1U5TC

Structure of the escrt-ii endosomal trafficking complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
198
structure length
178
Chain Sequence
SALPPVYSFPPLYTRQPNSLTRRQQISTWIDIISQYCKTKKIWYMSVDGTSKNLFNNEDIQRSVSQVFIDEIWSQMTKEGKCLPIDQSGRRSSNTTTTRYFILWKSLDSWASLILQWFEDSGKLNQVITLYELSEGDETVNWEFHRMPESLLYYCLKPLCDRNRATMLKDENDKVIAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords appears to be functionally related to SNF7; Snf8p
publication title Structure of ESCRT-II endosomal trafficking complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
total genus 37
structure length 178
sequence length 198
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF05871 ESCRT-II ESCRT-II complex subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1u5tC02
1.10.10.570 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A "Winged helix" DNA-binding domain. Chain C. Domain 1 1u5tC01
4EJOA 2LKPA 2XVCA 1FYLA 4BYYA 3LAPA 1HW1A 1XGSA 3J81K 2VBYA 3V7CA 1J2XA 4GCVA 3SQNA 2A07F 5J6XA 1XGMA 3CUQB 4L9VA 2ACJA 3HIFA 4A0XA 2ZKZA 4RAZA 4EGYA 3C18A 1P92A 4AIHA 3WGHA 5K1YA 2GIVA 2QM3A 1IXSB 3KFWX 1BI3A 2H94A 2P5VA 3NQOA 3M9AA 1F5TA 2DLLA 2QENA 2X4HA 2V1DA 2F5EA 1P4AA 2HR3A 4KUMA 1QBJA 3JTHA 2DK5A 1G6NA 3RJPA 1K7AA 3GUDA 3P7NA 1G3YA 3BJAA 2FMYA 1HSJA 1O3TA 1LVAA 5E1WA 1EH8A 1EV7A 5CLSA 4EJVA 4ZYHA 2F2EA 2L01A 1XSXA 4RAYA 2RC4A 4WXHA 4H0EA 2D45A 2QVOA 2FE3A 4WWCA 1FBSA 4RGXA 3RKWA 2JZYA 2XAHA 3T8TA 4EJTA 2A61A 1XSDA 1Z1DA 1LNWA 3KP6A 4ENNA 2ZO4A 3DF8A 1VTNC 1KU2A 1OPCA 1BBYA 4N0BA 3T5XA 1I6XA 4XLPF 4P55A 5LBQA 1MJBA 1ZGJA 1YIOA 2GWRA 4M71A 1KU7A 2P8TA 2VN2A 1B9NA 1C0WA 3OOPA 1BI1A 1W5SA 3D0SA 1KYWA 4HV5A 3S2WA 2G7HA 4Z2YA 2A5YB 4WCGA 2YU3A 1GXQA 2ESNA 3MCZA 3JTGA 1SMTA 1KQ0A 3ERED 3QPHA 2GA2A 2GA1A 1ZHFA 2J5OA 2EA2A 1MD0A 4LLNA 5F1RA 1SAXA 5FB2A 5BPIA 1D3YA 2XKOA 3BROA 1LQ1A 4MNUA 2CWEA 2NS0A 1ODDA 3EYYA 2FNAA 5D5VB 1K79A 3J81Z 3FM3A 4PGHA 1F1ZA 4CO8A 5FD6A 3HRSA 3HUGA 4LLGF 4M9SA 2HKOA 2LDUA 1WWXA 4IXAA 2CFXA 1YW8A 3O3KA 2W57A 3WTZA 3F8NA 3LA7A 1SD6A 1R23A 2A69F 3JSPA 3SZTA 5ICFA 4ZZDA 3TOBA 2OZ6A 2COMA 4JQFA 4Q48A 1YW7A 1G4DA 5BS6A 3G73A 2HTJA 5IT9K 2GZWA 1FOKA 4BXUA 3VB2A 2VBXA 2OD5A 4D0PA 2XIGA 1DUXC 3ZMUA 4XSXF 2C6YA 3ZN1A 5L3FA 2FRHA 2F5CA 4EMSA 1XGOA 3WTVC 2L54A 2XROA 2O3FA 5LGTA 1KU3A 2EFPA 3HSFA 3FX3A 2VOOA 1I1GA 2PG4A 3F8MA 5L3GA 3DPLC 4LLLA 3E6BA 4B09A 4KFCA 4R1HA 3OV8A 4KA4A 3HTUA 1XMKA 1O7FA 2IVMA 2R7FA 1PDNC 3IRQA 4KYWA 1OMIA 3M7GA 1I27A 2XAGA 5D4RA 3V8LA 4I02A 4Q5SF 2LNBA 1RIOH 2ELHA 1H9TA 3MZHA 4IJAA 4L9TA 1S8NA 1T2KA 1O3QA 2JPBA 3WTTC 1U3EM 4A5MA 1BC8C 1DP7P 4R8HA 3GO5A 2VC0A 4M6YA 4ASNA 1ZH5A 3KP5A 4AIKA 5HLGA 2E1NA 3RYRA 1FC3A 4ON0A 1MZBA 3F22A 1IXCA 3QU6A 4DQ2A 1QO0D 1RI7A 1QNTA 4XLNF 2IA2A 2E1CA 2EA4A 3TDUC 2W84A 5HS8A 1YS6A 1KQ9A 1CF7A 2ISZA 1S7AA 4P9UA 2DU9A 2X0LA 4RS8A 3K0LA 2XASA 4L5JA 4MTEA 3CUOA 2HQRA 4IVNA 3V7RA 5AONA 5DD4A 5F64A 1ZGAA 1ZRCA 1HKSA 4TV7A 1WRJA 3QRFF 3ZQ7A 2MD5A 3E6CC 1KU9A 5L3EA 3F21A 4O6JA 4RB3C 4HW0A 1QPMA 1UB9A 5LEKA 4WK8F 4QLCU 3HOSA 2DQLA 2BGCA 3ZMDA 4L18B 1U8RA 5ED4A 3C1DA 4KDPA 1I1SA 5IT9Z 4A6EA 4LFUA 4A0YA 1TLHB 4YG2F 2XKPA 4MEYF 4M6XA 5H6RA 1MDMB 2DK8A 4R79A 5FLXK 3LSTA 2P6TA 3TQNA 1MKMA 1Z9CA 5FGMA 5CJ9A 4KN7X 3ZMZA 4FX0A 2P5KA 5DCMB 2M8EA 3RKYA 3F8CA 2QZ8A 1TQIA 2V9VA 2FEZA 2K7LA 3MAJA 1ON1A 5H6QA 1RNLA 1PUEE 1T38A 3BP8A 1R1UA 4ZZLA 2O61A 2VT2A 1WSUA 3H3UA 1DPUA 2VBZA 2QQBA 1FX7A 4LK0F 3GZ5A 3JAMK 1SD7A 3BDDA 4E70A 2W85A 2CYYA 5ICCA 1V3FA 4A0ZA 3U1DA 2IT0A 5LGNA 3T0YA 3EYIA 4CGZA 3RDIA 4EM2A 4LG0A 1FY7A 5FD5A 4G7ZF 1V4RA 3P9IA 3H92A 3QAHA 1LEBA 3GFMA 3K2ZA 2OQRA 4XSZF 3ZMTA 5L3DA 1ZRDA 2ZMEC 3FMRA 4UV8A 3IWFA 1TNSA 2D2WA 1E17A 2Q2EA 5HOOA 3RPUA 4ZH4F 2ZMEA 4BNCA 1XD7A 2Z5UA 4L0ZB 2L02A 4OU0A 4G7HF 2P5LC 4I0AA 1LJ9A 2DT5A 3M8FA 3Q5FA 3MWMA 1YYVA 3ECOA 2WWYA 5CVRA 2QQAA 3J80Z 2ZBKA 1OYWA 3RKXA 3C3WA 3M8EA 3I58A 4KNYA 3FMSA 2UZKA 1B9MA 2IA0A 1Z6RA 3HYIA 5JR3A 4L9NA 1U5TB 1RUOA 4BHPA 2PI0A 1KGSA 1X3UA 1SD4A 1IRGA 3TGNA 3FXQA 2VONA 1IW7F 4HYEA 4HQMA 3TOAA 3K1MA 1FBUA 4EQQA 1XN7A 4B8XA 2ADUA 2P6SA 3E5UA 2H6BA 2YSRA 4KMFA 2H09A 3KEQA 4Q4ZF 5FLXZ 3NRVA 2MH2A 4A12A 1SD5A 3E6DA 5HVQC 2LF8A 1HSTA 2E7WA 4CDGA 4FT8A 2FBIA 4XRFA 2MLGA 4U0WA 1GVJA 3DEUA 2NRAC 3L9FA 5HS9A 2NNNA 1BC7C 1QZYA 2M45A 3J7AO 4P9FA 1BM9A 2DPDA 2OAZA 4M74A 2VOPA 2K4BA 3BPXA 5JFRA 3TKYA 2EFQA 3Q9SA 2O03A 1ZRFA 5DCMA 4BAYA 3B73A 4NB5A 3JAMZ 1W4MA 4ZYGA 2PEXA 1PP7U 3VFZA 1FWZA 1HQCA 3I59B 4HA8A 2QQ9A 3LQRA 4L9JA 1DDNA 2P4WA 3HRMA 4ZYEA 1ZAOA 2KIUA 3DP7A 4YFKF 1IN6A 5D5WB 3NEUA 2BYVE 2MBFA 3C7JA 3GFIA 3ML6A 3K1NA 5K5RA 4HOBA 2FA5A 2QWWA 4A5NA 3SFZA 3ULQB 5DCFA 2HYFA 2HQNA 2KIMA 1T6SA 2F5FA 1NHAA 1LB2A 2IP2A 4M72A 2QBYB 5E1XA 2WC2A 1ON2A 1HXDA 2XRNA 4UXNA 1HW5A 2WTEA 3DQVC 2CSOA 5LRSA 2TDXA 1EH6A 3BOQA 4LMYA 1XCBA 4OIQF 3FXRA 1KYZA 4I2OA 3CUQC 1FP2A 1IRFA 5ERIA 5D4SA 4BHBA 3CUQA 2A6HF 3R61A 2KIFA 3JW4A 3TO9A 3HTSB 1U2WA 5EEHA 5ICGA 4S05A 1YW9A 2FNPA 3PFIA 1F4KA 2RN7A 1FYMA 2A6EF 3RI4A 1G3SA 4MEXF 3ECHA 1QZZA 2ESHA 3LAJA 2JTVA 3EUHA 2ETHA 4AVPA 2UWMA 3ROUA 5L3BA 2HFHA 5HDGA 2FXAA 4UUVA 1ULYA 2OA4A 2H6CA 4EM1A 4UVAA 3RYPA 4HLYA 1BIBA 1J7KA 3KLOA 3SZPA 2CQKA 3M1EA 2RQPA 3KZYA 5FFZA 3HHHA 4CICA 3P9CA 4IRGA 5ILUA 1LDJA 4LK1F 5F6FA 4OIPF 3FWEA 1S7OA 4KICA 3T8RA 1PP8F 4ESFA 2RNJA 1YTYA 4ZYDA 4ESJA 3BJ6A 3GYHX 5BOXA 4ETSA 3L09A 3MFKA 1ZG5A 4DNCA 1J5YA 5D8KB 1K6OA 1U78A 3W6JB 4EV0A 1FBQA 2BE5F 4UVBA 1REPC 3AAFA 1KA8A 1MGTA 3REOA 3WU1B 3VEPA 3H3ZA 3G3ZA 5ICEA 5CVVA 3F23A 2YR2A 3IL2A 4I09A 3GZ6A 1P4WA 4I01A 4IRHA 1JHHA 5CYVA 3V4GA 4WXDA 3F6VA 4OMZA 1XB4A 5LGUA 2IRFG 3PQJA 4GXOA 3QOPA 3J80K 2V1UA 2G9WA 1IF1A 1TNTA 2A68F 2KKOA 2GXBA 2FBHA 5DUKA 4KMUX 3K69A 3V7SA 2CG4A 3WG9A 3WU0A 4JBAA 3IC7A 2KJBA 3IRRA 2HKXA 1A04A 3DKWA 3I4PA 4LB5A 1O3RA 3F8BA 3KEOA 3MQ0A 4YIIA 4HAMA 1IXRC 3WE3A 5K5QA 2R7DA 4IRIA 1AOYA 5CVJA 5DUIA 1XGNA 3WODF 4YFXF 4EGZA 5D5UB 4KN4X 3GFJA 4WX9A 4GYGA 1WI9A 4OOIA 3ABTA 3ZN0A 5HLIA 4ESBA 1TQMA 5A2QZ 1RUNA 3N4MA 3TDZC 4G9YA 1BI0A 1F9NA 1YFHA 3FM5A 3E3VA 1R5HA 3K9TA 5LHHA 5FFXA 3IWZA 2VT3A 2XUBA 3F72A 2LSOA 4YIFA 1IN7A 1UFMA 5E8GA 3E5QA 2BBYA 4IPAA 1R1VA 5D6FA 1OYIA 2K27A 1XCVA 2FBKA 1XDUA 3N97A 2XAQA 4K2EA 1BI2A 2VE9A 2EWNA 1U6GA 3PQKA 4MQ9F 4MQVA 4FX4A 4O3MA 2MLKA 2FQ3A 4CYDA 5LLQA 5DYMA 1WKMA 1IUYA 3I71A 1HBXG 4I0BA 3WTXC 2O0YA 1P4XA 2FMLA 1L3LA 2WV0A 1J0RA 1USSA 2V79A 2AXLA 4U7BA 2VBWA 1Z05A 3DV8A 4AD9A 2IJLA 2PLYA 2E7XA 1YQAA 3L7WA 2IW5A 2HGCA 5JHUA 1IN8A 4JK1X 1ONVA 4Q47A 2DFIA 3KP2A 5AIQA 2EV5A 3V8JA 4OMYA 1IN4A 2O6GE 4KIBA 2VC1A 3SHFA 5FO5A 3I64A 1SFXA 2EFWA 3QP6A 3WTUC 4HF0A 1ZG3A 4G6DA 1ZG1A 1UCRA 3QU3A 2NNYA 4YFNF 5L3CA 1BOAA 3BPVA 2XAJA 1CGPA 3WGGA 5LEJA 3BY6A 3GX4X 3I5UA 2ZNZA 2EFNA 4L5IA 3WTWC 1B1BA 3WE2A 3B02A 1TTYA 4PZJA 1JXSA 4MHGA 4ENMA 3V8KA 2STWA 4BH9A 3GF2A 2JRTA 1L0OC 5LHIA 4RB1A 3VODA 1XSVA 1J59A 2PQ8A 2L4MA 4M9ZA 3CO6C 2P7CB 3I54A 3HOTA 4RGRA 5H20A 3LQQA 1R00A 4FHTA 1O3SA 5JVTA 1UHWA 1HKTA 4HF2A 3ISPA 3GWZA 4U88A 4HV6A 3KP7A 2VXZA 2Y48A 1FSEA 1LDDA 3R6SA 2Q8KA 2FU4A 2W24A 2Y75A 4EM0B 2Z9OA 3VOEA 4CZZA 2FSWA 4Y15A 1ZLKA 5E20A 1OR7A 2OBPA 3CJNA 2OQGA 3EDPA 5K5OA 2HDCA 1YG2A 3GW2A 5DV5A 1QGPA 2GQQA 2VODA 3HRUA 3DFGA 1MDMA 1SFEA 3ELKA 1Z7UA 2JPCA 1W7PB 5JI6A 2HOEA 5KVRA 2O8XA 3MEXA 3JSOA 4KIGA 2H27A 1R36A 2ZNYA 3P9KA 4RGUA 2R3SA 1J75A 2Y0MA 4HDUA 1UHMA 4RB2C 4KIFA 4EJWA 2EJRA 4F7ZA 4A2UA 2DTRA 4N9HA 2UXXA 4S04A 5D6EA 5DEQA 1FLIA 4HF1A 3HRTA 3ZPLA 3IKVA 2V6CA 1RZ4A 2D1HA 3QP5A 3QPTA 4Y13A 1CF7B 4M9XA 2OU2A 3GVAA 2LF7A 1B59A 2AS5F 2HTSA 2EK5A 2V1XA 3ABUA 3R4KA 1WQ2A 3HHGA 3BWGA 1FZPB 3GEZA 1FT9A 2M30A 1MJ9A 2IPQX 2ZCWA 1FNNA 4RB0A 5BMZA 1IAWA 4LB6B 6PAXA 2VE8A 3Q9VA 1K78B 4PCQA 5E8IA 2DI3A 4GGGA 1S29A 2KJCA 1STZA 4BQAA 5HS7A 5E17F 1G3WA 2P7VB 2HEOA 4WF2A 5TJJA 4MGRA 1P2FA 5HDKA 1KQ8A 1S3JA 5EEGA 3KCCA 2PFBA 4NHJA 5AIPA 2K02A 3L2CA 3GFLA 4HQEA 1FYKA 5LHGA 2HWVA 4PGGA 5A2QK 3KLNA 3MZYA 2CO5A 2BEOA 2UXNA 1T98A 2CW0F 4ENKA 5E1ZB 1ZYRF 3GLXA 5D8LB 1U5TC 1HW2A 2MH9A 2F5DA 4HX7A 5BPDA 1W7PD 1LDKB 1R5GA 2JSCA 1U5TA 5E18F 3RIRA 1T0FA 3FMQA 3L00A 4I98B 3BJOA 1OYYA 5BQTA 3ZMVA 2NAZA 1MJAA 3D5LA 3K1PA 2Z3YA 3HSEA 1HKQA 3CLOA 4ENJA 1BIAA 2G7UA 1R7JA 1P6RA 3I53A 4P96A 3RPQA 1GXPA 2K4JA 3LA2A 2YPRA 5LRRA 3CTAA 1BN5A 1D8KA 2DO7A 2DBBA 2QUFA 4UVCA 2MA3A 1O57A 4LG0B 1OKRA 5IT3A 4IHTA 1BJAA 4MTDA 3O2PE 3U2RA 3R0AA 2FF4A 3COAC 4OIOF 2IA1A 3SXYA 4P5OA 3GXOA 1XMAA 4N9IA 4U0VA 3CO7C 3RTRA 2XAFA 1Z91A 3DXJF 4HLXA 1YLFA 1B6AA 3F6OA 2ZMEB 1DPRA 1ZN2A 1TQPA 4NQWA 1W7PA 4UNOA 4BHCA 4EVIA 4U0YA 2CGPA 2PN6A 2ISYA 3EQLF 1JGSA 4G8XA 2XV4S 5CVIA 5D5XB 3E6MA 2YX7A 4HDVA 4GYIA 2M87A 3WTSC 2M5WA 3FHZA 1J9IA 2EFOA 2RV8A 2PMHA 3I59A 3R60A 4AWXB 5KK1A 2FOKA 3DPTA 4EJUA 2DPUA 4L0YB 1O7LA 1G3TA 1T39A 3O6BB 1EH7A 2A3SA 2EB7A 4AIJA 3TO6A 2L4AA 3HSRA 4A6DA 1Q1HA 3E5XA 4HX4A 3E97A 4CHUA 4KT5C 4OINF 1IN5A 4GO1A 1JE8A 1YS7A 3IHUA 5J8FA 1IZ1A 2EV6A 3IKTA 3FF5A 4RGSA 3LFKA 5DDGA 1TW3A 3TO7A 3KP3A 3KZZA 4XBFA 2BV6A 2QYOA 1H0MA 4LJZF 3WTYC 2QBYA 4LGWA 5J8CA 4IF4A 2RVCA 2RGVA 1K78A 2XGXA 4G7OF 2XHKA 2EV0A 2DAOA 4IHSA 5ILVA 1H9GA 3LA3A 4UHTA 2PBIA 3CDHA 5TRDA 2D1VA 5ILSA 3LWFA 4OIRF 3FZVA 2K86A 3KETA 2DQRA 3EETA 2HYGD 2YX4A 5CVUA 1B4AA 4HBLA 2NYXA 1FP1D 1R1TA 2ZJ2A 2W25A 1YO5C 3R0JA 2GXGA 2Z99A 2MC3A 2Q0OA 2QLZA 1R22A 3ZP5A 2RKHA 1FPQA 1TBXA 4HZFA 1TW2A 2HZTA 2OZUA 5DD8A 1W5TA 2L3DA 2HS5A 4LD5A 1E2XA 3KE2A 4I7HA 5HLHA 1ZREA 2J5PA 4G94A 2RDPA 2PJPA 2JT1A 2ZXJA 3KP4A 2B0LA 1XDSA 2PMUA 1QQIA 2DW4A 3F3XA 2Z33A 3I0TA 1ZLJA 1SMYF 4CXFA 1ZARA 1LEAA 3FXUA 3F8FA 2ZFWA 4U7DA 1Y0UA 3ZMSA 1AWCA 4QWQA 4PDKA 1SFUA 1D5VA 1JHFA 2M1BA 5HDNA 1S6LA 4O5VA 3U9GA 4HX8A 1R58A 2STTA 1USTA 4M73A 4UV9A 4Y17A 3BZ6A 1I5ZA 1FSHA 4G6QA 1D8JA 3T1BA 3WGIA 2GAUA 1GHCA 1Z6TA 3W6KB 4WXCA 2KRFA
chains in the Genus database with same CATH superfamily
3MN2A 4EJOA 3M3YJ 4A3LJ 2LKPA 2XVCA 1FYLA 4BYYA 3LAPA 1HW1A 1EKEA 4M3EA 4KISA 1RRJA 2L2OA 3K4JA 1XGSA 3JR9A 3J81K 2VBYA 3V7CA 3ASNH 4V19K 1J2XA 2LMDA 4GCVA 3SQNA 2A07F 5J6XA 1XGMA 5JLXA 2F48A 1BJZA 1VF9A 5FJ8J 4A3CJ 3CUQB 3PNVA 4L9VA 3W3CA 2ACJA 3HIFA 1V54H 3CC2I 4A0XA 2BHYA 2EZLA 2ZKZA 4RAZA 4EGYA 3HOUJ 3C18A 1P92A 4AIHA 2KRHA 3WGHA 2R0QC 5K1YA 4JP0A 2COBA 4CA0A 3ZQCA 2LC2A 2GIVA 2QM3A 3ABLH 1IXSB 3RZOJ 2HPMA 3KFWX 1BI3A 3JCUC 2HNHA 2E1OA 2H94A 4E4HA 2P5VA 3OYNA 1D1BA 1FOYA 4BACA 2AQFA 1QHHD 1VNDA 3NQOA 3VYTB 3M9AA 1F5TA 2DLLA 2QENA 1SANA 3HKZN 3V42A 2DOEA 2X4HA 2V1DA 2V26A 1OCCH 2F5EA 1P4AA 2HR3A 3OYBA 4KUMA 2X6WA 1YITI 3JTHA 1QBJA 2DK5A 1G6NA 2XF6A 3RJPA 1K7AA 3GUDA 5F27A 3P7NA 3UKGA 1G3YA 3BJAA 2L7KA 2FMYA 3LSJA 1HSJA 1O3TA 1LVAA 4IL6C 3CJQB 5E1WA 4CCMA 1EH8A 1EV7A 5F08A 3Q0UA 4AU7A 5CLSA 1OCRH 4EJVA 4ZYHA 5J1RA 2DJIA 3MZ8A 3GTLJ 2F2EA 1WPKA 2IGOA 2JA6J 3GCMA 2K85A 2L01A 2IAIA 2O7OA 1XSXA 1W5CC 2RC4A 4RAYA 4WXHA 4H0EA 2D45A 2QVOA 2KL4A 1MBEA 2FE3A 2LREA 4WWCA 1FBSA 4RGXA 3RKWA 2QKLB 4BJ5C 4JX6A 3K7AJ 5FRMA 2JZYA 2VLAA 2XAHA 1KONA 3T8TA 4EJTA 1RKWA 2A61A 1XSDA 2ME6A 5IP6A 1T8IA 1Z1DA 1LNWA 3KP6A 1Y6IA 4ENNA 2ZO4A 3DF8A 3FIWA 1VTNC 1KU2A 1VQ4I 4B3AA 1OPCA 1BBYA 1NG6A 4N0BA 2P81A 2IGKA 3T5XA 1I6XA 4XLPF 3OWTA 1OCOH 4P55A 1X1PA 1OLTA 4RAGA 1BR2A 5LBQA 1TL8A 1MJBA 3UNGC 2WV1A 1ZGJA 1YIOA 1A6QA 2GWRA 4M71A 3A1YA 1MBHA 1KU7A 2P8TA 2VN2A 1B9NA 4LIVA 2XPWA 2P0WA 1C0WA 4IZZA 3OOPA 3PM1A 4GFBA 2JA7J 3CCLI 1ZR2A 1BI1A 1W5SA 3D0SA 1KYWA 2ME0A 4HV5A 3TW6A 3S2WA 3OS1A 2G7HA 5EG0A 3A0BC 1G2HA 2A5WA 5EF6A 4Z2YA 2YUSA 2A5YB 1S5LC 4WCGA 4A3EJ 2R5YB 2YU3A 4RLFA 2KHMA 1SVMA 2A6TA 1GXQA 3HJEA 1JUPA 5F0CA 1VQKI 2ESNA 1I3QJ 1IGNA 4LITA 1F43A 3MCZA 1G8XA 3JTGA 1SMTA 2XPUA 3L2VA 1KQ0A 