  2FEZ A;  2GWR A;  1IN8 A;  2RNJ A;  2R3S A;  4RGX A;  1SD6 A;  1JGS A;  5TRD A;  3C1D A;  3K1P A;  5J8F A;  1ZG1 A;  1XSV A;  4WCG A;  2ZO4 A;  2QQA A;  2P5K A;  1O57 A;  4OMY A;  1HKQ A;  1KQ0 A;  3RKX A;  3IHU A;  3KP7 A;  1O7F A;  2EFQ A;  1PUE E;  1K79 A;  2H09 A;  3J81 K;  4U88 A;  3F23 A;  1XGS A;  3HTS B;  1S8N A;  3KFW X;  2H6C A;  2WV0 A;  5DDG A;  1J75 A;  1FOK A;  2O3F A;  4EJV A;  1LVA A;  1OYY A;  4XBF A;  2A61 A;  5KVR A;  6PAX A;  4M9S A;  4BHB A;  3O3K A;  3C18 A;  1P4X A;  2X0L A;  1T6S A;  3P9K A;  3LWF A;  3I71 A;  1K6O A;  1ZLK A;  2OQR A;  2LF7 A;  1XMK A;  1KYZ A;  2G7U A;  3IWF A;  4HX4 A;  4HQE A;  3F21 A;  4BXU A;  4BHP A;  3IKV A;  1KU7 A;  2BGC A;  3DP7 A;  1BI1 A;  3CJN A;  5D5W B;  2QBY A;  1OMI A;  5H6Q A;  3VB2 A;  3N97 A;  2DQR A;  4B09 A;  4N9I A;  5A2Q Z;  1BJA A;  1MJ9 A;  3TOB A;  3IWZ A;  5TJJ A;  1OR7 A;  4KDP A;  1OKR A;  3E5U A;  3SZT A;  4NHJ A;  2W24 A;  1LDJ A;  4MGR A;  1T2K A;  1GHC A;  4IRI A;  2QYO A;  2RQP A;  2A5Y B;  2O0Y A;  5F64 A;  3F6V A;  3FMS A;  2HQR A;  2Z9O A;  4LG0 A;  2XV4 S;  3MZH A;  2NRA C;  5LHH A;  1WSU A;  1J0R A;  5CJ9 A;  4PCQ A;  2VXZ A;  3RYR A;  2CQK A;  1H0M A;  4ZYG A;  3NQO A;  1HW5 A;  3CUQ A;  2J5P A;  1IZ1 A;  2UXX A;  2EJR A;  1LB2 A;  4LLN A;  1IAW A;  4KIB A;  5CLS A;  1KU2 A;  5A2Q K;  4OIQ F;  3D5L A;  2Z5U A;  2H27 A;  1QNT A;  1TQM A;  4R1H A;  4L5I A;  4D0P A;  3HSR A;  1RZ4 A;  3DPL C;  1O3S A;  4MEY F;  1I27 A;  5LGU A;  3E3V A;  2IRF G;  3R4K A;  1Z7U A;  3QPT A;  3G3Z A;  3SZP A;  1G4D A;  3WGH A;  2AXL A;  5E1W A;  5ED4 A;  4M73 A;  3WTS C;  2XAQ A;  3DQV C;  1HKT A;  3CLO A;  1R22 A;  3QU3 A;  1U5T C;  1U5T B;  4E70 A;  3L9F A;  3WE2 A;  3E6M A;  1XSD A;  2B0L A;  5KK1 A;  2P7C B;  3K69 A;  3RJP A;  1YLF A;  1FSE A;  3HSE A;  3OV8 A;  2ACJ A;  2HYF A;  4RGS A;  2ESN A;  3RPQ A;  3AAF A;  4XLN F;  1FNN A;  2ZME B;  5D6F A;  2EV6 A;  2EV0 A;  2L4M A;  1TNS A;  3HRT A;  4HLX A;  2W85 A;  4LD5 A;  4IRG A;  3MEX A;  3GFM A;  3DFG A;  5CVJ A;  1OYI A;  1HBX G;  1O3Q A;  5E8I A;  2VOD A;  4IPA A;  3KP4 A;  1SFX A;  1XSX A;  4A12 A;  4BH9 A;  3MCZ A;  5L3B A;  2VE9 A;  2IT0 A;  1BC8 C;  4U0V A;  1FP2 A;  1XGO A;  4EQQ A;  2H6B A;  5BPI A;  4ETS A;  3GW2 A;  3BPV A;  3H3U A;  2DK5 A;  3ZP5 A;  3MAJ A;  3EQL F;  4KT5 C;  2MBF A;  3B73 A;  1LEB A;  1J9I A;  3DV8 A;  1DPR A;  2JTV A;  1D8J A;  3O6B B;  2G7H A;  2EFO A;  2PMH A;  3GFJ A;  5DYM A;  3QU6 A;  1O3R A;  1T0F A;  1WRJ A;  1R1V A;  2DPU A;  1CF7 B;  4R79 A;  3GX4 X;  4CYD A;  4ENM A;  3O2P E;  2ETH A;  2BBY A;  3WTU C;  3OOP A;  4P96 A;  1K7A A;  4ZZL A;  3HIF A;  4FX0 A;  2DAO A;  4EM0 B;  1TBX A;  3BP8 A;  3F8C A;  4A2U A;  3K9T A;  4G6D A;  3WG9 A;  4HA8 A;  5K5Q A;  4LMY A;  5LRS A;  2RVC A;  5K5R A;  3EYI A;  3WTY C;  4A0Z A;  2LDU A;  2L54 A;  2QM3 A;  3WU1 B;  2E7W A;  2MH2 A;  4FX4 A;  1LDK B;  3E6D A;  2DPD A;  1WKM A;  3ULQ B;  1G3W A;  1PP8 F;  2FU4 A;  4H0E A;  5IT3 A;  4G8X A;  4QLC U;  1TQI A;  4U7D A;  5LEK A;  3HUG A;  4CDG A;  3H92 A;  3TGN A;  2EB7 A;  2EFW A;  4RB3 C;  5JR3 A;  3TDU C;  1YW9 A;  4HZF A;  2G9W A;  3BOQ A;  3HTU A;  2Y75 A;  1MJA A;  4WXH A;  2BEO A;  2W84 A;  1QZZ A;  2RGV A;  4YFN F;  3HYI A;  4WK8 F;  3VOE A;  2XRO A;  3NEU A;  3IC7 A;  2CGP A;  1FPQ A;  1IUY A;  2DU9 A;  2Z33 A;  5BMZ A;  2GIV A;  5LGT A;  2KIU A;  3REO A;  2GQQ A;  4G94 A;  1T39 A;  1W7P B;  3CDH A;  3LA7 A;  1MD0 A;  1FYL A;  5HLG A;  2QBY B;  2STT A;  2MLK A;  1FBS A;  3F6O A;  3FZV A;  2DK8 A;  4EMS A;  3JAM Z;  3F3X A;  3ZMD A;  3I53 A;  2HOE A;  4I0B A;  2RDP A;  2OA4 A;  3ABU A;  3CTA A;  5CYV A;  2L4A A;  1R36 A;  2Q0O A;  5BQT A;  2ZME A;  1I6X A;  4LFU A;  3M7G A;  4UV8 A;  3N4M A;  2P5V A;  3T8R A;  2A3S A;  1KQ8 A;  5CVV A;  3MFK A;  1YQA A;  5K1Y A;  1JHF A;  3RPU A;  1U6G A;  4LG0 B;  3E97 A;  3WOD F;  5HDN A;  3JSO A;  1Y0U A;  4ZYE A;  5L3D A;  4MQ9 F;  4JQF A;  3ABT A;  2NNN A;  4U7B A;  5DUK A;  2ISZ A;  1ZHF A;  1QPM A;  3FXQ A;  2IP2 A;  2IA1 A;  3ISP A;  2EK5 A;  3CUQ C;  3CUQ B;  2HGC A;  1UHM A;  2KJC A;  1SAX A;  1YYV A;  4N9H A;  4IHT A;  3FMQ A;  1YW7 A;  2E1C A;  1UFM A;  3JAM K;  1ULY A;  2FNP A;  1RUN A;  4I7H A;  1IRF A;  2XAJ A;  3F22 A;  1QGP A;  2QLZ A;  1TW3 A;  3V8K A;  3DEU A;  1F1Z A;  5E1Z B;  1OYW A;  4U0W A;  1ZAO A;  1RNL A;  1FZP B;  3HOT A;  3QRF F;  4UV9 A;  1H9T A;  3SXY A;  2HFH A;  2KRF A;  1X3U A;  1S3J A;  1SFE A;  1KA8 A;  2VT2 A;  1TNT A;  3Q9S A;  4NB5 A;  4NQW A;  1J5Y A;  4XSX F;  5ILV A;  4ASN A;  2V6C A;  1IRG A;  3C7J A;  4CGZ A;  5FD6 A;  4IRH A;  2VBY A;  4M71 A;  1LQ1 A;  3EYY A;  1WI9 A;  4HW0 A;  5HS9 A;  1HKS A;  2J5O A;  3WTV C;  1SD4 A;  4L0Z B;  4KYW A;  1EH6 A;  2UWM A;  1W7P D;  4LJZ F;  4OIP F;  1B1B A;  4GCV A;  4XSZ F;  1ZG5 A;  1BC7 C;  5HDK A;  2CSO A;  1F4K A;  2V1X A;  2HWV A;  4OOI A;  3LAP A;  1KGS A;  3KEQ A;  3TO7 A;  4M6X A;  1TLH B;  3I64 A;  4OIN F;  1SD5 A;  3ZMT A;  2QQ9 A;  1R5G A;  4M6Y A;  4UXN A;  1T38 A;  2NNY A;  1KU9 A;  1BI2 A;  5ILU A;  4XRF A;  1GXP A;  2D2W A;  1G3T A;  2OD5 A;  3DPT A;  3W6J B;  2MD5 A;  2HEO A;  5BOX A;  4EGY A;  1QQI A;  4QWQ A;  1H9G A;  3SHF A;  3E6B A;  2Q8K A;  5L3E A;  1W7P A;  5E18 F;  1EV7 A;  1IXS B;  1ZRF A;  4KNY A;  3ML6 A;  1AWC A;  2V1D A;  2M5W A;  4IJA A;  1IXR C;  4A5M A;  5HS8 A;  1Z6T A;  3J7A O;  3JSP A;  1XB4 A;  4BYY A;  4MQV A;  4O3M A;  3I5U A;  4MTE A;  1LNW A;  3F72 A;  5D5U B;  4AWX B;  4HV5 A;  4Y15 A;  1HW1 A;  3JW4 A;  5HVQ C;  5AIQ A;  2FE3 A;  4Q48 A;  1U8R A;  2PN6 A;  4RB2 C;  1FX7 A;  2P7V B;  3RYP A;  1FBU A;  2FXA A;  3PFI A;  4HYE A;  1GXQ A;  3IKT A;  5E8G A;  2XAH A;  1D8K A;  2JZY A;  1XDU A;  1UCR A;  3M8F A;  2L3D A;  2XKP A;  2F5F A;  2VN2 A;  2PQ8 A;  4O5V A;  4HQM A;  4I0A A;  3ECH A;  2GXG A;  3K0L A;  2K7L A;  3BJO A;  1B9M A;  2KIM A;  3V8J A;  1REP C;  2PEX A;  3I58 A;  2IJL A;  3W6K B;  2HR3 A;  2EFN A;  2EA2 A;  1S6L A;  2C6Y A;  4CZZ A;  1S29 A;  1XCV A;  5H6R A;  5LHI A;  4OIO F;  2DBB A;  2IA0 A;  5E17 F;  4GXO A;  4UVB A;  2O03 A;  2IVM A;  3BY6 A;  4BAY A;  1R00 A;  4DNC A;  4MTD A;  3D0S A;  3LA2 A;  1STZ A;  5DV5 A;  3ELK A;  1YS6 A;  2M45 A;  4HDU A;  4RB0 A;  4CHU A;  2ZME C;  1BI0 A;  5DEQ A;  2HTS A;  1YG2 A;  5JHU A;  5DUI A;  5DCM A;  3MQ0 A;  2JRT A;  2HYG D;  2M8E A;  4Y17 A;  2ZCW A;  1BN5 A;  4Q5S F;  2ZFW A;  1V4R A;  4M9Z A;  4GYG A;  2YPR A;  4EVI A;  3ZMZ A;  3FXU A;  3S2W A;  1DP7 P;  1HQC A;  2E7X A;  3Q5F A;  3K2Z A;  2DO7 A;  3V7C A;  1VTN C;  1FY7 A;  5BS6 A;  2FNA A;  2ZNZ A;  2RC4 A;  1SFU A;  1YS7 A;  1QZY A;  4GYI A;  2V9V A;  2DQL A;  5LBQ A;  4AIK A;  