1U5TC

Structure of the escrt-ii endosomal trafficking complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
198
structure length
178
Chain Sequence
SALPPVYSFPPLYTRQPNSLTRRQQISTWIDIISQYCKTKKIWYMSVDGTSKNLFNNEDIQRSVSQVFIDEIWSQMTKEGKCLPIDQSGRRSSNTTTTRYFILWKSLDSWASLILQWFEDSGKLNQVITLYELSEGDETVNWEFHRMPESLLYYCLKPLCDRNRATMLKDENDKVIAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of ESCRT-II endosomal trafficking complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
molecule keywords appears to be functionally related to SNF7; Snf8p
total genus 37
structure length 178
sequence length 198
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF05871 ESCRT-II ESCRT-II complex subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1u5tC02
1.10.10.570 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A "Winged helix" DNA-binding domain. Chain C. Domain 1 1u5tC01
4BAYA 3FXQA 2L4MA 1XDSA 2JPCA 2LDUA 1ZHFA 1L3LA 2YSRA 5L3FA 1J7KA 5H6RA 1YQAA 1XCVA 1BN5A 3F3XA 3M8EA 1S8NA 4HOBA 4Y17A 3HRMA 2PMUA 1F5TA 4ETSA 2KJBA 5K5OA 1DDNA 2EWNA 3WE3A 1D3YA 4HF2A 4OIQF 2IA1A 3WTTC 4YFXF 2UXXA 2FU4A 1D5VA 2HKOA 1RNLA 2HFHA 5L3CA 2VE8A 4IXAA 3LA2A 1TW3A 5E18F 3IRRA 2J5PA 2MH9A 1T38A 5CVVA 3BWGA 5A2QZ 1Z9CA 3QRFF 5D6EA 1KYZA 3IKTA 5E20A 4WK8F 3MWMA 1XSVA 3FWEA 4OINF 4LB5A 3FMRA 2CSOA 1WI9A 4M74A 4U88A 1UCRA 1O3QA 3R61A 3TDUC 1IAWA 3QOPA 1FBSA 1XDUA 1XN7A 3EUHA 4XRFA 2KIFA 5ICCA 1RZ4A 1R00A 3WE2A 2PEXA 1W5TA 3P9KA 1HKSA 2PI0A 2DQLA 4A2UA 1IN7A 3DKWA 1KYWA 3J80K 1U2WA 2ESNA 4RGUA 2CYYA 2XAQA 1LDJA 4HX4A 4G9YA 1I27A 4M6XA 2R3SA 2TDXA 2K4JA 2F5EA 4GYGA 3WTWC 2JT1A 4CGZA 1IXRC 3W6JB 2VOPA 4IRHA 5E8IA 2A68F 2OBPA 2P4WA 2NAZA 1Z05A 2E1CA 4MQ9F 1MKMA 2HWVA 4G94A 2VBWA 2BYVE 1OPCA 5LGTA 1FP2A 2HGCA 2VXZA 4FT8A 4ASNA 5J6XA 1J0RA 2AXLA 4I01A 2FA5A 2H27A 1REPC 1O3RA 3ZMUA 1U5TC 4S04A 1LNWA 5DD8A 1HSJA 3FMQA 1T98A 2XVCA 3SHFA 3VOEA 2EJRA 4KUMA 4LGWA 3F8CA 3FM3A 5BPIA 5FFZA 4IF4A 1BIBA 1MGTA 3EDPA 1HW1A 4LFUA 3F8MA 3JTHA 4L5JA 4RB1A 1WQ2A 3KCCA 2RN7A 3GEZA 5L3GA 1IRGA 2L02A 2D1HA 4ZYDA 1JE8A 5FGMA 3K1NA 4IPAA 4PGGA 3WU1B 2ISZA 3R6SA 2E7WA 1WSUA 2W85A 3CDHA 2VC0A 3F6VA 2HOEA 5K5RA 3QPTA 4BYYA 1Z6RA 4P9UA 1TNTA 4RAYA 4HX8A 4IVNA 3MZHA 2CWEA 1FZPB 1HQCA 2STTA 4UNOA 3BPXA 2EV6A 4O5VA 3BZ6A 4I2OA 3F22A 3NEUA 2EA4A 1OYIA 5ED4A 3MQ0A 3QU6A 3GYHX 2A3SA 2IA0A 1R5HA 1F4KA 1OKRA 2PG4A 4YIFA 1U3EM 5E1ZB 2WC2A 5D8KB 2IP2A 4EQQA 4U0YA 1JGSA 1DP7P 4PDKA 3DXJF 2H94A 2MLGA 2ZBKA 3R0JA 1FX7A 1ZGAA 5ILUA 3TDZC 2EB7A 2W57A 1JXSA 4ENMA 2P5LC 3O6BB 5KK1A 4BH9A 5IT3A 3BOQA 3IL2A 1CF7A 1IF1A 1EH8A 1CGPA 1XSXA 1P4WA 3R60A 3FXRA 1T6SA 2M45A 2FMLA 4MHGA 1YYVA 2GAUA 5K5QA 2HYFA 5K1YA 2UXNA 5HVQC 4LG0A 3MAJA 4WXDA 5LGUA 2OZUA 4I02A 3RTRA 2LF8A 3JSOA 1XSDA 3SFZA 2DAOA 4KYWA 3L2CA 2RKHA 2FXAA 2PQ8A 4GYIA 3M7GA 2JRTA 4O3MA 1QZZA 2F2EA 5ERIA 5LEJA 3P9CA 3KETA 1ZH5A 3J81K 1TTYA 3RPUA 2HQRA 4EGZA 1K78A 1R23A 1ODDA 2Q8KA 4DNCA 1F9NA 2ESHA 2XUBA 3QU3A 3NRVA 4Q4ZF 3V7SA 2MH2A 2FSWA 4KDPA 5L3BA 4EJWA 4AIHA 3CO7C 2GZWA 5JHUA 4E70A 2DFIA 1P6RA 2BGCA 4ZYHA 1FSHA 2ZO4A 2V1XA 3PQKA 2VBYA 1G3SA 4HDVA 4HF1A 1MZBA 4KN7X 3M8FA 3ZP5A 2ZKZA 1H9TA 3F8FA 1XGMA 2DTRA 3B73A 4AIKA 1KQ8A 1OR7A 1Q1HA 2XAJA 1I5ZA 3ABUA 3MCZA 2OZ6A 1FYLA 1OMIA 1E2XA 1O57A 3ZQ7A 3OOPA 3E5QA 3VODA 4ENKA 1NHAA 2DI3A 1SD7A 2OA4A 2FE3A 5IT9K 3WGGA 1B9NA 4UXNA 4WXCA 1S7AA 1TQIA 2FEZA 1F1ZA 4JK1X 4P96A 4L0ZB 2KRFA 2VT3A 4G7OF 3WTVC 4KMUX 3ZPLA 1KU7A 3I53A 3CTAA 3P9IA 3TO6A 1FP1D 3U1DA 1IXCA 2DO7A 2RVCA 3E97A 1PP7U 4K2EA 3C7JA 5D8LB 3E5UA 1KGSA 1QBJA 2GA2A 5DCFA 4MTEA 1BI3A 1GVJA 5L3DA 2ZJ2A 2BE5F 2CO5A 1SD5A 2G7HA 5D5WB 4ESFA 3HSEA 1ZG3A 3LA3A 4XLPF 5LHGA 1SMTA 2V1DA 3DV8A 4BXUA 3HSRA 3DPLC 1KU3A 4RS8A 3GZ6A 3E5XA 3N4MA 1LQ1A 1QPMA 2A6EF 6PAXA 2GIVA 4YIIA 3SZTA 3K1PA 3BROA 5BQTA 4EJVA 2XROA 2DBBA 4RB3C 4MTDA 2Y48A 4KT5C 2G7UA 4XBFA 3RIRA 1IXSB 3TKYA 2HR3A 3ZMTA 1FSEA 2PJPA 1QNTA 5CLSA 2MD5A 2DLLA 1R22A 3REOA 4IRGA 2EFQA 5FD5A 1YO5C 2W84A 2XV4S 2XKPA 1J9IA 3I71A 2M1BA 3KP2A 2PN6A 1Z6TA 3DFGA 3EQLF 4M9ZA 1I6XA 2V1UA 4HQMA 1RUNA 2OQRA 2LF7A 4YFNF 5D5XB 1UB9A 3I0TA 5ICGA 1QGPA 4PGHA 5AIPA 2EFPA 4L0YB 2QYOA 2IPQX 4CDGA 3GZ5A 1P4XA 2WV0A 2VONA 1J5YA 1FPQA 1H0MA 2GQQA 3HHGA 2QENA 3WTYC 2O0YA 1AOYA 3MZYA 3L09A 4ON0A 4G7ZF 1AWCA 2P5VA 2V9VA 5HLIA 1K78B 5D4RA 3BJOA 1I1GA 5BOXA 2DQRA 1ON2A 1G3WA 2HTSA 2O3FA 2FNPA 2XAHA 5FB2A 2HQNA 2P7CB 