3ERED 1YX3A 2V9PA 3BTJA 4DBQA 3QPHA 2GA2A 2GA1A 1ZHFA 2J5OA 3I55I 2EA2A 3VDXA 1ZGWA 1MD0A 2CQQA 5JVGF 2R7SA 2XGCA 4LLNA 5F1RA 1SAXA 5J40A 4I76A 1JKOC 2CMPA 5FB2A 5BPIA 1D3YA 5GADJ 1Y1VJ 2XKOA 1Z77A 4PK4A 1S72I 3BROA 1ETOA 1Z7LA 3CESA 1LQ1A 1YRNB 3CCMI 3HOVJ 4MNUA 2NVYJ 2CWEA 2NS0A 1ODDA 3EYYA 2FNAA 4XKBA 5D5VB 1K79A 2K9QA 4ZTFA 1IV6A 3ZXSA 2XB0X 3J81Z 3FM3A 4PGHA 1F1ZA 2O5RA 3HXLA 4CO8A 5FD6A 3HRSA 3C2GA 2KZGA 3HUGA 4LLGF 2HKOA 4M9SA 4BEHB 3PJRA 1Z67A 2LDUA 1WWXA 4A3MJ 4IXAA 2IS2A 2CFXA 1YW8A 3ABMH 3O3KA 2W57A 3WTZA 3F8NA 3RQ4A 3LA7A 1SD6A 5FKKA 1A6IA 1R23A 2A69F 3JSPA 3SZTA 5ICFA 4ZZDA 3TOBA 1AHDP 4BDZA 3OSGA 2OZ6A 1OCTC 5F0HA 2COMA 4JQFA 2HVQA 4Q48A 1YW7A 4DZPA 3OYIA 2XSJC 3VYSB 5F1JA 1G4DA 5BS6A 3G73A 2CJJA 2HTJA 3LSGA 1P7JA 5B1AH 5IT9K 1WJEA 5J4YA 2GZWA 2K40A 2V1NA 1FOKA 4BXUA 1E0EA 3VB2A 3IV5A 2VBXA 2OD5A 4D0PA 2JA8J 2ECBA 2XIGA 1DUXC 3ZMUA 3FXLA 3DU6A 4XSXF 2C6YA 3KX2A 2QGUA 2QSGX 3ZN1A 5L3FA 3BT9A 2LRDA 1I50J 3LL7A 1FMVA 1VQPI 3DWLE 2HI3A 2FRHA 3OY9A 5E3NA 1FTZA 2F5CA 4EMSA 1XGOA 4CH7A 4C9YA 3WTVC 2R5ZA 2L54A 1N77A 3JRFA 2XROA 2O3FA 2EIJH 1MMAA 2OTJI 5LGTA 1KU3A 3W2AA 2EFPA 2NOGA 2ID3A 3FX3A 3HSFA 1ACIA 2PJRB 2VOOA 4JX4A 1I1GA 2PG4A 3F8MA 5L3GA 3DPLC 1SFKA 3VSKA 3DLLF 4A3BJ 2VASA 4LLLA 3E6BA 4XQFA 4B09A 4DIQA 1WVRA 4KFCA 1ETKA 1PVEA 1M1EB 4R1HA 1MNMC 3K70D 3OV8A 4PJNA 1VI0A 5J1YA 4NBQA 4KA4A 2E34A 3HTUA 1XMKA 2DMPA 1EA3A 2M4KA 1O7FA 2IVMA 2R7FA 1PDNC 2MFZA 1MW7A 3GTQJ 1Z21A 3A01B 3IRQA 4KYWA 5KAIC 1OMIA 3KYDB 3M7GA 4IHYA 1I27A 2XAGA 5D4RA 2NVTJ 2E71A 3V8LA 3LNQA 4I02A 4Q5SF 2LNBA 3K4CA 1WJCA 1RIOH 1ORKA 3PUBA 2QCOA 1N78A 2ELHA 2YU9J 1H9TA 2DFHA 4A69C 5KHDA 4B3XA 1WH5A 3MZHA 4IJAA 1JKPC 4L9TA 1S8NA 4V2GA 3BQYA 2BOLA 3LSMA 1FJLA 4XLHA 1T2KA 2ZJQF 2DCEA 2JPBA 3WTTC 1VQMI 1U3EM 1O3QA 4A5MA 2M34A 1BC8C 1DP7P 1OCZH 4U87A 2LR8A 4R8HA 2LBFB 3H0DA 3GO5A 2LVSA 4UB8C 5GAHJ 1BL0A 2VC0A 1WHUA 4M6YA 4J19A 2BXYA 4ASNA 1ZH5A 5HODA 1BOBA 2KLOA 2E5ZA 3KP5A 4AIKA 2VKEA 4RAFA 3PFYA 5HLGA 2PMZA 2E1NA 3SEQA 4IEJA 1WJ5A 2FX0A 3RYRA 3W6VA 2WAFA 1FC3A 2RAEA 4XNFA 4ON0A 3MKLA 1MZBA 2VPRA 3F22A 2HOSA 1IXCA 1ZTRA 3QU6A 4DQ2A 4CYCB 1QO0D 1RI7A 1TT5B 1QNTA 3E1SA 4XLNF 2IA2A 2E1CA 2EA4A 1TWHJ 3TDUC 4XR6A 4DYQA 2GOXB 2W84A 5HS8A 1TT0A 3H1CA 1YS6A 3J7AY 1KQ9A 1CF7A 2ISZA 3BQZA 3W2VA 1S7AA 5JHFA 4P9UA 1V5GA 2DU9A 2X0LA 4RS8A 2HOTA 2ICWG 3K0LA 2XASA 4G12A 2DYRH 4PFPA 4L5JA 3PIOF 1DGRM 1UHSA 4I99C 3FXMA 2NS8A 3BR0A 2QSHX 2N8GA 4MTEA 5HNHA 4V2FA 3PNTA 2W00A 3S1MJ 3CUOA 1PUFB 1ETQA 2HQRA 4IVNA 5EEAA 3CP2A 3V7RA 5AONA 5K7HA 1QVTA 5DD4A 5F64A 2VKVA 1T95A 1ZGAA 1ZRCA 1HKSA 3PIPF 2X1DA 2AO9A 1LE8B 4TV7A 2DN0A 1WRJA 2VJ4A 3E7LA 5CQGA 3QRFF 3ZQ7A 2MD5A 3E6CC 1PYVA 3B6AA 1KU9A 5L3EA 5M3MJ 3F21A 4J00A 1FEXA 4DZJA 4I6ZA 4O6JA 2EH3A 4OAYA 4RB3C 4DYRA 4HW0A 2KT0A 5HNFA 1YRNA 1U9OA 1QPMA 1UB9A 4OWRB 5LEKA 4WK8F 1HCRA 2CU7A 1XX5A 4QLCU 3HOSA 4HPQA 1UG0A 2DQLA 2BGCA 3ZMDA 4L18B 3MKWB 1WJBA 1U8RA 3EUAA 5ED4A 2JUCA 3C1DA 4KDPA 2XAUA 2DDAA 1I1SA 3H5RA 4JYKA 4HNVA 5IT9Z 4A6EA 4LFUA 4A0YA 4RDUA 1X1CA 1TLHB 3O8HA 4YG2F 2XKPA 2IGNA 2LYCA 4MEYF 4M3GA 1MSEC 2DMTA 5HLTA 3G1LA 4M6XA 5H6RA 1MDMB 2K3PA 4A3IJ 2DK8A 4R79A 3QQAA 5B3SH 1EJ9A 5FLXK 2X85A 3LSTA 2QKMB 1X4PA 2P6TA 3TQNA 1MKMA 1Z9CA 5FGMA 4FISA 5CJ9A 4KN7X 2E2HJ 3ZMZA 4FX0A 4XL9A 3OYHA 2P5KA 3X2QH 5DCMB 2M8EA 3RKYA 2EIKH 3F8CA 2H1KA 2LLKA 3GMEA 2O9LA 1QA6A 3IH4A 2E19A 2W1OA 1V5EA 3ABKH 3DBHB 2WBMA 4GDFA 2QZ8A 1TQIA 1XMXA 2BVLA 2VI6A 2DYSH 4BQOA 1TP4A 3HOWJ 3OYFA 2V9VA 3NWSA 2FEZA 2HVRA 2L9SA 2K7LA 3MAJA 1ON1A 5H6QA 5IOZA 3GLLA 3DU5A 1NTCA 1RNLA 1PUEE 1VQ8I 2JMWA 3W2WA 1T38A 3BP8A 2E60A 1R1UA 1SVLA 2JWTA 4ZZLA 1B72A 2O61A 2VT2A 4BGDA 1WSUA 2FOWA 3H3UA 1DPUA 1ENHA 2VBZA 2QQBA 3OIPA 1FX7A 1GV2A 1MMDA 4LK0F 1YX5A 3PSFA 4ZDPA 1MH4A 3GZ5A 3JAMK 1SD7A 2PJRA 3BDDA 4E70A 2W85A 2CYYA 3GTOJ 4HNUA 3L1PA 3K4NA 5ICCA 1W0UA 1V3FA 4A0ZA 2BW3A 5J1UA 3U1DA 1DP3A 3CCRI 3GTKJ 2IT0A 5IOYA 5LGNA 2EZHA 3T0YA 1T56A 4FTHA 3EYIA 4ABZA 2LTPA 3AG4H 4CGZA 4D7NA 1BW5A 4BQNA 3RDIA 2R7TA 4EM2A 4LG0A 1FIPA 1FY7A 3A01A 4PJLA 5FD5A 1GVDA 2MGQA 2CH0A 4G7ZF 2CUFA 1V4RA 3P9IA 3H92A 3QAHA 2LG4A 1LEBA 1TWAJ 3ZOBA 2HXOA 3GFMA 4PUSA 2OPTA 5E3OA 3K2ZA 2OQRA 4CCLA 4XSZF 1NK3P 3ZMTA 3L2QA 4RBOA 5L3DA 1ZRDA 2KMUA 2ZMEC 3OYGA 3FMRA 1LVKA 3IWFA 4L5EA 1TNSA 4UV8A 2D2WA 2LKXA 1E17A 4MO7A 3D1NI 2Q2EA 5HOOA 1Z3YA 3K2AA 3RPUA 4XICA 4ZH4F 1UMQA 2ZMEA 3DTIA 4BNCA 4BU2A 1XD7A 2DTZA 2Z5UA 2L02A 4L0ZB 2O8KA 1I6HJ 4OU0A 4G7HF 2P5LC 4I0AA 1LJ9A 2ZSHB 5M5XJ 2DT5A 3M8FA 3Q5FA 5FKOA 5FKLA 2EBIA 2WA0A 2XC7A 1VQ9I 3MWMA 1YYVA 1A5JA 3ECOA 3BTLA 2WWYA 2WY7Q 5GTIC 5CVRA 4HRIA 1Y56A 5EYRA 3NWTA 2QQAA 3J80Z 2ZBKA 3KYLA 4C3JJ 1OYWA 3RKXA 3CQZJ 1MSFC 3C3WA 4PFOA 5LD2C 2TRTA 2X48A 3M8EA 4CYCA 3PO3J 3I58A 4KNYA 1D1CA 2CV0A 3FMSA 1GV5A 3FBIB 2UZKA 1B9MA 2W48A 2IA0A 1Z6RA 3HYIA 5JR3A 4L9NA 1XPXA 2E2JJ 1U5TB 1RUOA 2IEKA 4D5FA 4BHPA 2IS1A 2PI0A 3IUOA 2FQ4A 1VQNI 1KGSA 1X3UA 1SD4A 2DOAA 3SJMA 3H5AA 1IRGA 2L9RA 1D0YA 3TGNA 3FXQA 3AG3H 1ETVA 2VONA 2X9DA 3G1OA 1IW7F 1MNEA 4HQMA 4HYEA 3TOAA 1OCPA 1FBUA 3K1MA 2ZXHA 5FKNA 4MFEA 4AVZA 4EQQA 1XN7A 3Q0WA 4B8XA 2ADUA 2P6SA 1SC7A 2Y2ZA 3JRIA 4XMYA 5CKTA 1SFOJ 2BHZA 4ZDOA 3E5UA 2H6BA 4PJMA 3BR5A 1T08B 2YSRA 1K61A 4KMFA 1MH3A 2H09A 3KEQA 4EEFG 3SEZA 5EZHA 5GAEJ 5FLXZ 4Q4ZF 3NRVA 4H4KC 3P5JA 2MH2A 3RKQA 4KITB 4A12A 1SD5A 3E6DA 5HVQC 1AKHB 2LF8A 1UG2A 1HSTA 4D5CA 3A03A 2E7WA 1TC3C 4CDGA 4Z6YA 1HOMA 4FT8A 3U1KA 1PJRA 1GDTA 3G2BA 2FBIA 4XRFA 5JLWA 2MLGA 3K10A 1P9QC 3M8JA 5K7FA 4U0WA 1ZR4A 2ECCA 1DU6A 3UR3C 4C2UA 1GVJA 3DEUA 2EZKA 2NRAC 3L9FA 4QTRA 2EINH 2CQNA 2X6XA 2Y0SN 5IP7J 4KJZA 2NNNA 5HS9A 2IXSA 1BC7C 5EDNA 4Y4RA 4F52A 4Y33A 1QZYA 2M45A 3J7AO 4P9FA 1BM9A 4A3GJ 4C3HJ 2DPDA 3F9KA 4A3JJ 1IUFA 3ZQFA 2OAZA 3D5RC 4M74A 4IX7A 2VOPA 2K4BA 3BPXA 5JFRA 1DQUA 2M8GX 4BY7J 3TKYA 2EFQA 3Q9SA 4II2A 2O03A 1ZRFA 2V7FA 2CW8A 2JK3A 3VPRA 4IHWA 3L2UA 5DCMA 4BAYA 3B73A 2R92J 3OYLA 4NB5A 3JAMZ 1W4MA 4ZYGA 1VZ0A 2CV2A 2XRLA 3OL3A 2PEXA 1PP7U 4BL0B 1NG7A 3VFZA 1FWZA 4FE4A 1HQCA 1N75A 3I59B 4HA8A 4PJJA 2QQ9A 3LQRA 3FK6A 4L9JA 1IC8A 1Y8QB 2P4WA 1DDNA 3H9GA 1ZKGA 3HRMA 2Y69H 3O8GA 1R49A 5IYBJ 3OS0A 4ZYEA 1X2MA 1ZAOA 2H1LA 2KIUA 3DP7A 1VQ5I 4YFKF 1IN6A 2GM4A 2JA5J 2EILH 5D5WB 2I5UA 3I3LA 1X1DA 4E7ZA 3NEUA 2VJJA 2R7VA 3TP0A 2BYVE 2MBFA 1N25A 4B43A 3C7JA 3GFIA 2ZSIB 3OSFA 3ML6A 3K1NA 5K5RA 3CMAI 5B1BH 2VIXA 4HOBA 3ZQHA 2FA5A 2QWWA 2K9NA 4ZC3A 1Y8RB 4A5NA 1X1BA 3EPZA 3SFZA 3ULQB 1K83J 5DCFA 2DXIA 4XLFA 4BQQA 2HYFA 1R4MB 3K4LA 4CCKA 4C2MJ 4B4CA 2HQNA 2KIMA 1T6SA 1OISA 1WJFA 1TZLA 2F5FA 1NHAA 4FASD 1LB2A 2IP2A 2M7AA 1X4OA 4M72A 1I39A 2QBYB 5E1XA 3DCFA 2WC2A 1ON2A 1W0TA 3FKJA 2DMNA 1HXDA 2XRNA 4UXNA 1TWFJ 2OF7A 1W36D 1HW5A 2WTEA 3DQVC 2CSOA 5LRSA 3CC7I 1V5FA 2TDXA 1EH6A 2VJIA 3BOQA 1FOWA 4BY1J 2KRCA 3AL0B 4LMYA 3CCYA 1XCBA 1JTXA 4OIQF 3FXRA 2EZIA 1KYZA 1WGXA 4I2OA 4NDLA 5J47A 3CUQC 3OYDA 1FP2A 3B6CA 2CFOA 2TCTA 4IHXA 1IRFA 5ERIA 5D4SA 4DGWB 5EGOB 4BHBA 3CUQA 2A6HF 2XPVA 5FKMA 3R61A 2KIFA 2WAQN 4E7KA 2X1EA 2WB1A 3JW4A 4XRSA 2EQRA 4JX5A 3TO9A 3BLYA 3HTSB 1U2WA 4PSXA 4S0HB 5EEHA 1ETWA 5ICGA 3NAUA 4S05A 3CDLA 1YW9A 3DPUA 5LFAA 2FNPA 2ZFUA 3HGGA 3HGYA 3PFIA 2XGDA 2RN7A 2DMUA 5B66C 1F4KA 1B8IB 2KFDA 1FYMA 2A6EF 2QF7A 3RI4A 1G3SA 2IBDA 4F91B 4MEXF 3CCJI 3ECHA 1YOVB 1QZZA 1E3PA 2E1MB 3I9V2 4DOZA 5CQEA 1K4TA 2ESHA 2DT7B 3LAJA 3JRGA 2JTVA 3EUHA 3RZDJ 1Z0XA 2BZTA 2ETHA 4AVPA 2G0EA 1WI3A 3ROUA 2UWMA 3A4CA 5L3BA 1GUUA 1WCMJ 2HFHA 5HDGA 2FXAA 4ITVA 4UUVA 1ULYA 2F4IA 2OA4A 2H6CA 1Y39A 4UUSB 4EM1A 4UVAA 4A3KJ 4D9JA 4YIRX 3QPLA 3RYPA 4AUXA 4HLYA 3E0JB 3OYEA 3DLAA 3JREA 1BIBA 1J7KA 3AFHA 2LY9A 2HOAA 4BS9A 3KLOA 3CMMA 3SZPA 2CQKA 2HZDA 3M1EA 2RQPA 3KZYA 5FFZA 1WJDA 3ZGKA 3S1NJ 3RCOA 3HHHA 3CJRB 4CICA 1QHGA 3P9CA 4IRGA 5ILUA 1LDJA 4LK1F 3OR2C 4A93J 1F36A 5F6FA 4DW6A 2VL8A 3OYAA 2KIQA 2A05A 4XN3A 1A36A 4OIPF 3FWEA 1S7OA 2B63J 4KICA 3T8RA 4BDYA 1PP8F 4ESFA 2RNJA 1YTYA 4ZYDA 4ESJA 3BJ6A 3CJTB 4FE7A 2DDBA 2V9KA 3GYHX 4IO9F 3H3VK 2HQ5A 5BOXA 4ETSA 3ZQLA 4IOAF 4HG2A 3L09A 3MFKA 1ZG5A 3HOXJ 3HPHA 3S32A 4BJ6C 3HB9A 4DNCA 4BJTA 1J5YA 3BTCA 5D8KB 1K6OA 4X6AJ 1U78A 1X3WB 1QPIA 3W6JB 4EV0A 2KZVA 1FBQA 2BE5F 3TL4X 4UVBA 4F3QA 1REPC 4RMNA 3AAFA 4MIMA 3PNYA 1KA8A 2HDWA 3DTEA 1JI8A 3I4MJ 1MGTA 3REOA 3CD6I 3MVPA 5GPCA 2F6CA 3K70C 4XRSG 3WU1B 5GP9A 1OFCX 3VEPA 3H3ZA 3G3ZA 5ICEA 5CVVA 3F23A 3I4NJ 2NXNB 2VQGA 3BC8A 2YR2A 3IL2A 3QPSA 1H88C 1D5YA 4I09A 3GZ6A 3H5NA 1P4WA 4I01A 4IRHA 1JHHA 4XORA 4AM3A 2R5YA 5CYVA 3V4GA 4WXDA 5KAFC 3OS2A 1YJ9I 3F6VA 4BXXJ 1MBKA 3N05A 1NH3A 2WADA 4OMZA 1XB4A 5LGUA 4ZTJA 2IRFG 3PQJA 2MG4A 4GXOA 3QOPA 3ZQIA 3J80K 2V1UA 2G9WA 3ERMA 1IF1A 3M07A 1TNTA 2A68F 2KKOA 2GXBA 2X51A 2FBHA 5DUKA 1JT0A 2JA2A 4KMUX 1JT6A 2X6YA 3K69A 3V7SA 2EPFA 4PSWA 1HF0A 2CG4A 1LFBA 1LPQA 2HQAA 3WG9A 3D5SC 3WU0A 4JBAA 4B48A 5C4XJ 2QQ8A 5F0FA 3IC7A 2KJBA 4IKFA 3IRRA 2HKXA 5DM6F 2M0MA 2DA6A 3PO2J 1A04A 3DKWA 3I4PA 1G59A 3S1QJ 3ESWB 3OL4A 5IP9J 1OJLA 4LB5A 1S9HA 1O3RA 3F8BA 3KEOA 5TISC 3MQ0A 2ID6A 2Z1DA 4YIIA 1HA8A 3CF2A 4HAMA 1IXRC 3WE3A 5K5QA 2R7DA 4IRIA 1AOYA 5CVJA 5DUIA 5H2FC 1XGNA 3WODF 3BG6A 3S3NA 4YFXF 4EGZA 4XOPA 4BEHA 5D5UB 4NUBA 4XLAA 4KN4X 1W1WE 1O4XA 3GFJA 4WX9A 4GYGA 1BR4A 1WI9A 4OOIA 3ABTA 3ZN0A 5HLIA 4ESBA 2MD0A 1TQMA 5A2QZ 1RUNA 4D1QA 2R7XA 3N4MA 3TDZC 3HL2A 4G9YA 2RNGA 1BI0A 1F9NA 1YFHA 3FM5A 2IS4A 3E3VA 1R5HA 4XKWA 3K9TA 5LHHA 1UZCA 4RM2A 4AYBN 5FFXA 3IWZA 2VT3A 2XUBA 3F72A 2LSOA 4YIFA 1IN7A 1UFMA 4YRVA 4RA2A 3S14J 1VFCA 5E8GA 3E5QA 2BBYA 4IPAA 1R1VA 5D6FA 1OYIA 3PL8A 2K27A 3KPHA 1XCVA 2FBKA 1XC5A 1RESA 1XDUA 3CCSI 3QYEA 1X58A 3N97A 3Q3SA 3S16J 2XAQA 1IG7A 2B7EA 3FK7A 5EG0B 4K2EA 1AA7A 1BI2A 2CUEA 3VYRB 2BY0A 1MBGA 2VE9A 2EWNA 1CQTA 3S3MA 1U6GA 4X0GA 3GZNB 4F93B 3PQKA 4MQ9F 2MSYA 4MQVA 3FKIJ 4FX4A 2MLKA 4O3MA 2FQ3A 4CYDA 1ETXA 2FD5A 2NS7A 5LLQA 3IH3A 5DYMA 4DBRA 1R9TJ 2MYSA 1WKMA 4YELA 1IUYA 1XG1A 2CUZA 3I71A 3VYUB 1HBXG 1UAAA 2VQCA 3LSIA 4I0BA 1IDYA 3WTXC 2O0YA 1P4XA 2FMLA 1L3LA 2WV0A 1APLC 1J0RA 2GIZA 1XS9A 1TWGJ 1USSA 2V79A 2AXLA 4U7BA 2L5QA 3GTPJ 2L9NA 2VBWA 1Z05A 3DV8A 4XOTA 2IJLA 4AD9A 1RR8C 2PLYA 2E7XA 1YQAA 3L7WA 2IW5A 3MKZA 1BW6A 2HGCA 3TW7A 5JHUA 2KDZA 2VXDA 1BA5A 1KZHA 4E7LA 1EF4A 1IN8A 4JK1X 1ONVA 4Q47A 2DFIA 5CPRB 2NVQJ 3KP2A 3QOEA 5AIQA 2Z16A 2LP0A 2ZC2A 4ZJZA 2XF5A 2XB5A 1QVUA 2R7ZJ 2EV5A 2FUG2 3V8JA 4OMYA 1IN4A 2BY2A 1K4SA 2O6GE 1IO2A 1QU3A 1YI2I 4KIBA 1AU7A 1Y0NA 2XDVA 4XONA 3NARA 2OTLI 2VC1A 5BNGA 3SHFA 3BCAA 2M7BA 5FO5A 4MFDA 5KCMA 4E7HA 4II3A 3J7YJ 2I8DA 3I64A 3HUGB 1SFXA 4ANJA 2EFWA 3QP6A 3ZRGA 2CW7A 2JSPA 2K3FA 2LBFA 4YEJA 1X19A 2XF7A 2JQ7A 2RQQA 3WTUC 4HF0A 1ZG3A 4G6DA 2DA2A 1FTTA 4BBRJ 1ZG1A 5B5EC 1P7IA 1UCRA 3FBNB 3PUFA 3QU3A 2NNYA 3QYBA 4YFNF 5L3CA 1BOAA 3BPVA 2XAJA 1CGPA 3JRBA 3WGGA 5LEJA 3BY6A 3GX4X 2K9SA 3I5UA 2ZNZA 2EFNA 4L5IA 3WTWC 2D5VA 1B1BA 2X1CA 4W97A 3WE2A 2K5CA 3B02A 1TTYA 2ZJRF 4PZJA 4E6KG 2CUJA 2MABA 2WAEA 4IHVA 1JXSA 2I10A 2R93J 1D0XA 1K6YA 3FXOA 4HSTA 2DA4A 2HU9A 4B1RA 4MHGA 4Y52J 4BE0A 4ENMA 4KT6A 3V8KA 4JOMA 4XK4A 3C2BA 1R71A 1XTAA 3BG7A 1Y1WJ 1X1AA 3DBLB 5GAGJ 2DFFA 2STWA 2M4GA 3GF2A 4BH9A 3FXJA 1WZ2A 2JRTA 2XGEA 3GTGJ 3CMYA 2HPIA 1L0OC 3SFIA 3HKZA 5LHIA 1RKTA 5J3LA 3IAM2 4RB1A 2CRGA 3VODA 3JRCA 4C2TA 1XSVA 1J59A 2PQ8A 2L4MA 4M9ZA 2ELJA 3CO6C 2P7CB 2R5ZB 3I54A 3H35A 4RGRA 3HOTA 5H20A 5E79C 2ZXIA 3LQQA 1R00A 3BZCA 4FHTA 1JTYA 3SYTA 3LSRA 1HDDC 1O3SA 5JVTA 1UHWA 2QEXI 1SAUA 1SVOA 4XRMA 1HKTA 1ZELA 4DYCA 4HF2A 3ISPA 3SZGA 1PUFA 3LSHA 2GXAA 3GWZA 4G6TB 4U88A 5M5YJ 2KPMA 4HV6A 2R7OA 3HPGA 3KP7A 2VXZA 2Y48A 4Y3OA 1UJ8A 4CCOA 4CSWA 1LE8A 3HBLA 3ONQA 1FSEA 1LDDA 3R6SA 2Q8KA 1MMSA 2FU4A 4N4OB 2OV7A 