2PBI A;  2P5L C;  4Z2Y A;  3DKW A;  1ZRC A;  3U1D A;  1YIO A;  2VT3 A;  4EJU A;  4EV0 A;  2K02 A;  1ZRE A;  2ZBK A;  3RTR A;  4WF2 A;  1IXC A;  1G6N A;  1R1T A;  4AVP A;  2YR2 A;  2YX4 A;  1MKM A;  3H3Z A;  2GXB A;  4JBA A;  2KJB A;  3I4P A;  3EUH A;  3ECO A;  2MC3 A;  3FXR A;  1FSH A;  5HLI A;  4EJO A;  1P6R A;  3WTX C;  4KA4 A;  1P2F A;  5FLX K;  2VC0 A;  1ON1 A;  2RV8 A;  2BYV E;  4M74 A;  3ERE D;  1BOA A;  1PP7 U;  1XDS A;  1MDM A;  5J8C A;  4RAY A;  2VBZ A;  5CVU A;  2LSO A;  5FFZ A;  2CG4 A;  1JE8 A;  1XN7 A;  2BV6 A;  3MZY A;  3NRV A;  2MH9 A;  3VOD A;  1ZGA A;  1Z05 A;  4UVC A;  3M8E A;  4KMU X;  5ICG A;  4LK1 F;  1ZG3 A;  2F2E A;  4TV7 A;  4L0Y B;  1B6A A;  1RIO H;  3GF2 A;  1J7K A;  1DUX C;  1B4A A;  1BM9 A;  3VEP A;  4IF4 A;  1XGM A;  3WGG A;  2XVC A;  5BPD A;  1XGN A;  2VC1 A;  4GGG A;  2V79 A;  4Q4Z F;  5FD5 A;  3F8M A;  2ZJ2 A;  3LQR A;  3P7N A;  2DLL A;  4A0Y A;  1BIB A;  3QP6 A;  1TTY A;  4HV6 A;  4A6E A;  2FA5 A;  1W5T A;  1ZGJ A;  1A04 A;  1YTY A;  4PGG A;  3IL2 A;  2OBP A;  1LDD A;  2QEN A;  3J80 Z;  3WU0 A;  3LAJ A;  4I2O A;  1HXD A;  5L3C A;  3KP3 A;  1USS A;  5FGM A;  2Q2E A;  5DD8 A;  4BQA A;  2QWW A;  3I59 A;  4HF2 A;  4HX8 A;  4KN7 X;  4RS8 A;  5LHG A;  2AS5 F;  4I09 A;  4RGU A;  1W4M A;  2GZW A;  1U78 A;  4CIC A;  2D1V A;  4CO8 A;  1V3F A;  1B9N A;  2GA1 A;  1MGT A;  4YFK F;  2A6E F;  4ENN A;  2NYX A;  3GFL A;  1FP1 D;  3V7S A;  4EM1 A;  3K1M A;  1P4A A;  1ZLJ A;  3ZQ7 A;  4B8X A;  3DXJ F;  2YU3 A;  3MWM A;  4HX7 A;  1PDN C;  3GFI A;  5ICC A;  4WX9 A;  4BHC A;  1KU3 A;  2TDX A;  3FMR A;  2STW A;  2EWN A;  3ROU A;  3HSF A;  3BJA A;  2IA2 A;  2FRH A;  2O61 A;  3JTG A;  3J80 K;  2PG4 A;  2A68 F;  1UST A;  3JTH A;  4LLG F;  3T8T A;  1BI3 A;  1HSJ A;  2DW4 A;  1E17 A;  1I5Z A;  2IPQ X;  4GO1 A;  3RDI A;  3WTT C;  4L9T A;  1NHA A;  4N0B A;  3TQN A;  2CO5 A;  5D5V B;  5LGN A;  4LB5 A;  3FHZ A;  3F8F A;  3P9I A;  4LK0 F;  3R0J A;  1OPC A;  3GO5 A;  2RKH A;  3E5Q A;  3I54 A;  2D1H A;  4PZJ A;  2FML A;  2FF4 A;  2ZKZ A;  3GWZ A;  4LLL A;  1IF1 A;  2VON A;  5FO5 A;  2MA3 A;  3T0Y A;  3CUO A;  2HQN A;  3LST A;  4L9J A;  3FWE A;  5E1X A;  5HDG A;  3U2R A;  1FC3 A;  3HRS A;  1K78 A;  2P6S A;  2DTR A;  3C3W A;  4HLY A;  1MJB A;  2WC2 A;  1WQ2 A;  3M1E A;  2WWY A;  4IHS A;  4ESF A;  3SQN A;  5DCM B;  2OU2 A;  3SFZ A;  2MLG A;  4ENJ A;  5IT9 Z;  1XMA A;  3QPH A;  1IN6 A;  2H94 A;  2YX7 A;  3KP2 A;  1TW2 A;  2Z3Y A;  5E20 A;  2XAF A;  1UB9 A;  3B02 A;  3TKY A;  3R6S A;  4KFC A;  2WTE A;  2LNB A;  4IXA A;  5FFX A;  1F9N A;  4UUV A;  2PJP A;  1EH7 A;  4KMF A;  2L01 A;  4MNU A;  1Z6R A;  1C0W A;  1IN4 A;  3KCC A;  2GAU A;  1B59 A;  4OMZ A;  3L09 A;  3GUD A;  4P55 A;  3P9C A;  4MEX F;  2FBI A;  5EEG A;  1WWX A;  1HST A;  2IW5 A;  3TOA A;  1SMY F;  2OZU A;  2XRN A;  2NAZ A;  1YW8 A;  3E5X A;  2KKO A;  2O8X A;  4YFX F;  2ELH A;  2Y48 A;  3R60 A;  1R23 A;  5JVT A;  4U0Y A;  4CXF A;  2P4W A;  4UVA A;  4I98 B;  4RGR A;  1Z9C A;  2UZK A;  3GEZ A;  1D5V A;  5IT9 K;  1EH8 A;  2HS5 A;  4L5J A;  2CW0 F;  5F6F A;  1ODD A;  3BPX A;  3HRU A;  4AIH A;  3LQQ A;  3TO6 A;  1ZAR A;  4RB1 A;  3CO6 C;  4P5O A;  2P6T A;  2ZXJ A;  3ZMV A;  2VBX A;  2O6G E;  2OZ6 A;  4HOB A;  1J2X A;  2NS0 A;  5HLH A;  5FB2 A;  4EJT A;  2A69 F;  3ZN1 A;  2ZNY A;  3KZY A;  4YG2 F;  1MDM B;  1R7J A;  4I01 A;  2XIG A;  1Z1D A;  1IN5 A;  5EEH A;  2E1N A;  4YIF A;  1JXS A;  1GVJ A;  3V8L A;  4AIJ A;  4FHT A;  5D4S A;  2PFB A;  3BWG A;  3K1N A;  1YO5 C;  1QO0 D;  3M9A A;  2COM A;  1FT9 A;  5DCF A;  1L0O C;  5L3G A;  4MHG A;  2R7F A;  3L00 A;  3DF8 A;  2XAG A;  3LFK A;  4ZYH A;  4G7O F;  1TQP A;  2GA2 A;  3RI4 A;  3F8N A;  3EDP A;  4I02 A;  3IRQ A;  3E6C C;  3GYH X;  1P92 A;  3KEO A;  2XHK A;  4K2E A;  5D5X B;  4WWC A;  4RAZ A;  3QAH A;  4HAM A;  4M9X A;  3U9G A;  3FM5 A;  3I59 B;  4KUM A;  4IVN A;  5HOO A;  3Q9V A;  2QQB A;  3BZ6 A;  3R61 A;  2M87 A;  3BDD A;  1T98 A;  3QP5 A;  1HW2 A;  4OU0 A;  3HRM A;  2V1U A;  4F7Z A;  2M1B A;  2XAS A;  2LKP A;  4P9U A;  5D8L B;  4L18 B;  2A07 F;  4UHT A;  4JK1 X;  2KIF A;  2HDC A;  5CVI A;  2PLY A;  1S7O A;  4KIF A;  4PGH A;  4G7Z F;  4S04 A;  2FBK A;  4A0X A;  1FLI A;  1MZB A;  1L3L A;  5FLX Z;  1U3E M;  1G3Y A;  4ZH4 F;  1BIA A;  1F5T A;  1IN7 A;  2PI0 A;  4HF1 A;  2P8T A;  3WE3 A;  1E2X A;  2XKO A;  2ESH A;  2CWE A;  2ISY A;  1I1S A;  1S7A A;  3WTW C;  2HKX A;  1D3Y A;  2XUB A;  2EA4 A;  1CGP A;  4ZZD A;  4HDV A;  4EJW A;  2XGX A;  2F5C A;  2F5D A;  3COA C;  1FBQ A;  1QBJ A;  1W5S A;  2HZT A;  3TDZ C;  1LJ9 A;  4UNO A;  2W57 A;  1ZN2 A;  3LA3 A;  2HKO A;  3PQJ A;  1IW7 F;  1Z91 A;  1ONV A;  2K4J A;  3WTZ A;  3VFZ A;  5ICF A;  2K27 A;  5J6X A;  2QVO A;  3V7R A;  4R8H A;  5LLQ A;  3KLO A;  1DDN A;  5D4R A;  3BJ6 A;  3G73 A;  5L3F A;  3GZ5 A;  4ESB A;  3RIR A;  2EV5 A;  1ON2 A;  1K78 B;  4ESJ A;  1XD7 A;  2EFP A;  4EGZ A;  2X4H A;  3CO7 C;  5AIP A;  2K86 A;  1DPU A;  4A6D A;  2W25 A;  3KP6 A;  1BBY A;  1UHW A;  3HOS A;  2JPC A;  5AON A;  2CYY A;  4Q47 A;  3GZ6 A;  3WGI A;  2FBH A;  1O3T A;  4KIC A;  2UXN A;  5JFR A;  5JI6 A;  1AOY A;  5F1R A;  4EM2 A;  4ZYD A;  2BE5 F;  5ICE A;  1RUO A;  2CFX A;  3KZZ A;  1U2W A;  2FQ3 A;  5K5O A;  4M72 A;  2VBW A;  3KE2 A; 
#chains in the Genus database with same CATH topology
 3BRO A;  2CUJ A;  2M30 A;  4LOC A;  4CYC A;  4WXD A;  1RI7 A;  2QUF A;  3A0H C;  4UB8 C;  5HS7 A;  3TL4 X;  2DMN A;  3J7A Y;  2FUG 2;  3ZPL A;  2Y9Y A;  2LC2 A;  3FF5 A;  1VQN I;  1FWZ A;  3GLX A;  2L02 A;  4X0G A;  5LRR A;  4P9F A;  3PQK A;  2FSW A;  3IRR A;  3K4J A;  3M07 A;  4HBL A;  1K83 J;  1MMD A;  2JVH A;  1ZRD A;  4RDU A;  1A5J A;  4FT8 A;  2E1M B;  2NXN B;  1U5T A;  2JSC A;  3MD2 A;  2FD5 A;  3HHH A;  2VE8 A;  3TP0 A;  3OYC A;  2W7N A;  1R1U A;  1XCB A;  3CZ6 A;  4A5N A;  4JYK A;  4NDL A;  4DOZ A;  1J59 A;  3L7W A;  2PMU A;  5J1R A;  2F5V A;  3ZXS A;  5ERI A;  3T1B A;  2DA1 A;  3L2C A;  1I1G A;  2LF8 A;  2F6C A;  1UZC A;  3CCY A;  1KYW A;  4G6Q A;  5M3F J;  3QOD A;  3W2W A;  4XLP F;  3HHG A;  3ZMS A;  5EG0 A;  3KET A;  4UY8 I;  1FYM A;  1Q1H A;  4DGW B;  4ON0 A;  1A6I A;  5TGT A;  4G7H F;  2XSJ C;  1WCM J;  1Z67 A;  2A05 A;  3CP2 A;  1SMT A;  2VOP A;  1U9O A;  2QA4 I;  2F5E A;  3HXL A;  4XL9 A;  2DFI A;  2EQR A;  2A6H F;  2OAZ A;  4ENK A;  2W4S A;  3ZMU A;  3ABK H;  2QZ8 A;  2LLK A;  2ELK A;  4Y13 A;  2OCE A;  4PDK A;  3QOP A;  1UHS A;  3GTL J;  1ZKG A;  2Y0M A;  3T5X A;  2HOA A;  3AL0 B;  4PJJ A;  5D8K B;  1R6R A;  1R58 A;  4XLE A;  3GZN B;  5BNG A;  1MH4 A;  4L9V A;  2FMY A;  2ADU A;  1X1C A;  2JPB A;  5H20 A;  5GPC A;  4XON A;  2VPL A;  2AQE A;  4XKB A;  3TO9 A;  2D45 A;  2M2E