1P2FA 4CXFA 2Z99A 2YPRA 4BHCA 4GO1A 1TQPA 3RJPA 4LLLA 1R7JA 3WU0A 2H09A 2VN2A 3G3ZA 4ESJA 3KP6A 4KNYA 2E7XA 3H3ZA 4LK0F 2QZ8A 3H92A 5LGNA 4OU0A 1VTNC 4WWCA 4WX9A 2A07F 1UHWA 2XHKA 5CVUA 4P55A 5DYMA 3K2ZA 2GXBA 1MJAA 2RV8A 3SQNA 4MQVA 1B59A 3KE2A 2ZMEA 4I0AA 3KP5A 4KIGA 2VE9A 1DPUA 2IW5A 3EETA 2HYGD 5F64A 2EFOA 4LB6B 1A04A 1S29A 1ZYRF 3LWFA 5HLHA 3KZZA 2IJLA 3L7WA 3GO5A 2XKOA 3BJAA 1USSA 4KN4X 3IHUA 2DK8A 2X0LA 4NB5A 2VT2A 1ZRCA 3F23A 4LLNA 4O6JA 1SD6A 3I54A 1EH6A 2W24A 1FY7A 1U8RA 1GHCA 3CJNA 1ZG5A 4IRIA 2FBIA 3V7RA 3GUDA 4H0EA 1XB4A 2P7VB 2JSCA 3EYIA 5HS7A 4RB0A 1TBXA 3BPVA 1BBYA 1O3TA 5DDGA 2C6YA 1XMAA 4AWXB 4HW0A 2XAFA 1SFEA 1G3YA 3Q9VA 2Q2EA 4UVCA 2F5DA 1Y0UA 3ECHA 1BIAA 1R1UA 3OV8A 4ENNA 2FRHA 4WCGA 1YIOA 2M5WA 4Q48A 4OIOF 3FM5A 3BJ6A 1QZYA 2UWMA 2K02A 2RQPA 4HAMA 5CVIA 2OQGA 2A5YB 4L5IA 1KU9A 1LDKB 3G73A 3GFMA 4OIRF 1ZGJA 1ZAOA 2OAZA 2L4AA 5CYVA 3HYIA 2Z5UA 4N9IA 3GLXA 2COMA 2XAGA 4D0PA 3LAJA 2FF4A 2ZNZA 3I4PA 1BJAA 2P5KA 1S3JA 3E6CC 3S2WA 3E6MA 3EYYA 2IRFG 3ZMVA 5D6FA 1Z91A 2QQAA 1RI7A 3D5LA 3VFZA 3L00A 3F21A 2IA2A 5DUKA 3WODF 1U5TA 3RKYA 4KICA 3DPTA 4EJTA 1IN6A 4BNCA 2V79A 2JPBA 3KLNA 4U7BA 2HZTA 2QBYB 4A0ZA 1IZ1A 1SFXA 4QLCU 4A6DA 5FO5A 3T5XA 2ETHA 1V3FA 2HDCA 1V4RA 4M9SA 4BHPA 3LFKA 1PP8F 1LEAA 5LEKA 2M30A 4HV5A 3DP7A 2DPDA 5DUIA 1D8KA 4ZYEA 4R79A 3VEPA 2EFNA 1K7AA 3ML6A 5LRRA 4YFKF 1MD0A 3ERED 5ILVA 4OMYA 1YG2A 2VOOA 3ELKA 3E6DA 2LNBA 4CICA 1HKQA 1KU2A 3I58A 4HQEA 4L9VA 5EEHA 4EGYA 3HHHA 4AVPA 1KA8A 1USTA 2IT0A 1B1BA 3GXOA 3PQJA 4UV9A 3KP7A 3JSPA 2D2WA 4KIBA 5CVRA 2Z33A 4RGXA 4RB2C 3I59A 4F7ZA 5LHHA 3HOTA 5CJ9A 1JHFA 4AD9A 3K69A 4B8XA 2Q0OA 1SFUA 4HLYA 1W7PD 1FBUA 4DQ2A 5E1WA 1FT9A 3I5UA 3HTUA 2CQKA 2MA3A 2JTVA 3KLOA 2FBKA 4LMYA 5H20A 3IWZA 2DT5A 2BBYA 2J5OA 4ENJA 1C0WA 5HDGA 4I09A 3ZMZA 1XGSA 1D8JA 3H3UA 3HIFA 2L54A 5ILSA 2QLZA 5ICEA 3GFIA 5LRSA 3M9AA 5AONA 4KFCA 3GFJA 1HBXG 2Y0MA 2DPUA 4Z2YA 2W25A 3VB2A 4G7HF 5TRDA 5FLXZ 3T8RA 1YFHA 1HXDA 1BI0A 5E1XA 2EV5A 1RUOA 2UZKA 4WF2A 4HA8A 1UHMA 2XIGA 1LB2A 3FZVA 2EV0A 2VODA 1W4MA 2JZYA 1G6NA 5J8CA 2ZCWA 3TQNA 1HW5A 2NNNA 3WTXC 4MNUA 5KVRA 3E6BA 3MFKA 1FWZA 2STWA 4LG0B 1DPRA 4HBLA 2H6CA 4A12A 2FNAA 5HS8A 4HYEA 3HRUA 2D1VA 4LLGF 1WWXA 4JQFA 1EV7A 5DV5A 3ZN1A 1TNSA 2F5CA 1BOAA 1GXQA 2LKPA 4G6DA 4BQAA 1MDMB 2EA2A 3O2PE 4A0XA 5J8FA 1LEBA 3SZPA 4N0BA 2YU3A 2GWRA 2YR2A 3AAFA 3V8JA 3RKXA 4EM0B 5FD6A 3KEOA 3CUOA 3M1EA 2NS0A 1BC8C 3O3KA 4EVIA 3TO9A 4Y15A 1QQIA 5CVJA 4LD5A 3WTZA 1STZA 3FHZA 3HSFA 1O3SA 2M87A 4L18B 3PFIA 4GXOA 1CF7B 3RDIA 1SD4A 3C18A 4M73A 1UFMA 2M8EA 4OMZA 3Q5FA 4EM1A 4N9HA 1T39A 1K79A 3WTSC 4PZJA 5E8GA 3F8BA 4HLXA 1LJ9A 1R36A 4A6EA 2Y75A 3GF2A 3ZMSA 3L9FA 2AS5F 3KEQA 3SXYA 4I98B 1BC7C 4GGGA 2KIUA 2DU9A 2P6SA 2ADUA 4ZZLA 2BEOA 2L3DA 4LK1F 3U2RA 1ULYA 4KMFA 3QPHA 5DCMB 2OU2A 3CO6C 4FX4A 4ESBA 4EJOA 3T1BA 3QP6A 3ULQB 1YW8A 5DEQA 1PDNC 1E17A 1P92A 5HLGA 2K4BA 4UVBA 5AIQA 1BI1A 5ICFA 3ZN0A 1R58A 4L9TA 3FMSA 2XASA 4PCQA 2ZMEB 2VC1A 3TGNA 5LHIA 4G8XA 2WTEA 2G9WA 5BPDA 2E1NA 1W7PA 2FQ3A 3HRTA 1HKTA 3RKWA 4OOIA 2FBHA 5FLXK 2KKOA 1IW7F 1Z7UA 5JVTA 1FOKA 1B4AA 2QWWA 4NQWA 2BV6A 3P7NA 4MEXF 4A0YA 2YX7A 4Q47A 5H6QA 4EJUA 4BHBA 4CHUA 2ISYA 3GWZA 1ZG1A 4R8HA 5HOOA 1J59A 1LDDA 2Z9OA 1DUXC 1XCBA 2CFXA 4HX7A 3W6KB 2ACJA 1K6OA 1BM9A 3HUGA 3KZYA 4UHTA 1FLIA 2DW4A 4XLNF 2RNJA 2FOKA 2A61A 2ZFWA 5A2QK 1T2KA 1RIOH 3RYPA 1O7FA 2O61A 2GXGA 2PFBA 4MEYF 2GA1A 1EH7A 3T8TA 2RDPA 1XD7A 2RGVA 4M6YA 1TQMA 4GCVA 3V7CA 3BY6A 5HS9A 3B02A 4EMSA 4KIFA 2K7LA 4U0WA 3HOSA 4EM2A 1PUEE 2R7FA 2CG4A 4R1HA 2D45A 2VBZA 4HV6A 4P5OA 5EEGA 4ZYGA 1YW9A 1ON1A 4JBAA 3R4KA 1TLHB 4L9JA 2PLYA 2QBYA 1WKMA 3ECOA 2P8TA 3IRQA 1MJBA 1WRJA 2MBFA 3CUQC 2QVOA 4EV0A 3V8KA 3N97A 2NNYA 3F72A 4UVAA 1U5TB 3Q9SA 1J2XA 1ZARA 3CLOA 3I64A 1L0OC 2HEOA 3WTUC 1IN5A 1QO0D 3K0LA 1S7OA 3JTGA 2V6CA 2HTJA 2DK5A 2A6HF 1R1VA 4IHTA 3R0AA 1P4AA 2CW0F 4A5NA 1FC3A 1HSTA 4P9FA 3E3VA 4I0BA 1BI2A 5DD4A 4KA4A 1MDMA 2O03A 3QP5A 3LAPA 1B9MA 4CYDA 1U6GA 3LQRA 1ZREA 4ZZDA 3COAC 2QUFA 3IWFA 3IC7A 4A5MA 4U0VA 3NQOA 3J80Z 2L01A 3FX3A 3C1DA 2P6TA 3IKVA 1IUYA 1KQ0A 1FNNA 3RYRA 4HF0A 1YTYA 2ZXJA 1SMYF 3GX4X 4HDUA 4ZH4F 5D5VB 3GVAA 1LVAA 2MC3A 5D4SA 5JFRA 4M9XA 4NHJA 3JAMK 3F6OA 2K27A 1ONVA 2XGXA 1H9GA 1R1TA 3GW2A 4AIJA 3V4GA 2FMYA 3JW4A 3QAHA 4M71A 4RGRA 4FHTA 3K9TA 1T0FA 2KIMA 3C3WA 3BDDA 3WG9A 2IVMA 1ZLKA 1SAXA 5LBQA 4U7DA 1XMKA 1GXPA 3CUQB 3DEUA 2PBIA 