2E5NA 4F55A 3G6EI 2W24A 3JRDA 9ANTA 2Y75A 2ZJPF 4EM0B 2AXTC 2Z9OA 1UELB 1S7EA 3VOEA 1OR7C 3OOUA 2L7MP 4CZZA 2LD5A 1JGGA 3S2HJ 2FSWA 3H0GJ 4UB6C 4Y15A 2LFBA 1ZLKA 4CUGA 5E20A 1RPWA 3G4SI 1OR7A 5EZGA 2OBPA 3H9JA 1DGWY 3CJNA 2OQGA 3CCUI 3ZCOA 1NK2P 2M2EA 3EDPA 2AQEA 3DBRB 2HDDA 3OYMA 4QPQA 5K5OA 3OR1C 1YG2A 2HDCA 3PSIA 5M5WJ 3FISA 3GW2A 1SEUA 5DV5A 4C3IJ 3LOCA 1QGPA 2Y0SA 2DA1A 1X3ZB 5IYCJ 2GQQA 2VODA 3WG7H 3G1MA 3HRUA 4QSHA 3DFGA 3QWLA 3DEWA 2EIMH 1MDMA 1SFEA 3ELKA 4NQWB 1Z7UA 2JPCA 2VB6A 1W7PB 4NC8A 3TMOA 4BE2A 5JI6A 2HOEA 1J09A 4B44A 5KVRA 2Q1ZB 4DJAA 2O8XA 1MMNA 3MEXA 4M3DA 2XSDC 3JSOA 4KIGA 2H27A 1R36A 2F5VA 2ZNYA 3IH2A 3P9KA 2M0CA 2Y30A 3CDIA 4RGUA 3H9QA 5TGTA 1JKRC 1ZQ3P 2OUMA 1H8AC 2R3SA 1J75A 3S17J 2Y0MA 2F4MB 4RLQA 4HDUA 4N4NB 2OCCH 1UHMA 3OMYA 4RB2C 4KIFA 3SDBA 4EJWA 1LFUP 2EJRA 4A2UA 4F7ZA 2DTRA 2BVMA 4N9HA 2UXXA 1YJWI 4S04A 5D6EA 3MMYB 5DEQA 1FLIA 4HF1A 3HRTA 3ZPLA 3IKVA 3BZKA 2V6CA 1RZ4A 2D1HA 2KISA 2ZXWH 3QP5A 2W4SA 2QSFX 3QPTA 4Y13A 1CF7B 2MW8A 2CQXA 2ZB9A 2LH9A 1U0JA 3IAS2 4M9XA 2BY1A 2OU2A 2CQ7A 3GVAA 1E3OC 2LF7A 1B59A 3BR2A 4E7IA 2AS5F 2L7FP 2R4GA 4M3FA 5FROA 2HTSA 2EK5A 1OQYA 2V1XA 3ABUA 3R4KA 4MLOA 3AG2H 3BR6A 4ZYAA 1JJ6C 2UUZA 1WQ2A 2Y9ZA 4ZDLA 3HHGA 1GT0C 4HNTA 3BWGA 2Y31A 1FZPB 3GEZA 1LKXA 4UUTA 5EJCA 1FT9A 3CC4I 2M30A 1MJ9A 2ELKA 3DEEA 2IPQX 5GTHC 3OIQA 4E7JA 2GLOA 2ZCWA 2Y9YA 2JVHA 1FNNA 3G71I 4BE1A 4RB0A 3OYCA 5BMZA 3TEDA 3BR3A 1YE9A 3CF5F 2NOJB 1IAWA 4LB6B 3F0CA 6PAXA 3HOYJ 2VE8A 3Q9VA 1VQLI 1K78B 2DA3A 4LOCA 4PCQA 5E8IA 2DI3A 3ASOH 3SDGA 1VQOI 2AHQA 5M3FJ 1T33A 3QYFA 4GGGA 1S29A 1YJNI 2KJCA 4XLCA 3DTKA 4PJ0C 2R7UA 1STZA 4BQAA 5HS7A 5E17F 1G3WA 4W1UA 2P7VB 2HEOA 4WF2A 1HDPA 5TJJA 3CZ6A 4MGRA 1RC9A 5E3MA 2H8RA 1P2FA 3MKYB 3HC7A 5HDKA 4XKVA 1KQ8A 1S3JA 5EEGA 2K9LA 2DT6A 3KCCA 2PFBA 4NHJA 5AIPA 2OC6A 2CS3A 1WJAA 1HC8A 4CZCA 2K02A 3K6GA 3L2CA 3GFLA 4HQEA 4AC0A 2WAQA 1FYKA 2LY1A 2HWVA 5LHGA 1RR7A 2GBYA 4PGGA 3KLNA 5A2QK 3MZYA 2CO5A 5FLVA 2L0KA 2BEOA 3U21A 3BG5A 2UXNA 1T98A 2CW0F 2L7ZA 4D7MA 4ENKA 3A0HC 3L2WA 3HOZJ 1HLVA 5E1ZB 1ZYRF 3GLXA 3HEFA 1IRXA 5D8LB 1U5TC 2WB1N 3EUHC 1HW2A 3KYCB 2KDOA 2MH9A 2F5DA 4HX7A 1T0FC 4A3DJ 4J01A 2VJ5A 3JRAA 2LOOA 2KP6A 4GRIA 5BPDA 1W7PD 1LDKB 1R5GA 2JSCA 3AG1H 1U5TA 3KIOA 3S8PA 3RIRA 4AIDA 5E18F 1T0FA 3FMQA 3L00A 5IPAA 4I98B 3BJOA 1OYYA 3DKXA 2JRMA 5DM7F 5BQTA 2DA5A 3ZMVA 2NAZA 3OYJA 1B72B 1ITYA 1MJAA 3D5LA 2JVGA 4XKCA 3K1PA 1W36C 2Z3YA 3TBIA 3HSEA 1HKQA 3CLOA 1WH7A 3VWBA 4ENJA 1BIAA 2G7UA 4BXFA 1R7JA 1P6RA 1I3AA 3I53A 4XLEA 4P96A 3RPQA 1GXPA 3S2DJ 2K4JA 3LA2A 2YPRA 4X1EA 1MBJA 2BXZA 3CTAA 5LRRA 4FQGA 2BW3B 1BN5A 1D8KA 1IJWC 5E3LA 2NVXJ 2JUGA 3L2RA 2DO7A 2DBBA 1D0ZA 2QUFA 4UVCA 2PX9A 2MA3A 4QIWN 5GPAA 4IOCF 3CMEI 1O57A 4LG0B 1OKRA 4NNJA 3M1CA 3ZQQA 5IT3A 4IHTA 4P1WA 1BJAA 4MTDA 3O2PE 3LSPA 1MBFA 3U2RA 1AKHA 2R7QA 4M6VA 3R0AA 3ZR8X 3BCBA 2FF4A 3COAC 3CCQI 4OIOF 1ERDA 3BG9A 3J7ZI 2IA1A 2V4JC 3SXYA 4P5OA 2QA4I 3GXOA 3CCVI 1XMAA 4N9IA 4U0VA 2DA7A 2W7NA 3CO7C 3RTRA 2XAFA 1Z91A 3DXJF 4HLXA 4LIUA 2Q2EB 1D1AA 1YLFA 1Z3XA 1B6AA 2L9VA 3F6OA 2ZMEB 3TP3A 1BR1A 1DPRA 1ZN2A 1TQPA 4NQWA 2YS9A 1R4NB 2E35A 1W7PA 3BR1A 5KNLA 3ZQGA 4UNOA 4BHCA 2F4OB 4EVIA 2LY2A 1X2NA 1YHQI 4U0YA 2CGPA 4Y7NJ 2PN6A 3CLQA 1FOXA 2PMZN 2ISYA 3EQLF 1JGSA 4G8XA 1JUSA 2DMQA 2XV4S 3IP4B 5CVIA 2MC4A 5FLMJ 5D5XB 3E6MA 3HDDA 2YX7A 4HDVA 4GYIA 2RREA 2M87A 3WTSC 3HZJA 1LFPA 4XM3A 2M5WA 3FHZA 1J9IA 1R5ID 2EFOA 4NC7A 2RV8A 2VQLA 2PMHA 2VKDA 3I59A 3R60A 4AWXB 3EUKL 5KK1A 2FOKA 3DPTA 2WY8Q 4EJUA 2V6EA 2DPUA 4L0YB 1O7LA 1G3TA 2LK2A 1T39A 3O6BB 1ETYA 1EH7A 2R7WA 2A3SA 2EB7A 4AIJA 5C3EJ 3TO6A 2L4AA 3HSRA 4A6DA 3GTJJ 2HVSA 2IGMA 1Q1HA 3E5XA 4HX4A 2H8WA 5F04A 4LG3A 3FHNA 3WU2C 2CV1A 3E97A 4CHUA 1FIAA 4KT5C 4OINF 1IN5A 4GO1A 1JE8A 1YS7A 3IHUA 3GTMJ 1IDZA 5J8FA 1IZ1A 2EV6A 3IKTA 3FF5A 4RGSA 3FDYA 3LFUA 3LFKA 4HSRA 4EATA 5DDGA 1TW3A 3TO7A 5K7ZA 3KP3A 4E7SA 3OIOA 4FETA 3KZZA 4XBFA 2BV6A 2QYOA 1YIJI 1H0MA 4LJZF 3WTYC 2QBYA 4LGWA 5J8CA 2GOMA 3OYKA 4IF4A 2RVCA 2RGVA 1K78A 3S93A 2VPLA 5IY5H 2XGXA 1IV8A 4G7OF 1IRZA 2XHKA 2EV0A 2VQHA 3BTIA 3VSLA 3AL0C 2DAOA 4IHSA 3WHCA 5ILVA 1Q1VA 3Q0VA 1H9GA 3LA3A 5DTDA 3AKZA 4UHTA 2Z2SB 2PBIA 3CDHA 4IQ4A 4BUPA 4IQJA 3HG9A 3RSNA 5TRDA 4NC6A 2D1VA 5ILSA 2VKHA 3LWFA 2X6OA 3FZVA 2K86A 4OIRF 3HM5A 3KETA 2DFEA 2DQRA 3EETA 1MNDA 3K4MA 1VQ7I 2HYGD 2YX4A 5CVUA 1B4AA 4F92B 4AYBA 5J4VA 1JKQC 4HBLA 1V55H 2NYXA 1FP1D 1R1TA 2ZJ2A 1R6RA 2W25A 1DU0A 2JN6A 2UV1A 3C2HA 5EGOA 5FRNA 1WFXA 1YO5C 2E36A 3QODA 3R0JA 3BG3A 2GXGA 1QRYA 2Z99A 4CCNA 4BBSJ 3S15J 2MC3A 4XN0A 2Q0OA 2QLZA 4M3BA 3M4OJ 3S1RJ 3JRHA 4CCJA 2M9HA 1R22A 3ZP5A 2RKHA 1VQ6I 1U9NA 1FPQA 2E1MC 1B8IA 2K9MA 1TBXA 1FMWA 3K4KA 3RPUD 3A2KA 4HZFA 1TW2A 2NVUB 4A3FJ 2HZTA 2OZUA 5DD8A 2JJ7A 1W5TA 2L3DA 2HS5A 4LD5A 2DOFA 4FCYA 1E2XA 1POGA 3KE2A 4I7HA 3CP8A 1MIJA 3DKYA 5HLHA 1ZREA 2J5PA 2LKSA 4G94A 2RDPA 2PJPA 2JT1A 2ZXJA 3KP4A 2B0LA 2BY3A 3CCEI 1XDSA 2PMUA 4UUSA 1QQIA 2DODA 2DW4A 3F3XA 2Z33A 2HXIA 1JUMA 1QZEA 3I0TA 3MD2A 1ZLJA 3K4BA 1LUJB 3S3OA 2IS6A 3LSKA 3H36A 1SMYF 2W82A 4CXFA 2OCEA 4B47A 1ZARA 5DS9A 4BKXA 2VUMJ 1LEAA 3FXUA 2R7RA 3LMMA 1RETA 3F8FA 2FJ1A 2ZFWA 4U7DA 1Y0UA 3FXKA 3ZMSA 1AWCA 4QWQA 2KQRA 4RM3A 5C44J 3GBGA 4PDKA 2HYJA 1SFUA 4QPOA 1D5VA 5IYDJ 3WHBA 1JJ8C 1JHFA 2M1BA 5HDNA 1S6LA 4HEA2 1GLNA 2OJED 4O5VA 3RQIA 3U9GA 4HX8A 1R58A 4XIDA 2STTA 1E3HA 4OAZA 4UY8I 4C30A 1USTA 4M73A 1A31A 4UV9A 3KZIC 4Y17A 2M3AA 3BZ6A 1H89C 2B9SA 1I5ZA 5C4JJ 1FSHA 2E2IJ 4G6QA 1MMGA 1D8JA 3KEYA 3A02A 3T1BA 3WGIA 1ZK8A 2GAUA 1Z6TA 2DJNA 1A35A 1GHCA 1U8BA 1TWCJ 3W6KB 3I56I 4WXCA 2KRFA
chains in the Genus database with same CATH topology
4EJOA 2LKPA 2XVCA 1FYLA 4BYYA 3LAPA 1HW1A 1XGSA 3J81K 2VBYA 3V7CA 1J2XA 4GCVA 3SQNA 2A07F 5J6XA 1XGMA 3CUQB 4L9VA 2ACJA 3HIFA 4A0XA 2ZKZA 4RAZA 4EGYA 3C18A 1P92A 4AIHA 3WGHA 5K1YA 2GIVA 2QM3A 1IXSB 3KFWX 1BI3A 2H94A 2P5VA 3NQOA 3M9AA 1F5TA 2DLLA 2QENA 2X4HA 2V1DA 2F5EA 1P4AA 2HR3A 4KUMA 1QBJA 3JTHA 2DK5A 1G6NA 3RJPA 1K7AA 3GUDA 3P7NA 1G3YA 3BJAA 2FMYA 1HSJA 1O3TA 1LVAA 5E1WA 1EH8A 1EV7A 5CLSA 4EJVA 4ZYHA 2F2EA 2L01A 1XSXA 4RAYA 2RC4A 4WXHA 4H0EA 2D45A 2QVOA 2FE3A 4WWCA 1FBSA 4RGXA 3RKWA 2JZYA 2XAHA 3T8TA 4EJTA 2A61A 1XSDA 1Z1DA 1LNWA 3KP6A 4ENNA 2ZO4A 3DF8A 1VTNC 1KU2A 1OPCA 1BBYA 4N0BA 3T5XA 1I6XA 4XLPF 4P55A 5LBQA 1MJBA 1ZGJA 1YIOA 2GWRA 4M71A 1KU7A 2P8TA 2VN2A 1B9NA 1C0WA 3OOPA 1BI1A 1W5SA 3D0SA 1KYWA 4HV5A 3S2WA 2G7HA 4Z2YA 2A5YB 4WCGA 2YU3A 1GXQA 2ESNA 3MCZA 3JTGA 1SMTA 1KQ0A 3ERED 3QPHA 2GA2A 2GA1A 1ZHFA 2J5OA 2EA2A 1MD0A 4LLNA 5F1RA 1SAXA 5FB2A 5BPIA 1D3YA 2XKOA 3BROA 1LQ1A 4MNUA 2CWEA 2NS0A 1ODDA 3EYYA 2FNAA 5D5VB 1K79A 3J81Z 3FM3A 4PGHA 1F1ZA 4CO8A 5FD6A 3HRSA 3HUGA 4LLGF 4M9SA 2HKOA 2LDUA 1WWXA 4IXAA 2CFXA 1YW8A 3O3KA 2W57A 3WTZA 3F8NA 3LA7A 1SD6A 1R23A 2A69F 3JSPA 3SZTA 5ICFA 4ZZDA 3TOBA 2OZ6A 2COMA 4JQFA 4Q48A 1YW7A 1G4DA 5BS6A 3G73A 2HTJA 5IT9K 2GZWA 1FOKA 4BXUA 3VB2A 2VBXA 2OD5A 4D0PA 2XIGA 1DUXC 3ZMUA 4XSXF 2C6YA 3ZN1A 5L3FA 2FRHA 2F5CA 4EMSA 1XGOA 3WTVC 2L54A 2XROA 2O3FA 5LGTA 1KU3A 2EFPA 3HSFA 3FX3A 2VOOA 1I1GA 2PG4A 3F8MA 5L3GA 3DPLC 4LLLA 3E6BA 4B09A 4KFCA 4R1HA 3OV8A 4KA4A 3HTUA 1XMKA 1O7FA 2IVMA 2R7FA 1PDNC 3IRQA 4KYWA 1OMIA 3M7GA 1I27A 2XAGA 5D4RA 3V8LA 4I02A 4Q5SF 2LNBA 1RIOH 2ELHA 1H9TA 3MZHA 4IJAA 4L9TA 1S8NA 1T2KA 1O3QA 2JPBA 3WTTC 1U3EM 4A5MA 1BC8C 1DP7P 4R8HA 3GO5A 2VC0A 4M6YA 4ASNA 1ZH5A 3KP5A 4AIKA 5HLGA 2E1NA 3RYRA 1FC3A 4ON0A 1MZBA 3F22A 1IXCA 3QU6A 4DQ2A 1QO0D 1RI7A 1QNTA 4XLNF 2IA2A 2E1CA 2EA4A 3TDUC 2W84A 5HS8A 1YS6A 1KQ9A 1CF7A 2ISZA 1S7AA 4P9UA 2DU9A 2X0LA 4RS8A 3K0LA 2XASA 4L5JA 4MTEA 3CUOA 2HQRA 4IVNA 3V7RA 5AONA 5DD4A 5F64A 1ZGAA 1ZRCA 1HKSA 4TV7A 1WRJA 3QRFF 3ZQ7A 2MD5A 3E6CC 1KU9A 5L3EA 3F21A 4O6JA 4RB3C 4HW0A 1QPMA 1UB9A 5LEKA 4WK8F 4QLCU 3HOSA 2DQLA 2BGCA 3ZMDA 4L18B 1U8RA 5ED4A 3C1DA 4KDPA 1I1SA 5IT9Z 4A6EA 4LFUA 4A0YA 1TLHB 4YG2F 2XKPA 4MEYF 4M6XA 5H6RA 1MDMB 2DK8A 4R79A 5FLXK 3LSTA 2P6TA 3TQNA 1MKMA 1Z9CA 5FGMA 5CJ9A 4KN7X 3ZMZA 4FX0A 2P5KA 5DCMB 2M8EA 3RKYA 3F8CA 2QZ8A 1TQIA 2V9VA 2FEZA 2K7LA 3MAJA 1ON1A 5H6QA 1RNLA 1PUEE 1T38A 3BP8A 1R1UA 4ZZLA 2O61A 2VT2A 1WSUA 3H3UA 1DPUA 2VBZA 2QQBA 1FX7A 4LK0F 3GZ5A 3JAMK 1SD7A 3BDDA 4E70A 2W85A 2CYYA 5ICCA 1V3FA 4A0ZA 3U1DA 2IT0A 5LGNA 3T0YA 3EYIA 4CGZA 3RDIA 4EM2A 4LG0A 1FY7A 5FD5A 4G7ZF 1V4RA 3P9IA 3H92A 3QAHA 1LEBA 3GFMA 3K2ZA 2OQRA 4XSZF 3ZMTA 5L3DA 1ZRDA 2ZMEC 3FMRA 4UV8A 3IWFA 1TNSA 2D2WA 1E17A 2Q2EA 5HOOA 3RPUA 4ZH4F 2ZMEA 4BNCA 1XD7A 2Z5UA 4L0ZB 2L02A 4OU0A 4G7HF 2P5LC 4I0AA 1LJ9A 2DT5A 3M8FA 3Q5FA 3MWMA 1YYVA 3ECOA 2WWYA 5CVRA 2QQAA 3J80Z 2ZBKA 1OYWA 3RKXA 3C3WA 3M8EA 3I58A 4KNYA 3FMSA 2UZKA 1B9MA 2IA0A 1Z6RA 3HYIA 5JR3A 4L9NA 1U5TB 1RUOA 4BHPA 2PI0A 1KGSA 1X3UA 1SD4A 1IRGA 3TGNA 3FXQA 2VONA 1IW7F 4HYEA 4HQMA 3TOAA 3K1MA 1FBUA 4EQQA 1XN7A 4B8XA 2ADUA 2P6SA 3E5UA 2H6BA 2YSRA 4KMFA 2H09A 3KEQA 4Q4ZF 5FLXZ 3NRVA 2MH2A 4A12A 1SD5A 3E6DA 5HVQC 2LF8A 1HSTA 2E7WA 4CDGA 4FT8A 2FBIA 4XRFA 2MLGA 4U0WA 1GVJA 3DEUA 2NRAC 3L9FA 5HS9A 2NNNA 1BC7C 1QZYA 2M45A 3J7AO 4P9FA 1BM9A 2DPDA 2OAZA 4M74A 2VOPA 2K4BA 3BPXA 5JFRA 3TKYA 2EFQA 3Q9SA 2O03A 1ZRFA 5DCMA 4BAYA 3B73A 4NB5A 3JAMZ 1W4MA 4ZYGA 2PEXA 1PP7U 3VFZA 1FWZA 1HQCA 3I59B 4HA8A 2QQ9A 3LQRA 4L9JA 1DDNA 2P4WA 3HRMA 4ZYEA 1ZAOA 2KIUA 3DP7A 4YFKF 1IN6A 5D5WB 3NEUA 2BYVE 2MBFA 3C7JA 3GFIA 3ML6A 3K1NA 5K5RA 4HOBA 2FA5A 2QWWA 4A5NA 3SFZA 3ULQB 5DCFA 2HYFA 2HQNA 2KIMA 1T6SA 2F5FA 1NHAA 1LB2A 2IP2A 4M72A 2QBYB 5E1XA 2WC2A 1ON2A 1HXDA 2XRNA 4UXNA 1HW5A 2WTEA 3DQVC 2CSOA 5LRSA 2TDXA 1EH6A 3BOQA 4LMYA 1XCBA 4OIQF 3FXRA 1KYZA 4I2OA 3CUQC 1FP2A 1IRFA 5ERIA 5D4SA 4BHBA 3CUQA 2A6HF 3R61A 2KIFA 3JW4A 3TO9A 3HTSB 1U2WA 5EEHA 5ICGA 4S05A 1YW9A 2FNPA 3PFIA 1F4KA 2RN7A 1FYMA 2A6EF 3RI4A 1G3SA 4MEXF 3ECHA 1QZZA 2ESHA 3LAJA 2JTVA 3EUHA 2ETHA 4AVPA 2UWMA 3ROUA 5L3BA 2HFHA 5HDGA 2FXAA 4UUVA 1ULYA 2OA4A 2H6CA 4EM1A 4UVAA 3RYPA 4HLYA 1BIBA 1J7KA 3KLOA 3SZPA 2CQKA 3M1EA 2RQPA 3KZYA 5FFZA 3HHHA 4CICA 3P9CA 4IRGA 5ILUA 1LDJA 4LK1F 5F6FA 4OIPF 3FWEA 1S7OA 4KICA 3T8RA 1PP8F 4ESFA 2RNJA 1YTYA 4ZYDA 4ESJA 3BJ6A 3GYHX 5BOXA 4ETSA 3L09A 3MFKA 1ZG5A 4DNCA 1J5YA 5D8KB 1K6OA 1U78A 3W6JB 4EV0A 1FBQA 2BE5F 4UVBA 1REPC 3AAFA 1KA8A 1MGTA 3REOA 3WU1B 3VEPA 3H3ZA 3G3ZA 5ICEA 5CVVA 3F23A 2YR2A 3IL2A 4I09A 3GZ6A 1P4WA 4I01A 4IRHA 1JHHA 5CYVA 3V4GA 4WXDA 3F6VA 4OMZA 1XB4A 5LGUA 2IRFG 3PQJA 4GXOA 3QOPA 3J80K 2V1UA 2G9WA 1IF1A 1TNTA 2A68F 2KKOA 2GXBA 2FBHA 5DUKA 4KMUX 3K69A 3V7SA 2CG4A 3WG9A 3WU0A 4JBAA 3IC7A 2KJBA 3IRRA 2HKXA 1A04A 3DKWA 3I4PA 4LB5A 1O3RA 3F8BA 3KEOA 3MQ0A 4YIIA 4HAMA 1IXRC 3WE3A 5K5QA 2R7DA 4IRIA 1AOYA 5CVJA 5DUIA 1XGNA 3WODF 4YFXF 4EGZA 5D5UB 4KN4X 3GFJA 4WX9A 4GYGA 1WI9A 4OOIA 3ABTA 3ZN0A 5HLIA 4ESBA 1TQMA 5A2QZ 1RUNA 3N4MA 3TDZC 4G9YA 1BI0A 1F9NA 1YFHA 3FM5A 3E3VA 1R5HA 3K9TA 5LHHA 5FFXA 3IWZA 2VT3A 2XUBA 3F72A 2LSOA 4YIFA 1IN7A 1UFMA 5E8GA 3E5QA 2BBYA 4IPAA 1R1VA 5D6FA 1OYIA 2K27A 1XCVA 2FBKA 1XDUA 3N97A 2XAQA 4K2EA 1BI2A 2VE9A 2EWNA 1U6GA 3PQKA 4MQ9F 4MQVA 4FX4A 4O3MA 2MLKA 2FQ3A 4CYDA 5LLQA 5DYMA 1WKMA 1IUYA 3I71A 1HBXG 4I0BA 3WTXC 2O0YA 1P4XA 2FMLA 1L3LA 2WV0A 1J0RA 1USSA 2V79A 2AXLA 4U7BA 2VBWA 1Z05A 3DV8A 4AD9A 2IJLA 2PLYA 2E7XA 1YQAA 3L7WA 2IW5A 2HGCA 5JHUA 1IN8A 4JK1X 1ONVA 4Q47A 2DFIA 3KP2A 5AIQA 2EV5A 3V8JA 4OMYA 1IN4A 2O6GE 4KIBA 2VC1A 3SHFA 5FO5A 3I64A 1SFXA 2EFWA 3QP6A 3WTUC 4HF0A 1ZG3A 4G6DA 1ZG1A 1UCRA 3QU3A 2NNYA 4YFNF 5L3CA 1BOAA 3BPVA 2XAJA 1CGPA 3WGGA 5LEJA 3BY6A 3GX4X 3I5UA 2ZNZA 2EFNA 4L5IA 3WTWC 1B1BA 3WE2A 3B02A 1TTYA 4PZJA 1JXSA 4MHGA 4ENMA 3V8KA 2STWA 4BH9A 3GF2A 2JRTA 1L0OC 5LHIA 4RB1A 3VODA 1XSVA 1J59A 2PQ8A 2L4MA 4M9ZA 3CO6C 2P7CB 3I54A 