A;  2R7D A;  5CVR A;  1K4S A;  2V6E A;  4UB6 C;  2FOK A;  3BG6 A;  1G3S A;  2OQG A;  5D6E A;  4KN4 X;  3OYD A;  3R0A A;  3FIW A;  4BU2 A;  1FYK A;  1Y0N A;  1EA3 A;  2DI3 A;  3PUB A;  2HTJ A;  2YSR A;  4HF0 A;  2HDD A;  2IS2 A;  4LIU A;  2EIN H;  3FM3 A;  1GV5 A;  3S1N J;  2RN7 A;  2ZXI A;  1YHQ I;  3RKW A;  4G9Y A;  2PJR B;  1XMX A;  5ILS A;  1U8B A;  2DT5 A;  3OYH A;  2O9L A;  2FQ4 A;  3AG4 H;  2BW3 A;  4WXC A;  4OIR F;  1R71 A;  1O7L A;  2Z1D A;  5LEJ A;  2P81 A;  3I0T A;  2ZFU A;  1MSE C;  3GVA A;  4DQ2 A;  4AD9 A;  1GV2 A;  4C3H J;  4L9N A;  3EET A;  3RKY A;  5F08 A;  4LB6 B;  1JHH A;  5GTH C;  3MKY B;  2BY3 A;  4O6J A;  3V4G A;  3F8B A;  1R5H A;  3J81 Z;  2JT1 A;  1BA5 A;  3OSF A;  2Z99 A;  4LGW A;  1TWH J;  1DP3 A;  4YII A;  1YFH A;  1CF7 A;  2VOO A;  4S05 A;  1P4W A;  3ZN0 A;  1MNE A;  2K4B A;  3KLN A;  2R4G A;  3S1M J;  3G4S I;  3GXO A;  3B6C A;  4RAG A;  5E79 C;  5IYD J;  1QHG A;  1ZYR F;  1F43 A;  4B47 A;  2CFO A;  1KQ9 A;  3FX3 A;  3KP5 A;  4BNC A;  1S9H A;  1SD7 A;  2JJ7 A;  1ZH5 A;  1LEA A;  5DD4 A;  1D0Y A;  2ZJR F;  4KIG A;  3CC2 I;  2FEZ A;  2GWR A;  1IN8 A;  2RNJ A;  2R3S A;  4RGX A;  1SD6 A;  4Y3O A;  2QCO A;  2KZG A;  2JRM A;  1JGS A;  5TRD A;  3C1D A;  5F0H A;  3K1P A;  5F27 A;  3QPL A;  1Z0X A;  2JA8 J;  5J8F A;  1PVE A;  1ZG1 A;  1XSV A;  3I56 I;  1EKE A;  1G2H A;  3P5J A;  3FK7 A;  5B1B H;  3OWT A;  4WCG A;  2CW7 A;  1T56 A;  2ZO4 A;  2QQA A;  3SYT A;  5FKK A;  3BC8 A;  2P5K A;  4XKV A;  1O57 A;  2KT0 A;  2VJ4 A;  1HC8 A;  4OMY A;  2KL4 A;  1HKQ A;  5CKT A;  1KQ0 A;  1MMN A;  3RKX A;  3E0J B;  1TC3 C;  3IHU A;  5JVG F;  2NVY J;  3KP7 A;  1DU0 A;  1O7F A;  4V19 K;  3HOY J;  2EFQ A;  1AHD P;  1PUE E;  1K79 A;  2H09 A;  3IH2 A;  3J81 K;  3HPH A;  4U88 A;  3PFY A;  3F23 A;  1FOW A;  2V9K A;  4AYB N;  4BL0 B;  5EYR A;  1XGS A;  3HTS B;  1JT6 A;  1SVL A;  1JTY A;  3FXL A;  4A3E J;  1S8N A;  3KFW X;  2H6C A;  2WV0 A;  5DDG A;  1J75 A;  3BTI A;  1FOK A;  2O3F A;  3H5N A;  3LFU A;  4EJV A;  1LVA A;  1OYY A;  4XBF A;  2LK2 A;  2O8K A;  2K3F A;  4KT6 A;  1LKX A;  1T95 A;  2A61 A;  1ENH A;  5KVR A;  6PAX A;  3MKW B;  3UKG A;  5CPR B;  4M9S A;  4BHB A;  3L2U A;  3O3K A;  3C18 A;  1P4X A;  2X0L A;  1T6S A;  3P9K A;  3LWF A;  3I71 A;  1K6O A;  3S3O A;  1ZLK A;  2TCT A;  2BY1 A;  2RQQ A;  2V9P A;  2OQR A;  2Z2S B;  4RA2 A;  3DTI A;  2LF7 A;  1TZL A;  1XMK A;  1QRY A;  3C2B A;  3NAR A;  1X2M A;  1KYZ A;  2G7U A;  3IWF A;  4D5F A;  5B5E C;  4HX4 A;  4HQE A;  3F21 A;  4BXU A;  3RKQ A;  4BHP A;  3BR5 A;  4RM3 A;  3IKV A;  1KU7 A;  1V55 H;  3EUA A;  1MBH A;  4ZC3 A;  2BGC A;  3DP7 A;  2VJJ A;  4A3M J;  1I3Q J;  1AA7 A;  1BI1 A;  3CJN A;  2LBF B;  3HG9 A;  1Y39 A;  5D5W B;  4B48 A;  4DBQ A;  2QBY A;  1OMI A;  3H1C A;  5H6Q A;  3CCR I;  3VB2 A;  3N97 A;  2DQR A;  4B09 A;  3PJR A;  4N9I A;  5A2Q Z;  1BJA A;  3SFI A;  2H8R A;  1MJ9 A;  3TOB A;  3IWZ A;  5TJJ A;  1OR7 A;  4KDP A;  1OKR A;  3E5U A;  4EAT A;  4GFB A;  3SZT A;  4NHJ A;  4XKW A;  2KRH A;  4NNJ A;  4RBO A;  2W24 A;  2BVL A;  3J7Y J;  2DOA A;  1LDJ A;  4MGR A;  2VQC A;  1T2K A;  2K9Q A;  4E7K A;  1GHC A;  2DFE A;  1ETV A;  4XIC A;  4IRI A;  2QYO A;  2RQP A;  3S14 J;  2A5Y B;  2WB1 A;  2O0Y A;  2HI3 A;  3L1P A;  3K70 D;  5F64 A;  2UV1 A;  3F6V A;  3FMS A;  2W48 A;  5K7H A;  2HQR A;  3HPG A;  2Z9O A;  2E71 A;  3K4L A;  4LG0 A;  4IQ4 A;  3G71 I;  2XV4 S;  2MAB A;  4PSW A;  3MZH A;  3W6V A;  5GAE J;  2NRA C;  2O5R A;  5LHH A;  2IGO A;  1WSU A;  1J0R A;  4A3D J;  5CJ9 A;  3JRF A;  4PCQ A;  1GUU A;  2VXZ A;  2LY2 A;  5CQE A;  3RYR A;  2CQK A;  5K7F A;  1H0M A;  3BR2 A;  2VQL A;  2HQA A;  4G6T B;  3ZQC A;  2ZSH B;  4ZYG A;  3JRE A;  3K4K A;  1OCZ H;  3F9K A;  3NQO A;  1HW5 A;  3CUQ A;  2J5P A;  3DWL E;  1IZ1 A;  2UXX A;  2EJR A;  1LB2 A;  4F93 B;  2ELJ A;  3S32 A;  4LLN A;  5IOY A;  3K10 A;  1IAW A;  1S5L C;  1FMW A;  4KIB A;  5CLS A;  1KU2 A;  5A2Q K;  4OIQ F;  4BS9 A;  4YRV A;  1RKT A;  1E0E A;  3H5A A;  4B3X A;  3D5L A;  2Z5U A;  1P7I A;  2XSD C;  2H27 A;  4DIQ A;  1QNT A;  2DOD A;  1MMS A;  2M8G X;  3TBI A;  5IYC J;  1TQM A;  2PX9 A;  2GXA A;  2COB A;  4R1H A;  3CCE I;  4L5I A;  4D0P A;  2DN0 A;  2Y9Z A;  1ETW A;  5FRN A;  4DYC A;  3HSR A;  3KX2 A;  1RZ4 A;  3DPL C;  4CYC B;  1O3S A;  4MEY F;  1I27 A;  4XLA A;  5LGU A;  3E3V A;  2EZH A;  4LG3 A;  2IRF G;  2R7X A;  3R4K A;  1Z7U A;  3QPT A;  3G3Z A;  3SZP A;  1JKR C;  4ZDL A;  1OLT A;  1VQ6 I;  1R49 A;  3WGH A;  2AXL A;  1G4D A;  5E1W A;  1AU7 A;  2IGN A;  5ED4 A;  4M73 A;  2EZL A;  1K4T A;  3WTS C;  2XAQ A;  1ITY A;  1XX5 A;  3DQV C;  3CCQ I;  2R93 J;  5J3L A;  4MFD A;  3HOX J;  1FIP A;  1HKT A;  3CLO A;  1R22 A;  3QU3 A;  3OYF A;  4B4C A;  1U5T C;  1U5T B;  3S3M A;  5HNF A;  2CQQ A;  4E70 A;  1HLV A;  3L9F A;  1I39 A;  3WE2 A;  1JGG A;  3S15 J;  3E6M A;  1VQO I;  1IGN A;  2EIJ H;  1XSD A;  3JR9 A;  1X1D A;  1ERD A;  2B0L A;  2XPW A;  5KK1 A;  1MBE A;  4BDY A;  2P7C B;  3K69 A;  3RJP A;  3DCF A;  2HPI A;  4BXX J;  5EG0 B;  3ZQF A;  4M6V A;  1ORK A;  1FSE A;  1YLF A;  1MMA A;  3HSE A;  3TW6 A;  3OV8 A;  2ACJ A;  1PUF B;  1HDP A;  2EPF A;  2OPT A;  2HYF A;  3CMY A;  3FXJ A;  1NG7 A;  1X4O A;  4RGS A;  2ESN A;  3RPQ A;  5FRO A;  3OYL A;  3AAF A;  4MFE A;  3BCB A;  4XLN F;  1FNN A;  2ZME B;  3JRB A;  5D6F A;  2EV6 A;  2EV0 A;  3H9J A;  2L4M A;  1TNS A;  3HRT A;  4HLX A;  2W85 A;  4LD5 A;  2MG4 A;  3DBR B;  1ZQ3 P;  4IRG A;  2BHY A;  3MEX A;  3GFM A;  3DFG A;  1IRX A;  1OYI A;  5CVJ A;  4XK4 A;  4IZZ A;  1HBX G;  1O3Q A;  5E8I A;  1R4M B;  2VI6 A;  2VOD A;  5FKN A;  4C2U A;  1PJR A;  4IPA A;  3KP4 A;  1SFX A;  4IEJ A;  3TW7 A;  1OFC X;  2OJE D;  5FLV A;  3GTM J;  3S2H J;  1XSX A;  4J01 A;  2DMQ A;  4A12 A;  4BH9 A;  3MCZ A;  5L3B A;  4FCY A;  2ECC A;  2PMZ A;  2VE9 A;  2ID6 A;  2IT0 A;  1BC8 C;  4U0V A;  1FP2 A;  3A02 A;  2IGK A;  1XGO A;  4EQQ A;  2H6B A;  3BLY A;  5BPI A;  4ETS A;  3GW2 A;  3BPV A;  1MNM C;  3H3U A;  2DK5 A;  2HNH A;  3OYB A;  4CCN A;  3MAJ A;  3ZP5 A;  2YS9 A;  2WY7 Q;  5IYB J;  2OCC H;  1D1A A;  3EQL F;  4KT5 C;  2MBF A;  1T08 B;  3B73 A;  1LEB A;  3WHB A;  1J9I A;  3DV8 A;  4CUG A;  1R4N B;  1RES A;  4AUX A;  1DPR A;  2JTV A;  1D8J A;  2VQG A;  2HVR A;  3HOV J;  4AYB A;  1P9Q C;  1V5E A;  5EZG A;  3O6B B;  2G7H A;  1KZH A;  2EFO A;  2PMH A;  3GFJ A;  5DYM A;  3QU6 A;  1BW5 A;  4W1U A;  1O3R A;  1T0F A;  1WRJ A;  1R1V A;  2DPU A;  2LVS A;  1CF7 B;  4R79 A;  3GX4 X;  4PUS A;  1ZR4 A;  4CYD A;  3K4C A;  1M1E B;  4ENM A;  4MO7 A;  3O2P E;  2ETH A;  2DYS H;  2RRE A;  2BBY A;  2MFZ A;  3WTU C;  2Z16 A;  3OOP A;  3CMM A;  3DLL F;  2CV0 A;  2QSF X;  4P96 A;  1K7A A;  4ZZL A;  