4I7HA 3TO7A 4RAZA 5E17F 4MGRA 4Q5SF 1TW2A 2O8XA 2K86A 1ZRFA 2Z3YA 3LSTA 2OD5A 1YS6A 5DCMA 1ZN2A 3V8LA 2QQ9A 2A69F 3KP4A 4QWQA 2HS5A 3F8NA 4YG2F 3T0YA 1YW7A 1IN4A 1R5GA 3ZMDA 3FF5A 2HKXA 2ELHA 3RI4A 3FXUA 5JR3A 1FYKA 2YX4A 1JHHA 2NRAC 4OIPF 3J7AO 5HDKA 1FYMA 2MLKA 4B09A 4XSZF 1YS7A 2X4HA 2WWYA 5LLQA 4RGSA 5F6FA 1IRFA 1YLFA 1O7LA 3KP3A 4G6QA 4HZFA 1ZLJA 1B6AA 4M72A 1IN8A 3U9GA 5L3EA 1ZRDA 2RC4A 3I59B 3TOAA 3DF8A 4XSXF 3CUQA 5FFXA 5TJJA 3ABTA 1FBQA 3HRSA 4CZZA 3JAMZ 4CO8A 4TV7A 1G4DA 2PMHA 2KJCA 1W5SA 4UV8A 4Y13A 1OYWA 2ZNYA 3HTSB 2O6GE 4LJZF 2VBXA 2NYXA 3J81Z 3RPQA 3GFLA 3ISPA 3ROUA 1KQ9A 5BS6A 2R7DA 3KFWX 1J75A 3MEXA 2ZMEC 3K1MA 2QQBA 3WGHA 1S6LA 4S05A 5F1RA 2LSOA 1OYYA 1MJ9A 1I1SA 4IHSA 2EK5A 2QM3A 4IJAA 3TOBA 3D0SA 2EFWA 1HW2A 2XRNA 5JI6A 4WXHA 5D5UB 4FX0A 2CGPA 4UUVA 1U78A 4L9NA 1X3UA 3BP8A 1XGOA 1G3TA 3WGIA 1XGNA 2B0LA 3LA7A 5IT9Z 2F5FA 3DQVC 1W7PB 5BMZA 2H6BA 5HDNA 3LQQA 1Z1DA
chains in the Genus database with same CATH superfamily
4BAYA 3JRBA 3FXQA 3CZ6A 2L4MA 1XDSA 2JPCA 1S72I 2R7QA 2LDUA 1ZHFA 4X1EA 1L3LA 2YSRA 5L3FA 1J7KA 3LSRA 5H6RA 1YQAA 3ZQIA 1XCVA 2O9LA 1BN5A 3F3XA 3LMMA 1T33A 3M8EA 2ZSHB 1S8NA 4HOBA 4Y17A 3HRMA 2PMUA 2LRDA 3HZJA 1YHQI 5IY5H 1R4MB 1F5TA 4ETSA 1FMWA 2KJBA 1IUFA 1S9HA 5K5OA 1TZLA 2XPUA 1DDNA 3FKJA 2R7WA 2EWNA 3AG3H 3F0CA 2W1OA 5E3MA 3WE3A 2LMDA 4E6KG 1D3YA 4HF2A 4OIQF 2IA1A 3WTTC 4YFXF 3PJRA 1QHHD 2UXXA 2FU4A 2LREA 1D5VA 2ECCA 2HKOA 1RNLA 1UG0A 2HFHA 4BY7J 5L3CA 1X1CA 2VE8A 4IXAA 3LA2A 1TW3A 1YOVB 5E18F 4OAZA 3IRRA 3TW7A 2J5PA 4JX6A 3H9QA 2MH9A 3BTLA 3D5SC 3IP4B 4HNUA 1T38A 1V5FA 2XSJC 5CVVA 2FJ1A 2Q1ZB 5J4YA 3BWGA 5A2QZ 1Z9CA 1JJ6C 3QRFF 5D6EA 3HBLA 1KYZA 2P0WA 3MKYB 2M7AA 3IKTA 5E20A 4WK8F 3MWMA 1XSVA 3FWEA 2WY7Q 4OINF 4LB5A 2H1KA 3BZKA 3FMRA 2H1LA 2CSOA 1WI9A 3GTQJ 4M74A 1X2NA 1Y1VJ 4U88A 3AKZA 1UCRA 2K3FA 2VB6A 2BZTA 2JUGA 3R61A 3TDUC 1O3QA 1IAWA 1Z0XA 3QOPA 4XIDA 1FBSA 1XDUA 4BDZA 1XN7A 4CCLA 4UB8C 2DFEA 3EUHA 5J4VA 4AIDA 1JKRC 1E3HA 1X4PA 4IHXA 3WHBA 2DOAA 2COBA 3A1YA 4XRFA 2KIFA 5ICCA 3JRAA 2KP6A 1RZ4A 2HQAA 1R00A 2HDWA 3WE2A 2MABA 1UZCA 2PEXA 3BCAA 3IUOA 1V5GA 1W5TA 3P9KA 1HKSA 2PI0A 2DQLA 3ZRGA 5GPCA 3LSKA 1IN7A 3DKWA 1KYWA 4A2UA 5F04A 2DTZA 1U2WA 4W97A 2ESNA 3J80K 4IX7A 3BZCA 2M3AA 4RGUA 2CYYA 2XAQA 1U9OA 2VJ5A 1ZTRA 3HGYA 3OYLA 1LDJA 4HX4A 2MG4A 4G9YA 2D5VA 1I27A 4M6XA 5B1AH 4LOCA 2R3SA 2A6TA 2TDXA 1Z21A 2K4JA 2F5EA 4GYGA 3WTWC 2JT1A 3LOCA 4CCJA 4CGZA 4FQGA 2L2OA 4A93J 1IXRC 1OQYA 3W6JB 3BCBA 2VOPA 1HA8A 4IRHA 2QSGX 2DMQA 2A68F 2OBPA 5E8IA 4BQQA 1R9TJ 1LPQA 1LE8A 2TRTA 2P4WA 2NAZA 3L2UA 1Z05A 2IS4A 2E1CA 3OYNA 2M4KA 4MQ9F 1A36A 1MKMA 1NTCA 2HWVA 2ICWG 4NQWB 2JA2A 3TL4X 4G94A 4DIQA 4DBQA 2XC7A 2VBWA 3HM5A 4A3DJ 1U0JA 2GBYA 3BLYA 2BYVE 1ZK8A 2WAQA 1OPCA 5LGTA 1FP2A 2HGCA 4IL6C 2VXZA 3GTKJ 4V19K 3BG6A 4FT8A 1DP3A 2CH0A 4ASNA 5J6XA 1J0RA 3HPGA 3UKGA 2AHQA 4RAGA 5EG0A 5J1YA 2AXLA 4YEJA 1GV5A 4I01A 2FA5A 2H27A 2IBDA 3UNGC 2R5ZA 5K7FA 4RBOA 3SYTA 4DBRA 1REPC 2DA4A 3ZMUA 1O3RA 1U5TC 4FISA 4S04A 1VQNI 2DJIA 1R5ID 1JKQC 1LNWA 5DD8A 1HSJA 3FMQA 1DGRM 4NUBA 4YELA 1MBFA 1T98A 1YX5A 2XVCA 3H5RA 2X48A 5IYCJ 4KITB 2IXSA 5E3LA 3SHFA 1X3WB 1WZ2A 2B63J 3VOEA 2EJRA 4KUMA 3F9KA 2VPRA 4LGWA 3J7ZI 3F8CA 3FM3A 4ANJA 5BPIA 4PK4A 5FFZA 4IF4A 1VQMI 1E3PA 1BIBA 1MMGA 1MGTA 3EDPA 1HW1A 3BTCA 4LFUA 1YRNB 1RKTA 4CUGA 3F8MA 3JTHA 1D0ZA 2K9LA 3ZOBA 3IAS2 4D7NA 4X6AJ 2HZDA 4L5JA 2DXIA 4E7JA 4RB1A 1WQ2A 2MFZA 4RAFA 2VQLA 3KCCA 2R5YB 2RN7A 3BQZA 3GEZA 2VQCA 3LSPA 3ZQLA 5L3GA 1IRGA 2F6CA 2KDOA 1V55H 1XPXA 3HG9A 2L02A 2D1HA 4ZYDA 4IO9F 1JE8A 3CCLI 5FGMA 4EEFG 3K1NA 4IPAA 4PGGA 2M0MA 3WU1B 1X1BA 1Y56A 2ISZA 1MMDA 3R6SA 1HDDC 2E7WA 1WSUA 2W85A 3CDHA 2MSYA 2XPVA 2VC0A 1XX5A 4XLHA 2LTPA 5E3OA 3F6VA 2CQXA 2VLAA 2HOEA 4F52A 3S1QJ 5K5RA 1DQUA 5FROA 2NS7A 4IZZA 1YJNI 2M8GX 3QPTA 4BYYA 2OJED 1Z6RA 2MYSA 4Y33A 1D1CA 3LSGA 1XMXA 4P9UA 1TNTA 4RAYA 2VKVA 4HX8A 4IVNA 3MZHA 2CWEA 2EQRA 1HQCA 4CYCA 1FZPB 2STTA 4UNOA 3BPXA 1QZEA 4LIVA 1M1EB 2R7UA 2EV6A 4O5VA 3BZ6A 1VQ6I 4I2OA 3PNYA 4FE7A 3F22A 3NEUA 2EA4A 1UG2A 1OYIA 2V4JC 5M5WJ 5ED4A 4IOCF 3MQ0A 4I76A 1IDZA 3QU6A 2LVSA 3DTIA 2X51A 3GYHX 2A3SA 3LSMA 1YITI 2IA0A 1YJWI 4ZYAA 1R5HA 5FKKA 1F4KA 4BEHA 1OKRA 1KZHA 2PG4A 4YIFA 1U3EM 1I39A 5F08A 3VYRB 1QVTA 5E1ZB 2WC2A 2CUZA 2DA5A 5D8KB 2IP2A 2M9HA 4DGWB 3K4LA 4EQQA 5EGOB 4U0YA 1JGSA 3L2VA 4DJAA 1T08B 3PL8A 1DP7P 4PDKA 3DXJF 1U8BA 1W0UA 