3HOTA 4RGRA 5H20A 3LQQA 1R00A 4FHTA 1O3SA 5JVTA 1UHWA 1HKTA 4HF2A 3ISPA 3GWZA 4U88A 4HV6A 3KP7A 2VXZA 2Y48A 1FSEA 1LDDA 3R6SA 2Q8KA 2FU4A 2W24A 2Y75A 4EM0B 2Z9OA 3VOEA 4CZZA 2FSWA 4Y15A 1ZLKA 5E20A 1OR7A 2OBPA 3CJNA 2OQGA 3EDPA 5K5OA 2HDCA 1YG2A 3GW2A 5DV5A 1QGPA 2GQQA 2VODA 3HRUA 3DFGA 1MDMA 1SFEA 3ELKA 1Z7UA 2JPCA 1W7PB 5JI6A 2HOEA 5KVRA 2O8XA 3MEXA 3JSOA 4KIGA 2H27A 1R36A 2ZNYA 3P9KA 4RGUA 2R3SA 1J75A 2Y0MA 4HDUA 1UHMA 4RB2C 4KIFA 4EJWA 2EJRA 4F7ZA 4A2UA 2DTRA 4N9HA 2UXXA 4S04A 5D6EA 5DEQA 1FLIA 4HF1A 3HRTA 3ZPLA 3IKVA 2V6CA 1RZ4A 2D1HA 3QP5A 3QPTA 4Y13A 1CF7B 4M9XA 2OU2A 3GVAA 2LF7A 1B59A 2AS5F 2HTSA 2EK5A 2V1XA 3ABUA 3R4KA 1WQ2A 3HHGA 3BWGA 1FZPB 3GEZA 1FT9A 2M30A 1MJ9A 2IPQX 2ZCWA 1FNNA 4RB0A 5BMZA 1IAWA 4LB6B 6PAXA 2VE8A 3Q9VA 1K78B 4PCQA 5E8IA 2DI3A 4GGGA 1S29A 2KJCA 1STZA 4BQAA 5HS7A 5E17F 1G3WA 2P7VB 2HEOA 4WF2A 5TJJA 4MGRA 1P2FA 5HDKA 1KQ8A 1S3JA 5EEGA 3KCCA 2PFBA 4NHJA 5AIPA 2K02A 3L2CA 3GFLA 4HQEA 1FYKA 5LHGA 2HWVA 4PGGA 5A2QK 3KLNA 3MZYA 2CO5A 2BEOA 2UXNA 1T98A 2CW0F 4ENKA 5E1ZB 1ZYRF 3GLXA 5D8LB 1U5TC 1HW2A 2MH9A 2F5DA 4HX7A 5BPDA 1W7PD 1LDKB 1R5GA 2JSCA 1U5TA 5E18F 3RIRA 1T0FA 3FMQA 3L00A 4I98B 3BJOA 1OYYA 5BQTA 3ZMVA 2NAZA 1MJAA 3D5LA 3K1PA 2Z3YA 3HSEA 1HKQA 3CLOA 4ENJA 1BIAA 2G7UA 1R7JA 1P6RA 3I53A 4P96A 3RPQA 1GXPA 2K4JA 3LA2A 2YPRA 5LRRA 3CTAA 1BN5A 1D8KA 2DO7A 2DBBA 2QUFA 4UVCA 2MA3A 1O57A 4LG0B 1OKRA 5IT3A 4IHTA 1BJAA 4MTDA 3O2PE 3U2RA 3R0AA 2FF4A 3COAC 4OIOF 2IA1A 3SXYA 4P5OA 3GXOA 1XMAA 4N9IA 4U0VA 3CO7C 3RTRA 2XAFA 1Z91A 3DXJF 4HLXA 1YLFA 1B6AA 3F6OA 2ZMEB 1DPRA 1ZN2A 1TQPA 4NQWA 1W7PA 4UNOA 4BHCA 4EVIA 4U0YA 2CGPA 2PN6A 2ISYA 3EQLF 1JGSA 4G8XA 2XV4S 5CVIA 5D5XB 3E6MA 2YX7A 4HDVA 4GYIA 2M87A 3WTSC 2M5WA 3FHZA 1J9IA 2EFOA 2RV8A 2PMHA 3I59A 3R60A 4AWXB 5KK1A 2FOKA 3DPTA 4EJUA 2DPUA 4L0YB 1O7LA 1G3TA 1T39A 3O6BB 1EH7A 2A3SA 2EB7A 4AIJA 3TO6A 2L4AA 3HSRA 4A6DA 1Q1HA 3E5XA 4HX4A 3E97A 4CHUA 4KT5C 4OINF 1IN5A 4GO1A 1JE8A 1YS7A 3IHUA 5J8FA 1IZ1A 2EV6A 3IKTA 3FF5A 4RGSA 3LFKA 5DDGA 1TW3A 3TO7A 3KP3A 3KZZA 4XBFA 2BV6A 2QYOA 1H0MA 4LJZF 3WTYC 2QBYA 4LGWA 5J8CA 4IF4A 2RVCA 2RGVA 1K78A 2XGXA 4G7OF 2XHKA 2EV0A 2DAOA 4IHSA 5ILVA 1H9GA 3LA3A 4UHTA 2PBIA 3CDHA 5TRDA 2D1VA 5ILSA 3LWFA 4OIRF 3FZVA 2K86A 3KETA 2DQRA 3EETA 2HYGD 2YX4A 5CVUA 1B4AA 4HBLA 2NYXA 1FP1D 1R1TA 2ZJ2A 2W25A 1YO5C 3R0JA 2GXGA 2Z99A 2MC3A 2Q0OA 2QLZA 1R22A 3ZP5A 2RKHA 1FPQA 1TBXA 4HZFA 1TW2A 2HZTA 2OZUA 5DD8A 1W5TA 2L3DA 2HS5A 4LD5A 1E2XA 3KE2A 4I7HA 5HLHA 1ZREA 2J5PA 4G94A 2RDPA 2PJPA 2JT1A 2ZXJA 3KP4A 2B0LA 1XDSA 2PMUA 1QQIA 2DW4A 3F3XA 2Z33A 3I0TA 1ZLJA 1SMYF 4CXFA 1ZARA 1LEAA 3FXUA 3F8FA 2ZFWA 4U7DA 1Y0UA 3ZMSA 1AWCA 4QWQA 4PDKA 1SFUA 1D5VA 1JHFA 2M1BA 5HDNA 1S6LA 4O5VA 3U9GA 4HX8A 1R58A 2STTA 1USTA 4M73A 4UV9A 4Y17A 3BZ6A 1I5ZA 1FSHA 4G6QA 1D8JA 3T1BA 3WGIA 2GAUA 1GHCA 1Z6TA 3W6KB 4WXCA 2KRFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EJO A;  2LKP A;  2XVC A;  1FYL A;  4BYY A;  3LAP A;  1HW1 A;  1XGS A;  3J81 K;  2VBY A;  3V7C A;  1J2X A;  4GCV A;  3SQN A;  2A07 F;  5J6X A;  1XGM A;  3CUQ B;  4L9V A;  2ACJ A;  3HIF A;  4A0X A;  2ZKZ A;  4RAZ A;  4EGY A;  3C18 A;  1P92 A;  4AIH A;  3WGH A;  5K1Y A;  2GIV A;  2QM3 A;  1IXS B;  3KFW X;  1BI3 A;  2H94 A;  2P5V A;  3NQO A;  3M9A A;  1F5T A;  2DLL A;  2QEN A;  2X4H A;  2V1D A;  2F5E A;  1P4A A;  2HR3 A;  4KUM A;  1QBJ A;  3JTH A;  2DK5 A;  1G6N A;  3RJP A;  1K7A A;  3GUD A;  3P7N A;  1G3Y A;  3BJA A;  2FMY A;  1HSJ A;  1O3T A;  1LVA A;  5E1W A;  1EH8 A;  1EV7 A;  5CLS A;  4EJV A;  4ZYH A;  2F2E A;  2L01 A;  1XSX A;  4RAY A;  2RC4 A;  4WXH A;  4H0E A;  2D45 A;  2QVO A;  2FE3 A;  4WWC A;  1FBS A;  4RGX A;  3RKW A;  2JZY A;  2XAH A;  3T8T A;  4EJT A;  2A61 A;  1XSD A;  1Z1D A;  1LNW A;  3KP6 A;  4ENN A;  2ZO4 A;  3DF8 A;  1VTN C;  1KU2 A;  1OPC A;  1BBY A;  4N0B A;  3T5X A;  1I6X A;  4XLP F;  4P55 A;  5LBQ A;  1MJB A;  1ZGJ A;  1YIO A;  2GWR A;  4M71 A;  1KU7 A;  2P8T A;  2VN2 A;  1B9N A;  1C0W A;  3OOP A;  1BI1 A;  1W5S A;  3D0S A;  1KYW A;  4HV5 A;  3S2W A;  2G7H A;  4Z2Y A;  2A5Y B;  4WCG A;  2YU3 A;  1GXQ A;  2ESN A;  3MCZ A;  3JTG A;  1SMT A;  1KQ0 A;  3ERE D;  3QPH A;  2GA2 A;  2GA1 A;  1ZHF A;  2J5O A;  2EA2 A;  1MD0 A;  4LLN A;  5F1R A;  1SAX A;  5FB2 A;  5BPI A;  1D3Y A;  2XKO A;  3BRO A;  1LQ1 A;  4MNU A;  2CWE A;  2NS0 A;  1ODD A;  3EYY A;  2FNA A;  5D5V B;  1K79 A;  3J81 Z;  3FM3 A;  4PGH A;  1F1Z A;  4CO8 A;  5FD6 A;  3HRS A;  3HUG A;  4LLG F;  4M9S A;  2HKO A;  2LDU A;  1WWX A;  4IXA A;  2CFX A;  1YW8 A;  3O3K A;  2W57 A;  3WTZ A;  3F8N A;  3LA7 A;  1SD6 A;  1R23 A;  2A69 F;  3JSP A;  3SZT A;  5ICF A;  4ZZD A;  3TOB A;  2OZ6 A;  2COM A;  4JQF A;  4Q48 A;  1YW7 A;  1G4D A;  5BS6 A;  3G73 A;  2HTJ A;  5IT9 K;  2GZW A;  1FOK A;  4BXU A;  3VB2 A;  2VBX A;  2OD5 A;  4D0P A;  2XIG A;  1DUX C;  3ZMU A;  4XSX F;  2C6Y A;  3ZN1 A;  5L3F A;  2FRH A;  2F5C A;  4EMS A;  1XGO A;  3WTV C;  2L54 A;  2XRO A;  2O3F A;  5LGT A;  1KU3 A;  2EFP A;  3HSF A;  3FX3 A;  2VOO A;  1I1G A;  2PG4 A;  3F8M A;  5L3G A;  3DPL C;  4LLL A;  3E6B A;  4B09 A;  4KFC A;  4R1H A;  3OV8 A;  4KA4 A;  3HTU A;  1XMK A;  1O7F A;  2IVM A;  2R7F A;  1PDN C;  3IRQ A;  4KYW A;  1OMI A;  3M7G A;  1I27 A;  2XAG A;  5D4R A;  3V8L A;  4I02 A;  4Q5S F;  2LNB A;  1RIO H;  2ELH A;  1H9T A;  3MZH A;  4IJA A;  4L9T A;  1S8N A;  1T2K A;  1O3Q A;  2JPB A;  3WTT C;  1U3E M;  4A5M A;  1BC8 C;  1DP7 P;  4R8H A;  3GO5 A;  2VC0 A;  4M6Y A;  4ASN A;  1ZH5 A;  3KP5 A;  4AIK A;  5HLG A;  2E1N A;  3RYR A;  1FC3 A;  4ON0 A;  1MZB A;  3F22 A;  1IXC A;  3QU6 A;  4DQ2 A;  1QO0 D;  1RI7 A;  1QNT A;  4XLN F;  2IA2 A;  2E1C A;  2EA4 A;  3TDU C;  2W84 A;  5HS8 A;  1YS6 A;  1KQ9 A;  1CF7 A;  2ISZ A;  1S7A A;  4P9U A;  2DU9 A;  2X0L A;  4RS8 A;  3K0L A;  2XAS A;  4L5J A;  4MTE A;  3CUO A;  2HQR A;  4IVN A;  3V7R A;  5AON A;  5DD4 A;  5F64 A;  1ZGA A;  1ZRC A;  1HKS A;  4TV7 A;  1WRJ A;  3QRF F;  3ZQ7 A;  2MD5 A;  3E6C C;  1KU9 A;  5L3E A;  3F21 A;  4O6J A;  4RB3 C;  4HW0 A;  1QPM A;  1UB9 A;  5LEK A;  4WK8 F;  4QLC U;  3HOS A;  2DQL A;  2BGC A;  3ZMD A;  4L18 B;  1U8R A;  5ED4 A;  3C1D A;  4KDP A;  1I1S A;  5IT9 Z;  4A6E A;  4LFU A;  4A0Y A;  1TLH B;  4YG2 F;  2XKP A;  4MEY F;  4M6X A;  5H6R A;  1MDM B;  2DK8 A;  4R79 A;  5FLX K;  3LST A;  2P6T A;  3TQN A;  1MKM A;  1Z9C A;  5FGM A;  5CJ9 A;  4KN7 X;  3ZMZ A;  4FX0 A;  2P5K A;  5DCM B;  2M8E A;  3RKY A;  3F8C A;  2QZ8 A;  1TQI A;  2V9V A;  2FEZ A;  2K7L A;  3MAJ A;  1ON1 A;  5H6Q A;  1RNL A;  1PUE E;  1T38 A;  3BP8 A;  1R1U A;  4ZZL A;  2O61 A;  2VT2 A;  1WSU A;  3H3U A;  1DPU A;  2VBZ A;  2QQB A;  1FX7 A;  4LK0 F;  3GZ5 A;  3JAM K;  1SD7 A;  3BDD A;  4E70 A;  2W85 A;  2CYY A;  5ICC A;  1V3F A;  4A0Z A;  3U1D A;  2IT0 A;  5LGN A;  3T0Y A;  3EYI A;  4CGZ A;  3RDI A;  4EM2 A;  4LG0 A;  1FY7 A;  5FD5 A;  4G7Z F;  1V4R A;  3P9I A;  3H92 A;  3QAH A;  1LEB A;  3GFM A;  3K2Z A;  2OQR A;  4XSZ F;  3ZMT A;  5L3D A;  1ZRD A;  2ZME C;  3FMR A;  4UV8 A;  3IWF A;  1TNS A;  2D2W A;  1E17 A;  2Q2E A;  5HOO A;  3RPU A;  4ZH4 F;  2ZME A;  4BNC A;  1XD7 A;  2Z5U A;  4L0Z B;  2L02 A;  4OU0 A;  4G7H F;  2P5L C;  4I0A A;  1LJ9 A;  2DT5 A;  3M8F A;  3Q5F A;  3MWM A;  1YYV A;  3ECO A;  2WWY A;  5CVR A;  2QQA A;  3J80 Z;  2ZBK A;  1OYW A;  3RKX A;  3C3W A;  3M8E A;  3I58 A;  4KNY A;  3FMS A;  2UZK A;  1B9M A;  2IA0 A;  1Z6R A;  3HYI A;  5JR3 A;  4L9N A;  1U5T B;  1RUO A;  4BHP A;  2PI0 A;  1KGS A;  1X3U A;  1SD4 A;  1IRG A;  3TGN A;  3FXQ A;  2VON A;  1IW7 F;  4HYE A;  4HQM A;  3TOA A;  3K1M A;  1FBU A;  4EQQ A;  1XN7 A;  4B8X A;  2ADU A;  2P6S A;  3E5U A;  2H6B A;  2YSR A;  4KMF A;  2H09 A;  3KEQ A;  4Q4Z F;  5FLX Z;  3NRV A;  2MH2 A;  4A12 A;  1SD5 A;  3E6D A;  5HVQ C;  2LF8 A;  1HST A;  2E7W A;  4CDG A;  4FT8 A;  2FBI A;  4XRF A;  2MLG A;  4U0W A;  1GVJ A;  3DEU A;  2NRA C;  3L9F A;  5HS9 A;  2NNN A;  1BC7 C;  1QZY A;  2M45 A;  3J7A O;  4P9F A;  1BM9 A;  2DPD A;  2OAZ A;  4M74 A;  2VOP A;  2K4B A;  3BPX A;  5JFR A;  3TKY A;  2EFQ A;  3Q9S A;  2O03 A;  1ZRF A;  5DCM A;  4BAY A;  3B73 A;  4NB5 A;  3JAM Z;  1W4M A;  4ZYG A;  2PEX A;  1PP7 U;  3VFZ A;  1FWZ A;  1HQC A;  3I59 B;  4HA8 A;  2QQ9 A;  3LQR A;  4L9J A;  1DDN A;  2P4W A;  3HRM A;  4ZYE A;  1ZAO A;  2KIU A;  3DP7 A;  4YFK F;  1IN6 A;  5D5W B;  3NEU A;  2BYV E;  2MBF A;  3C7J A;  3GFI A;  3ML6 A;  3K1N A;  5K5R A;  4HOB A;  2FA5 A;  2QWW A;  4A5N A;  3SFZ A;  3ULQ B;  5DCF A;  2HYF A;  2HQN A;  2KIM A;  1T6S A;  2F5F A;  1NHA A;  1LB2 A;  2IP2 A;  4M72 A;  2QBY B;  5E1X A;  2WC2 A;  1ON2 A;  1HXD A;  2XRN A;  4UXN A;  1HW5 A;  2WTE A;  3DQV C;  2CSO A;  5LRS A;  2TDX A;  1EH6 A;  3BOQ A;  4LMY A;  1XCB A;  4OIQ F;  3FXR A;  1KYZ A;  4I2O A;  3CUQ C;  1FP2 A;  1IRF A;  5ERI A;  5D4S A;  4BHB A;  3CUQ A;  2A6H F;  3R61 A;  2KIF A;  3JW4 A;  3TO9 A;  3HTS B;  1U2W A;  5EEH A;  5ICG A;  4S05 A;  1YW9 A;  2FNP A;  3PFI A;  1F4K A;  2RN7 A;  1FYM A;  2A6E F;  3RI4 A;  1G3S A;  4MEX F;  3ECH A;  1QZZ A;  2ESH A;  3LAJ A;  2JTV A;  3EUH A;  2ETH A;  4AVP A;  2UWM A;  3ROU A;  5L3B A;  2HFH A;  5HDG A;  2FXA A;  4UUV A;  1ULY A;  2OA4 A;  2H6C A;  4EM1 A;  4UVA A;  3RYP A;  4HLY A;  1BIB A;  1J7K A;  3KLO A;  3SZP A;  2CQK A;  3M1E A;  2RQP A;  3KZY A;  5FFZ A;  3HHH A;  4CIC A;  3P9C A;  4IRG A;  5ILU A;  1LDJ A;  4LK1 F;  5F6F A;  4OIP F;  3FWE A;  1S7O A;  4KIC A;  3T8R A;  1PP8 F;  4ESF A;  2RNJ A;  1YTY A;  4ZYD A;  4ESJ A;  3BJ6 A;  3GYH X;  5BOX A;  4ETS A;  3L09 A;  3MFK A;  1ZG5 A;  4DNC A;  1J5Y A;  5D8K B;  1K6O A;  1U78 A;  3W6J B;  4EV0 A;  1FBQ A;  2BE5 F;  4UVB A;  1REP C;  3AAF A;  1KA8 A;  1MGT A;  3REO A;  3WU1 B;  3VEP A;  3H3Z A;  3G3Z A;  5ICE A;  5CVV A;  3F23 A;  2YR2 A;  3IL2 A;  4I09 A;  3GZ6 A;  1P4W A;  4I01 A;  4IRH A;  1JHH A;  5CYV A;  3V4G A;  4WXD A;  3F6V A;  4OMZ A;  1XB4 A;  5LGU A;  2IRF G;  3PQJ A;  4GXO A;  3QOP A;  3J80 K;  2V1U A;  2G9W A;  1IF1 A;  1TNT A;  2A68 F;  2KKO A;  2GXB A;  2FBH A;  5DUK A;  4KMU X;  3K69 A;  3V7S A;  2CG4 A;  3WG9 A;  3WU0 A;  4JBA A;  3IC7 A;  2KJB A;  3IRR A;  2HKX A;  1A04 A;  3DKW A;  3I4P A;  4LB5 A;  1O3R A;  3F8B A;  3KEO A;  3MQ0 A;  4YII A;  4HAM A;  1IXR C;  3WE3 A;  5K5Q A;  2R7D A;  4IRI A;  1AOY A;  5CVJ A;  5DUI A;  1XGN A;  3WOD F;  4YFX F;  4EGZ A;  5D5U B;  4KN4 X;  3GFJ A;  4WX9 A;  4GYG A;  1WI9 A;  4OOI A;  3ABT A;  3ZN0 A;  5HLI A;  4ESB A;  1TQM A;  5A2Q Z;  1RUN A;  3N4M A;  3TDZ C;  4G9Y A;  1BI0 A;  1F9N A;  1YFH A;  3FM5 A;  3E3V A;  1R5H A;  3K9T A;  5LHH A;  5FFX A;  3IWZ A;  2VT3 A;  2XUB A;  3F72 A;  2LSO A;  4YIF A;  1IN7 A;  1UFM A;  5E8G A;  3E5Q A;  2BBY A;  4IPA A;  1R1V A;  5D6F A;  1OYI A;  2K27 A;  1XCV A;  2FBK A;  1XDU A;  3N97 A;  2XAQ A;  4K2E A;  1BI2 A;  2VE9 A;  2EWN A;  1U6G A;  3PQK A;  4MQ9 F;  4MQV A;  4FX4 A;  4O3M A;  2MLK A;  2FQ3 A;  4CYD A;  5LLQ A;  5DYM A;  1WKM A;  1IUY A;  3I71 A;  1HBX G;  4I0B A;  3WTX C;  2O0Y A;  1P4X A;  2FML A;  1L3L A;  2WV0 A;  1J0R A;  1USS A;  2V79 A;  2AXL A;  4U7B A;  2VBW A;  1Z05 A;  3DV8 A;  4AD9 A;  2IJL A;  2PLY A;  2E7X A;  1YQA A;  3L7W A;  2IW5 A;  2HGC A;  5JHU A;  1IN8 A;  4JK1 X;  1ONV A;  4Q47 A;  2DFI A;  3KP2 A;  5AIQ A;  2EV5 A;  3V8J A;  4OMY A;  1IN4 A;  2O6G E;  4KIB A;  2VC1 A;  3SHF A;  5FO5 A;  3I64 A;  1SFX A;  2EFW A;  3QP6 A;  3WTU C;  4HF0 A;  1ZG3 A;  4G6D A;  1ZG1 A;  1UCR A;  3QU3 A;  2NNY A;  4YFN F;  5L3C A;  1BOA A;  3BPV A;  2XAJ A;  1CGP A;  3WGG A;  5LEJ A;  3BY6 A;  3GX4 X;  3I5U A;  2ZNZ A;  2EFN