3HIF A;  4RMN A;  1WJB A;  4FX0 A;  2EZI A;  4B1R A;  4FTH A;  2DAO A;  4ANJ A;  2P0W A;  2K9M A;  4EM0 B;  1TBX A;  3BP8 A;  3F8C A;  3M1C A;  4OAY A;  4A2U A;  3K9T A;  2OC6 A;  2GBY A;  4G6D A;  5J40 A;  3DBH B;  4HEA 2;  3WG9 A;  4HA8 A;  2X6Y A;  1NK3 P;  3OYK A;  3DEW A;  3RQI A;  1D5Y A;  5K5Q A;  1NH3 A;  3OIP A;  4LMY A;  5LRS A;  2N8G A;  2RVC A;  1Z21 A;  5K5R A;  3EYI A;  3CCM I;  1IO2 A;  3WTY C;  3GTQ J;  3SEQ A;  1YRN A;  3CES A;  4A0Z A;  3Q0U A;  2LDU A;  1LPQ A;  2L54 A;  2QM3 A;  1LE8 A;  1S7E A;  3WU1 B;  2E7W A;  2MH2 A;  2XC7 A;  4FX4 A;  1LDK B;  1MH3 A;  4XM3 A;  1WJF A;  3E6D A;  2DPD A;  1WKM A;  1F36 A;  3ULQ B;  1G3W A;  1UMQ A;  1VI0 A;  1YJW I;  2LTP A;  1WJA A;  1PP8 F;  2FU4 A;  1Z3X A;  3CQZ J;  5IT3 A;  4H0E A;  3BG3 A;  4G8X A;  4QLC U;  3LSP A;  5HLT A;  3FHN A;  3QYB A;  1TQI A;  4ZTJ A;  3OR2 C;  3PO3 J;  4I99 C;  2ZJP F;  4U7D A;  4HSR A;  3BTJ A;  1Y56 A;  5LEK A;  3HUG A;  1JI8 A;  4CDG A;  3H92 A;  3TGN A;  2EB7 A;  2EFW A;  2XB5 A;  2CUZ A;  3AG3 H;  4UUS A;  4C3J J;  3H9Q A;  2VL8 A;  3RCO A;  2ZC2 A;  4RB3 C;  5JR3 A;  3TDU C;  1YW9 A;  4HZF A;  2G9W A;  5J1Y A;  3BOQ A;  3HTU A;  2Y75 A;  3AFH A;  1MJA A;  4WXH A;  4CZC A;  2BEO A;  2W84 A;  1QZZ A;  2RGV A;  4YFN F;  2M7A A;  4C2M J;  2L0K A;  3HYI A;  5GTI C;  4WK8 F;  2G0E A;  3KPH A;  2DMT A;  3VOE A;  2XRO A;  3NEU A;  3IC7 A;  4NUB A;  2JUG A;  3A4C A;  2CGP A;  2LKS A;  2WB1 N;  1B72 A;  4IHX A;  2MW8 A;  1FPQ A;  2E60 A;  3OS0 A;  1IUY A;  3ZQL A;  4D1Q A;  3KYL A;  2X1D A;  2VIX A;  2DU9 A;  3S8P A;  2Z33 A;  4XQF A;  2JA5 J;  5BMZ A;  2E1M C;  2GIV A;  3H0D A;  5LGT A;  3RPU D;  1X1B A;  3VYT B;  4BEH B;  2KIU A;  3REO A;  2GQQ A;  4G94 A;  1T39 A;  1W7P B;  3CDH A;  3LA7 A;  1MD0 A;  3W2A A;  1FYL A;  5HLG A;  2QBY B;  1WGX A;  3OIQ A;  4BGD A;  1UAA A;  2STT A;  2MLK A;  1FBS A;  3F6O A;  3FZV A;  2DK8 A;  4EMS A;  3C2G A;  2QEX I;  1SAU A;  3JAM Z;  3F3X A;  1PYV A;  3I53 A;  3ZMD A;  1OR7 C;  4FQG A;  2HOE A;  4XN0 A;  4I0B A;  2RDP A;  2OA4 A;  3ABU A;  1PUF A;  3CTA A;  5CYV A;  4YEL A;  2L4A A;  4BXF A;  3JRI A;  1R36 A;  2GLO A;  2F4M B;  4C30 A;  3I4N J;  4YEJ A;  2Q0O A;  5BQT A;  2LOO A;  2ZME A;  1I6X A;  4ZDP A;  4LFU A;  1GT0 C;  2NVX J;  3LSG A;  3M7G A;  5GAD J;  4UV8 A;  2VKD A;  2P5V A;  3T8R A;  3N4M A;  2A3S A;  3I9V 2;  1SFK A;  3MZ8 A;  1KQ8 A;  3HOZ J;  5CVV A;  3MFK A;  1K61 A;  1YQA A;  5K1Y A;  2V26 A;  5KAI C;  3AL0 C;  2RNG A;  1JHF A;  3RPU A;  1U6G A;  4LG0 B;  3HZJ A;  3E97 A;  2WAQ A;  3WOD F;  5HDN A;  3JSO A;  1Y0U A;  4ZYE A;  4MIM A;  5L3D A;  4MQ9 F;  4JQF A;  3ABT A;  2NNN A;  4U7B A;  5DUK A;  1S72 I;  1CQT A;  2ISZ A;  1ZHF A;  1QPM A;  3FXQ A;  4PFO A;  4BE0 A;  2M34 A;  1NG6 A;  2IP2 A;  4PJ0 C;  2IA1 A;  3ISP A;  3NAU A;  2EK5 A;  4U87 A;  3BR1 A;  2R7R A;  4LIT A;  3CUQ C;  3CUQ B;  1RR8 C;  4N4N B;  2HGC A;  1UHM A;  2VPR A;  3FIS A;  1B8I A;  2KJC A;  1SAX A;  1YYV A;  5M5X J;  4N9H A;  5B1A H;  1N75 A;  4IHT A;  3FMQ A;  1XPX A;  1K6Y A;  1YW7 A;  2QKM B;  1UFM A;  2E1C A;  2F48 A;  2NS7 A;  2CU7 A;  3JAM K;  1ULY A;  2FNP A;  1RUN A;  2R5Y A;  1VQ9 I;  3K70 C;  2Y0S A;  4I7H A;  1IRF A;  2E35 A;  2XAJ A;  3F22 A;  5CQG A;  2GOM A;  3S3N A;  3S17 J;  1OIS A;  4DZP A;  3DU5 A;  3O8H A;  1E3H A;  1QGP A;  2CQN A;  1BJZ A;  2EZK A;  4F91 B;  2QLZ A;  1TW3 A;  3V8K A;  3C2H A;  2HOT A;  3DEU A;  3JRA A;  1F1Z A;  1FTZ A;  2E2H J;  2AQF A;  3DEE A;  5E1Z B;  5C44 J;  1D1B A;  2LD5 A;  3CC7 I;  1OYW A;  4U0W A;  1ZAO A;  1RNL A;  3K4M A;  1FZP B;  4F55 A;  3HOT A;  3G6E I;  4B44 A;  2O7O A;  3QRF F;  4UV9 A;  5J47 A;  2EIM H;  1IRZ A;  1H9T A;  4BJ5 C;  1P7J A;  2PMZ N;  3SXY A;  3EUK L;  3A2K A;  3CJT B;  2HFH A;  2KRF A;  1X3U A;  1S3J A;  1SFE A;  1RKW A;  1KA8 A;  2HZD A;  2VT2 A;  1QPI A;  1TNT A;  3Q9S A;  4NB5 A;  4NQW A;  1J5Y A;  4E7Z A;  2F4O B;  3ZR8 X;  1YJ9 I;  4XSX F;  5ILV A;  4ASN A;  2V6C A;  1IRG A;  1ETY A;  4FET A;  3C7J A;  3M8J A;  4CGZ A;  1T33 A;  4IRH A;  4M71 A;  2VBY A;  3ABL H;  5FD6 A;  2XAU A;  2ZJQ F;  1LQ1 A;  3EYY A;  1WI9 A;  4HW0 A;  2R5Z A;  5HS9 A;  4IHV A;  1HKS A;  2DA3 A;  2KMU A;  2WAF A;  3VYS B;  2H1L A;  2J5O A;  3WTV C;  1SD4 A;  4L0Z B;  4KYW A;  1EH6 A;  2UWM A;  2TRT A;  2KHM A;  3PNT A;  2BOL A;  2A5W A;  1QZE A;  1W7P D;  4LJZ F;  4OIP F;  3H9G A;  1JKP C;  1B1B A;  4GCV A;  4XSZ F;  1ZG5 A;  1BC7 C;  5HDK A;  2CSO A;  1Z3Y A;  1F4K A;  1ZEL A;  2KPM A;  1TWA J;  1BR4 A;  1WZ2 A;  2HVS A;  3BZK A;  2V1X A;  2HWV A;  4OOI A;  4AVZ A;  3LAP A;  2KZV A;  2NVU B;  1KGS A;  3KEQ A;  4XR6 A;  3SDG A;  3TO7 A;  2LFB A;  4M6X A;  1TLH B;  3LL7 A;  1RRJ A;  3TP3 A;  3I64 A;  4OIN F;  1SD5 A;  3ZMT A;  4BKX A;  1MBK A;  2V7F A;  2QQ9 A;  4ZJZ A;  2DA5 A;  1R5G A;  1VQ8 I;  4M6Y A;  4UXN A;  1T38 A;  2QF7 A;  1KU9 A;  1BI2 A;  2NNY A;  1VQ5 I;  5ILU A;  2HOS A;  4XRF A;  1GXP A;  2D2W A;  1G3T A;  2OD5 A;  3DPT A;  3W6J B;  3BR3 A;  2MD5 A;  2HEO A;  2JA7 J;  4BEH A;  1ETK A;  5BOX A;  2E2I J;  1QQI A;  4QWQ A;  4EGY A;  1H9G A;  3SHF A;  3E6B A;  3WU2 C;  3GTO J;  2Q8K A;  3E7L A;  4M3G A;  4ZTF A;  2IS4 A;  2GIZ A;  1W7P A;  5L3E A;  2K40 A;  2FOW A;  3PSI A;  4CCJ A;  5E18 F;  1EV7 A;  2X51 A;  1IXS B;  1T0F C;  1ZRF A;  4KNY A;  3ML6 A;  2UUZ A;  3VYU B;  4UUT A;  2HPM A;  1AWC A;  1OJL A;  2M5W A;  2V1D A;  3F0C A;  1IXR C;  3HKZ A;  4IJA A;  5EZH A;  4A5M A;  4B3A A;  5FJ8 J;  5HS8 A;  1OCO H;  5C4J J;  1Z6T A;  5M5Y J;  4IKF A;  4QSH A;  3J7A O;  3JSP A;  1XB4 A;  4JX6 A;  4BYY A;  1X58 A;  2L2O A;  4MQV A;  2HXI A;  2XDV A;  4ABZ A;  4O3M A;  3I5U A;  4MTE A;  2Y31 A;  3HBL A;  2DJI A;  1LNW A;  3S93 A;  4Y52 J;  1YX5 A;  3F72 A;  3HJE A;  4BY7 J;  5D5U B;  4AWX B;  5B3S H;  3L2W A;  4HV5 A;  2ZXH A;  4Y15 A;  3K4N A;  1HW1 A;  2YUS A;  3JW4 A;  5HVQ C;  5AIQ A;  1H88 C;  2FE3 A;  2D5V A;  4Q48 A;  4V2G A;  1U8R A;  1YRN B;  4A3K J;  2CJJ A;  3IAM 2;  3ZQH A;  1LE8 B;  2PN6 A;  4RB2 C;  3TED A;  1FX7 A;  1D0X A;  3V42 A;  2X6O A;  2P7V B;  1IV6 A;  3RYP A;  5C4X J;  1FBU A;  1HDD C;  5FKL A;  2FXA A;  2R7V A;  3PFI A;  4HYE A;  4DW6 A;  2W00 A;  4PK4 A;  1GXQ A;  3IKT A;  5E8G A;  2XAH A;  1OCP A;  1W36 D;  1D8K A;  4BQQ A;  2JZY A;  3CCJ I;  1XDU A;  4HNT A;  1ETQ A;  1UCR A;  3W3C A;  4DYQ A;  1IC8 A;  4A3B J;  3M8F A;  3ZGK A;  3CJQ B;  2WY8 Q;  3CDL A;  2JQ7 A;  3HUG B;  1TP4 A;  5C3E J;  2L3D A;  4GDF A;  2I8D A;  2XKP A;  3HL2 A;  2F5F A;  4UUS B;  3A01 A;  2VN2 A;  2AHQ A;  1SAN A;  5EGO A;  3HGY A;  1TWF J;  3DKX A;  1JUP A;  1OCC H;  1U9N A;  2R7S A;  2PQ8 A;  4O5V A;  4HQM A;  4I0A A;  3ECH