1MBGA 3SDBA 3A0BC 2H94A 2MLGA 2ZBKA 4A3CJ 2FX0A 3R0JA 1FX7A 2GLOA 1ZGAA 1JJ8C 3MD2A 2JA8J 2L9VA 2ID3A 5ILUA 2XF5A 3TDZC 2LG4A 3AG1H 2EB7A 1Y8QB 2W57A 1JXSA 1B8IA 4ENMA 2P5LC 3RCOA 5GADJ 5DM6F 2EBIA 3O6BB 5KK1A 1NK3P 3S32A 4BH9A 5IT3A 3BOQA 4C2TA 3IL2A 2JWTA 3G71I 1CF7A 1IF1A 1EH8A 1CGPA 1XSXA 2WAQN 1P4WA 5FRNA 3K4JA 3R60A 2R5YA 3FXRA 1T6SA 2M45A 2GXAA 2FMLA 2JA5J 4MHGA 1YYVA 4CSWA 2GAUA 2IS1A 1EKEA 5K5QA 2HYFA 4N4OB 3HKZA 5K1YA 4CH7A 2UXNA 5HVQC 4LG0A 2X9DA 2VL8A 1ZR4A 2XF6A 3CMYA 3MAJA 4E4HA 5CQEA 4WXDA 5C4XJ 1H8AC 5LGUA 2OZUA 4I02A 3RTRA 2LF8A 5J3LA 4ZDLA 3JSOA 2HYJA 1KONA 3SFZA 3Q0UA 1XSDA 5J1UA 1N78A 2DAOA 3CCVI 4KYWA 1U9NA 1LFUP 4A3BJ 4M3BA 5FKOA 3L2CA 2RKHA 1YI2I 2FXAA 2PQ8A 1JGGA 4GYIA 3OS1A 3SEZA 2X6XA 4FETA 3M7GA 2JRTA 4O3MA 1QZZA 2HQ5A 2F2EA 5ERIA 5EF6A 5LEJA 3O8HA 3P9CA 1TP4A 1MSEC 2PJRB 2VIXA 3PO3J 2BXYA 4AYBN 3KETA 4E7HA 3KZIC 1IRZA 3H0DA 1ZH5A 3J81K 4XONA 2X1EA 1TTYA 4HSTA 3RPUA 3ZCOA 2NOJB 2HQRA 4RM2A 1R4NB 4EGZA 1K78A 1R23A 5EJCA 1ODDA 4NC7A 2Q8KA 2DMNA 3S1RJ 4IOAF 4DNCA 1F9NA 5M3MJ 4CA0A 2EZLA 4ZJZA 2ESHA 2XUBA 3QU3A 3NRVA 1X19A 4Q4ZF 3V7SA 1VZ0A 4J01A 4YIRX 2MH2A 2R7SA 5IYBJ 2FSWA 1SVMA 2IAIA 4KDPA 1IV6A 3HC7A 5L3BA 3H1CA 2ZJQF 4M6VA 3QPSA 2NVXJ 1FEXA 4EJWA 4B4CA 3BR1A 3DPUA 4AIHA 4D1QA 2KDZA 3CO7C 1MIJA 3OYCA 3LNQA 2CQ7A 1QVUA 1FIPA 2GZWA 3OS2A 5JHUA 3PUFA 4E70A 2W7NA 2DFIA 1P6RA 2BGCA 4ZYHA 1FSHA 4F91B 3C2BA 2ZO4A 2V1XA 3PQKA 4XNFA 2VBYA 1G3SA 3I56I 1QA6A 2E2JJ 4HDVA 3CP2A 2R4GA 4HF1A 1MZBA 4KN7X 3M8FA 3ZP5A 2ZKZA 1N75A 1H9TA 3F8FA 5HLTA 1XGMA 2DTRA 1TT0A 3TP3A 1PUFB 3B73A 5E3NA 5EEAA 4AIKA 1KQ8A 1OR7A 1Q1HA 2XAJA 1W5CC 1I5ZA 2ME6A 5LD2C 3ABUA 3H5AA 3MCZA 4OAYA 5IPAA 1SFOJ 1IV8A 2OZ6A 1OJLA 1FYLA 1OMIA 1E2XA 1O57A 3ZQ7A 3CMEI 3OOPA 3E5QA 1RR8C 3GZNB 2WAFA 3IH3A 3K4CA 3VODA 3A01B 1BR2A 3Q0WA 1I6HJ 3DEEA 5KNLA 4ENKA 1NHAA 4AC0A 1YIJI 3IV5A 3K70D 2DI3A 1SD7A 2OA4A 2XAUA 1ITYA 2FE3A 5IT9K 3WGGA 4CZCA 1B9NA 3S17J 2R7RA 4UXNA 4WXCA 4E7LA 3MZ8A 3NWTA 1S7AA 2M7BA 3EUAA 3DTKA 4PSWA 1TQIA 3K2AA 2FEZA 1F1ZA 2F4OB 3FXLA 4JK1X 4P96A 4A3KJ 1WHUA 4L0ZB 2KRFA 1P9QC 2VT3A 4G7OF 3WTVC 2PMZN 3B6AA 1BOBA 4KMUX 3ZPLA 3X2QH 1KU7A 3D5RC 3I53A 3CTAA 3K70C 1D1BA 3SFIA 3P9IA 3TO6A 1FP1D 3U1DA 1IXCA 2DO7A 1FOXA 2RVCA 1R6RA 3E97A 1PP7U 3DEWA 4K2EA 5GP9A 1JT6A 4B3XA 2DMUA 3C7JA 5D8LB 3E5UA 1R49A 2KIQA 1KGSA 4AU7A 4XICA 1QBJA 4M3GA 5EYRA 2GA2A 4DYRA 2DCEA 5DCFA 4MTEA 2KMUA 1BI3A 1GVJA 1RKWA 2EILH 4AUXA 1WFXA 1X3ZB 2CV0A 5L3DA 2ZJ2A 2BE5F 5B1BH 2CO5A 3OYBA 1SD5A 2Z1DA 2G7HA 2K85A 5D5WB 4ESFA 3HSEA 1WI3A 2ZJRF 5EZGA 1ZG3A 1Y8RB 3LA3A 4XLPF 5LHGA 1SMTA 2XB0X 4HPQA 2V1DA 3DV8A 2R7OA 4BXUA 3CCRI 1Z7LA 3HSRA 3DPLC 1KU3A 4PJJA 4RS8A 3GZ6A 4MIMA 3E5XA 2CW7A 1PYVA 3N4MA 3M07A 1LQ1A 4XRSG 3JRIA 1TT5B 2ZXWH 1ETVA 1QPMA 2A6EF 3E0JB 3ERMA 3H9JA 6PAXA 5CPRB 5JHFA 3CJTB 2GIVA 4YIIA 4C3IJ 3SZTA 2JA6J 3K1PA 3KIOA 5CKTA 4FCYA 3BROA 3CQZJ 5BQTA 3K7AJ 4EJVA 2XROA 5B5EC 2DBBA 4RB3C 2BW3A 2Y48A 4MTDA 4KT5C 2G7UA 4XBFA 3RIRA 3CESA 4PJMA 1OFCX 4C3JJ 1IXSB 1ETYA 3PUBA 3L2QA 5KCMA 4BQNA 3TKYA 2HR3A 3ZMTA 1FSEA 2Y0SN 1ETXA 2W4SA 2PJPA 1QNTA 1Z67A 5CLSA 3NWSA 2MD5A 2DLLA 1R22A 3REOA 5M3FJ 3BTIA 4HRIA 2BVMA 1JUPA 4IRGA 2EFQA 2L9SA 5FD5A 1YO5C 2W84A 2XV4S 3GTPJ 2E1MC 2XKPA 1J9IA 2F48A 2KHMA 3FBIB 3I71A 2M1BA 3KP2A 2DT7B 1Z6TA 2PN6A 3EQLF 3DFGA 4M9ZA 1I6XA 4E7KA 2I5UA 2V1UA 4HQMA 2ZJPF 3CF5F 1RUNA 2R7XA 2OQRA 2LF7A 4YFNF 5FLVA 5D5XB 1UB9A 3I0TA 5ICGA 2BVLA 1QGPA 1ERDA 1WPKA 2OC6A 1TL8A 1MH4A 3BC8A 4PGHA 5AIPA 5GTHC 2I8DA 4C9YA 2EFPA 4L0YB 2ECBA 2ELJA 2M0CA 4BXFA 4F93B 2QYOA 2LFBA 3MN2A 4IHVA 2E5NA 3H3VK 2IPQX 2BW3B 4CDGA 1FOWA 3K6GA 2W00A 3GZ5A 1P4XA 2WV0A 2VONA 4B3AA 1K83J 1J5YA 1FPQA 3CJQB 1H0MA 2GQQA 3EPZA 3HUGB 5EZHA 3HHGA 2QENA 4Y3OA 2Q2EB 2VJ4A 3WTYC 1D5YA 3ASOH 2OTJI 2O0YA 3GMEA 4HG2A 3N05A 2IEKA 1AOYA 4AYBA 3MZYA 3L09A 4JX5A 2CUFA 3S1MJ 4ON0A 4G7ZF 1AWCA 3S2DJ 2P5VA 2VKDA 4BL0B 2V9VA 5HLIA 1K78B 4ZTFA 4G6TB 1LKXA 5D4RA 3W3CA 3BJOA 3QPLA 3S3OA 1I1GA 5BOXA 2DQRA 2E60A 1ON2A 1G3WA 2HTSA 2O3FA 1GUUA 4U87A 2R5ZB 2FNPA 2XAHA 2F4IA 2Z2SB 1I3QJ 5FB2A 2HQNA 1K4TA 4BJ6C 2P7CB 1P2FA 3H0GJ 4CXFA 3G2BA 2Z99A 4A3LJ 2YPRA 4BHCA 2E34A 4GO1A 3OYIA 1LE8B 2MGQA 1TQPA 5B66C 5C44J 1FOYA 3ESWB 2JUCA 3RJPA 4LLLA 3S8PA 4XLCA 1R7JA 2IGOA 3WU0A 2H09A 3OYJA 2VN2A 3G3ZA 1F36A 3KP6A 4ESJA 4UUSB 3I55I 4KNYA 2E7XA 2WADA 3BR0A 3H3ZA 4IQ4A 4LK0F 1APLC 2QZ8A 3PO2J 1WJCA 2DMPA 