A;  4L5I A;  3WTW C;  1B1B A;  3WE2 A;  3B02 A;  1TTY A;  4PZJ A;  1JXS A;  4MHG A;  4ENM A;  3V8K A;  2STW A;  4BH9 A;  3GF2 A;  2JRT A;  1L0O C;  5LHI A;  4RB1 A;  3VOD A;  1XSV A;  1J59 A;  2PQ8 A;  2L4M A;  4M9Z A;  3CO6 C;  2P7C B;  3I54 A;  3HOT A;  4RGR A;  5H20 A;  3LQQ A;  1R00 A;  4FHT A;  1O3S A;  5JVT A;  1UHW A;  1HKT A;  4HF2 A;  3ISP A;  3GWZ A;  4U88 A;  4HV6 A;  3KP7 A;  2VXZ A;  2Y48 A;  1FSE A;  1LDD A;  3R6S A;  2Q8K A;  2FU4 A;  2W24 A;  2Y75 A;  4EM0 B;  2Z9O A;  3VOE A;  4CZZ A;  2FSW A;  4Y15 A;  1ZLK A;  5E20 A;  1OR7 A;  2OBP A;  3CJN A;  2OQG A;  3EDP A;  5K5O A;  2HDC A;  1YG2 A;  3GW2 A;  5DV5 A;  1QGP A;  2GQQ A;  2VOD A;  3HRU A;  3DFG A;  1MDM A;  1SFE A;  3ELK A;  1Z7U A;  2JPC A;  1W7P B;  5JI6 A;  2HOE A;  5KVR A;  2O8X A;  3MEX A;  3JSO A;  4KIG A;  2H27 A;  1R36 A;  2ZNY A;  3P9K A;  4RGU A;  2R3S A;  1J75 A;  2Y0M A;  4HDU A;  1UHM A;  4RB2 C;  4KIF A;  4EJW A;  2EJR A;  4F7Z A;  4A2U A;  2DTR A;  4N9H A;  2UXX A;  4S04 A;  5D6E A;  5DEQ A;  1FLI A;  4HF1 A;  3HRT A;  3ZPL A;  3IKV A;  2V6C A;  1RZ4 A;  2D1H A;  3QP5 A;  3QPT A;  4Y13 A;  1CF7 B;  4M9X A;  2OU2 A;  3GVA A;  2LF7 A;  1B59 A;  2AS5 F;  2HTS A;  2EK5 A;  2V1X A;  3ABU A;  3R4K A;  1WQ2 A;  3HHG A;  3BWG A;  1FZP B;  3GEZ A;  1FT9 A;  2M30 A;  1MJ9 A;  2IPQ X;  2ZCW A;  1FNN A;  4RB0 A;  5BMZ A;  1IAW A;  4LB6 B;  6PAX A;  2VE8 A;  3Q9V A;  1K78 B;  4PCQ A;  5E8I A;  2DI3 A;  4GGG A;  1S29 A;  2KJC A;  1STZ A;  4BQA A;  5HS7 A;  5E17 F;  1G3W A;  2P7V B;  2HEO A;  4WF2 A;  5TJJ A;  4MGR A;  1P2F A;  5HDK A;  1KQ8 A;  1S3J A;  5EEG A;  3KCC A;  2PFB A;  4NHJ A;  5AIP A;  2K02 A;  3L2C A;  3GFL A;  4HQE A;  1FYK A;  5LHG A;  2HWV A;  4PGG A;  5A2Q K;  3KLN A;  3MZY A;  2CO5 A;  2BEO A;  2UXN A;  1T98 A;  2CW0 F;  4ENK A;  5E1Z B;  1ZYR F;  3GLX A;  5D8L B;  1U5T C;  1HW2 A;  2MH9 A;  2F5D A;  4HX7 A;  5BPD A;  1W7P D;  1LDK B;  1R5G A;  2JSC A;  1U5T A;  5E18 F;  3RIR A;  1T0F A;  3FMQ A;  3L00 A;  4I98 B;  3BJO A;  1OYY A;  5BQT A;  3ZMV A;  2NAZ A;  1MJA A;  3D5L A;  3K1P A;  2Z3Y A;  3HSE A;  1HKQ A;  3CLO A;  4ENJ A;  1BIA A;  2G7U A;  1R7J A;  1P6R A;  3I53 A;  4P96 A;  3RPQ A;  1GXP A;  2K4J A;  3LA2 A;  2YPR A;  5LRR A;  3CTA A;  1BN5 A;  1D8K A;  2DO7 A;  2DBB A;  2QUF A;  4UVC A;  2MA3 A;  1O57 A;  4LG0 B;  1OKR A;  5IT3 A;  4IHT A;  1BJA A;  4MTD A;  3O2P E;  3U2R A;  3R0A A;  2FF4 A;  3COA C;  4OIO F;  2IA1 A;  3SXY A;  4P5O A;  3GXO A;  1XMA A;  4N9I A;  4U0V A;  3CO7 C;  3RTR A;  2XAF A;  1Z91 A;  3DXJ F;  4HLX A;  1YLF A;  1B6A A;  3F6O A;  2ZME B;  1DPR A;  1ZN2 A;  1TQP A;  4NQW A;  1W7P A;  4UNO A;  4BHC A;  4EVI A;  4U0Y A;  2CGP A;  2PN6 A;  2ISY A;  3EQL F;  1JGS A;  4G8X A;  2XV4 S;  5CVI A;  5D5X B;  3E6M A;  2YX7 A;  4HDV A;  4GYI A;  2M87 A;  3WTS C;  2M5W A;  3FHZ A;  1J9I A;  2EFO A;  2RV8 A;  2PMH A;  3I59 A;  3R60 A;  4AWX B;  5KK1 A;  2FOK A;  3DPT A;  4EJU A;  2DPU A;  4L0Y B;  1O7L A;  1G3T A;  1T39 A;  3O6B B;  1EH7 A;  2A3S A;  2EB7 A;  4AIJ A;  3TO6 A;  2L4A A;  3HSR A;  4A6D A;  1Q1H A;  3E5X A;  4HX4 A;  3E97 A;  4CHU A;  4KT5 C;  4OIN F;  1IN5 A;  4GO1 A;  1JE8 A;  1YS7 A;  3IHU A;  5J8F A;  1IZ1 A;  2EV6 A;  3IKT A;  3FF5 A;  4RGS A;  3LFK A;  5DDG A;  1TW3 A;  3TO7 A;  3KP3 A;  3KZZ A;  4XBF A;  2BV6 A;  2QYO A;  1H0M A;  4LJZ F;  3WTY C;  2QBY A;  4LGW A;  5J8C A;  4IF4 A;  2RVC A;  2RGV A;  1K78 A;  2XGX A;  4G7O F;  2XHK A;  2EV0 A;  2DAO A;  4IHS A;  5ILV A;  1H9G A;  3LA3 A;  4UHT A;  2PBI A;  3CDH A;  5TRD A;  2D1V A;  5ILS A;  3LWF A;  4OIR F;  3FZV A;  2K86 A;  3KET A;  2DQR A;  3EET A;  2HYG D;  2YX4 A;  5CVU A;  1B4A A;  4HBL A;  2NYX A;  1FP1 D;  1R1T A;  2ZJ2 A;  2W25 A;  1YO5 C;  3R0J A;  2GXG A;  2Z99 A;  2MC3 A;  2Q0O A;  2QLZ A;  1R22 A;  3ZP5 A;  2RKH A;  1FPQ A;  1TBX A;  4HZF A;  1TW2 A;  2HZT A;  2OZU A;  5DD8 A;  1W5T A;  2L3D A;  2HS5 A;  4LD5 A;  1E2X A;  3KE2 A;  4I7H A;  5HLH A;  1ZRE A;  2J5P A;  4G94 A;  2RDP A;  2PJP A;  2JT1 A;  2ZXJ A;  3KP4 A;  2B0L A;  1XDS A;  2PMU A;  1QQI A;  2DW4 A;  3F3X A;  2Z33 A;  3I0T A;  1ZLJ A;  1SMY F;  4CXF A;  1ZAR A;  1LEA A;  3FXU A;  3F8F A;  2ZFW A;  4U7D A;  1Y0U A;  3ZMS A;  1AWC A;  4QWQ A;  4PDK A;  1SFU A;  1D5V A;  1JHF A;  2M1B A;  5HDN A;  1S6L A;  4O5V A;  3U9G A;  4HX8 A;  1R58 A;  2STT A;  1UST A;  4M73 A;  4UV9 A;  4Y17 A;  3BZ6 A;  1I5Z A;  1FSH A;  4G6Q A;  1D8J A;  3T1B A;  3WGI A;  2GAU A;  1GHC A;  1Z6T A;  3W6K B;  4WXC A;  2KRF A; 
#chains in the Genus database with same CATH topology
 3MN2 A;  4EJO A;  3M3Y J;  4A3L J;  2LKP A;  2XVC A;  1FYL A;  4BYY A;  3LAP A;  1HW1 A;  1EKE A;  4M3E A;  4KIS A;  1RRJ A;  2L2O A;  3K4J A;  1XGS A;  3JR9 A;  3J81 K;  2VBY A;  3V7C A;  3ASN H;  4V19 K;  1J2X A;  2LMD A;  4GCV A;  3SQN A;  2A07 F;  5J6X A;  1XGM A;  5JLX A;  2F48 A;  1BJZ A;  1VF9 A;  5FJ8 J;  4A3C J;  3CUQ B;  3PNV A;  4L9V A;  3W3C A;  2ACJ A;  3HIF A;  1V54 H;  3CC2 I;  4A0X A;  2BHY A;  2EZL A;  2ZKZ A;  4RAZ A;  4EGY A;  3HOU J;  3C18 A;  1P92 A;  4AIH A;  2KRH A;  3WGH A;  2R0Q C;  5K1Y A;  4JP0 A;  2COB A;  4CA0 A;  3ZQC A;  2LC2 A;  2GIV A;  2QM3 A;  3ABL H;  1IXS B;  3RZO J;  2HPM A;  3KFW X;  1BI3 A;  3JCU C;  2HNH A;  2E1O A;  2H94 A;  4E4H A;  2P5V A;  3OYN A;  1D1B A;  1FOY A;  4BAC A;  2AQF A;  1QHH D;  1VND A;  3NQO A;  3VYT B;  3M9A A;  1F5T A;  2DLL A;  2QEN A;  1SAN A;  3HKZ N;  3V42 A;  2DOE A;  2X4H A;  2V1D A;  2V26 A;  1OCC H;  2F5E A;  1P4A A;  2HR3 A;  3OYB A;  4KUM A;  2X6W A;  1YIT I;  3JTH A;  1QBJ A;  2DK5 A;  1G6N A;  2XF6 A;  3RJP A;  1K7A A;  3GUD A;  5F27 A;  3P7N A;  3UKG A;  1G3Y A;  3BJA A;  2L7K A;  2FMY A;  3LSJ A;  1HSJ A;  1O3T A;  1LVA A;  4IL6 C;  3CJQ B;  5E1W A;  4CCM A;  1EH8 A;  1EV7 A;  5F08 A;  3Q0U A;  4AU7 A;  5CLS A;  1OCR H;  4EJV A;  4ZYH A;  5J1R A;  2DJI A;  3MZ8 A;  3GTL J;  2F2E A;  1WPK A;  2IGO A;  2JA6 J;  3GCM A;  2K85 A;  2L01 A;  2IAI A;  2O7O A;  1XSX A;  1W5C C;  2RC4 A;  4RAY A;  4WXH A;  4H0E A;  2D45 A;  2QVO A;  2KL4 A;  1MBE A;  2FE3 A;  2LRE A;  4WWC A;  1FBS A;  4RGX A;  3RKW A;  2QKL B;  4BJ5 C;  4JX6 A;  3K7A J;  5FRM A;  2JZY A;  2VLA A;  2XAH A;  1KON A;  3T8T A;  4EJT A;  1RKW A;  2A61 A;  1XSD A;  2ME6 A;  5IP6 A;  1T8I A;  1Z1D A;  1LNW A;  3KP6 A;  1Y6I A;  4ENN A;  2ZO4 A;  3DF8 A;  3FIW A;  1VTN C;  1KU2 A;  1VQ4 I;  4B3A A;  1OPC A;  1BBY A;  1NG6 A;  4N0B A;  2P81 A;  2IGK A;  3T5X A;  1I6X A;  4XLP F;  3OWT A;  1OCO H;  4P55 A;  1X1P A;  1OLT A;  4RAG A;  1BR2 A;  5LBQ A;  1TL8 A;  1MJB A;  3UNG C;  2WV1 A;  1ZGJ A;  1YIO A;  1A6Q A;  2GWR A;  4M71 A;  3A1Y A;  1MBH A;  1KU7 A;  2P8T A;  2VN2 A;  1B9N A;  4LIV A;  2XPW A;  2P0W A;  1C0W A;  4IZZ A;  3OOP A;  3PM1 A;  4GFB A;  2JA7 J;  3CCL I;  1ZR2 A;  1BI1 A;  1W5S A;  3D0S A;  1KYW A;  2ME0 A;  4HV5 A;  3TW6 A;  3S2W A;  3OS1 A;  2G7H A;  5EG0 A;  3A0B C;  1G2H A;  2A5W A;  5EF6 A;  4Z2Y A;  2YUS A;  2A5Y B;  1S5L C;  4WCG A;  4A3E J;  2R5Y B;  2YU3 A;  4RLF A;  2KHM A;  1SVM A;  2A6T A;  1GXQ A;  3HJE A;  1JUP A;  5F0C A;  1VQK I;  2ESN A;  1I3Q J;  1IGN A;  4LIT A;  1F43 A;  3MCZ A;  1G8X A;  3JTG A;  1SMT A;  2XPU A;  3L2V A;  1KQ0 A;  3ERE D;  1YX3 A;  2V9P A;  3BTJ A;  4DBQ A;  3QPH A;  2GA2 A;  2GA1 A;  1ZHF A;  2J5O A;  3I55 I;  2EA2 A;  3VDX A;  1ZGW A;  1MD0 A;  2CQQ A;  5JVG F;  2R7S A;  2XGC A;  4LLN A;  5F1R A;  1SAX A;  5J40 A;  4I76 A;  1JKO C;  2CMP A;  5FB2 A;  5BPI A;  1D3Y A;  5GAD J;  1Y1V J;  2XKO A;  1Z77 A;  4PK4 A;  1S72 I;  3BRO A;  1ETO A;  1Z7L A;  3CES A;  1LQ1 A;  1YRN B;  3CCM I;  3HOV J;  4MNU A;  2NVY J;  2CWE A;  2NS0 A;  1ODD A;  3EYY A;  2FNA A;  4XKB A;  5D5V B;  1K79 A;  2K9Q A;  4ZTF A;  1IV6 A;  3ZXS A;  2XB0 X;  3J81 Z;  3FM3 A;  4PGH A;  1F1Z A;  2O5R A;  3HXL A;  4CO8 A;  5FD6 A;  3HRS A;  3C2G A;  2KZG A;  3HUG A;  4LLG F;  2HKO A;  4M9S A;  4BEH B;  3PJR A;  1Z67 A;  2LDU A;  1WWX A;  4A3M J;  4IXA A;  2IS2 A;  2CFX A;  1YW8 A;  3ABM H;  3O3K A;  2W57 A;  3WTZ A;  3F8N A;  3RQ4 A;  3LA7 A;  1SD6 A;  5FKK A;  1A6I A;  1R23 A;  2A69 F;  3JSP A;  3SZT A;  5ICF A;  4ZZD A;  3TOB A;  1AHD P;  4BDZ A;  3OSG A;  2OZ6 A;  1OCT C;  5F0H A;  2COM A;  4JQF A;  2HVQ A;  4Q48 A;  1YW7 A;  4DZP A;  3OYI A;  2XSJ C;  3VYS B;  5F1J A;  1G4D A;  5BS6 A;  3G73 A;  2CJJ A;  2HTJ A;  3LSG A;  1P7J A;  5B1A H;  5IT9 K;  1WJE A;  5J4Y A;  2GZW A;  2K40 A;  2V1N A;  1FOK A;  4BXU A;  1E0E A;  3VB2 A;  3IV5 A;  2VBX A;  2OD5 A;  4D0P A;  2JA8 J;  2ECB A;  2XIG A;  1DUX C;  3ZMU A;  3FXL A;  3DU6 A;  4XSX F;  2C6Y A;  3KX2 A;  2QGU A;  2QSG X;  3ZN1 A;  5L3F A;  3BT9 A;  2LRD A;  1I50 J;  3LL7 A;  1FMV A;  1VQP I;  3DWL E;  2HI3 A;  2FRH A;  3OY9 A;  5E3N A;  1FTZ A;  2F5C A;  4EMS A;  1XGO A;  4CH7 A;  4C9Y A;  3WTV C;  2R5Z A;  2L54 A;  1N77 A;  3JRF A;  2XRO A;  2O3F A;  2EIJ H;  1MMA A;  2OTJ I;  5LGT A;  1KU3 A;  3W2A A;  2EFP A;  2NOG A;  2ID3 A;  3FX3 A;  3HSF A;  1ACI A;  2PJR B;  2VOO A;  4JX4 A;  1I1G A;  2PG4 A;  3F8M A;  5L3G A;  3DPL C;  1SFK A;  3VSK A;  3DLL F;  4A3B J;  2VAS A;  4LLL A;  3E6B A;  4XQF A;  4B09 A;  4DIQ A;  1WVR A;  4KFC A;  1ETK A;  1PVE A;  1M1E B;  4R1H A;  1MNM C;  3K70 D;  3OV8 A;  4PJN A;  1VI0 A;  5J1Y A;  4NBQ A;  4KA4 A;  2E34 A;  3HTU A;  1XMK A;  2DMP A;  1EA3 A;  2M4K A;  1O7F A;  2IVM A;  2R7F A;  1PDN C;  2MFZ A;  1MW7 A;  3GTQ J;  1Z21 A;  3A01 B;  3IRQ A;  4KYW A;  5KAI C;  1OMI A;  3KYD B;  3M7G A;  4IHY A;  1I27 A;  2XAG A;  5D4R A;  2NVT J;  2E71 A;  3V8L A;  3LNQ A;  4I02 A;  4Q5S F;  2LNB A;  3K4C A;  1WJC A;  1RIO H;  1ORK A;  3PUB A;  2QCO A;  1N78 A;  2ELH A;  2YU9 J;  1H9T A;  2DFH A;  4A69 C;  5KHD A;  4B3X A;  1WH5 A;  3MZH A;  4IJA A;  1JKP C;  4L9T A;  1S8N A;  4V2G A;  3BQY A;  2BOL A;  3LSM A;  1FJL A;  4XLH A;  1T2K A;  2ZJQ F;  2DCE A;  2JPB A;  3WTT C;  1VQM I;  1U3E M;  1O3Q A;  4A5M A;  2M34 A;  1BC8 C;  1DP7 P;  1OCZ H;  4U87 A;  2LR8 A;  4R8H A;  2LBF B;  3H0D A;  3GO5 A;  2LVS A;  4UB8 C;  5GAH J;  1BL0 A;  2VC0 A;  1WHU A;  4M6Y A;  4J19 A;  2BXY A;  4ASN A;  1ZH5 A;  5HOD A;  1BOB A;  2KLO A;  2E5Z A;  3KP5 A;  4AIK A;  2VKE A;  4RAF A;  3PFY A;  5HLG A;  2PMZ A;  2E1N A;  3SEQ A;  4IEJ A;  1WJ5 A;  2FX0 A;  3RYR A;  3W6V A;  2WAF A;  1FC3 A;  2RAE A;  4XNF A;  4ON0 A;  3MKL A;  1MZB A;  2VPR A;  3F22 A;  2HOS A;  1IXC A;  1ZTR A;  3QU6 A;  4DQ2 A;  4CYC B;  1QO0 D;  1RI7 A;  1TT5 B;  1QNT A;  3E1S A;  4XLN F;  2IA2 A;  2E1C A;  2EA4 A;  1TWH J;  3TDU C;  4XR6 A;  4DYQ A;  2GOX B;  2W84 A;  5HS8 A;  1TT0 A;  3H1C A;  1YS6 A;  3J7A Y;  1KQ9 A;  1CF7 A;  2ISZ A;  3BQZ A;  3W2V A;  1S7A A;  5JHF A;  4P9U A;  1V5G A;  2DU9 A;  2X0L A;  4RS8 A;  2HOT A;  2ICW G;  3K0L A;  2XAS A;  4G12 A;  2DYR H;  4PFP A;  4L5J A;  3PIO F;  1DGR M;  1UHS A;  4I99 C;  3FXM A;  2NS8 A;  3BR0 A;  2QSH X;  2N8G A;  4MTE A;  5HNH A;  4V2F A;  3PNT A;  2W00 A;  3S1M J;  3CUO A;  1PUF B;  1ETQ A;  2HQR A;  4IVN A;  5EEA A;  3CP2 A;  3V7R A;  5AON A;  5K7H A;  1QVT A;  5DD4 A;  5F64 A;  2VKV A;  1T95 A;  1ZGA A;  1ZRC A;  1HKS A;  3PIP F;  2X1D A;  2AO9 A;  1LE8 B;  4TV7 A;  2DN0 A;  1WRJ A;  2VJ4 A;  3E7L A;  5CQG A;  3QRF F;  3ZQ7 A;  2MD5 A;  3E6C C;  1PYV A;  3B6A A;  1KU9 A;  5L3E A;  5M3M J;  3F21 A;  4J00 A;  1FEX A;  4DZJ A;  4I6Z A;  4O6J A;  2EH3 A;  4OAY A;  4RB3 C;  4DYR A;  4HW0 A;  2KT0 A;  5HNF A;  1YRN A;  1U9O A;  1QPM A;  1UB9 A;  4OWR B;  5LEK A;  4WK8 F;  1HCR A;  2CU7 A;  1XX5 A;  4QLC U;  3HOS