A;  2GXG A;  3GLL A;  2X1E A;  2MYS A;  1E3O C;  3K0L A;  3NWT A;  2K7L A;  3BJO A;  2NOG A;  5F0C A;  1B9M A;  1W5C C;  1SVM A;  3KYC B;  2KIM A;  1SFO J;  1LFB A;  3V8J A;  1B72 B;  1VQM I;  2OTL I;  1REP C;  2PEX A;  3KEY A;  3I58 A;  4F92 B;  2IJL A;  3W6K B;  2HR3 A;  3KIO A;  4E6K G;  2EFN A;  2EA2 A;  2WAQ N;  2M0M A;  2XPV A;  1S6L A;  1XC5 A;  2C6Y A;  4CZZ A;  1S29 A;  1XCV A;  2VKV A;  4E4H A;  5H6R A;  5LHI A;  4OIO F;  2DBB A;  3PIO F;  2YU9 J;  2IA0 A;  5E17 F;  4GXO A;  4UVB A;  2O03 A;  2IVM A;  3BY6 A;  4BAY A;  1BW6 A;  1R00 A;  4E7H A;  4DNC A;  2Y30 A;  4MTD A;  3D0S A;  3LA2 A;  3SZG A;  1STZ A;  4D5C A;  5DV5 A;  1VZ0 A;  3ELK A;  1YS6 A;  3FBI B;  4RM2 A;  2M45 A;  3K7A J;  1HF0 A;  4HDU A;  4CSW A;  3VPR A;  5DM6 F;  2Q2E B;  4RB0 A;  1X3Z B;  5F1J A;  2ID3 A;  2ZME C;  4CHU A;  2KFD A;  1BI0 A;  3QYF A;  5DEQ A;  1FTT A;  4HPQ A;  2HTS A;  4HNV A;  2Y0S N;  1YG2 A;  5JHU A;  1Y1V J;  3GME A;  2QSG X;  4BJ6 C;  5DUI A;  4BBS J;  1HCR A;  4ITV A;  2OV7 A;  3GCM A;  1WH5 A;  5DCM A;  3HOW J;  3CDI A;  1TWC J;  2JRT A;  3MQ0 A;  4Y7N J;  3PUF A;  1WJE A;  3ZQQ A;  4XRS G;  3HEF A;  4ZYA A;  4ZDO A;  2HYG D;  3A0B C;  1UJ8 A;  2M8E A;  1Y8Q B;  2BVM A;  3DPU A;  4C9Y A;  2EIL H;  4Y17 A;  2Q1Z B;  5EJC A;  2ZCW A;  4KIT B;  1BN5 A;  2VUM J;  4Q5S F;  3LOC A;  3QWL A;  2ZFW A;  1V4R A;  4M9Z A;  1JTX A;  4GYG A;  2YPR A;  3ABM H;  1I50 J;  4EVI A;  3OIO A;  3ZMZ A;  3FXU A;  3UNG C;  3HM5 A;  2VKH A;  3I55 I;  4II3 A;  3OYG A;  2VJ5 A;  3H36 A;  3S2W A;  1DP7 P;  4M3F A;  1HQC A;  2E7X A;  5KAF C;  3Q5F A;  4IO9 F;  3N05 A;  1B8I B;  3K2Z A;  2DO7 A;  3W2V A;  1JT0 A;  3V7C A;  1VTN C;  1VFC A;  2H8W A;  1FY7 A;  5BS6 A;  3HC7 A;  4XKC A;  2HYJ A;  4V2F A;  2FNA A;  2ZNZ A;  2RC4 A;  3BG7 A;  1SFU A;  1YS7 A;  1QZY A;  4JX5 A;  2K9N A;  3AG1 H;  4M3D A;  4GYI A;  1AKH A;  2R5Y B;  1POG A;  2CUE A;  3OYM A;  3FDY A;  4XOT A;  2V9V A;  4XLC A;  2DMP A;  3S2D J;  2DQL A;  5IPA A;  3M4O J;  1VQ4 I;  5LBQ A;  1RC9 A;  1H8A C;  2CV1 A;  4AIK A;  1N78 A;  4L5E A;  4PJN A;  2CH0 A;  2PBI A;  2P5L C;  1O4X A;  3JRH A;  4Z2Y A;  5GAH J;  1LFP A;  1X4P A;  3CCL I;  2VJI A;  3DKW A;  2QKL B;  3X2Q H;  1ZRC A;  3U1D A;  5E3O A;  3PIP F;  5LD2 C;  1KON A;  4FAS D;  2DTZ A;  1YIO A;  2VT3 A;  1RET A;  4EJU A;  4EV0 A;  2K02 A;  1ZRE A;  2ZBK A;  2M4K A;  3RTR A;  3CF5 F;  2DA4 A;  3D1N I;  1BL0 A;  1UG2 A;  3LSK A;  4WF2 A;  1IXC A;  3FXO A;  4B43 A;  4XOR A;  2GOX B;  4S0H B;  3VDX A;  1G6N A;  1R1T A;  3QOE A;  3ESW B;  1XTA A;  4AVP A;  5EF6 A;  2XF5 A;  2YR2 A;  3H0G J;  1BR1 A;  2B63 J;  3CCV I;  2NOJ B;  4QPQ A;  3PO2 J;  2YX4 A;  4NQW B;  1MKM A;  3H3Z A;  5IOZ A;  2GXB A;  4JBA A;  2KJB A;  4C3I J;  1EF4 A;  3I4P A;  1IJW C;  3EUH A;  3ECO A;  2MC3 A;  3ZQI A;  2OF7 A;  5FRM A;  3FXR A;  1FSH A;  3L2V A;  4BE2 A;  3CD6 I;  5HLI A;  1DQU A;  1D1C A;  4EJO A;  1P6R A;  3WTX C;  1DGW Y;  4KA4 A;  2R5Z B;  2B7E A;  5FLM J;  3JCU C;  1P2F A;  5FLX K;  2DDB A;  2VC0 A;  1ON1 A;  1A31 A;  5FKO A;  4CCO A;  3I3L A;  5JHF A;  2RV8 A;  2BYV E;  1BR2 A;  4M74 A;  3PNV A;  1FOX A;  3ERE D;  4G12 A;  1BOA A;  3ZOB A;  2WA0 A;  1PP7 U;  1XDS A;  3DKY A;  1MDM A;  5J8C A;  4RAY A;  4BQN A;  4OWR B;  2VBZ A;  5CVU A;  1JKO C;  4IQJ A;  1NK2 P;  3OL4 A;  1NTC A;  1MSF C;  2LSO A;  3HKZ N;  5GPA A;  5FFZ A;  3H35 A;  2L7Z A;  2CG4 A;  1JE8 A;  1FIA A;  1XN7 A;  1GVD A;  2BV6 A;  3MZY A;  3NRV A;  3CMA I;  2MH9 A;  2NVQ J;  5F04 A;  4KJZ A;  3VOD A;  1ZGA A;  3CP8 A;  1Z05 A;  1G59 A;  3NWS A;  4UVC A;  4HST A;  3M8E A;  1ACI A;  5DM7 F;  4KMU X;  4BE1 A;  5ICG A;  4LK1 F;  2F4I A;  1ZG3 A;  2F2E A;  4TV7 A;  4L0Y B;  9ANT A;  1B6A A;  1RIO H;  4RLF A;  3FK6 A;  2EIK H;  1TT5 B;  1VQ7 I;  3GF2 A;  1J7K A;  4M3B A;  4D9J A;  1DUX C;  1B4A A;  3AG2 H;  1BM9 A;  3Q3S A;  4II2 A;  3VEP A;  4IF4 A;  4AC0 A;  3OYI A;  1TL8 A;  4CA0 A;  3RZO J;  1XGM A;  1QVU A;  2W1O A;  3WGG A;  2L9N A;  2XVC A;  5BPD A;  4HRI A;  1U0J A;  2QQ8 A;  5E3N A;  2NS8 A;  2L9V A;  1XGN A;  2MC4 A;  2VC1 A;  4GGG A;  2V79 A;  2R92 J;  4Q4Z F;  5FD5 A;  2E5N A;  3F8M A;  3RZD J;  2ZJ2 A;  3LQR A;  3P7N A;  2DLL A;  4N4O B;  4A0Y A;  1BIB A;  3QP6 A;  4AID A;  1TTY A;  4HV6 A;  4JOM A;  2LRD A;  4A6E A;  3Q0W A;  2FA5 A;  1W5T A;  1ZGJ A;  1A04 A;  1FMV A;  3OY9 A;  1YTY A;  3H5R A;  4PGG A;  2OBP A;  3IL2 A;  1Y1W J;  1LDD A;  2QEN A;  4A69 C;  3J80 Z;  3WU0 A;  3VSK A;  3FXK A;  2CRG A;  3PL8 A;  3LAJ A;  4IL6 C;  4I2O A;  1HXD A;  5L3C A;  3KP3 A;  1MIJ A;  1XG1 A;  3S1Q J;  1USS A;  5FGM A;  2Q2E A;  3FKI J;  5DD8 A;  4BQA A;  2QWW A;  3CC4 I;  5B66 C;  5EEA A;  5H2F C;  5E3M A;  3I59 A;  3PM1 A;  4RLQ A;  2MD0 A;  5JLX A;  4HX8 A;  4HF2 A;  4KN7 X;  2XRL A;  1TWG J;  3IUO A;  4RS8 A;  5LHG A;  2AS5 F;  4Z6Y A;  4RAF A;  4I09 A;  3FBN B;  3IH3 A;  4RGU A;  4XLF A;  4KIS A;  3GTK J;  1W4M A;  4PJM A;  2GZW A;  1U78 A;  3OYE A;  2HXO A;  3OYA A;  3G2B A;  2M3A A;  4CIC A;  2D1V A;  5DTD A;  3OS2 A;  4D7N A;  4CO8 A;  1V3F A;  1B9N A;  2GA1 A;  1MGT A;  3EPZ A;  1JUM A;  2JN6 A;  4BJT A;  1Y6I A;  4YFK F;  3SJM A;  4IOC F;  3WG7 H;  2A6E F;  4ENN A;  4E7I A;  1I6H J;  5FKM A;  2VXD A;  2LR8 A;  1ETX A;  2NYX A;  1FP1 D;  3GFL A;  3V7S A;  2I10 A;  4EM1 A;  3MKZ A;  3K1M A;  4F52 A;  1YE9 A;  4Y4R A;  1P4A A;  1ZLJ A;  3A1Y A;  3ZQ7 A;  4B8X A;  2JMW A;  5HNH A;  3DXJ F;  2JSP A;  2BHZ A;  2XGD A;  3LSR A;  2YU3 A;  1WJD A;  3MWM A;  4HX7 A;  1PDN C;  3GFI A;  2DOF A;  2CW8 A;  5ICC A;  4WX9 A;  4BHC A;  1X2N A;  1KU3 A;  3OOU A;  2TDX A;  3FMR A;  2STW A;  2EWN A;  3ROU A;  3HSF A;  3BR0 A;  3BJA A;  3BT9 A;  2IA2 A;  3DTE A;  2FRH A;  1VF9 A;  3HOU J;  2OUM A;  3JTG A;  3MMY B;  2O61 A;  3BG5 A;  4EEF G;  3J80 K;  3IH4 A;  2PG4 A;  1R9T J;  2A68 F;  1UST A;  2I5U A;  3JTH A;  2RAE A;  2X6W A;  4LLG F;  3ONQ A;  3A01 B;  3T8T A;  1BI3 A;  2JUC A;  5EGO B;  1HSJ A;  2DW4 A;  1E17 A;  1JJ8 C;  3VWB A;  1I5Z A;  4A3J J;  2CQX A;  2E2J J;  2IPQ X;  4QIW N;  4GO1 A;  3RDI A;  3WTT C;  1JKQ C;  4X6A J;  1WH7 A;  4L9T A;  1NHA A;  4DYR A;  4CCM A;  4N0B A;  1J09 A;  3TQN A;  3CJR B;  2L9S A;  2CO5 A;  2V4J C;  2WV1 A;  5D5V B;  5LGN A;  4LB5 A;  3FHZ A;  1UEL B;  3F8F A;  3P9I A;  3OYN A;  4LK0 F;  1H89 C;  3R0J A;  1XS9 A;  1OQY A;  1WI3 A;  4P1W A;  2OTJ I;  1OPC A;  2K9S A;  2KIQ A;  3GO5 A;  2L7K A;  3HGG A;  4FE4 A;  4I6Z A;  1W36 C;  2RKH A;  5LFA A;  2BY2 A;  3E5Q A;  3I54 A;  2D1H A;  4DJA A;  3OSG A;  1YIT I;  4XLH A;  2R7U A;  2ZXW H;  2QSH X;  4PZJ A;  2FML A;  2FF4 A;  2ZKZ A;  3GWZ A;  4LLL A;  5F0F A;  1N77 A;  3BTC A;  