1IC8A 3H92A 5LGNA 3KYDB 5GTIC 4OU0A 4II3A 2PMZA 1VTNC 4WWCA 4WX9A 2A07F 3BR2A 1UHWA 4PJLA 3VYUB 2XHKA 4HEA2 5CVUA 3AL0B 4P55A 5DYMA 3K2ZA 3DBHB 2GXBA 1MJAA 2RV8A 3SQNA 4MQVA 1B59A 3JRFA 3KE2A 2ZMEA 4I0AA 3KP5A 4KIGA 4DZPA 2VE9A 4MFDA 5JVGF 4BJTA 4A3EJ 1B72B 1DPUA 2IW5A 3EETA 2HYGD 5F64A 2EFOA 4LB6B 1A04A 1S29A 2JQ7A 4KT6A 2NVYJ 3S2HJ 9ANTA 1ZYRF 1Z77A 4GRIA 3W2VA 3LWFA 1VFCA 2MD0A 1RPWA 5HLHA 2XRLA 3KZZA 1HC8A 1SVLA 2IJLA 3L7WA 4JYKA 5JLXA 2ZSIB 3GO5A 2XKOA 1HOMA 3BJAA 4BKXA 1USSA 3FXKA 3IHUA 3M8JA 4KN4X 2DK8A 2X0LA 3CDLA 4NB5A 4V2FA 2VT2A 3QYEA 3F23A 1ZRCA 4LLNA 4O6JA 2ZB9A 4FASD 2V9KA 1SD6A 4DYCA 3I54A 1TWFJ 1EH6A 2O5RA 2W24A 2EIJH 4XK4A 1FY7A 3OYDA 3OSGA 1U8RA 5EGOA 1GHCA 3CJNA 1ZG5A 1DU0A 4IRIA 2FBIA 3V7RA 2JSPA 2K5CA 3GUDA 4H0EA 1XB4A 2P7VB 5KAFC 1TWCJ 2JSCA 3EYIA 5HS7A 2HNHA 4RB0A 1TBXA 3BPVA 2VUMJ 1DGWY 2ZXIA 1ENHA 3LSIA 1BBYA 1O3TA 5DDGA 2C6YA 1XMAA 2MW8A 4AWXB 4HW0A 3A0HC 2XAFA 1SFEA 3DBLB 2LK2A 2NVTJ 1G3YA 3Q9VA 3H35A 3HL2A 2Q2EA 4XLFA 4UVCA 4CCNA 2F5DA 2WA0A 1Y0UA 2HXIA 3ECHA 1BIAA 1R1UA 3OV8A 1YE9A 4ENNA 2FRHA 4WCGA 1YIOA 3OYHA 2M5WA 2LY2A 4Q48A 4JP0A 3FM5A 3BJ6A 3PFYA 1QZYA 4OIOF 2UWMA 1E3OC 1T8IA 2K02A 1OCCH 3K4MA 4ZC3A 1A6QA 2E36A 2RQPA 4HAMA 5CVIA 3CCJI 2KZGA 2OQGA 2A5YB 2EZHA 4L5IA 1XTAA 1KU9A 3PNVA 1LDKB 1X1PA 4ZTJA 3G73A 1JUMA 3GFMA 1IDYA 4OIRF 2LBFB 2QF7A 1ZGJA 1J09A 3GCMA 2JVHA 2K9SA 1ZAOA 5GAEJ 1FJLA 2HOAA 2OAZA 2L4AA 2FUG2 2VQGA 5CYVA 3HYIA 2K9MA 3ZQQA 2Z5UA 2XDVA 3OR2C 3QQAA 3TBIA 4N9IA 4HNTA 3GLXA 3U21A 2COMA 3Q0VA 3S3NA 3HOWJ 5J1RA 2M4GA 1UJ8A 2XAGA 3DLAA 3BG5A 1NG6A 1EF4A 4D0PA 1LFPA 2IGNA 3LAJA 2FF4A 1W36C 2ZNZA 3I4PA 1BJAA 2P5KA 1S3JA 5B3SH 3E6CC 3S2WA 3E6MA 3EYYA 4LITA 2VQHA 1A31A 1I3AA 2IRFG 1A5JA 4E7IA 3ZMVA 5D6FA 1Z91A 2QQAA 2XF7A 1HLVA 3W2AA 2QKMB 1RI7A 3D5LA 3VFZA 4PSXA 1SAUA 3GTGJ 1ZQ3P 3LSHA 2R0QC 1MMNA 3L00A 4Z6YA 3F21A 2IA2A 5DUKA 3WODF 2DOEA 1NH3A 1U5TA 2L9NA 1Y0NA 3RKYA 1PVEA 1WJAA 2XB5A 4KICA 3DPTA 1H89C 1B8IB 4QIWN 4EJTA 1QU3A 1IN6A 4BNCA 2V79A 4UUTA 2JPBA 3KLNA 4B43A 2HZTA 4U7BA 2QBYB 2FD5A 1IZ1A 2H8WA 4A0ZA 5HNFA 3OS0A 1SFXA 4RLFA 4QLCU 4A6DA 1ETOA 5TGTA 3PNTA 5FO5A 3CC2I 3KPHA 3K4KA 3WG7H 4DW6A 1OCTC 3T5XA 3D1NI 2ETHA 1V3FA 3MKZA 2HDCA 4XR6A 1V4RA 4M9SA 2OUMA 4BHPA 3LFKA 1PP8F 1LEAA 5LEKA 2FOWA 3NARA 2LKSA 2M30A 4HV5A 3S3MA 3DP7A 3HOYJ 1MBJA 4B47A 4A3GJ 2Y2ZA 2DPDA 3LL7A 1MW7A 2KT0A 2RAEA 3P5JA 4IHYA 4A3MJ 4C30A 5HODA 3JRCA 5DUIA 3OY9A 2IS6A 1T56A 2XGDA 1D8KA 4ZYEA 4NDLA 4R79A 3VEPA 2BY0A 2LBFA 2EFNA 2VKEA 1K7AA 2HPMA 4XORA 3ML6A 3FBNB 2K9NA 5EG0B 4QSHA 5LRRA 2M2EA 4BUPA 4YFKF 2HVSA 1MD0A 3GTLJ 3ERED 2DA7A 5ILVA 2ZC2A 2OPTA 4OMYA 1YG2A 2VOOA 1CQTA 1SANA 3ELKA 1N25A 3E6DA 4QTRA 2QGUA 5GPAA 3BR3A 2LNBA 5IP9J 1BW6A 4CICA 1HKQA 2KRHA 2CV2A 1KU2A 3I58A 2A05A 4YRVA 1XG1A 4HQEA 4L9VA 5EEHA 4BQOA 4EGYA 3HHHA 2XSDC 4I99C 2GOMA 3A4CA 5FKNA 4AVPA 3JRDA 1KA8A 1USTA 2IT0A 1HCRA 1B1BA 1Z3YA 2JN6A 3GXOA 3PQJA 4UV9A 3KP7A 4Y4RA 3JSPA 2O7OA 3O8GA 2D2WA 4KIBA 5CVRA 2HDDA 1EA3A 2Z33A 4AM3A 2DDAA 3PM1A 3OIOA 2Y0SA 4RGXA 2YU9J 4RB2C 1K4SA 1D1AA 2BOLA 3QYFA 3ZQCA 3I59A 4F7ZA 5LHHA 3HPHA 2DA2A 2GIZA 1V5EA 1YRNA 3HOTA 2Z16A 5CJ9A 1WJ5A 1JHFA 2KLOA 4AD9A 3K69A 4B8XA 2CV1A 3ASNH 3EUHC 5GAHJ 2Q0OA 2DJNA 4HLYA 1W7PD 1SFUA 1FBUA 4XRMA 5H2FC 2HXOA 4DQ2A 3ZR8X 5E1WA 1FT9A 2ID6A 3IH4A 3I5UA 2CS3A 5KHDA 3HTUA 2CQKA 2MA3A 2JTVA 3KLOA 1G8XA 1AKHB 2FBKA 4LMYA 5H20A 1AHDP 4BXXJ 2VKHA 3KEYA 2K40A 3IWZA 3OYGA 1X1DA 2DT5A 3VWBA 2BBYA 2J5OA 4ENJA 1ETWA 2L5QA 1C0WA 2E1MB 1AKHA 2F5VA 5HDGA 4I09A 3ZMZA 1XGSA 1D8JA 3H3UA 3HIFA 2L54A 5ILSA 3I4NJ 2QLZA 5ICEA 3GFIA 4IHWA 5LRSA 2LC2A 3PIOF 1S5LC 3HOVJ 2E71A 3M9AA 5AONA 3K4NA 4KFCA 3GFJA 2QSFX 2WBMA 3CMAI 2Y0MA 1HBXG 2DPUA 1W1WE 4XLEA 4Z2YA 2W25A 2N8GA 4A69C 1V54H 4D5CA 3H36A 2EINH 5DS9A 3VB2A 3A2KA 2W48A 3RKQA 4G7HF 2E2HJ 5TRDA 3OOUA 2DN0A 3JREA 2QA4I 1D0YA 5FLXZ 3T8RA 1YFHA 1IGNA 1HXDA 1MNDA 1BI0A 2Y31A 2WB1A 5E1XA 4X0GA 2EV5A 1RUOA 2UZKA 3C2GA 4WF2A 4HA8A 1UHMA 2XIGA 1LB2A 3DU6A 2WAEA 2WB1N 3FZVA 2HOSA 4Y7NJ 2EV0A 2VODA 1W4MA 2OF7A 1N77A 2QSHX 3JRGA 2R93J 1OCOH 1JKOC 2JZYA 1G6NA 5J8CA 2ZCWA 1UHSA 3TQNA 2YS9A 2EPFA 4M3EA 1HW5A 2NNNA 3WTXC 3HGGA 2OCEA 4MNUA 3Q3SA 4J00A 2LKXA 5KVRA 3E6BA 4XLAA 3MFKA 1IO2A 1FWZA 2STWA 4LG0B 4BBSJ 1DPRA 4M3DA 4HBLA 2RREA 2YUSA 4UB6C 4CCOA 1BR4A 2H6CA 4BJ5C 4A12A 2FNAA 2V6EA 2LYCA 5HS8A 1FMVA 2LY9A 4HYEA 4XOPA 3HRUA 1MBHA 2D1VA 3M4OJ 5IP7J 