A;  4HPQ A;  1UG0 A;  2DQL A;  2BGC A;  3ZMD A;  4L18 B;  3MKW B;  1WJB A;  1U8R A;  3EUA A;  5ED4 A;  2JUC A;  3C1D A;  4KDP A;  2XAU A;  2DDA A;  1I1S A;  3H5R A;  4JYK A;  4HNV A;  5IT9 Z;  4A6E A;  4LFU A;  4A0Y A;  4RDU A;  1X1C A;  1TLH B;  3O8H A;  4YG2 F;  2XKP A;  2IGN A;  2LYC A;  4MEY F;  4M3G A;  1MSE C;  2DMT A;  5HLT A;  3G1L A;  4M6X A;  5H6R A;  1MDM B;  2K3P A;  4A3I J;  2DK8 A;  4R79 A;  3QQA A;  5B3S H;  1EJ9 A;  5FLX K;  2X85 A;  3LST A;  2QKM B;  1X4P A;  2P6T A;  3TQN A;  1MKM A;  1Z9C A;  5FGM A;  4FIS A;  5CJ9 A;  4KN7 X;  2E2H J;  3ZMZ A;  4FX0 A;  4XL9 A;  3OYH A;  2P5K A;  3X2Q H;  5DCM B;  2M8E A;  3RKY A;  2EIK H;  3F8C A;  2H1K A;  2LLK A;  3GME A;  2O9L A;  1QA6 A;  3IH4 A;  2E19 A;  2W1O A;  1V5E A;  3ABK H;  3DBH B;  2WBM A;  4GDF A;  2QZ8 A;  1TQI A;  1XMX A;  2BVL A;  2VI6 A;  2DYS H;  4BQO A;  1TP4 A;  3HOW J;  3OYF A;  2V9V A;  3NWS A;  2FEZ A;  2HVR A;  2L9S A;  2K7L A;  3MAJ A;  1ON1 A;  5H6Q A;  5IOZ A;  3GLL A;  3DU5 A;  1NTC A;  1RNL A;  1PUE E;  1VQ8 I;  2JMW A;  3W2W A;  1T38 A;  3BP8 A;  2E60 A;  1R1U A;  1SVL A;  2JWT A;  4ZZL A;  1B72 A;  2O61 A;  2VT2 A;  4BGD A;  1WSU A;  2FOW A;  3H3U A;  1DPU A;  1ENH A;  2VBZ A;  2QQB A;  3OIP A;  1FX7 A;  1GV2 A;  1MMD A;  4LK0 F;  1YX5 A;  3PSF A;  4ZDP A;  1MH4 A;  3GZ5 A;  3JAM K;  1SD7 A;  2PJR A;  3BDD A;  4E70 A;  2W85 A;  2CYY A;  3GTO J;  4HNU A;  3L1P A;  3K4N A;  5ICC A;  1W0U A;  1V3F A;  4A0Z A;  2BW3 A;  5J1U A;  3U1D A;  1DP3 A;  3CCR I;  3GTK J;  2IT0 A;  5IOY A;  5LGN A;  2EZH A;  3T0Y A;  1T56 A;  4FTH A;  3EYI A;  4ABZ A;  2LTP A;  3AG4 H;  4CGZ A;  4D7N A;  1BW5 A;  4BQN A;  3RDI A;  2R7T A;  4EM2 A;  4LG0 A;  1FIP A;  1FY7 A;  3A01 A;  4PJL A;  5FD5 A;  1GVD A;  2MGQ A;  2CH0 A;  4G7Z F;  2CUF A;  1V4R A;  3P9I A;  3H92 A;  3QAH A;  2LG4 A;  1LEB A;  1TWA J;  3ZOB A;  2HXO A;  3GFM A;  4PUS A;  2OPT A;  5E3O A;  3K2Z A;  2OQR A;  4CCL A;  4XSZ F;  1NK3 P;  3ZMT A;  3L2Q A;  4RBO A;  5L3D A;  1ZRD A;  2KMU A;  2ZME C;  3OYG A;  3FMR A;  1LVK A;  3IWF A;  4L5E A;  1TNS A;  4UV8 A;  2D2W A;  2LKX A;  1E17 A;  4MO7 A;  3D1N I;  2Q2E A;  5HOO A;  1Z3Y A;  3K2A A;  3RPU A;  4XIC A;  4ZH4 F;  1UMQ A;  2ZME A;  3DTI A;  4BNC A;  4BU2 A;  1XD7 A;  2DTZ A;  2Z5U A;  2L02 A;  4L0Z B;  2O8K A;  1I6H J;  4OU0 A;  4G7H F;  2P5L C;  4I0A A;  1LJ9 A;  2ZSH B;  5M5X J;  2DT5 A;  3M8F A;  3Q5F A;  5FKO A;  5FKL A;  2EBI A;  2WA0 A;  2XC7 A;  1VQ9 I;  3MWM A;  1YYV A;  1A5J A;  3ECO A;  3BTL A;  2WWY A;  2WY7 Q;  5GTI C;  5CVR A;  4HRI A;  1Y56 A;  5EYR A;  3NWT A;  2QQA A;  3J80 Z;  2ZBK A;  3KYL A;  4C3J J;  1OYW A;  3RKX A;  3CQZ J;  1MSF C;  3C3W A;  4PFO A;  5LD2 C;  2TRT A;  2X48 A;  3M8E A;  4CYC A;  3PO3 J;  3I58 A;  4KNY A;  1D1C A;  2CV0 A;  3FMS A;  1GV5 A;  3FBI B;  2UZK A;  1B9M A;  2W48 A;  2IA0 A;  1Z6R A;  3HYI A;  5JR3 A;  4L9N A;  1XPX A;  2E2J J;  1U5T B;  1RUO A;  2IEK A;  4D5F A;  4BHP A;  2IS1 A;  2PI0 A;  3IUO A;  2FQ4 A;  1VQN I;  1KGS A;  1X3U A;  1SD4 A;  2DOA A;  3SJM A;  3H5A A;  1IRG A;  2L9R A;  1D0Y A;  3TGN A;  3FXQ A;  3AG3 H;  1ETV A;  2VON A;  2X9D A;  3G1O A;  1IW7 F;  1MNE A;  4HQM A;  4HYE A;  3TOA A;  1OCP A;  1FBU A;  3K1M A;  2ZXH A;  5FKN A;  4MFE A;  4AVZ A;  4EQQ A;  1XN7 A;  3Q0W A;  4B8X A;  2ADU A;  2P6S A;  1SC7 A;  2Y2Z A;  3JRI A;  4XMY A;  5CKT A;  1SFO J;  2BHZ A;  4ZDO A;  3E5U A;  2H6B A;  4PJM A;  3BR5 A;  1T08 B;  2YSR A;  1K61 A;  4KMF A;  1MH3 A;  2H09 A;  3KEQ A;  4EEF G;  3SEZ A;  5EZH A;  5GAE J;  5FLX Z;  4Q4Z F;  3NRV A;  4H4K C;  3P5J A;  2MH2 A;  3RKQ A;  4KIT B;  4A12 A;  1SD5 A;  3E6D A;  5HVQ C;  1AKH B;  2LF8 A;  1UG2 A;  1HST A;  4D5C A;  3A03 A;  2E7W A;  1TC3 C;  4CDG A;  4Z6Y A;  1HOM A;  4FT8 A;  3U1K A;  1PJR A;  1GDT A;  3G2B A;  2FBI A;  4XRF A;  5JLW A;  2MLG A;  3K10 A;  1P9Q C;  3M8J A;  5K7F A;  4U0W A;  1ZR4 A;  2ECC A;  1DU6 A;  3UR3 C;  4C2U A;  1GVJ A;  3DEU A;  2EZK A;  2NRA C;  3L9F A;  4QTR A;  2EIN H;  2CQN A;  2X6X A;  2Y0S N;  5IP7 J;  4KJZ A;  2NNN A;  5HS9 A;  2IXS A;  1BC7 C;  5EDN A;  4Y4R A;  4F52 A;  4Y33 A;  1QZY A;  2M45 A;  3J7A O;  4P9F A;  1BM9 A;  4A3G J;  4C3H J;  2DPD A;  3F9K A;  4A3J J;  1IUF A;  3ZQF A;  2OAZ A;  3D5R C;  4M74 A;  4IX7 A;  2VOP A;  2K4B A;  3BPX A;  5JFR A;  1DQU A;  2M8G X;  4BY7 J;  3TKY A;  2EFQ A;  3Q9S A;  4II2 A;  2O03 A;  1ZRF A;  2V7F A;  2CW8 A;  2JK3 A;  3VPR A;  4IHW A;  3L2U A;  5DCM A;  4BAY A;  3B73 A;  2R92 J;  3OYL A;  4NB5 A;  3JAM Z;  1W4M A;  4ZYG A;  1VZ0 A;  2CV2 A;  2XRL A;  3OL3 A;  2PEX A;  1PP7 U;  4BL0 B;  1NG7 A;  3VFZ A;  1FWZ A;  4FE4 A;  1HQC A;  1N75 A;  3I59 B;  4HA8 A;  4PJJ A;  2QQ9 A;  3LQR A;  3FK6 A;  4L9J A;  1IC8 A;  1Y8Q B;  2P4W A;  1DDN A;  3H9G A;  1ZKG A;  3HRM A;  2Y69 H;  3O8G A;  1R49 A;  5IYB J;  3OS0 A;  4ZYE A;  1X2M A;  1ZAO A;  2H1L A;  2KIU A;  3DP7 A;  1VQ5 I;  4YFK F;  1IN6 A;  2GM4 A;  2JA5 J;  2EIL H;  5D5W B;  2I5U A;  3I3L A;  1X1D A;  4E7Z A;  3NEU A;  2VJJ A;  2R7V A;  3TP0 A;  2BYV E;  2MBF A;  1N25 A;  4B43 A;  3C7J A;  3GFI A;  2ZSI B;  3OSF A;  3ML6 A;  3K1N A;  5K5R A;  3CMA I;  5B1B H;  2VIX A;  4HOB A;  3ZQH A;  2FA5 A;  2QWW A;  2K9N A;  4ZC3 A;  1Y8R B;  4A5N A;  1X1B A;  3EPZ A;  3SFZ A;  3ULQ B;  1K83 J;  5DCF A;  2DXI A;  4XLF A;  4BQQ A;  2HYF A;  1R4M B;  3K4L A;  4CCK A;  4C2M J;  4B4C A;  2HQN A;  2KIM A;  1T6S A;  1OIS A;  1WJF A;  1TZL A;  2F5F A;  1NHA A;  4FAS D;  1LB2 A;  2IP2 A;  2M7A A;  1X4O A;  4M72 A;  1I39 A;  2QBY B;  5E1X A;  3DCF A;  2WC2 A;  1ON2 A;  1W0T A;  3FKJ A;  2DMN A;  1HXD A;  2XRN A;  4UXN A;  1TWF J;  2OF7 A;  1W36 D;  1HW5 A;  2WTE A;  3DQV C;  2CSO A;  5LRS A;  3CC7 I;  1V5F A;  2TDX A;  1EH6 A;  2VJI A;  3BOQ A;  1FOW A;  4BY1 J;  2KRC A;  3AL0 B;  4LMY A;  3CCY A;  1XCB A;  1JTX A;  4OIQ F;  3FXR A;  2EZI A;  1KYZ A;  1WGX A;  4I2O A;  4NDL A;  5J47 A;  3CUQ C;  3OYD A;  1FP2 A;  3B6C A;  2CFO A;  2TCT A;  4IHX A;  1IRF A;  5ERI A;  5D4S A;  4DGW B;  5EGO B;  4BHB A;  3CUQ A;  2A6H F;  2XPV A;  5FKM A;  3R61 A;  2KIF A;  2WAQ N;  4E7K A;  2X1E A;  2WB1 A;  3JW4 A;  4XRS A;  2EQR A;  4JX5 A;  3TO9 A;  3BLY A;  3HTS B;  1U2W A;  4PSX A;  4S0H B;  5EEH A;  1ETW A;  5ICG A;  3NAU A;  4S05 A;  3CDL A;  1YW9 A;  3DPU A;  5LFA A;  2FNP A;  2ZFU A;  3HGG A;  3HGY A;  3PFI A;  2XGD A;  2RN7 A;  2DMU A;  5B66 C;  1F4K A;  1B8I B;  2KFD A;  1FYM A;  2A6E F;  2QF7 A;  3RI4 A;  1G3S A;  2IBD A;  4F91 B;  4MEX F;  3CCJ I;  3ECH A;  1YOV B;  1QZZ A;  1E3P A;  2E1M B;  3I9V 2;  4DOZ A;  5CQE A;  1K4T A;  2ESH A;  2DT7 B;  3LAJ A;  3JRG A;  2JTV A;  3EUH A;  3RZD J;  1Z0X A;  2BZT A;  2ETH A;  4AVP A;  2G0E A;  1WI3 A;  3ROU A;  2UWM A;  3A4C A;  5L3B A;  1GUU A;  1WCM J;  2HFH A;  5HDG A;  2FXA A;  4ITV A;  4UUV A;  1ULY A;  2F4I A;  2OA4 A;  2H6C A;  1Y39 A;  4UUS B;  4EM1 A;  4UVA A;  4A3K J;  4D9J A;  4YIR X;  3QPL A;  3RYP A;  4AUX A;  4HLY A;  3E0J B;  3OYE A;  3DLA A;  3JRE A;  1BIB A;  1J7K A;  3AFH A;  2LY9 A;  2HOA A;  4BS9 A;  3KLO A;  3CMM A;  3SZP A;  2CQK A;  2HZD A;  3M1E A;  2RQP A;  3KZY A;  5FFZ A;  1WJD A;  3ZGK A;  3S1N J;  3RCO A;  3HHH A;  3CJR B;  4CIC A;  1QHG A;  3P9C A;  4IRG A;  5ILU A;  1LDJ A;  4LK1 F;  3OR2 C;  4A93 J;  1F36 A;  5F6F A;  4DW6 A;  2VL8 A;  3OYA A;  2KIQ A;  2A05 A;  4XN3 A;  1A36 A;  4OIP F;  3FWE A;  1S7O A;  2B63 J;  4KIC A;  3T8R A;  4BDY A;  1PP8 F;  4ESF A;  2RNJ A;  1YTY A;  4ZYD A;  4ESJ A;  3BJ6 A;  3CJT B;  4FE7 A;  2DDB A;  2V9K A;  3GYH X;  4IO9 F;  3H3V K;  2HQ5 A;  5BOX A;  4ETS A;  3ZQL A;  4IOA F;  4HG2 A;  3L09 A;  3MFK A;  1ZG5 A;  3HOX J;  3HPH A;  3S32 A;  4BJ6 C;  3HB9 A;  4DNC A;  4BJT A;  1J5Y A;  3BTC A;  5D8K B;  1K6O A;  4X6A J;  1U78 A;  1X3W B;  1QPI A;  3W6J B;  4EV0 A;  2KZV A;  1FBQ A;  2BE5 F;  3TL4 X;  4UVB A;  4F3Q A;  1REP C;  4RMN A;  3AAF A;  4MIM A;  3PNY A;  1KA8 A;  2HDW A;  3DTE A;  1JI8 A;  3I4M J;  1MGT A;  3REO A;  3CD6 I;  3MVP A;  5GPC A;  2F6C A;  3K70 C;  4XRS G;  3WU1 B;  5GP9 A;  1OFC X;  3VEP A;  3H3Z A;  3G3Z A;  5ICE A;  5CVV A;  3F23 A;  3I4N J;  2NXN B;  2VQG A;  3BC8 A;  2YR2 A;  3IL2 A;  3QPS A;  1H88 C;  1D5Y A;  4I09 A;  3GZ6 A;  3H5N A;  1P4W A;  4I01 A;  4IRH A;  1JHH A;  4XOR A;  4AM3 A;  2R5Y A;  5CYV A;  3V4G A;  4WXD A;  5KAF C;  3OS2 A;  1YJ9 I;  3F6V A;  4BXX J;  1MBK A;  3N05 A;  1NH3 A;  2WAD A;  4OMZ A;  1XB4 A;  5LGU A;  4ZTJ A;  2IRF G;  3PQJ A;  2MG4 A;  4GXO A;  3QOP A;  3ZQI A;  3J80 K;  2V1U A;  2G9W A;  3ERM A;  1IF1 A;  3M07 A;  1TNT A;  2A68 F;  2KKO A;  2GXB A;  2X51 A;  2FBH A;  5DUK A;  1JT0 A;  2JA2 A;  4KMU X;  1JT6 A;  2X6Y A;  3K69 A;  3V7S A;  2EPF A;  4PSW A;  1HF0 A;  2CG4 A;  1LFB A;  1LPQ A;  2HQA A;  3WG9 A;  3D5S C;  3WU0 A;  4JBA A;  4B48 A;  5C4X J;  2QQ8 A;  5F0F A;  3IC7 A;  2KJB A;  4IKF A;  3IRR A;  2HKX A;  5DM6 F;  2M0M A;  2DA6 A;  3PO2 J;  1A04 A;  3DKW A;  3I4P A;  1G59 A;  3S1Q J;  3ESW B;  3OL4 A;  5IP9 J;  1OJL A;  4LB5 A;  1S9H A;  1O3R A;  3F8B A;  3KEO A;  5TIS C;  3MQ0 A;  2ID6 A;  2Z1D A;  4YII A;  1HA8 A;  3CF2 A;  4HAM A;  1IXR C;  3WE3 A;  5K5Q A;  2R7D A;  4IRI A;  1AOY A;  5CVJ A;  5DUI A;  5H2F C;  1XGN A;  3WOD F;  3BG6 A;  3S3N A;  4YFX F;  4EGZ A;  4XOP A;  4BEH A;  5D5U B;  4NUB A;  4XLA A;  4KN4 X;  1W1W E;  1O4X A;  3GFJ A;  4WX9 A;  4GYG A;  1BR4 A;  1WI9 A;  4OOI A;  3ABT A;  3ZN0 A;  5HLI A;  4ESB A;  2MD0 A;  1TQM A;  5A2Q Z;  1RUN A;  4D1Q A;  2R7X A;  3N4M A;  3TDZ C;  3HL2 A;  4G9Y A;  2RNG A;  1BI0 A;  1F9N A;  1YFH A;  3FM5 A;  2IS4 A;  3E3V A;  1R5H A;  4XKW A;  3K9T A;  5LHH A;  1UZC A;  4RM2 A;  4AYB N;  5FFX A;  3IWZ A;  2VT3 A;  2XUB A;  3F72 A;  2LSO A;  4YIF A;  1IN7 A;  1UFM A;  4YRV A;  4RA2 A;  3S14 J;  1VFC A;  5E8G A;  3E5Q A;  2BBY A;  4IPA A;  1R1V A;  5D6F A;  1OYI A;  3PL8 A;  2K27 A;  3KPH A;  1XCV A;  2FBK A;  1XC5 A;  1RES A;  1XDU A;  3CCS I;  3QYE A;  1X58 A;  3N97 A;  3Q3S A;  3S16 J;  2XAQ A;  1IG7 A;  2B7E A;  3FK7 A;  5EG0 B;  4K2E A;  1AA7 A;  1BI2 A;  2CUE A;  3VYR B;  2BY0 A;  1MBG A;  2VE9 A;  2EWN A;  1CQT A;  3S3M A;  1U6G A;  4X0G A;  3GZN B;  4F93 B;  3PQK A;  4MQ9 F;  2MSY A;  4MQV A;  3FKI J;  4FX4 A;  2MLK A;  4O3M A;  2FQ3 A;  4CYD A;  1ETX A;  2FD5 A;  2NS7 A;  5LLQ A;  3IH3 A;  5DYM A;  4DBR A;  1R9T J;  2MYS A;  1WKM A;  4YEL A;  1IUY A;  1XG1 A;  2CUZ A;  3I71 A;  3VYU B;  1HBX G;  1UAA A;  2VQC A;  3LSI A;  4I0B A;  1IDY A;  3WTX C;  2O0Y A;  1P4X A;  2FML A;  1L3L A;  2WV0 A;  1APL C;  1J0R A;  2GIZ A;  1XS9 A;  1TWG J;  1USS A;  2V79 A;  2AXL A;  4U7B A;  2L5Q A;  3GTP J;  2L9N A;  2VBW A;  1Z05 A;  3DV8 A;  4XOT A;  2IJL A;  4AD9 A;  1RR8 C;  2PLY A;  2E7X A;  1YQA A;  3L7W A;  2IW5 A;  3MKZ A;  1BW6 A;  2HGC A;  3TW7 A;  5JHU A;  2KDZ A;  2VXD A;  1BA5 A;  1KZH A;  4E7L A;  1EF4 A;  1IN8 A;  4JK1 X;  1ONV A;  4Q47 A;  2DFI A;  5CPR B;  2NVQ J;  3KP2 A;  3QOE A;  5AIQ A;  2Z16 A;  2LP0 A;  2ZC2 A;  4ZJZ A;  2XF5 A;  2XB5 A;  1QVU A;  2R7Z J;  2EV5 A;  2FUG 2;  3V8J A;  4OMY A;  1IN4 A;  2BY2 A;  1K4S A;  2O6G E;  1IO2 A;  1QU3 A;  1YI2 I;  4KIB A;  1AU7 A;  1Y0N A;  2XDV A;  4XON A;  3NAR A;  2OTL I;  2VC1 A;  5BNG A;  3SHF A;  3BCA A;  2M7B A;  5FO5 A;  4MFD A;  5KCM A;  4E7H A;  4II3 A;  3J7Y J;  2I8D A;  3I64 A;  3HUG B;  1SFX A;  4ANJ A;  2EFW A;  3QP6 A;  3ZRG A;  2CW7 A;  2JSP A;  2K3F A;  2LBF A;  4YEJ A;  1X19 A;  2XF7 A;  2JQ7 A;  2RQQ A;  3WTU C;  4HF0 A;  1ZG3 A;  4G6D A;  2DA2 A;  1FTT A;  4BBR J;  1ZG1 