1IF1 A;  1UG0 A;  3KYD B;  3K2A A;  2R7T A;  3CF2 A;  5J1U A;  2MGQ A;  2VON A;  5FO5 A;  3GTG J;  2MA3 A;  3BQY A;  4FIS A;  3T0Y A;  4XOP A;  2LY9 A;  4E7L A;  3ASO H;  3CUO A;  2HQN A;  3LST A;  4L9J A;  3FWE A;  5E1X A;  5HDG A;  4NC6 A;  1FC3 A;  3HRS A;  3U2R A;  2P6S A;  2DTR A;  1K78 A;  2CV2 A;  3C3W A;  3LMM A;  2V1N A;  5KNL A;  4W97 A;  4HLY A;  3A03 A;  1MJB A;  2WC2 A;  1WQ2 A;  3M1E A;  3L2Q A;  2HVQ A;  2WWY A;  3AKZ A;  4IOA F;  3U1K A;  4IHS A;  4ESF A;  2X48 A;  4NC7 A;  3SQN A;  4XID A;  5DCM B;  3SDB A;  3G1M A;  2OU2 A;  3SFZ A;  2MLG A;  4ENJ A;  2HDW A;  5IT9 Z;  1XMA A;  3QPH A;  1IN6 A;  2H94 A;  2YX7 A;  1MW7 A;  1TW2 A;  2EBI A;  3KP2 A;  2Z3Y A;  5E20 A;  3J7Z I;  2ICW G;  2XAF A;  1UB9 A;  2JA2 A;  3B02 A;  5KCM A;  3TKY A;  4NC8 A;  4A3G J;  3R6S A;  5M5W J;  4BBR J;  5KHD A;  4KFC A;  2VAS A;  3RQ4 A;  5DS9 A;  2WTE A;  3LSJ A;  2LNB A;  4IXA A;  5FFX A;  1OCR H;  1F9N A;  4UUV A;  2JK3 A;  2PJP A;  3GTJ J;  1X1P A;  2IS6 A;  1EH7 A;  4KMF A;  2L01 A;  4MNU A;  4BUP A;  1Z6R A;  2VKE A;  1C0W A;  4JP0 A;  1IN4 A;  4E7J A;  3KCC A;  4Y33 A;  1YIJ I;  2EH3 A;  3MN2 A;  2GAU A;  1B59 A;  2Y2Z A;  4OMZ A;  2LP0 A;  3O8G A;  3S1R J;  3L09 A;  2M7B A;  2MSY A;  3GUD A;  1E3P A;  4P55 A;  4CCL A;  3IAS 2;  3IV5 A;  3P9C A;  4MEX F;  2FBI A;  4MLO A;  2LYC A;  5EEG A;  3JRD A;  1W0U A;  1AKH B;  1WWX A;  2Y69 H;  1HST A;  5GP9 A;  2CUF A;  2IW5 A;  1T8I A;  3TOA A;  1SMY F;  5E3L A;  2OZU A;  2CMP A;  2XRN A;  4DZJ A;  2NAZ A;  1YW8 A;  3D5S C;  3E5X A;  2KKO A;  2O8X A;  2R7Q A;  4YFX F;  2ELH A;  4YIR X;  2Y48 A;  3R60 A;  5EDN A;  4XNF A;  1R23 A;  1VQP I;  2IEK A;  2XB0 X;  5JVT A;  4U0Y A;  2XPU A;  4CXF A;  2XGE A;  2P4W A;  4UVA A;  4I98 B;  4RGR A;  1OCT C;  2LMD A;  1Z9C A;  2UZK A;  2HU9 A;  3GEZ A;  1D5V A;  3ZRG A;  3BZC A;  5IT9 K;  3GBG A;  2HQ5 A;  3DLA A;  3JRC A;  1QA6 A;  3ZCO A;  1Z7L A;  1EH8 A;  2HS5 A;  2DXI A;  4L5J A;  4J00 A;  1WPK A;  2E34 A;  2R7W A;  2CW0 F;  5F6F A;  1ODD A;  2DJN A;  1RPW A;  3BPX A;  1WFX A;  1APL C;  2K5C A;  2XF6 A;  5K7Z A;  1D0Z A;  3ASN H;  3HRU A;  1MBF A;  4AIH A;  3LQQ A;  1IUF A;  2DOE A;  4HG2 A;  3TO6 A;  2K9L A;  1ZAR A;  4CCK A;  4RB1 A;  1ZGW A;  2E36 A;  4HNU A;  3CO6 C;  4P5O A;  3VSL A;  1X1A A;  2DT6 A;  2P6T A;  2ZXJ A;  3ZMV A;  2H1K A;  3EUH C;  1GDT A;  3RSN A;  3HB9 A;  2VBX A;  2LG4 A;  2O6G E;  2OZ6 A;  4HOB A;  4A3C J;  1J2X A;  2NS0 A;  1X19 A;  2DT7 B;  2GM4 A;  1LFU P;  2X6X A;  5HLH A;  5FB2 A;  4EJT A;  4C2T A;  2DFF A;  2A69 F;  1I3A A;  2VQH A;  3ZN1 A;  2E1O A;  3S16 J;  2ZNY A;  3KZY A;  2PJR A;  2QGU A;  2WBM A;  4YG2 F;  1MDM B;  1R7J A;  2DA2 A;  2LRE A;  4I01 A;  2XIG A;  1G8X A;  4JX4 A;  4IHY A;  1Z1D A;  1IN5 A;  5EEH A;  4A3F J;  2E1N A;  4YIF A;  3CME I;  1Z77 A;  3KZI C;  1JXS A;  1GVJ A;  3V8L A;  4AIJ A;  1IDZ A;  4GRI A;  4FHT A;  1JJ6 C;  1HA8 A;  1FJL A;  3LNQ A;  4A3L J;  1X3W B;  5D4S A;  2PFB A;  2XGC A;  3BWG A;  3K1N A;  1YO5 C;  1QO0 D;  3M9A A;  2COM A;  2M4G A;  2ZB9 A;  1LUJ B;  1FT9 A;  5J4Y A;  2VB6 A;  5IY5 H;  5DCF A;  4I76 A;  2ME6 A;  4QTR A;  1TT0 A;  2JA6 J;  1L0O C;  2NVT J;  5L3G A;  2K3P A;  1Q1V A;  3G1L A;  4MHG A;  1MND A;  2R7F A;  3L00 A;  3DF8 A;  1ZK8 A;  2XAG A;  1N25 A;  3UR3 C;  2R7O A;  2E19 A;  3LFK A;  3HDD A;  4ZYH A;  2X1C A;  2KDZ A;  4G7O F;  2L7M P;  1TQP A;  3DBL B;  2GA2 A;  3D5R C;  4FE7 A;  1WVR A;  4QPO A;  3RI4 A;  2FX0 A;  2M0C A;  1IG7 A;  4IHW A;  4LIV A;  3BG9 A;  1W1W E;  3F8N A;  3EDP A;  1FEX A;  4XN3 A;  3MKL A;  4I02 A;  4OAZ A;  2IS1 A;  3IRQ A;  3DU6 A;  3E6C C;  4DBR A;  3QQA A;  4PSX A;  4X1E A;  1P92 A;  3KEO A;  3PNY A;  3GYH X;  2XHK A;  1LVK A;  2AXT C;  4K2E A;  5JLW A;  5D5X B;  4F3Q A;  2L9R A;  4WWC A;  2JWT A;  4RAZ A;  1HOM A;  4PFP A;  3G1O A;  3FXM A;  3QAH A;  4HAM A;  4M9X A;  3U9G A;  3IP4 B;  3H3V K;  2KIS A;  4XRM A;  1MBG A;  3FM5 A;  3I59 B;  4KUM A;  1VND A;  1ZTR A;  3ERM A;  3MVP A;  4IVN A;  5HOO A;  3Q9V A;  5IP7 J;  2KQR A;  2QQB A;  4BDZ A;  1W0T A;  1SVO A;  2LY1 A;  3OL3 A;  2DMU A;  3BZ6 A;  3R61 A;  2DA6 A;  3U21 A;  1VQL I;  1V5F A;  2KLO A;  3BCA A;  2M87 A;  3BDD A;  1DGR M;  1T98 A;  2BY0 A;  1R5I D;  2X9D A;  3QP5 A;  1HW2 A;  4OU0 A;  3HRM A;  3K6G A;  2V1U A;  4F7Z A;  1QU3 A;  2M1B A;  2XAS A;  4BY1 J;  3K4B A;  2IXS A;  5IP9 J;  2LKP A;  4P9U A;  3I4M J;  4IX7 A;  5D8L B;  4E7S A;  1A6Q A;  2KDO A;  4L18 B;  2A07 F;  4UHT A;  1BOB A;  2BXZ A;  4JK1 X;  2KIF A;  1ZR2 A;  2HDC A;  5CVI A;  2E5Z A;  3BQZ A;  3L2R A;  4BQO A;  3CCU I;  2PLY A;  1S7O A;  4KIF A;  4PGH A;  2R7Z J;  4G7Z F;  2BZT A;  4S04 A;  2FBK A;  3QYE A;  5M3M J;  4XMY A;  3SEZ A;  1GLN A;  2L5Q A;  4A0X A;  3CCS I;  1FLI A;  1MZB A;  1V54 H;  3BR6 A;  1L3L A;  1YI2 I;  5FLX Z;  2ME0 A;  1U3E M;  1G3Y A;  4ZH4 F;  1BIA A;  1F5T A;  1IN7 A;  2PI0 A;  4HF1 A;  2P8T A;  3WE3 A;  2BW3 B;  1E2X A;  4A3I J;  2XKO A;  2ESH A;  2CWE A;  2ISY A;  5GAG J;  3VYR B;  1YOV B;  2IBD A;  3LSM A;  1I1S A;  1S7A A;  3WTW C;  2HKX A;  1D3Y A;  2XUB A;  3DTK A;  4BAC A;  1YX3 A;  2LH9 A;  2EA4 A;  4J19 A;  5TIS C;  3WHC A;  1SC7 A;  1CGP A;  4ZZD A;  4HDV A;  2X85 A;  4EJW A;  2LBF A;  2XGX A;  3B6A A;  5J4V A;  2F5C A;  2L7F P;  2F5D A;  3COA C;  1FBQ A;  1QBJ A;  3E1S A;  3Q0V A;  1A36 A;  2ZSI B;  1FOY A;  1W5S A;  1WJ5 A;  1ETO A;  2HZT A;  3TDZ C;  1LJ9 A;  4UNO A;  2DFH A;  2W57 A;  4A93 J;  1ZN2 A;  1V5G A;  2VLA A;  2DCE A;  3LA3 A;  1IV8 A;  2HKO A;  3PQJ A;  1IW7 F;  3BTL A;  1Z91 A;  2WAD A;  4XRS A;  1ONV A;  2K4J A;  3WTZ A;  3JRG A;  3VFZ A;  5ICF A;  2K27 A;  2BXY A;  2AO9 A;  5J6X A;  2QVO A;  3V7R A;  5HOD A;  4R8H A;  5LLQ A;  2W82 A;  1IDY A;  1JUS A;  3M3Y J;  2A6T A;  4CH7 A;  4PJL A;  2IGM A;  1DU6 A;  3KLO A;  3FKJ A;  4H4K C;  3CLQ A;  1DDN A;  5D4R A;  3BJ6 A;  4AM3 A;  3OMY A;  3G73 A;  5L3F A;  3GZ5 A;  4ESB A;  3RIR A;  2EV5 A;  1ON2 A;  1K78 B;  4ESJ A;  1XD7 A;  2EFP A;  2X4H A;  3CO7 C;  4EGZ A;  1SEU A;  5AIP A;  3PSF A;  2K86 A;  1QHH D;  1DPU A;  4A6D A;  2W25 A;  3KP6 A;  1BBY A;  4M3E A;  2DDA A;  4NBQ A;  1MMG A;  3GTP J;  1UHW A;  3HOS A;  3TMO A;  1MBJ A;  2FJ1 A;  2KP6 A;  2JPC A;  5AON A;  2CYY A;  4Q47 A;  3GZ6 A;  1QVT A;  2CS3 A;  3ZQG A;  2DA7 A;  2ECB A;  3WGI A;  4D7M A;  1RR7 A;  2FBH A;  3OYJ A;  2R0Q C;  1VQK I;  3LSH A;  1YJN I;  1O3T A;  3QPS A;  2XF7 A;  4KIC A;  2UXN A;  5JFR A;  5JI6 A;  1AOY A;  5F1R A;  1Y8R B;  2JVG A;  2K85 A;  3LSI A;  4EM2 A;  4ZYD A;  1WJC A;  2BE5 F;  5ICE A;  2CQ7 A;  2DYR H;  4AU7 A;  1RUO A;  3OR1 C;  2CFX A;  3KZZ A;  1U2W A;  2FQ3 A;  5IP6 A;  2LKX A;  2WAE A;  3OS1 A;  5K5O A;  4M72 A;  2M9H A;  2IAI A;  2KRC A;  1EJ9 A;  2VBW A;  2B9S A;  3KE2 A;  1WHU A;  1A35 A; 