3VYSB 4LLGF 2R7TA 1WWXA 5F0CA 4JQFA 3HOUJ 1ZELA 1EV7A 2K9QA 3FDYA 2CQQA 5DV5A 3OL4A 1O4XA 3ZN1A 1VF9A 1TNSA 2F5CA 1I50J 1BOAA 1GXQA 2FQ4A 4RM3A 2LKPA 3W2WA 4G6DA 4GDFA 4XM3A 3VPRA 3JR9A 2CUEA 3M3YJ 3OYAA 5LFAA 4PJNA 3DCFA 3BT9A 3AG4H 4BQAA 1MDMB 2EA2A 3O2PE 4A0XA 5J8FA 3CCMI 5BNGA 1LEBA 4QPQA 3SZPA 4N0BA 2YU3A 2GWRA 2YR2A 3ZQHA 3KYLA 3AAFA 2HVQA 3V8JA 3IH2A 3RKXA 4EM0B 2IGKA 4RMNA 5FD6A 3HKZN 3KEOA 3QYBA 4II2A 3CUOA 3M1EA 2DA3A 2NS0A 1JUSA 1BC8C 4Y52J 1QRYA 3CD6I 3O3KA 3BQYA 4EVIA 4OWRB 4A3IJ 3CP8A 3TO9A 1Y6IA 4Y15A 1LFBA 4D5FA 1QQIA 2Y9ZA 5CVJA 2EZKA 4LD5A 3WTZA 1STZA 1SEUA 2XGCA 2LH9A 3FHZA 3HSFA 2LP0A 2VJIA 2M87A 4ABZA 1O3SA 3PFIA 4L18B 4GXOA 2I10A 1CF7B 3RDIA 3DKYA 1SD4A 3C18A 1W36D 5K7ZA 4M73A 2CMPA 3H9GA 1UFMA 2M8EA 3WU2C 4OMZA 3Q5FA 4EM1A 4N9HA 3QOEA 1MBEA 1T39A 1K6YA 3MVPA 3DTEA 4N4NB 3QWLA 1UELB 1SFKA 1K79A 3WTSC 5M5XJ 3GTOJ 3ZQGA 3S1NJ 1VQ5I 3G1LA 4PZJA 5E8GA 4PJ0C 5F1JA 3F8BA 4NNJA 1JT0A 4BE2A 2L7KA 4HLXA 1LJ9A 1R36A 3BR5A 2IGMA 4A6EA 2V7FA 2Y75A 3GF2A 3ZMSA 4J19A 3L9FA 2AS5F 3KEQA 3SXYA 1P7IA 4I98B 1VQ4I 2BHYA 4GGGA 2KIUA 1BC7C 2DU9A 3FKIJ 4RA2A 4QPOA 2P6SA 2ADUA 4ZZLA 5IOYA 1G2HA 2BEOA 2L3DA 1TWAJ 4LK1F 3U2RA 2RNGA 1RR7A 1ULYA 4KMFA 2BXZA 4KJZA 3CCYA 3OIPA 2LLKA 3QPHA 5DCMB 3OYMA 1MMSA 1UMQA 2OU2A 3CO6C 4FX4A 1VQOI 1E0EA 4ESBA 1SVOA 4EJOA 1VQKI 3ONQA 3T1BA 2R7ZJ 2VXDA 3QP6A 3ULQB 1UAAA 2BY3A 1YW8A 3VSLA 2A5WA 5DEQA 4D9JA 1WH7A 1PDNC 1E17A 1P92A 5HLGA 3RZOJ 2K4BA 4UVBA 5AIQA 1BI1A 5ICFA 1S7EA 2L7MP 3ZN0A 3MMYB 1R58A 1A35A 4L9TA 2KFDA 2HI3A 3G6EI 3FMSA 2XASA 2E5ZA 4PCQA 2GM4A 2ZMEB 4JOMA 3CMMA 2VC1A 3TGNA 3KX2A 3OYKA 5LHIA 5EDNA 4G8XA 2WTEA 2G9WA 4E7ZA 5BPDA 3HOZJ 3E7LA 1TWGJ 1BJZA 2E1NA 4NC8A 1W7PA 2FQ3A 4HNVA 2G0EA 1Y39A 3HRTA 1OCPA 1HKTA 4E7SA 3RKWA 4LIUA 4OOIA 2QEXI 1A6IA 3VSKA 2FBHA 2EH3A 3HOXJ 5FLXK 5J40A 4CCMA 2KKOA 1IW7F 1Z7UA 1PJRA 2UV1A 1YJ9I 3OSFA 1HF0A 5JVTA 1FOKA 1OR7C 5FJ8J 1B4AA 4H4KC 1K61A 2QWWA 4NQWA 1VNDA 2BV6A 1VQPI 2DODA 3P7NA 5C3EJ 4MEXF 4A0YA 2X6OA 1H88C 2YX7A 4Q47A 2HU9A 2VPLA 2B7EA 5H6QA 4EJUA 4BHBA 3ABKH 4CHUA 2ISYA 3GWZA 3GTJJ 1EJ9A 1ZG1A 4R8HA 2F4MB 2B9SA 2L9RA 2PX9A 5HOOA 4IQJA 2NVUB 1J59A 1P7JA 1LDDA 2CFOA 2Z9OA 1OCZH 1DUXC 2TCTA 4PFOA 4S0HB 1XCBA 2CFXA 3AL0C 4HX7A 1RC9A 3LFUA 5IP6A 1AU7A 3TEDA 3G1MA 2DFFA 3W6KB 4PUSA 2ACJA 1K6OA 1BM9A 3HUGA 3KZYA 4UHTA 2V1NA 4XKVA 1FLIA 2DW4A 4IEJA 1JTXA 4XLNF 2RNJA 2FOKA 2A61A 2ZFWA 3S14J 5A2QK 2JRMA 1T2KA 1R71A 2L7FP 3GBGA 1VQ9I 3I3LA 1RIOH 1TWHJ 3NAUA 3RYPA 1O7FA 2O61A 2DT6A 4MO7A 2GXGA 2PFBA 1WVRA 4MEYF 1JI8A 2GA1A 1EH7A 3A03A 3T8TA 2KRCA 2VI6A 1PUFA 2RDPA 2KPMA 3OL3A 5HNHA 1ORKA 1XD7A 3B6CA 4EATA 2RGVA 4M6YA 2NVQJ 4C3HJ 3FISA 1TQMA 1FTZA 3AG2H 2AO9A 4GCVA 2Y30A 3V7CA 3FK7A 3BY6A 1MBKA 5HS9A 5IYDJ 3K10A 3RQIA 4CCKA 2WY8Q 2AXTC 1MNMC 3B02A 4EMSA 4KIFA 2K7LA 4U0WA 3HOSA 4EM2A 1PUEE 2R7FA 4B48A 2QKLB 3L2RA 2CG4A 4R1HA 2D45A 1GLNA 2L0KA 3FHNA 2PJRA 2VBZA 4HV6A 3IAM2 4XOTA 4NC6A 4P5OA 5EEGA 4ZYGA 1YW9A 1ON1A 1DU6A 2H8RA 4JBAA 3OYEA 3R4KA 1TLHB 1WGXA 4L9JA 2IS2A 1LVKA 2PLYA 2QBYA 2ZFUA 1WKMA 3ECOA 2CW8A 4IKFA 5FRMA 1GVDA 4RDUA 2P8TA 3IRQA 1MJBA 1WRJA 2MBFA 1GDTA 5JLWA 3SEQA 3CUQC 3BR6A 5K7HA 2QVOA 4EV0A 2ZXHA 1RRJA 1WJBA 3V8KA 2KL4A 3N97A 2NNYA 3F72A 4UVAA 1NG7A 4DZJA 1U5TB 3I4MJ 3Q9SA 1J2XA 1ZARA 3CLOA 4HSRA 4V2GA 1SC7A 3I64A 3V42A 1L0OC 2CQNA 2DA1A 3WTUC 2HEOA 3WHCA 1IN5A 4A3JJ 3PSFA 1QO0D 3K0LA 2ELKA 3BG7A 1VQ7I 1S7OA 3GTMJ 3JTGA 2V6CA 2HTJA 1BR1A 2A6HF 2DK5A 4CYCB 1R1VA 3FXOA 4IHTA 2HPIA 3R0AA 1P4AA 1WCMJ 2CW0F 3AFHA 3ZGKA 4A5NA 1FC3A 1HSTA 4P9FA 3E3VA 3U1KA 4I0BA 1BI2A 2P81A 1LUJB 1VI0A 5DD4A 4KA4A 1GT0C 2X6WA 2CRGA 1MDMA 1T95A 2CJJA 1X2MA 2O03A 3QP5A 3LAPA 4BY1J 1X1AA 1B9MA 3JRHA 1POGA 4CYDA 3S15J 1U6GA 3LQRA 1ZREA 2O8KA 3HJEA 4ZZDA 3GLLA 3COAC 3HXLA 1ACIA 2QUFA 3IWFA 3IC7A 4A5MA 4U0VA 3OWTA 4XN0A 3NQOA 1MNEA 3DBRB 2VJJA 2DYRH 3E1SA 3J80Z 2L01A 3FX3A 3C1DA 2P6TA 4BE0A 3ZXSA 1WJDA 3IKVA 1IUYA 4BEHB 4DYQA 4G12A 1BA5A 1KQ0A 1FNNA 4FTHA 2X1CA 4RLQA 2W82A 2KZVA 2XPWA 3RYRA 4HF0A 4F3QA 3MKWB 4W1UA 1YTYA 2ZXJA 1SMYF 3GX4X 4HDUA 1X58A 1GV2A 3DWLE 4ZH4F 2VASA 5DTDA 4F92B 5D5VB 3ABMH 5FLMJ 3GVAA 1OCRH 2E1OA 1LVAA 4MFEA 2KISA 4XKCA 3G4SI 2MC3A 5D4SA 2QCOA 1MMAA 2OTLI 1ETQA 1Z3XA 2OV7A 1ETKA 5JFRA 4C2UA 1BW5A 3W6VA 4M9XA 4NHJA 3JAMK 2RQQA 3F6OA 2R7VA 4BBRJ 2K27A 1ONVA 1Q1VA 2XGXA 1H9GA 1R1TA 1YX3A 3GW2A 4I6ZA 4AIJA 3V4GA 3FXJA 2CU7A 2FMYA 3JW4A 