A;  5B5E C;  1P7I A;  1UCR A;  3FBN B;  3PUF A;  3QU3 A;  2NNY A;  3QYB A;  4YFN F;  5L3C A;  1BOA A;  3BPV A;  2XAJ A;  1CGP A;  3JRB A;  3WGG A;  5LEJ A;  3BY6 A;  3GX4 X;  2K9S A;  3I5U A;  2ZNZ A;  2EFN A;  4L5I A;  3WTW C;  2D5V A;  1B1B A;  2X1C A;  4W97 A;  3WE2 A;  2K5C A;  3B02 A;  1TTY A;  2ZJR F;  4PZJ A;  4E6K G;  2CUJ A;  2MAB A;  2WAE A;  4IHV A;  1JXS A;  2I10 A;  2R93 J;  1D0X A;  1K6Y A;  3FXO A;  4HST A;  2DA4 A;  2HU9 A;  4B1R A;  4MHG A;  4Y52 J;  4BE0 A;  4ENM A;  4KT6 A;  3V8K A;  4JOM A;  4XK4 A;  3C2B A;  1R71 A;  1XTA A;  3BG7 A;  1Y1W J;  1X1A A;  3DBL B;  5GAG J;  2DFF A;  2STW A;  2M4G A;  3GF2 A;  4BH9 A;  3FXJ A;  1WZ2 A;  2JRT A;  2XGE A;  3GTG J;  3CMY A;  2HPI A;  1L0O C;  3SFI A;  3HKZ A;  5LHI A;  1RKT A;  5J3L A;  3IAM 2;  4RB1 A;  2CRG A;  3VOD A;  3JRC A;  4C2T A;  1XSV A;  1J59 A;  2PQ8 A;  2L4M A;  4M9Z A;  2ELJ A;  3CO6 C;  2P7C B;  2R5Z B;  3I54 A;  3H35 A;  4RGR A;  3HOT A;  5H20 A;  5E79 C;  2ZXI A;  3LQQ A;  1R00 A;  3BZC A;  4FHT A;  1JTY A;  3SYT A;  3LSR A;  1HDD C;  1O3S A;  5JVT A;  1UHW A;  2QEX I;  1SAU A;  1SVO A;  4XRM A;  1HKT A;  1ZEL A;  4DYC A;  4HF2 A;  3ISP A;  3SZG A;  1PUF A;  3LSH A;  2GXA A;  3GWZ A;  4G6T B;  4U88 A;  5M5Y J;  2KPM A;  4HV6 A;  2R7O A;  3HPG A;  3KP7 A;  2VXZ A;  2Y48 A;  4Y3O A;  1UJ8 A;  4CCO A;  4CSW A;  1LE8 A;  3HBL A;  3ONQ A;  1FSE A;  1LDD A;  3R6S A;  2Q8K A;  1MMS A;  2FU4 A;  4N4O B;  2OV7 A;  2E5N A;  4F55 A;  3G6E I;  2W24 A;  3JRD A;  9ANT A;  2Y75 A;  2ZJP F;  4EM0 B;  2AXT C;  2Z9O A;  1UEL B;  1S7E A;  3VOE A;  1OR7 C;  3OOU A;  2L7M P;  4CZZ A;  2LD5 A;  1JGG A;  3S2H J;  2FSW A;  3H0G J;  4UB6 C;  4Y15 A;  2LFB A;  1ZLK A;  4CUG A;  5E20 A;  1RPW A;  3G4S I;  1OR7 A;  5EZG A;  2OBP A;  3H9J A;  1DGW Y;  3CJN A;  2OQG A;  3CCU I;  3ZCO A;  1NK2 P;  2M2E A;  3EDP A;  2AQE A;  3DBR B;  2HDD A;  3OYM A;  4QPQ A;  5K5O A;  3OR1 C;  1YG2 A;  2HDC A;  3PSI A;  5M5W J;  3FIS A;  3GW2 A;  1SEU A;  5DV5 A;  4C3I J;  3LOC A;  1QGP A;  2Y0S A;  2DA1 A;  1X3Z B;  5IYC J;  2GQQ A;  2VOD A;  3WG7 H;  3G1M A;  3HRU A;  4QSH A;  3DFG A;  3QWL A;  3DEW A;  2EIM H;  1MDM A;  1SFE A;  3ELK A;  4NQW B;  1Z7U A;  2JPC A;  2VB6 A;  1W7P B;  4NC8 A;  3TMO A;  4BE2 A;  5JI6 A;  2HOE A;  1J09 A;  4B44 A;  5KVR A;  2Q1Z B;  4DJA A;  2O8X A;  1MMN A;  3MEX A;  4M3D A;  2XSD C;  3JSO A;  4KIG A;  2H27 A;  1R36 A;  2F5V A;  2ZNY A;  3IH2 A;  3P9K A;  2M0C A;  2Y30 A;  3CDI A;  4RGU A;  3H9Q A;  5TGT A;  1JKR C;  1ZQ3 P;  2OUM A;  1H8A C;  2R3S A;  1J75 A;  3S17 J;  2Y0M A;  2F4M B;  4RLQ A;  4HDU A;  4N4N B;  2OCC H;  1UHM A;  3OMY A;  4RB2 C;  4KIF A;  3SDB A;  4EJW A;  1LFU P;  2EJR A;  4A2U A;  4F7Z A;  2DTR A;  2BVM A;  4N9H A;  2UXX A;  1YJW I;  4S04 A;  5D6E A;  3MMY B;  5DEQ A;  1FLI A;  4HF1 A;  3HRT A;  3ZPL A;  3IKV A;  3BZK A;  2V6C A;  1RZ4 A;  2D1H A;  2KIS A;  2ZXW H;  3QP5 A;  2W4S A;  2QSF X;  3QPT A;  4Y13 A;  1CF7 B;  2MW8 A;  2CQX A;  2ZB9 A;  2LH9 A;  1U0J A;  3IAS 2;  4M9X A;  2BY1 A;  2OU2 A;  2CQ7 A;  3GVA A;  1E3O C;  2LF7 A;  1B59 A;  3BR2 A;  4E7I A;  2AS5 F;  2L7F P;  2R4G A;  4M3F A;  5FRO A;  2HTS A;  2EK5 A;  1OQY A;  2V1X A;  3ABU A;  3R4K A;  4MLO A;  3AG2 H;  3BR6 A;  4ZYA A;  1JJ6 C;  2UUZ A;  1WQ2 A;  2Y9Z A;  4ZDL A;  3HHG A;  1GT0 C;  4HNT A;  3BWG A;  2Y31 A;  1FZP B;  3GEZ A;  1LKX A;  4UUT A;  5EJC A;  1FT9 A;  3CC4 I;  2M30 A;  1MJ9 A;  2ELK A;  3DEE A;  2IPQ X;  5GTH C;  3OIQ A;  4E7J A;  2GLO A;  2ZCW A;  2Y9Y A;  2JVH A;  1FNN A;  3G71 I;  4BE1 A;  4RB0 A;  3OYC A;  5BMZ A;  3TED A;  3BR3 A;  1YE9 A;  3CF5 F;  2NOJ B;  1IAW A;  4LB6 B;  3F0C A;  6PAX A;  3HOY J;  2VE8 A;  3Q9V A;  1VQL I;  1K78 B;  2DA3 A;  4LOC A;  4PCQ A;  5E8I A;  2DI3 A;  3ASO H;  3SDG A;  1VQO I;  2AHQ A;  5M3F J;  1T33 A;  3QYF A;  4GGG A;  1S29 A;  1YJN I;  2KJC A;  4XLC A;  3DTK A;  4PJ0 C;  2R7U A;  1STZ A;  4BQA A;  5HS7 A;  5E17 F;  1G3W A;  4W1U A;  2P7V B;  2HEO A;  4WF2 A;  1HDP A;  5TJJ A;  3CZ6 A;  4MGR A;  1RC9 A;  5E3M A;  2H8R A;  1P2F A;  3MKY B;  3HC7 A;  5HDK A;  4XKV A;  1KQ8 A;  1S3J A;  5EEG A;  2K9L A;  2DT6 A;  3KCC A;  2PFB A;  4NHJ A;  5AIP A;  2OC6 A;  2CS3 A;  1WJA A;  1HC8 A;  4CZC A;  2K02 A;  3K6G A;  3L2C A;  3GFL A;  4HQE A;  4AC0 A;  2WAQ A;  1FYK A;  2LY1 A;  2HWV A;  5LHG A;  1RR7 A;  2GBY A;  4PGG A;  3KLN A;  5A2Q K;  3MZY A;  2CO5 A;  5FLV A;  2L0K A;  2BEO A;  3U21 A;  3BG5 A;  2UXN A;  1T98 A;  2CW0 F;  2L7Z A;  4D7M A;  4ENK A;  3A0H C;  3L2W A;  3HOZ J;  1HLV A;  5E1Z B;  1ZYR F;  3GLX A;  3HEF A;  1IRX A;  5D8L B;  1U5T C;  2WB1 N;  3EUH C;  1HW2 A;  3KYC B;  2KDO A;  2MH9 A;  2F5D A;  4HX7 A;  1T0F C;  4A3D J;  4J01 A;  2VJ5 A;  3JRA A;  2LOO A;  2KP6 A;  4GRI A;  5BPD A;  1W7P D;  1LDK B;  1R5G A;  2JSC A;  3AG1 H;  1U5T A;  3KIO A;  3S8P A;  3RIR A;  4AID A;  5E18 F;  1T0F A;  3FMQ A;  3L00 A;  5IPA A;  4I98 B;  3BJO A;  1OYY A;  3DKX A;  2JRM A;  5DM7 F;  5BQT A;  2DA5 A;  3ZMV A;  2NAZ A;  3OYJ A;  1B72 B;  1ITY A;  1MJA A;  3D5L A;  2JVG A;  4XKC A;  3K1P A;  1W36 C;  2Z3Y A;  3TBI A;  3HSE A;  1HKQ A;  3CLO A;  1WH7 A;  3VWB A;  4ENJ A;  1BIA A;  2G7U A;  4BXF A;  1R7J A;  1P6R A;  1I3A A;  3I53 A;  4XLE A;  4P96 A;  3RPQ A;  1GXP A;  3S2D J;  2K4J A;  3LA2 A;  2YPR A;  4X1E A;  1MBJ A;  2BXZ A;  3CTA A;  5LRR A;  4FQG A;  2BW3 B;  1BN5 A;  1D8K A;  1IJW C;  5E3L A;  2NVX J;  2JUG A;  3L2R A;  2DO7 A;  2DBB A;  1D0Z A;  2QUF A;  4UVC A;  2PX9 A;  2MA3 A;  4QIW N;  5GPA A;  4IOC F;  3CME I;  1O57 A;  4LG0 B;  1OKR A;  4NNJ A;  3M1C A;  3ZQQ A;  5IT3 A;  4IHT A;  4P1W A;  1BJA A;  4MTD A;  3O2P E;  3LSP A;  1MBF A;  3U2R A;  1AKH A;  2R7Q A;  4M6V A;  3R0A A;  3ZR8 X;  3BCB A;  2FF4 A;  3COA C;  3CCQ I;  4OIO F;  1ERD A;  3BG9 A;  3J7Z I;  2IA1 A;  2V4J C;  3SXY A;  4P5O A;  2QA4 I;  3GXO A;  3CCV I;  1XMA A;  4N9I A;  4U0V A;  2DA7 A;  2W7N A;  3CO7 C;  3RTR A;  2XAF A;  1Z91 A;  3DXJ F;  4HLX A;  4LIU A;  2Q2E B;  1D1A A;  1YLF A;  1Z3X A;  1B6A A;  2L9V A;  3F6O A;  2ZME B;  3TP3 A;  1BR1 A;  1DPR A;  1ZN2 A;  1TQP A;  4NQW A;  2YS9 A;  1R4N B;  2E35 A;  1W7P A;  3BR1 A;  5KNL A;  3ZQG A;  4UNO A;  4BHC A;  2F4O B;  4EVI A;  2LY2 A;  1X2N A;  1YHQ I;  4U0Y A;  2CGP A;  4Y7N J;  2PN6 A;  3CLQ A;  1FOX A;  2PMZ N;  2ISY A;  3EQL F;  1JGS A;  4G8X A;  1JUS A;  2DMQ A;  2XV4 S;  3IP4 B;  5CVI A;  2MC4 A;  5FLM J;  5D5X B;  3E6M A;  3HDD A;  2YX7 A;  4HDV A;  4GYI A;  2RRE A;  2M87 A;  3WTS C;  3HZJ A;  1LFP A;  4XM3 A;  2M5W A;  3FHZ A;  1J9I A;  1R5I D;  2EFO A;  4NC7 A;  2RV8 A;  2VQL A;  2PMH A;  2VKD A;  3I59 A;  3R60 A;  4AWX B;  3EUK L;  5KK1 A;  2FOK A;  3DPT A;  2WY8 Q;  4EJU A;  2V6E A;  2DPU A;  4L0Y B;  1O7L A;  1G3T A;  2LK2 A;  1T39 A;  3O6B B;  1ETY A;  1EH7 A;  2R7W A;  2A3S A;  2EB7 A;  4AIJ A;  5C3E J;  3TO6 A;  2L4A A;  3HSR A;  4A6D A;  3GTJ J;  2HVS A;  2IGM A;  1Q1H A;  3E5X A;  4HX4 A;  2H8W A;  5F04 A;  4LG3 A;  3FHN A;  3WU2 C;  2CV1 A;  3E97 A;  4CHU A;  1FIA A;  4KT5 C;  4OIN F;  1IN5 A;  4GO1 A;  1JE8 A;  1YS7 A;  3IHU A;  3GTM J;  1IDZ A;  5J8F A;  1IZ1 A;  2EV6 A;  3IKT A;  3FF5 A;  4RGS A;  3FDY A;  3LFU A;  3LFK A;  4HSR A;  4EAT A;  5DDG A;  1TW3 A;  3TO7 A;  5K7Z A;  3KP3 A;  4E7S A;  3OIO A;  4FET A;  3KZZ A;  4XBF A;  2BV6 A;  2QYO A;  1YIJ I;  1H0M A;  4LJZ F;  3WTY C;  2QBY A;  4LGW A;  5J8C A;  2GOM A;  3OYK A;  4IF4 A;  2RVC A;  2RGV A;  1K78 A;  3S93 A;  2VPL A;  5IY5 H;  2XGX A;  1IV8 A;  4G7O F;  1IRZ A;  2XHK A;  2EV0 A;  2VQH A;  3BTI A;  3VSL A;  3AL0 C;  2DAO A;  4IHS A;  3WHC A;  5ILV A;  1Q1V A;  3Q0V A;  1H9G A;  3LA3 A;  5DTD A;  3AKZ A;  4UHT A;  2Z2S B;  2PBI A;  3CDH A;  4IQ4 A;  4BUP A;  4IQJ A;  3HG9 A;  3RSN A;  5TRD A;  4NC6 A;  2D1V A;  5ILS A;  2VKH A;  3LWF A;  2X6O A;  3FZV A;  2K86 A;  4OIR F;  3HM5 A;  3KET A;  2DFE A;  2DQR A;  3EET A;  1MND A;  3K4M A;  1VQ7 I;  2HYG D;  2YX4 A;  5CVU A;  1B4A A;  4F92 B;  4AYB A;  5J4V A;  1JKQ C;  4HBL A;  1V55 H;  2NYX A;  1FP1 D;  1R1T A;  2ZJ2 A;  1R6R A;  2W25 A;  1DU0 A;  2JN6 A;  2UV1 A;  3C2H A;  5EGO A;  5FRN A;  1WFX A;  1YO5 C;  2E36 A;  3QOD A;  3R0J A;  3BG3 A;  2GXG A;  1QRY A;  2Z99 A;  4CCN A;  4BBS J;  3S15 J;  2MC3 A;  4XN0 A;  2Q0O A;  2QLZ A;  4M3B A;  3M4O J;  3S1R J;  3JRH A;  4CCJ A;  2M9H A;  1R22 A;  3ZP5 A;  2RKH A;  1VQ6 I;  1U9N A;  1FPQ A;  2E1M C;  1B8I A;  2K9M A;  1TBX A;  1FMW A;  3K4K A;  3RPU D;  3A2K A;  4HZF A;  1TW2 A;  2NVU B;  4A3F J;  2HZT A;  2OZU A;  5DD8 A;  2JJ7 A;  1W5T A;  2L3D A;  2HS5 A;  4LD5 A;  2DOF A;  4FCY A;  1E2X A;  1POG A;  3KE2 A;  4I7H A;  3CP8 A;  1MIJ A;  3DKY A;  5HLH A;  1ZRE A;  2J5P A;  2LKS A;  4G94 A;  2RDP A;  2PJP A;  2JT1 A;  2ZXJ A;  3KP4 A;  2B0L A;  2BY3 A;  3CCE I;  1XDS A;  2PMU A;  4UUS A;  1QQI A;  2DOD A;  2DW4 A;  3F3X A;  2Z33 A;  2HXI A;  1JUM A;  1QZE A;  3I0T A;  3MD2 A;  1ZLJ A;  3K4B A;  1LUJ B;  3S3O A;  2IS6 A;  3LSK A;  3H36 A;  1SMY F;  2W82 A;  4CXF A;  2OCE A;  4B47 A;  1ZAR A;  5DS9 A;  4BKX A;  2VUM J;  1LEA A;  3FXU A;  2R7R A;  3LMM A;  1RET A;  3F8F A;  2FJ1 A;  2ZFW A;  4U7D A;  1Y0U A;  3FXK A;  3ZMS A;  1AWC A;  4QWQ A;  2KQR A;  4RM3 A;  5C44 J;  3GBG A;  4PDK A;  2HYJ A;  1SFU A;  4QPO A;  1D5V A;  5IYD J;  3WHB A;  1JJ8 C;  1JHF A;  2M1B A;  5HDN A;  1S6L A;  4HEA 2;  1GLN A;  2OJE D;  4O5V A;  3RQI A;  3U9G A;  4HX8 A;  1R58 A;  4XID A;  2STT A;  1E3H A;  4OAZ A;  4UY8 I;  4C30 A;  1UST A;  4M73 A;  1A31 A;  4UV9 A;  3KZI C;  4Y17 A;  2M3A A;  3BZ6 A;  1H89 C;  2B9S A;  1I5Z A;  5C4J J;  1FSH A;  2E2I J;  4G6Q A;  1MMG A;  1D8J A;  3KEY A;  3A02 A;  3T1B A;  3WGI A;  1ZK8 A;  2GAU A;  1Z6T A;  2DJN A;  1A35 A;  1GHC A;  1U8B A;  1TWC J;  3W6K B;  3I56 I;  4WXC A;  2KRF A; 
#chains in the Genus database with same CATH homology