#chains in the Genus database with same CATH homology
 3BRO A;  2M30 A;  4WXD A;  1RI7 A;  2QUF A;  5HS7 A;  3ZPL A;  3FF5 A;  1FWZ A;  3GLX A;  2L02 A;  5LRR A;  4P9F A;  3PQK A;  2FSW A;  3IRR A;  4HBL A;  1ZRD A;  4FT8 A;  1U5T A;  2JSC A;  3HHH A;  2VE8 A;  1R1U A;  1XCB A;  4A5N A;  1J59 A;  3L7W A;  2PMU A;  5ERI A;  3T1B A;  3L2C A;  1I1G A;  2LF8 A;  4G6Q A;  1KYW A;  4XLP F;  3HHG A;  3ZMS A;  3KET A;  1FYM A;  1Q1H A;  4ON0 A;  4G7H F;  1SMT A;  2VOP A;  2F5E A;  2DFI A;  2A6H F;  2OAZ A;  4ENK A;  3ZMU A;  2QZ8 A;  4Y13 A;  4PDK A;  3QOP A;  2Y0M A;  3T5X A;  5D8K B;  1R58 A;  4L9V A;  2FMY A;  2ADU A;  2JPB A;  5H20 A;  3TO9 A;  2D45 A;  2R7D A;  5CVR A;  2FOK A;  5D6E A;  1G3S A;  2OQG A;  4KN4 X;  3R0A A;  1FYK A;  2DI3 A;  2HTJ A;  2YSR A;  4HF0 A;  3FM3 A;  2RN7 A;  3RKW A;  4G9Y A;  5ILS A;  2DT5 A;  4WXC A;  4OIR F;  1O7L A;  5LEJ A;  3I0T A;  3GVA A;  4DQ2 A;  4AD9 A;  4L9N A;  3EET A;  3RKY A;  4LB6 B;  1JHH A;  4O6J A;  3V4G A;  3F8B A;  1R5H A;  3J81 Z;  2JT1 A;  2Z99 A;  4LGW A;  4YII A;  1YFH A;  1CF7 A;  2VOO A;  4S05 A;  1P4W A;  3ZN0 A;  2K4B A;  3KLN A;  3GXO A;  1ZYR F;  1KQ9 A;  3FX3 A;  3KP5 A;  4BNC A;  1SD7 A;  1ZH5 A;  1LEA A;  5DD4 A;  4KIG A;  2FEZ A;  2GWR A;  1IN8 A;  2RNJ A;  2R3S A;  4RGX A;  1SD6 A;  1JGS A;  5TRD A;  3C1D A;  3K1P A;  5J8F A;  1ZG1 A;  1XSV A;  4WCG A;  2ZO4 A;  2QQA A;  2P5K A;  1O57 A;  4OMY A;  1HKQ A;  1KQ0 A;  3RKX A;  3IHU A;  3KP7 A;  1O7F A;  2EFQ A;  1PUE E;  1K79 A;  2H09 A;  3J81 K;  4U88 A;  3F23 A;  1XGS A;  3HTS B;  1S8N A;  3KFW X;  2H6C A;  2WV0 A;  5DDG A;  1J75 A;  1FOK A;  2O3F A;  4EJV A;  1LVA A;  1OYY A;  4XBF A;  2A61 A;  5KVR A;  6PAX A;  4M9S A;  4BHB A;  3O3K A;  3C18 A;  1P4X A;  2X0L A;  1T6S A;  3P9K A;  3LWF A;  3I71 A;  1K6O A;  1ZLK A;  2OQR A;  2LF7 A;  1XMK A;  1KYZ A;  2G7U A;  3IWF A;  4HX4 A;  4HQE A;  3F21 A;  4BXU A;  4BHP A;  3IKV A;  1KU7 A;  2BGC A;  3DP7 A;  1BI1 A;  3CJN A;  5D5W B;  2QBY A;  1OMI A;  5H6Q A;  3VB2 A;  3N97 A;  2DQR A;  4B09 A;  4N9I A;  5A2Q Z;  1BJA A;  1MJ9 A;  3TOB A;  3IWZ A;  5TJJ A;  1OR7 A;  4KDP A;  1OKR A;  3E5U A;  3SZT A;  4NHJ A;  2W24 A;  1LDJ A;  4MGR A;  1T2K A;  1GHC A;  4IRI A;  2QYO A;  2RQP A;  2A5Y B;  2O0Y A;  5F64 A;  3F6V A;  3FMS A;  2HQR A;  2Z9O A;  4LG0 A;  2XV4 S;  3MZH A;  2NRA C;  5LHH A;  1WSU A;  1J0R A;  5CJ9 A;  4PCQ A;  2VXZ A;  3RYR A;  2CQK A;  1H0M A;  4ZYG A;  3NQO A;  1HW5 A;  3CUQ A;  2J5P A;  1IZ1 A;  2UXX A;  2EJR A;  1LB2 A;  4LLN A;  1IAW A;  4KIB A;  5CLS A;  1KU2 A;  5A2Q K;  4OIQ F;  3D5L A;  2Z5U A;  2H27 A;  1QNT A;  1TQM A;  4R1H A;  4L5I A;  4D0P A;  3HSR A;  1RZ4 A;  3DPL C;  1O3S A;  4MEY F;  1I27 A;  5LGU A;  3E3V A;  2IRF G;  3R4K A;  1Z7U A;  3QPT A;  3G3Z A;  3SZP A;  1G4D A;  3WGH A;  2AXL A;  5E1W A;  5ED4 A;  4M73 A;  3WTS C;  2XAQ A;  3DQV C;  1HKT A;  3CLO A;  1R22 A;  3QU3 A;  1U5T C;  1U5T B;  4E70 A;  3L9F A;  3WE2 A;  3E6M A;  1XSD A;  2B0L A;  5KK1 A;  2P7C B;  3K69 A;  3RJP A;  1YLF A;  1FSE A;  3HSE A;  3OV8 A;  2ACJ A;  2HYF A;  4RGS A;  2ESN A;  3RPQ A;  3AAF A;  4XLN F;  1FNN A;  2ZME B;  5D6F A;  2EV6 A;  2EV0 A;  2L4M A;  1TNS A;  3HRT A;  4HLX A;  2W85 A;  4LD5 A;  4IRG A;  3MEX A;  3GFM A;  3DFG A;  5CVJ A;  1OYI A;  1HBX G;  1O3Q A;  5E8I A;  2VOD A;  4IPA A;  3KP4 A;  1SFX A;  1XSX A;  4A12 A;  4BH9 A;  3MCZ A;  5L3B A;  2VE9 A;  2IT0 A;  1BC8 C;  4U0V A;  1FP2 A;  1XGO A;  4EQQ A;  2H6B A;  5BPI A;  4ETS A;  3GW2 A;  3BPV A;  3H3U A;  2DK5 A;  3ZP5 A;  3MAJ A;  3EQL F;  4KT5 C;  2MBF A;  3B73 A;  1LEB A;  1J9I A;  3DV8 A;  1DPR A;  2JTV A;  1D8J A;  3O6B B;  2G7H A;  2EFO A;  2PMH A;  3GFJ A;  5DYM A;  3QU6 A;  1O3R A;  1T0F A;  1WRJ A;  1R1V A;  2DPU A;  1CF7 B;  4R79 A;  3GX4 X;  4CYD A;  4ENM A;  3O2P E;  2ETH A;  2BBY A;  3WTU C;  3OOP A;  4P96 A;  1K7A A;  4ZZL A;  3HIF A;  4FX0 A;  2DAO A;  4EM0 B;  1TBX A;  3BP8 A;  3F8C A;  4A2U A;  3K9T A;  4G6D A;  3WG9 A;  4HA8 A;  5K5Q A;  4LMY A;  5LRS A;  2RVC A;  5K5R A;  3EYI A;  3WTY C;  4A0Z A;  2LDU A;  2L54 A;  2QM3 A;  3WU1 B;  2E7W A;  2MH2 A;  4FX4 A;  1LDK B;  3E6D A;  2DPD A;  1WKM A;  3ULQ B;  1G3W A;  1PP8 F;  2FU4 A;  4H0E A;  5IT3 A;  4G8X A;  4QLC U;  1TQI A;  4U7D A;  5LEK A;  3HUG A;  4CDG A;  3H92 A;  3TGN A;  2EB7 A;  2EFW A;  4RB3 C;  5JR3 A;  3TDU C;  1YW9 A;  4HZF A;  2G9W A;  3BOQ A;  3HTU A;  2Y75 A;  1MJA A;  4WXH A;  2BEO A;  2W84 A;  1QZZ A;  2RGV A;  4YFN F;  3HYI A;  4WK8 F;  3VOE A;  2XRO A;  3NEU A;  3IC7 A;  2CGP A;  1FPQ A;  1IUY A;  2DU9 A;  2Z33 A;  5BMZ A;  2GIV A;  5LGT A;  2KIU A;  3REO A;  2GQQ A;  4G94 A;  1T39 A;  1W7P B;  3CDH A;  3LA7 A;  1MD0 A;  1FYL A;  5HLG A;  2QBY B;  2STT A;  2MLK A;  1FBS A;  3F6O A;  3FZV A;  2DK8 A;  4EMS A;  3JAM Z;  3F3X A;  3ZMD A;  3I53 A;  2HOE A;  4I0B A;  2RDP A;  2OA4 A;  3ABU A;  3CTA A;  5CYV A;  2L4A A;  1R36 A;  2Q0O A;  5BQT A;  2ZME A;  1I6X A;  4LFU A;  3M7G A;  4UV8 A;  3N4M A;  2P5V A;  3T8R A;  2A3S A;  1KQ8 A;  5CVV A;  3MFK A;  1YQA A;  5K1Y A;  1JHF A;  3RPU A;  1U6G A;  4LG0 B;  3E97 A;  3WOD F;  5HDN A;  3JSO A;  1Y0U A;  4ZYE A;  5L3D A;  4MQ9 F;  4JQF A;  3ABT A;  2NNN A;  4U7B A;  5DUK A;  2ISZ A;  1ZHF A;  1QPM A;  3FXQ A;  2IP2 A;  2IA1 A;  3ISP A;  2EK5 A;  3CUQ C;  3CUQ B;  2HGC A;  1UHM A;  2KJC A;  1SAX A;  1YYV A;  4N9H A;  4IHT A;  3FMQ A;  1YW7 A;  2E1C A;  1UFM A;  3JAM K;  1ULY A;  2FNP A;  1RUN A;  4I7H A;  1IRF A;  2XAJ A;  3F22 A;  1QGP A;  2QLZ A;  1TW3 A;  3V8K A;  3DEU A;  1F1Z A;  5E1Z B;  1OYW A;  4U0W A;  1ZAO A;  1RNL A;  1FZP B;  3HOT A;  3QRF F;  4UV9 A;  1H9T A;  3SXY A;  2HFH A;  2KRF A;  1X3U A;  1S3J A;  1SFE A;  1KA8 A;  2VT2 A;  1TNT A;  3Q9S A;  4NB5 A;  4NQW A;  1J5Y A;  4XSX F;  5ILV A;  4ASN A;  2V6C A;  1IRG A;  3C7J A;  4CGZ A;  5FD6 A;  4IRH A;  2VBY A;  4M71 A;  1LQ1 A;  3EYY A;  1WI9 A;  4HW0 A;  5HS9 A;  1HKS A;  2J5O A;  3WTV C;  1SD4 A;  4L0Z B;  4KYW A;  1EH6 A;  2UWM A;  1W7P D;  4LJZ F;  4OIP F;  1B1B A;  4GCV A;  4XSZ F;  1ZG5 A;  1BC7 C;  5HDK A;  2CSO A;  1F4K A;  2V1X A;  2HWV A;  4OOI A;  3LAP A;  1KGS A;  3KEQ A;  3TO7 A;  4M6X A;  1TLH B;  3I64 A;  4OIN F;  1SD5 A;  3ZMT A;  2QQ9 A;  1R5G A;  4M6Y A;  4UXN A;  1T38 A;  2NNY A;  1KU9 A;  1BI2 A;  5ILU A;  4XRF A;  1GXP A;  2D2W A;  1G3T A;  2OD5 A;  3DPT A;  3W6J B;  2MD5 A;  2HEO A;  5BOX A;  4EGY A;  1QQI A;  4QWQ A;  1H9G A;  3SHF A;  3E6B A;  2Q8K A;  5L3E A;  1W7P A;  5E18 F;  1EV7 A;  1IXS B;  1ZRF A;  4KNY A;  3ML6 A;  1AWC A;  