3QAHA 3PSIA 1QPIA 4M71A 2OCCH 4ITVA 2V26A 5DM7F 3I9V2 4FE4A 4RGRA 3CDIA 3CCEI 2R92J 3TMOA 4FHTA 4PFPA 3K9TA 1T0FA 2KIMA 3C3WA 3BDDA 3WG9A 1FIAA 3FIWA 3J7AY 2NS8A 2IVMA 1ZLKA 2DA6A 1SAXA 2DMTA 5LBQA 4U7DA 1HDPA 1XMKA 1GXPA 2EIMH 1MH3A 1NK2P 3CUQB 3DEUA 3H5NA 2PBIA 2JVGA 3FXMA 4L5EA 2LOOA 4I7HA 1VQLI 2HOTA 3TW6A 3OYFA 3OMYA 3TO7A 4RAZA 5E17F 2E19A 4MGRA 4Q5SF 5J47A 1TW2A 4XRSA 2DDBA 2O8XA 2K86A 3L1PA 1ZRFA 5F0HA 2Z3YA 1WH5A 3HEFA 4BACA 3LSTA 1XC5A 5TISC 2OD5A 5FKMA 3LSJA 1YS6A 5DCMA 1ZN2A 3UR3C 3V8LA 3A01A 4C2MJ 2QQ9A 2A69F 1OISA 3KP4A 3M1CA 3OR1C 4QWQA 2LD5A 2HS5A 3F8NA 2JK3A 4XL9A 4MLOA 3CJRB 3L2WA 4YG2F 3DKXA 3T0YA 1YW7A 2L7ZA 3RQ4A 3BG3A 4JX4A 2E35A 2QQ8A 3KYCB 1VQ8I 1JTYA 3S93A 2DOFA 1IN4A 1R5GA 3ZMDA 2X6YA 3K4BA 5CQGA 1ZGWA 2M34A 3FF5A 1WJFA 3CF2A 2HKXA 2AQFA 3CCSI 2ELHA 3RI4A 4M3FA 3FXUA 5JR3A 1FYKA 1F43A 2YX4A 2X85A 3PIPF 1JHHA 2NRAC 4OIPF 3J7AO 5HDKA 1FYMA 2MLKA 4ZDPA 4B09A 4D7MA 5E79C 2GOXB 4XSZF 1YS7A 2X4HA 4A3FJ 3FK6A 2WWYA 2MC4A 5LLQA 4NBQA 4RGSA 5F6FA 1IRFA 3TP0A 4LG3A 1YLFA 1O7LA 3KP3A 1RESA 4G6QA 2EIKH 3MKLA 4HZFA 4DOZA 2JA7J 1ZLJA 3C2HA 3SJMA 1B6AA 2LR8A 4BGDA 4M72A 1IN8A 3U9GA 5L3EA 1ZRDA 3RPUD 2RC4A 1TC3C 1RETA 1IG7A 3I59B 5F27A 3TOAA 1IJWC 3DF8A 5F0FA 4XSXF 3CUQA 2JMWA 5FFXA 1B72A 5TJJA 1D0XA 3ABTA 2ME0A 2Y9YA 3A02A 4KISA 1FBQA 3HRSA 4XKWA 1OLTA 2XGEA 3CC7I 1FTTA 3S16J 4CZZA 3HDDA 3RSNA 5C4JJ 3JAMZ 2NOGA 4CO8A 4P1WA 2BY1A 2HVRA 4TV7A 3OIQA 1G4DA 2V9PA 3QODA 4XQFA 5GAGJ 1Y1WJ 4XKBA 2PMHA 1ZKGA 2KJCA 1W5SA 4UV8A 4Y13A 4UUSA 1OYWA 3HB9A 2ZNYA 3HTSB 1W0TA 2JJ7A 2O6GE 4LJZF 3DLLF 2VBXA 2NYXA 2LY1A 2NXNB 3J81Z 1X4OA 1WJEA 3RPQA 1ZR2A 4F55A 3GFLA 2KQRA 3ISPA 1XS9A 4BS9A 3ROUA 1AA7A 1KQ9A 1G59A 5BS6A 2R7DA 2UUZA 3DU5A 3KFWX 3G1OA 1J75A 3MEXA 2ZMEC 4BU2A 3ABLH 2EZIA 2X1DA 3K1MA 2QQBA 2CUJA 3WGHA 1S6LA 2BHZA 2DYSH 3VDXA 4S05A 3SDGA 4ZDOA 5F1RA 3ZQFA 2K3PA 2LSOA 1OYYA 3BTJA 1MJ9A 5FKLA 3RZDJ 1I1SA 4IHSA 1T0FC 2EK5A 2QM3A 4IJAA 3TOBA 3D0SA 1QHGA 2EFWA 1HW2A 2WV1A 1JKPC 2XRNA 5JI6A 4WXHA 5IOZA 5D5UB 4FX0A 4XN3A 2CGPA 4UUVA 1U78A 3CLQA 4L9NA 1X3UA 3BP8A 4B1RA 1IRXA 5KAIC 1XGOA 4XMYA 2Y69H 1G3TA 3WGIA 4GFBA 1XGNA 1BL0A 4B44A 4UY8I 2B0LA 2E2IJ 4AVZA 2AQEA 3LA7A 3JCUC 5M5YJ 1MSFC 5IT9Z 2F5FA 3DQVC 3CCUI 3BG9A 3VYTB 3SZGA 2BY2A 4BE1A 1W7PB 3CCQI 5BMZA 2H6BA 3EUKL 5HDNA 3J7YJ 4BDYA 2DFHA 3LQQA 1Z1DA 3CC4I
chains in the Genus database with same CATH topology
4BAYA 3FXQA 2L4MA 1XDSA 2JPCA 2LDUA 1ZHFA 1L3LA 2YSRA 5L3FA 1J7KA 5H6RA 1YQAA 1XCVA 1BN5A 3F3XA 3M8EA 1S8NA 4HOBA 4Y17A 3HRMA 2PMUA 1F5TA 4ETSA 2KJBA 5K5OA 1DDNA 2EWNA 3WE3A 1D3YA 4HF2A 4OIQF 2IA1A 3WTTC 4YFXF 2UXXA 2FU4A 1D5VA 2HKOA 1RNLA 2HFHA 5L3CA 2VE8A 4IXAA 3LA2A 1TW3A 5E18F 3IRRA 2J5PA 2MH9A 1T38A 5CVVA 3BWGA 5A2QZ 1Z9CA 3QRFF 5D6EA 1KYZA 3IKTA 5E20A 4WK8F 3MWMA 1XSVA 3FWEA 4OINF 4LB5A 3FMRA 2CSOA 1WI9A 4M74A 4U88A 1UCRA 1O3QA 3R61A 3TDUC 1IAWA 3QOPA 1FBSA 1XDUA 1XN7A 3EUHA 4XRFA 2KIFA 5ICCA 1RZ4A 1R00A 3WE2A 2PEXA 1W5TA 3P9KA 1HKSA 2PI0A 2DQLA 4A2UA 1IN7A 3DKWA 1KYWA 3J80K 1U2WA 2ESNA 4RGUA 2CYYA 2XAQA 1LDJA 4HX4A 4G9YA 1I27A 4M6XA 2R3SA 2TDXA 2K4JA 2F5EA 4GYGA 3WTWC 2JT1A 4CGZA 1IXRC 3W6JB 2VOPA 4IRHA 5E8IA 2A68F 2OBPA 2P4WA 2NAZA 1Z05A 2E1CA 4MQ9F 1MKMA 2HWVA 4G94A 2VBWA 2BYVE 1OPCA 5LGTA 1FP2A 2HGCA 2VXZA 4FT8A 4ASNA 5J6XA 1J0RA 2AXLA 4I01A 2FA5A 2H27A 1REPC 1O3RA 3ZMUA 1U5TC 4S04A 1LNWA 5DD8A 1HSJA 3FMQA 1T98A 2XVCA 3SHFA 3VOEA 2EJRA 4KUMA 4LGWA 3F8CA 3FM3A 5BPIA 5FFZA 4IF4A 1BIBA 1MGTA 3EDPA 1HW1A 4LFUA 3F8MA 3JTHA 4L5JA 4RB1A 1WQ2A 3KCCA 2RN7A 3GEZA 5L3GA 1IRGA 2L02A 2D1HA 4ZYDA 1JE8A 5FGMA 3K1NA 4IPAA 4PGGA 3WU1B 2ISZA 3R6SA 2E7WA 1WSUA 2W85A 3CDHA 2VC0A 3F6VA 2HOEA 5K5RA 3QPTA 4BYYA 1Z6RA 4P9UA 1TNTA 4RAYA 4HX8A 4IVNA 3MZHA 2CWEA 1FZPB 1HQCA 2STTA 4UNOA 3BPXA 2EV6A 4O5VA 3BZ6A 4I2OA 3F22A 3NEUA 2EA4A 1OYIA 5ED4A 3MQ0A 3QU6A 3GYHX 2A3SA 2IA0A 1R5HA 1F4KA 1OKRA 2PG4A 4YIFA 1U3EM 5E1ZB 2WC2A 5D8KB 2IP2A 4EQQA 4U0YA 1JGSA 1DP7P 4PDKA 3DXJF 2H94A 2MLGA 2ZBKA 3R0JA 1FX7A 1ZGAA 5ILUA 3TDZC 2EB7A 2W57A 1JXSA 4ENMA 2P5LC 3O6BB 5KK1A 4BH9A 5IT3A 3BOQA 3IL2A 1CF7A 1IF1A 1EH8A 1CGPA 1XSXA 1P4WA 3R60A 3FXRA 1T6SA 2M45A 2FMLA 4MHGA 1YYVA 2GAUA 5K5QA 2HYFA 5K1YA 2UXNA 5HVQC 4LG0A 3MAJA 4WXDA 5LGUA 2OZUA 4I02A 3RTRA 2LF8A 3JSOA 1XSDA 3SFZA 2DAOA 4KYWA 3L2CA 2RKHA 2FXAA 2PQ8A 4GYIA 3M7GA 2JRTA 4O3MA 1QZZA 2F2EA 5ERIA 5LEJA 3P9CA 3KETA 1ZH5A 3J81K 1TTYA 3RPUA 2HQRA 