 4EJO A;  2LKP A;  2XVC A;  1FYL A;  4BYY A;  3LAP A;  1HW1 A;  1XGS A;  3J81 K;  2VBY A;  3V7C A;  1J2X A;  4GCV A;  3SQN A;  2A07 F;  5J6X A;  1XGM A;  3CUQ B;  4L9V A;  2ACJ A;  3HIF A;  4A0X A;  2ZKZ A;  4RAZ A;  4EGY A;  3C18 A;  1P92 A;  4AIH A;  3WGH A;  5K1Y A;  2GIV A;  2QM3 A;  1IXS B;  3KFW X;  1BI3 A;  2H94 A;  2P5V A;  3NQO A;  3M9A A;  1F5T A;  2DLL A;  2QEN A;  2X4H A;  2V1D A;  2F5E A;  1P4A A;  2HR3 A;  4KUM A;  1QBJ A;  3JTH A;  2DK5 A;  1G6N A;  3RJP A;  1K7A A;  3GUD A;  3P7N A;  1G3Y A;  3BJA A;  2FMY A;  1HSJ A;  1O3T A;  1LVA A;  5E1W A;  1EH8 A;  1EV7 A;  5CLS A;  4EJV A;  4ZYH A;  2F2E A;  2L01 A;  1XSX A;  4RAY A;  2RC4 A;  4WXH A;  4H0E A;  2D45 A;  2QVO A;  2FE3 A;  4WWC A;  1FBS A;  4RGX A;  3RKW A;  2JZY A;  2XAH A;  3T8T A;  4EJT A;  2A61 A;  1XSD A;  1Z1D A;  1LNW A;  3KP6 A;  4ENN A;  2ZO4 A;  3DF8 A;  1VTN C;  1KU2 A;  1OPC A;  1BBY A;  4N0B A;  3T5X A;  1I6X A;  4XLP F;  4P55 A;  5LBQ A;  1MJB A;  1ZGJ A;  1YIO A;  2GWR A;  4M71 A;  1KU7 A;  2P8T A;  2VN2 A;  1B9N A;  1C0W A;  3OOP A;  1BI1 A;  1W5S A;  3D0S A;  1KYW A;  4HV5 A;  3S2W A;  2G7H A;  4Z2Y A;  2A5Y B;  4WCG A;  2YU3 A;  1GXQ A;  2ESN A;  3MCZ A;  3JTG A;  1SMT A;  1KQ0 A;  3ERE D;  3QPH A;  2GA2 A;  2GA1 A;  1ZHF A;  2J5O A;  2EA2 A;  1MD0 A;  4LLN A;  5F1R A;  1SAX A;  5FB2 A;  5BPI A;  1D3Y A;  2XKO A;  3BRO A;  1LQ1 A;  4MNU A;  2CWE A;  2NS0 A;  1ODD A;  3EYY A;  2FNA A;  5D5V B;  1K79 A;  3J81 Z;  3FM3 A;  4PGH A;  1F1Z A;  4CO8 A;  5FD6 A;  3HRS A;  3HUG A;  4LLG F;  4M9S A;  2HKO A;  2LDU A;  1WWX A;  4IXA A;  2CFX A;  1YW8 A;  3O3K A;  2W57 A;  3WTZ A;  3F8N A;  3LA7 A;  1SD6 A;  1R23 A;  2A69 F;  3JSP A;  3SZT A;  5ICF A;  4ZZD A;  3TOB A;  2OZ6 A;  2COM A;  4JQF A;  4Q48 A;  1YW7 A;  1G4D A;  5BS6 A;  3G73 A;  2HTJ A;  5IT9 K;  2GZW A;  1FOK A;  4BXU A;  3VB2 A;  2VBX A;  2OD5 A;  4D0P A;  2XIG A;  1DUX C;  3ZMU A;  4XSX F;  2C6Y A;  3ZN1 A;  5L3F A;  2FRH A;  2F5C A;  4EMS A;  1XGO A;  3WTV C;  2L54 A;  2XRO A;  2O3F A;  5LGT A;  1KU3 A;  2EFP A;  3HSF A;  3FX3 A;  2VOO A;  1I1G A;  2PG4 A;  3F8M A;  5L3G A;  3DPL C;  4LLL A;  3E6B A;  4B09 A;  4KFC A;  4R1H A;  3OV8 A;  4KA4 A;  3HTU A;  1XMK A;  1O7F A;  2IVM A;  2R7F A;  1PDN C;  3IRQ A;  4KYW A;  1OMI A;  3M7G A;  1I27 A;  2XAG A;  5D4R A;  3V8L A;  4I02 A;  4Q5S F;  2LNB A;  1RIO H;  2ELH A;  1H9T A;  3MZH A;  4IJA A;  4L9T A;  1S8N A;  1T2K A;  1O3Q A;  2JPB A;  3WTT C;  1U3E M;  4A5M A;  1BC8 C;  1DP7 P;  4R8H A;  3GO5 A;  2VC0 A;  4M6Y A;  4ASN A;  1ZH5 A;  3KP5 A;  4AIK A;  5HLG A;  2E1N A;  3RYR A;  1FC3 A;  4ON0 A;  1MZB A;  3F22 A;  1IXC A;  3QU6 A;  4DQ2 A;  1QO0 D;  1RI7 A;  1QNT A;  4XLN F;  2IA2 A;  2E1C A;  2EA4 A;  3TDU C;  2W84 A;  5HS8 A;  1YS6 A;  1KQ9 A;  1CF7 A;  2ISZ A;  1S7A A;  4P9U A;  2DU9 A;  2X0L A;  4RS8 A;  3K0L A;  2XAS A;  4L5J A;  4MTE A;  3CUO A;  2HQR A;  4IVN A;  3V7R A;  5AON A;  5DD4 A;  5F64 A;  1ZGA A;  1ZRC A;  1HKS A;  4TV7 A;  1WRJ A;  3QRF F;  3ZQ7 A;  2MD5 A;  3E6C C;  1KU9 A;  5L3E A;  3F21 A;  4O6J A;  4RB3 C;  4HW0 A;  1QPM A;  1UB9 A;  5LEK A;  4WK8 F;  4QLC U;  3HOS A;  2DQL A;  2BGC A;  3ZMD A;  4L18 B;  1U8R A;  5ED4 A;  3C1D A;  4KDP A;  1I1S A;  5IT9 Z;  4A6E A;  4LFU A;  4A0Y A;  1TLH B;  4YG2 F;  2XKP A;  4MEY F;  4M6X A;  5H6R A;  1MDM B;  2DK8 A;  4R79 A;  5FLX K;  3LST A;  2P6T A;  3TQN A;  1MKM A;  1Z9C A;  5FGM A;  5CJ9 A;  4KN7 X;  3ZMZ A;  4FX0 A;  2P5K A;  5DCM B;  2M8E A;  3RKY A;  3F8C A;  2QZ8 A;  1TQI A;  2V9V A;  2FEZ A;  2K7L A;  3MAJ A;  1ON1 A;  5H6Q A;  1RNL A;  1PUE E;  1T38 A;  3BP8 A;  1R1U A;  4ZZL A;  2O61 A;  2VT2 A;  1WSU A;  3H3U A;  1DPU A;  2VBZ A;  2QQB A;  1FX7 A;  4LK0 F;  3GZ5 A;  3JAM K;  1SD7 A;  3BDD A;  4E70 A;  2W85 A;  2CYY A;  5ICC A;  1V3F A;  4A0Z A;  3U1D A;  2IT0 A;  5LGN A;  3T0Y A;  3EYI A;  4CGZ A;  3RDI A;  4EM2 A;  4LG0 A;  1FY7 A;  5FD5 A;  4G7Z F;  1V4R A;  3P9I A;  3H92 A;  3QAH A;  1LEB A;  3GFM A;  3K2Z A;  2OQR A;  4XSZ F;  3ZMT A;  5L3D A;  1ZRD A;  2ZME C;  3FMR A;  4UV8 A;  3IWF A;  1TNS A;  2D2W A;  1E17 A;  2Q2E A;  5HOO A;  3RPU A;  4ZH4 F;  2ZME A;  4BNC A;  1XD7 A;  2Z5U A;  4L0Z B;  2L02 A;  4OU0 A;  4G7H F;  2P5L C;  4I0A A;  1LJ9 A;  2DT5 A;  3M8F A;  3Q5F A;  3MWM A;  1YYV A;  3ECO A;  2WWY A;  5CVR A;  2QQA A;  3J80 Z;  2ZBK A;  1OYW A;  3RKX A;  3C3W A;  3M8E A;  3I58 A;  4KNY A;  3FMS A;  2UZK A;  1B9M A;  2IA0 A;  1Z6R A;  3HYI A;  5JR3 A;  4L9N A;  1U5T B;  1RUO A;  4BHP A;  2PI0 A;  1KGS A;  1X3U A;  1SD4 A;  1IRG A;  3TGN A;  3FXQ A;  2VON A;  1IW7 F;  4HYE A;  4HQM A;  3TOA A;  3K1M A;  1FBU A;  4EQQ A;  1XN7 A;  4B8X A;  2ADU A;  2P6S A;  3E5U A;  2H6B A;  2YSR A;  4KMF A;  2H09 A;  3KEQ A;  4Q4Z F;  5FLX Z;  3NRV A;  2MH2 A;  4A12 A;  1SD5 A;  3E6D A;  5HVQ C;  2LF8 A;  1HST A;  2E7W A;  4CDG A;  4FT8 A;  2FBI A;  4XRF A;  2MLG A;  4U0W A;  1GVJ A;  3DEU A;  2NRA C;  3L9F A;  5HS9 A;  2NNN A;  1BC7 C;  1QZY A;  2M45 A;  3J7A O;  4P9F A;  1BM9 A;  2DPD A;  2OAZ A;  4M74 A;  2VOP A;  2K4B A;  3BPX A;  5JFR A;  3TKY A;  2EFQ A;  3Q9S A;  2O03 A;  1ZRF A;  5DCM A;  4BAY A;  3B73 A;  4NB5 A;  3JAM Z;  1W4M A;  4ZYG A;  2PEX A;  1PP7 U;  3VFZ A;  1FWZ A;  1HQC A;  3I59 B;  4HA8 A;  2QQ9 A;  3LQR A;  4L9J A;  1DDN A;  2P4W A;  3HRM A;  4ZYE A;  1ZAO A;  2KIU A;  3DP7 A;  4YFK F;  1IN6 A;  5D5W B;  3NEU A;  2BYV E;  2MBF A;  3C7J A;  3GFI A;  3ML6 A;  3K1N A;  5K5R A;  4HOB A;  2FA5 A;  2QWW A;  4A5N A;  3SFZ A;  3ULQ B;  5DCF A;  2HYF A;  2HQN A;  2KIM A;  1T6S A;  2F5F A;  1NHA A;  1LB2 A;  2IP2 A;  4M72 A;  2QBY B;  5E1X A;  2WC2 A;  1ON2 A;  1HXD A;  2XRN A;  4UXN A;  1HW5 A;  2WTE A;  3DQV C;  2CSO A;  5LRS A;  2TDX A;  1EH6 A;  3BOQ A;  4LMY A;  1XCB A;  4OIQ F;  3FXR A;  1KYZ A;  4I2O A;  3CUQ C;  1FP2 A;  1IRF A;  5ERI A;  5D4S A;  4BHB A;  3CUQ A;  2A6H F;  3R61 A;  2KIF A;  3JW4 A;  3TO9 A;  3HTS B;  1U2W A;  5EEH A;  5ICG A;  4S05 A;  1YW9 A;  2FNP A;  3PFI A;  1F4K A;  2RN7 A;  1FYM A;  2A6E F;  3RI4 A;  1G3S A;  4MEX F;  3ECH A;  1QZZ A;  2ESH A;  3LAJ A;  2JTV A;  3EUH A;  2ETH A;  4AVP A;  2UWM A;  3ROU A;  5L3B A;  2HFH A;  5HDG A;  2FXA A;  4UUV A;  1ULY A;  2OA4 A;  2H6C A;  4EM1 A;  4UVA A;  3RYP A;  4HLY A;  1BIB A;  1J7K A;  3KLO A;  3SZP A;  2CQK A;  3M1E A;  2RQP A;  3KZY A;  5FFZ A;  3HHH A;  4CIC A;  3P9C A;  4IRG A;  5ILU A;  1LDJ A;  4LK1 F;  5F6F A;  4OIP F;  3FWE A;  1S7O A;  4KIC A;  3T8R A;  1PP8 F;  4ESF A;  2RNJ A;  1YTY A;  4ZYD A;  4ESJ A;  3BJ6 A;  3GYH X;  5BOX A;  4ETS A;  3L09 A;  3MFK A;  1ZG5 A;  4DNC A;  1J5Y A;  5D8K B;  1K6O A;  1U78 A;  3W6J B;  4EV0 A;  1FBQ A;  2BE5 F;  4UVB A;  1REP C;  3AAF A;  1KA8 A;  1MGT A;  3REO A;  3WU1 B;  3VEP A;  3H3Z A;  3G3Z A;  5ICE A;  5CVV A;  3F23 A;  2YR2 A;  3IL2 A;  4I09 A;  3GZ6 A;  1P4W A;  4I01 A;  4IRH A;  1JHH A;  5CYV A;  3V4G A;  4WXD A;  3F6V A;  4OMZ A;  1XB4 A;  5LGU A;  2IRF G;  3PQJ A;  4GXO A;  3QOP A;  3J80 K;  2V1U A;  2G9W A;  1IF1 A;  1TNT A;  2A68 F;  2KKO A;  2GXB A;  2FBH A;  5DUK A;  4KMU X;  3K69 A;  3V7S A;  2CG4 A;  3WG9 A;  3WU0 A;  4JBA A;  3IC7 A;  2KJB A;  3IRR A;  2HKX A;  1A04 A;  3DKW A;  3I4P A;  4LB5 A;  1O3R A;  3F8B A;  3KEO A;  3MQ0 A;  4YII A;  4HAM A;  1IXR C;  3WE3 A;  5K5Q A;  2R7D A;  4IRI A;  1AOY A;  5CVJ A;  5DUI A;  1XGN A;  3WOD F;  4YFX F;  4EGZ A;  5D5U B;  4KN4 X;  3GFJ A;  4WX9 A;  4GYG A;  1WI9 A;  4OOI A;  3ABT A;  3ZN0 A;  5HLI A;  4ESB A;  1TQM A;  5A2Q Z;  1RUN A;  3N4M A;  3TDZ C;  4G9Y A;  1BI0 A;  1F9N A;  1YFH A;  3FM5 A;  3E3V A;  1R5H A;  3K9T A;  5LHH A;  5FFX A;  3IWZ A;  2VT3 A;  2XUB A;  3F72 A;  2LSO A;  4YIF A;  1IN7 A;  1UFM A;  5E8G A;  3E5Q A;  2BBY A;  4IPA A;  1R1V A;  5D6F A;  1OYI A;  2K27 A;  1XCV A;  2FBK A;  1XDU A;  3N97 A;  2XAQ A;  4K2E A;  1BI2 A;  2VE9 A;  2EWN A;  1U6G A;  3PQK A;  4MQ9 F;  4MQV A;  4FX4 A;  4O3M A;  2MLK A;  2FQ3 A;  4CYD A;  5LLQ A;  5DYM A;  1WKM A;  1IUY A;  3I71 A;  1HBX G;  4I0B A;  3WTX C;  2O0Y A;  1P4X A;  2FML A;  1L3L A;  2WV0 A;  1J0R A;  1USS A;  2V79 A;  2AXL A;  4U7B A;  2VBW A;  1Z05 A;  3DV8 A;  4AD9 A;  2IJL A;  2PLY A;  2E7X A;  1YQA A;  3L7W A;  2IW5 A;  2HGC A;  5JHU A;  1IN8 A;  4JK1 X;  1ONV A;  4Q47 A;  2DFI A;  3KP2 A;  5AIQ A;  2EV5 A;  3V8J A;  4OMY A;  1IN4 A;  2O6G E;  4KIB A;  2VC1 A;  3SHF A;  5FO5 A;  3I64 A;  1SFX A;  2EFW A;  3QP6 A;  3WTU C;  4HF0 A;  1ZG3 A;  4G6D A;  1ZG1 A;  1UCR A;  3QU3 A;  2NNY A;  4YFN F;  5L3C A;  1BOA A;  3BPV A;  2XAJ A;  1CGP A;  3WGG A;  5LEJ A;  3BY6 A;  3GX4 X;  3I5U A;  2ZNZ A;  2EFN A;  4L5I A;  3WTW C;  1B1B A;  3WE2 A;  3B02 A;  1TTY A;  4PZJ A;  1JXS A;  4MHG A;  4ENM A;  3V8K A;  2STW A;  4BH9 A;  3GF2 A;  2JRT A;  1L0O C;  5LHI A;  4RB1 A;  3VOD A;  1XSV A;  1J59 A;  2PQ8 A;  2L4M A;  4M9Z A;  3CO6 C;  2P7C B;  3I54 A;  3HOT A;  4RGR A;  5H20 A;  3LQQ A;  1R00 A;  4FHT A;  1O3S A;  5JVT A;  1UHW A;  1HKT A;  4HF2 A;  3ISP A;  3GWZ A;  4U88 A;  4HV6 A;  3KP7 A;  2VXZ A;  2Y48 A;  1FSE A;  1LDD A;  3R6S A;  2Q8K A;  2FU4 A;  2W24 A;  2Y75 A;  4EM0 B;  2Z9O A;  3VOE A;  4CZZ A;  2FSW A;  4Y15 A;  1ZLK A;  5E20 A;  1OR7 A;  2OBP A;  3CJN A;  2OQG A;  3EDP A;  5K5O A;  2HDC A;  1YG2 A;  3GW2 A;  5DV5 A;  1QGP A;  2GQQ A;  2VOD A;  3HRU A;  3DFG A;  1MDM A;  1SFE A;  3ELK A;  1Z7U A;  2JPC A;  1W7P B;  5JI6 A;  2HOE A;  5KVR A;  2O8X A;  3MEX A;  3JSO A;  4KIG A;  2H27 A;  1R36 A;  2ZNY A;  3P9K A;  4RGU A;  2R3S A;  1J75 A;  2Y0M A;  4HDU A;  1UHM A;  4RB2 C;  4KIF A;  4EJW A;  2EJR A;  4F7Z A;  4A2U A;  2DTR A;  4N9H A;  2UXX A;  4S04 A;  5D6E A;  5DEQ A;  1FLI A;  4HF1 A;  3HRT A;  3ZPL A;  3IKV A;  2V6C A;  1RZ4 A;  2D1H A;  3QP5 A;  3QPT A;  4Y13 A;  1CF7 B;  4M9X A;  2OU2 A;  3GVA A;  2LF7 A;  1B59 A;  2AS5 F;  2HTS A;  2EK5 A;  2V1X A;  3ABU A;  3R4K A;  1WQ2 A;  3HHG A;  3BWG A;  1FZP B;  3GEZ A;  1FT9 A;  2M30 A;  1MJ9 A;  2IPQ X;  2ZCW A;  1FNN A;  4RB0 A;  5BMZ A;  1IAW A;  4LB6 B;  6PAX A;  2VE8 A;  3Q9V A;  1K78 B;  4PCQ A;  5E8I A;  2DI3 A;  4GGG A;  1S29 A;  2KJC A;  1STZ A;  4BQA A;  5HS7 A;  5E17 F;  1G3W A;  2P7V B;  2HEO A;  4WF2 A;  5TJJ A;  4MGR A;  1P2F A;  5HDK A;  1KQ8 A;  1S3J A;  5EEG A;  3KCC A;  2PFB A;  4NHJ A;  5AIP A;  2K02 A;  3L2C A;  3GFL A;  4HQE A;  1FYK A;  5LHG A;  2HWV A;  4PGG A;  5A2Q K;  3KLN A;  3MZY A;  2CO5 A;  2BEO A;  2UXN A;  1T98 A;  2CW0 F;  4ENK A;  5E1Z B;  1ZYR F;  3GLX A;  5D8L B;  1U5T C;  1HW2 A;  2MH9 A;  2F5D A;  4HX7 A;  5BPD A;  1W7P D;  1LDK B;  1R5G A;  2JSC A;  1U5T A;  5E18 F;  3RIR A;  1T0F A;  3FMQ A;  3L00 A;  4I98 B;  3BJO A;  1OYY A;  5BQT A;  3ZMV A;  2NAZ A;  1MJA A;  3D5L A;  3K1P A;  2Z3Y A;  3HSE A;  1HKQ A;  3CLO A;  4ENJ A;  1BIA A;  2G7U A;  1R7J A;  1P6R A;  3I53 A;  4P96 A;  3RPQ A;  1GXP A;  2K4J A;  3LA2 A;  2YPR A;  5LRR A;  3CTA A;  1BN5 A;  1D8K A;  2DO7 A;  2DBB A;  2QUF A;  4UVC A;  2MA3 A;  1O57 A;  4LG0 B;  1OKR A;  5IT3 A;  4IHT A;  1BJA A;  4MTD A;  3O2P E;  3U2R A;  3R0A A;  2FF4 A;  3COA C;  4OIO F;  2IA1 A;  3SXY A;  4P5O A;  3GXO A;  1XMA A;  4N9I A;  4U0V A;  3CO7 C;  3RTR A;  2XAF A;  1Z91 A;  3DXJ F;  4HLX A;  1YLF A;  1B6A A;  3F6O A;  2ZME B;  1DPR A;  1ZN2 A;  1TQP A;  4NQW A;  1W7P A;  4UNO A;  4BHC A;  4EVI A;  4U0Y A;  2CGP A;  2PN6 A;  2ISY A;  3EQL F;  1JGS A;  4G8X A;  2XV4 S;  5CVI A;  5D5X B;  3E6M A;  2YX7 A;  4HDV A;  4GYI A;  2M87 A;  3WTS C;  2M5W A;  3FHZ A;  1J9I A;  2EFO A;  2RV8 A;  2PMH A;  3I59 A;  3R60 A;  4AWX B;  5KK1 A;  2FOK A;  3DPT A;  4EJU A;  2DPU A;  4L0Y B;  1O7L A;  1G3T A;  1T39 A;  3O6B B;  1EH7 A;  2A3S A;  2EB7 A;  4AIJ A;  3TO6 A;  2L4A A;  3HSR A;  4A6D A;  1Q1H A;  3E5X A;  4HX4 A;  3E97 A;  4CHU A;  4KT5 C;  4OIN F;  1IN5 A;  4GO1 A;  1JE8 A;  1YS7 A;  3IHU A;  5J8F A;  1IZ1 A;  2EV6 A;  3IKT A;  3FF5 A;  4RGS A;  3LFK A;  5DDG A;  1TW3 A;  3TO7 A;  3KP3 A;  3KZZ A;  4XBF A;  2BV6 A;  2QYO A;  1H0M A;  4LJZ F;  3WTY C;  2QBY A;  4LGW A;  5J8C A;  4IF4 A;  2RVC A;  2RGV A;  1K78 A;  2XGX A;  4G7O F;  2XHK A;  2EV0 A;  2DAO A;  4IHS A;  5ILV A;  1H9G A;  3LA3 A;  4UHT A;  2PBI A;  3CDH A;  5TRD A;  2D1V A;  5ILS A;  3LWF A;  4OIR F;  3FZV A;  2K86 A;  3KET A;  2DQR A;  3EET A;  2HYG D;  2YX4 A;  5CVU A;  1B4A A;  4HBL A;  2NYX A;  1FP1 D;  1R1T A;  2ZJ2 A;  2W25 A;  1YO5 C;  3R0J A;  2GXG A;  2Z99 A;  2MC3 A;  2Q0O A;  2QLZ A;  1R22 A;  3ZP5 A;  2RKH A;  1FPQ A;  1TBX A;  4HZF A;  1TW2 A;  2HZT A;  2OZU A;  5DD8 A;  1W5T A;  2L3D A;  2HS5 A;  4LD5 A;  1E2X A;  3KE2 A;  4I7H A;  5HLH A;  1ZRE A;  2J5P A;  4G94 A;  2RDP A;  2PJP A;  2JT1 A;  2ZXJ A;  3KP4 A;  2B0L A;  1XDS A;  2PMU A;  1QQI A;  2DW4 A;  3F3X A;  2Z33 A;  3I0T A;  1ZLJ A;  1SMY F;  4CXF A;  1ZAR A;  1LEA A;  3FXU A;  3F8F A;  2ZFW A;  4U7D A;  1Y0U A;  3ZMS A;  1AWC A;  4QWQ A;  4PDK A;  1SFU A;  1D5V A;  1JHF A;  2M1B A;  5HDN A;  1S6L A;  4O5V A;  3U9G A;  4HX8 A;  1R58 A;  2STT A;  1UST A;  4M73 A;  4UV9 A;  4Y17 A;  3BZ6 A;  1I5Z A;  1FSH A;  4G6Q A;  1D8J A;  3T1B A;  3WGI A;  2GAU A;  1GHC A;  1Z6T A;  3W6K B;  4WXC A;  2KRF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...