2V1D A;  2M5W A;  4IJA A;  1IXR C;  4A5M A;  5HS8 A;  1Z6T A;  3J7A O;  3JSP A;  1XB4 A;  4BYY A;  4MQV A;  4O3M A;  3I5U A;  4MTE A;  1LNW A;  3F72 A;  5D5U B;  4AWX B;  4HV5 A;  4Y15 A;  1HW1 A;  3JW4 A;  5HVQ C;  5AIQ A;  2FE3 A;  4Q48 A;  1U8R A;  2PN6 A;  4RB2 C;  1FX7 A;  2P7V B;  3RYP A;  1FBU A;  2FXA A;  3PFI A;  4HYE A;  1GXQ A;  3IKT A;  5E8G A;  2XAH A;  1D8K A;  2JZY A;  1XDU A;  1UCR A;  3M8F A;  2L3D A;  2XKP A;  2F5F A;  2VN2 A;  2PQ8 A;  4O5V A;  4HQM A;  4I0A A;  3ECH A;  2GXG A;  3K0L A;  2K7L A;  3BJO A;  1B9M A;  2KIM A;  3V8J A;  1REP C;  2PEX A;  3I58 A;  2IJL A;  3W6K B;  2HR3 A;  2EFN A;  2EA2 A;  1S6L A;  2C6Y A;  4CZZ A;  1S29 A;  1XCV A;  5H6R A;  5LHI A;  4OIO F;  2DBB A;  2IA0 A;  5E17 F;  4GXO A;  4UVB A;  2O03 A;  2IVM A;  3BY6 A;  4BAY A;  1R00 A;  4DNC A;  4MTD A;  3D0S A;  3LA2 A;  1STZ A;  5DV5 A;  3ELK A;  1YS6 A;  2M45 A;  4HDU A;  4RB0 A;  4CHU A;  2ZME C;  1BI0 A;  5DEQ A;  2HTS A;  1YG2 A;  5JHU A;  5DUI A;  5DCM A;  3MQ0 A;  2JRT A;  2HYG D;  2M8E A;  4Y17 A;  2ZCW A;  1BN5 A;  4Q5S F;  2ZFW A;  1V4R A;  4M9Z A;  4GYG A;  2YPR A;  4EVI A;  3ZMZ A;  3FXU A;  3S2W A;  1DP7 P;  1HQC A;  2E7X A;  3Q5F A;  3K2Z A;  2DO7 A;  3V7C A;  1VTN C;  1FY7 A;  5BS6 A;  2FNA A;  2ZNZ A;  2RC4 A;  1SFU A;  1YS7 A;  1QZY A;  4GYI A;  2V9V A;  2DQL A;  5LBQ A;  4AIK A;  2PBI A;  2P5L C;  4Z2Y A;  3DKW A;  1ZRC A;  3U1D A;  1YIO A;  2VT3 A;  4EJU A;  4EV0 A;  2K02 A;  1ZRE A;  2ZBK A;  3RTR A;  4WF2 A;  1IXC A;  1G6N A;  1R1T A;  4AVP A;  2YR2 A;  2YX4 A;  1MKM A;  3H3Z A;  2GXB A;  4JBA A;  2KJB A;  3I4P A;  3EUH A;  3ECO A;  2MC3 A;  3FXR A;  1FSH A;  5HLI A;  4EJO A;  1P6R A;  3WTX C;  4KA4 A;  1P2F A;  5FLX K;  2VC0 A;  1ON1 A;  2RV8 A;  2BYV E;  4M74 A;  3ERE D;  1BOA A;  1PP7 U;  1XDS A;  1MDM A;  5J8C A;  4RAY A;  2VBZ A;  5CVU A;  2LSO A;  5FFZ A;  2CG4 A;  1JE8 A;  1XN7 A;  2BV6 A;  3MZY A;  3NRV A;  2MH9 A;  3VOD A;  1ZGA A;  1Z05 A;  4UVC A;  3M8E A;  4KMU X;  5ICG A;  4LK1 F;  1ZG3 A;  2F2E A;  4TV7 A;  4L0Y B;  1B6A A;  1RIO H;  3GF2 A;  1J7K A;  1DUX C;  1B4A A;  1BM9 A;  3VEP A;  4IF4 A;  1XGM A;  3WGG A;  2XVC A;  5BPD A;  1XGN A;  2VC1 A;  4GGG A;  2V79 A;  4Q4Z F;  5FD5 A;  3F8M A;  2ZJ2 A;  3LQR A;  3P7N A;  2DLL A;  4A0Y A;  1BIB A;  3QP6 A;  1TTY A;  4HV6 A;  4A6E A;  2FA5 A;  1W5T A;  1ZGJ A;  1A04 A;  1YTY A;  4PGG A;  3IL2 A;  2OBP A;  1LDD A;  2QEN A;  3J80 Z;  3WU0 A;  3LAJ A;  4I2O A;  1HXD A;  5L3C A;  3KP3 A;  1USS A;  5FGM A;  2Q2E A;  5DD8 A;  4BQA A;  2QWW A;  3I59 A;  4HF2 A;  4HX8 A;  4KN7 X;  4RS8 A;  5LHG A;  2AS5 F;  4I09 A;  4RGU A;  1W4M A;  2GZW A;  1U78 A;  4CIC A;  2D1V A;  4CO8 A;  1V3F A;  1B9N A;  2GA1 A;  1MGT A;  4YFK F;  2A6E F;  4ENN A;  2NYX A;  3GFL A;  1FP1 D;  3V7S A;  4EM1 A;  3K1M A;  1P4A A;  1ZLJ A;  3ZQ7 A;  4B8X A;  3DXJ F;  2YU3 A;  3MWM A;  4HX7 A;  1PDN C;  3GFI A;  5ICC A;  4WX9 A;  4BHC A;  1KU3 A;  2TDX A;  3FMR A;  2STW A;  2EWN A;  3ROU A;  3HSF A;  3BJA A;  2IA2 A;  2FRH A;  2O61 A;  3JTG A;  3J80 K;  2PG4 A;  2A68 F;  1UST A;  3JTH A;  4LLG F;  3T8T A;  1BI3 A;  1HSJ A;  2DW4 A;  1E17 A;  1I5Z A;  2IPQ X;  4GO1 A;  3RDI A;  3WTT C;  4L9T A;  1NHA A;  4N0B A;  3TQN A;  2CO5 A;  5D5V B;  5LGN A;  4LB5 A;  3FHZ A;  3F8F A;  3P9I A;  4LK0 F;  3R0J A;  1OPC A;  3GO5 A;  2RKH A;  3E5Q A;  3I54 A;  2D1H A;  4PZJ A;  2FML A;  2FF4 A;  2ZKZ A;  3GWZ A;  4LLL A;  1IF1 A;  2VON A;  5FO5 A;  2MA3 A;  3T0Y A;  3CUO A;  2HQN A;  3LST A;  4L9J A;  3FWE A;  5E1X A;  5HDG A;  3U2R A;  1FC3 A;  3HRS A;  1K78 A;  2P6S A;  2DTR A;  3C3W A;  4HLY A;  1MJB A;  2WC2 A;  1WQ2 A;  3M1E A;  2WWY A;  4IHS A;  4ESF A;  3SQN A;  5DCM B;  2OU2 A;  3SFZ A;  2MLG A;  4ENJ A;  5IT9 Z;  1XMA A;  3QPH A;  1IN6 A;  2H94 A;  2YX7 A;  3KP2 A;  1TW2 A;  2Z3Y A;  5E20 A;  2XAF A;  1UB9 A;  3B02 A;  3TKY A;  3R6S A;  4KFC A;  2WTE A;  2LNB A;  4IXA A;  5FFX A;  1F9N A;  4UUV A;  2PJP A;  1EH7 A;  4KMF A;  2L01 A;  4MNU A;  1Z6R A;  1C0W A;  1IN4 A;  3KCC A;  2GAU A;  1B59 A;  4OMZ A;  3L09 A;  3GUD A;  4P55 A;  3P9C A;  4MEX F;  2FBI A;  5EEG A;  1WWX A;  1HST A;  2IW5 A;  3TOA A;  1SMY F;  2OZU A;  2XRN A;  2NAZ A;  1YW8 A;  3E5X A;  2KKO A;  2O8X A;  4YFX F;  2ELH A;  2Y48 A;  3R60 A;  1R23 A;  5JVT A;  4U0Y A;  4CXF A;  2P4W A;  4UVA A;  4I98 B;  4RGR A;  1Z9C A;  2UZK A;  3GEZ A;  1D5V A;  5IT9 K;  1EH8 A;  2HS5 A;  4L5J A;  2CW0 F;  5F6F A;  1ODD A;  3BPX A;  3HRU A;  4AIH A;  3LQQ A;  3TO6 A;  1ZAR A;  4RB1 A;  3CO6 C;  4P5O A;  2P6T A;  2ZXJ A;  3ZMV A;  2VBX A;  2O6G E;  2OZ6 A;  4HOB A;  1J2X A;  2NS0 A;  5HLH A;  5FB2 A;  4EJT A;  2A69 F;  3ZN1 A;  2ZNY A;  3KZY A;  4YG2 F;  1MDM B;  1R7J A;  4I01 A;  2XIG A;  1Z1D A;  1IN5 A;  5EEH A;  2E1N A;  4YIF A;  1JXS A;  1GVJ A;  3V8L A;  4AIJ A;  4FHT A;  5D4S A;  2PFB A;  3BWG A;  3K1N A;  1YO5 C;  1QO0 D;  3M9A A;  2COM A;  1FT9 A;  5DCF A;  1L0O C;  5L3G A;  4MHG A;  2R7F A;  3L00 A;  3DF8 A;  2XAG A;  3LFK A;  4ZYH A;  4G7O F;  1TQP A;  2GA2 A;  3RI4 A;  3F8N A;  3EDP A;  4I02 A;  3IRQ A;  3E6C C;  3GYH X;  1P92 A;  3KEO A;  2XHK A;  4K2E A;  5D5X B;  4WWC A;  4RAZ A;  3QAH A;  4HAM A;  4M9X A;  3U9G A;  3FM5 A;  3I59 B;  4KUM A;  4IVN A;  5HOO A;  3Q9V A;  2QQB A;  3BZ6 A;  3R61 A;  2M87 A;  3BDD A;  1T98 A;  3QP5 A;  1HW2 A;  4OU0 A;  3HRM A;  2V1U A;  4F7Z A;  2M1B A;  2XAS A;  2LKP A;  4P9U A;  5D8L B;  4L18 B;  2A07 F;  4UHT A;  4JK1 X;  2KIF A;  2HDC A;  5CVI A;  2PLY A;  1S7O A;  4KIF A;  4PGH A;  4G7Z F;  4S04 A;  2FBK A;  4A0X A;  1FLI A;  1MZB A;  1L3L A;  5FLX Z;  1U3E M;  1G3Y A;  4ZH4 F;  1BIA A;  1F5T A;  1IN7 A;  2PI0 A;  4HF1 A;  2P8T A;  3WE3 A;  1E2X A;  2XKO A;  2ESH A;  2CWE A;  2ISY A;  1I1S A;  1S7A A;  3WTW C;  2HKX A;  1D3Y A;  2XUB A;  2EA4 A;  1CGP A;  4ZZD A;  4HDV A;  4EJW A;  2XGX A;  2F5C A;  2F5D A;  3COA C;  1FBQ A;  1QBJ A;  1W5S A;  2HZT A;  3TDZ C;  1LJ9 A;  4UNO A;  2W57 A;  1ZN2 A;  3LA3 A;  2HKO A;  3PQJ A;  1IW7 F;  1Z91 A;  1ONV A;  2K4J A;  3WTZ A;  3VFZ A;  5ICF A;  2K27 A;  5J6X A;  2QVO A;  3V7R A;  4R8H A;  5LLQ A;  3KLO A;  1DDN A;  5D4R A;  3BJ6 A;  3G73 A;  5L3F A;  3GZ5 A;  4ESB A;  3RIR A;  2EV5 A;  1ON2 A;  1K78 B;  4ESJ A;  1XD7 A;  2EFP A;  4EGZ A;  2X4H A;  3CO7 C;  5AIP A;  2K86 A;  1DPU A;  4A6D A;  2W25 A;  3KP6 A;  1BBY A;  1UHW A;  3HOS A;  2JPC A;  5AON A;  2CYY A;  4Q47 A;  3GZ6 A;  3WGI A;  2FBH A;  1O3T A;  4KIC A;  2UXN A;  5JFR A;  5JI6 A;  1AOY A;  5F1R A;  4EM2 A;  4ZYD A;  2BE5 F;  5ICE A;  1RUO A;  2CFX A;  3KZZ A;  1U2W A;  2FQ3 A;  5K5O A;  4M72 A;  2VBW A;  3KE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...