4EGZA 1K78A 1R23A 1ODDA 2Q8KA 4DNCA 1F9NA 2ESHA 2XUBA 3QU3A 3NRVA 4Q4ZF 3V7SA 2MH2A 2FSWA 4KDPA 5L3BA 4EJWA 4AIHA 3CO7C 2GZWA 5JHUA 4E70A 2DFIA 1P6RA 2BGCA 4ZYHA 1FSHA 2ZO4A 2V1XA 3PQKA 2VBYA 1G3SA 4HDVA 4HF1A 1MZBA 4KN7X 3M8FA 3ZP5A 2ZKZA 1H9TA 3F8FA 1XGMA 2DTRA 3B73A 4AIKA 1KQ8A 1OR7A 1Q1HA 2XAJA 1I5ZA 3ABUA 3MCZA 2OZ6A 1FYLA 1OMIA 1E2XA 1O57A 3ZQ7A 3OOPA 3E5QA 3VODA 4ENKA 1NHAA 2DI3A 1SD7A 2OA4A 2FE3A 5IT9K 3WGGA 1B9NA 4UXNA 4WXCA 1S7AA 1TQIA 2FEZA 1F1ZA 4JK1X 4P96A 4L0ZB 2KRFA 2VT3A 4G7OF 3WTVC 4KMUX 3ZPLA 1KU7A 3I53A 3CTAA 3P9IA 3TO6A 1FP1D 3U1DA 1IXCA 2DO7A 2RVCA 3E97A 1PP7U 4K2EA 3C7JA 5D8LB 3E5UA 1KGSA 1QBJA 2GA2A 5DCFA 4MTEA 1BI3A 1GVJA 5L3DA 2ZJ2A 2BE5F 2CO5A 1SD5A 2G7HA 5D5WB 4ESFA 3HSEA 1ZG3A 3LA3A 4XLPF 5LHGA 1SMTA 2V1DA 3DV8A 4BXUA 3HSRA 3DPLC 1KU3A 4RS8A 3GZ6A 3E5XA 3N4MA 1LQ1A 1QPMA 2A6EF 6PAXA 2GIVA 4YIIA 3SZTA 3K1PA 3BROA 5BQTA 4EJVA 2XROA 2DBBA 4RB3C 4MTDA 2Y48A 4KT5C 2G7UA 4XBFA 3RIRA 1IXSB 3TKYA 2HR3A 3ZMTA 1FSEA 2PJPA 1QNTA 5CLSA 2MD5A 2DLLA 1R22A 3REOA 4IRGA 2EFQA 5FD5A 1YO5C 2W84A 2XV4S 2XKPA 1J9IA 3I71A 2M1BA 3KP2A 2PN6A 1Z6TA 3DFGA 3EQLF 4M9ZA 1I6XA 2V1UA 4HQMA 1RUNA 2OQRA 2LF7A 4YFNF 5D5XB 1UB9A 3I0TA 5ICGA 1QGPA 4PGHA 5AIPA 2EFPA 4L0YB 2QYOA 2IPQX 4CDGA 3GZ5A 1P4XA 2WV0A 2VONA 1J5YA 1FPQA 1H0MA 2GQQA 3HHGA 2QENA 3WTYC 2O0YA 1AOYA 3MZYA 3L09A 4ON0A 4G7ZF 1AWCA 2P5VA 2V9VA 5HLIA 1K78B 5D4RA 3BJOA 1I1GA 5BOXA 2DQRA 1ON2A 1G3WA 2HTSA 2O3FA 2FNPA 2XAHA 5FB2A 2HQNA 2P7CB 1P2FA 4CXFA 2Z99A 2YPRA 4BHCA 4GO1A 1TQPA 3RJPA 4LLLA 1R7JA 3WU0A 2H09A 2VN2A 3G3ZA 4ESJA 3KP6A 4KNYA 2E7XA 3H3ZA 4LK0F 2QZ8A 3H92A 5LGNA 4OU0A 1VTNC 4WWCA 4WX9A 2A07F 1UHWA 2XHKA 5CVUA 4P55A 5DYMA 3K2ZA 2GXBA 1MJAA 2RV8A 3SQNA 4MQVA 1B59A 3KE2A 2ZMEA 4I0AA 3KP5A 4KIGA 2VE9A 1DPUA 2IW5A 3EETA 2HYGD 5F64A 2EFOA 4LB6B 1A04A 1S29A 1ZYRF 3LWFA 5HLHA 3KZZA 2IJLA 3L7WA 3GO5A 2XKOA 3BJAA 1USSA 4KN4X 3IHUA 2DK8A 2X0LA 4NB5A 2VT2A 1ZRCA 3F23A 4LLNA 4O6JA 1SD6A 3I54A 1EH6A 2W24A 1FY7A 1U8RA 1GHCA 3CJNA 1ZG5A 4IRIA 2FBIA 3V7RA 3GUDA 4H0EA 1XB4A 2P7VB 2JSCA 3EYIA 5HS7A 4RB0A 1TBXA 3BPVA 1BBYA 1O3TA 5DDGA 2C6YA 1XMAA 4AWXB 4HW0A 2XAFA 1SFEA 1G3YA 3Q9VA 2Q2EA 4UVCA 2F5DA 1Y0UA 3ECHA 1BIAA 1R1UA 3OV8A 4ENNA 2FRHA 4WCGA 1YIOA 2M5WA 4Q48A 4OIOF 3FM5A 3BJ6A 1QZYA 2UWMA 2K02A 2RQPA 4HAMA 5CVIA 2OQGA 2A5YB 4L5IA 1KU9A 1LDKB 3G73A 3GFMA 4OIRF 1ZGJA 1ZAOA 2OAZA 2L4AA 5CYVA 3HYIA 2Z5UA 4N9IA 3GLXA 2COMA 2XAGA 4D0PA 3LAJA 2FF4A 2ZNZA 3I4PA 1BJAA 2P5KA 1S3JA 3E6CC 3S2WA 3E6MA 3EYYA 2IRFG 3ZMVA 5D6FA 1Z91A 2QQAA 1RI7A 3D5LA 3VFZA 3L00A 3F21A 2IA2A 5DUKA 3WODF 1U5TA 3RKYA 4KICA 3DPTA 4EJTA 1IN6A 4BNCA 2V79A 2JPBA 3KLNA 4U7BA 2HZTA 2QBYB 4A0ZA 1IZ1A 1SFXA 4QLCU 4A6DA 5FO5A 3T5XA 2ETHA 1V3FA 2HDCA 1V4RA 4M9SA 4BHPA 3LFKA 1PP8F 1LEAA 5LEKA 2M30A 4HV5A 3DP7A 2DPDA 5DUIA 1D8KA 4ZYEA 4R79A 3VEPA 2EFNA 1K7AA 3ML6A 5LRRA 4YFKF 1MD0A 3ERED 5ILVA 4OMYA 1YG2A 2VOOA 3ELKA 3E6DA 2LNBA 4CICA 1HKQA 1KU2A 3I58A 4HQEA 4L9VA 5EEHA 4EGYA 3HHHA 4AVPA 1KA8A 1USTA 2IT0A 1B1BA 3GXOA 3PQJA 4UV9A 3KP7A 3JSPA 2D2WA 4KIBA 5CVRA 2Z33A 4RGXA 4RB2C 3I59A 4F7ZA 5LHHA 3HOTA 5CJ9A 1JHFA 4AD9A 3K69A 4B8XA 2Q0OA 1SFUA 4HLYA 1W7PD 1FBUA 4DQ2A 5E1WA 1FT9A 3I5UA 3HTUA 2CQKA 2MA3A 2JTVA 3KLOA 2FBKA 4LMYA 5H20A 3IWZA 2DT5A 2BBYA 2J5OA 4ENJA 1C0WA 5HDGA 4I09A 3ZMZA 1XGSA 1D8JA 3H3UA 3HIFA 2L54A 5ILSA 2QLZA 5ICEA 3GFIA 5LRSA 3M9AA 5AONA 4KFCA 3GFJA 1HBXG 2Y0MA 2DPUA 4Z2YA 2W25A 3VB2A 4G7HF 5TRDA 5FLXZ 3T8RA 1YFHA 1HXDA 1BI0A 5E1XA 2EV5A 1RUOA 2UZKA 4WF2A 4HA8A 1UHMA 2XIGA 1LB2A 3FZVA 2EV0A 2VODA 1W4MA 2JZYA 1G6NA 5J8CA 2ZCWA 3TQNA 1HW5A 2NNNA 3WTXC 4MNUA 5KVRA 3E6BA 3MFKA 1FWZA 2STWA 4LG0B 1DPRA 4HBLA 2H6CA 4A12A 2FNAA 5HS8A 4HYEA 3HRUA 2D1VA 4LLGF 1WWXA 4JQFA 1EV7A 5DV5A 3ZN1A 1TNSA 2F5CA 1BOAA 1GXQA 2LKPA 4G6DA 4BQAA 1MDMB 2EA2A 3O2PE 4A0XA 5J8FA 1LEBA 3SZPA 4N0BA 2YU3A 2GWRA 2YR2A 3AAFA 3V8JA 3RKXA 4EM0B 5FD6A 3KEOA 3CUOA 3M1EA 2NS0A 1BC8C 3O3KA 4EVIA 3TO9A 4Y15A 1QQIA 5CVJA 4LD5A 3WTZA 1STZA 3FHZA 3HSFA 1O3SA 2M87A 4L18B 3PFIA 4GXOA 1CF7B 3RDIA 1SD4A 3C18A 4M73A 1UFMA 2M8EA 4OMZA 3Q5FA 4EM1A 4N9HA 1T39A 1K79A 3WTSC 4PZJA 5E8GA 3F8BA 4HLXA 1LJ9A 1R36A 4A6EA 2Y75A 3GF2A 3ZMSA 3L9FA 2AS5F 3KEQA 3SXYA 4I98B 1BC7C 4GGGA 2KIUA 2DU9A 2P6SA 2ADUA 4ZZLA 2BEOA 2L3DA 4LK1F 3U2RA 1ULYA 4KMFA 3QPHA 5DCMB 2OU2A 3CO6C 4FX4A 4ESBA 4EJOA 3T1BA 3QP6A 3ULQB 1YW8A 5DEQA 1PDNC 1E17A 1P92A 5HLGA 2K4BA 4UVBA 5AIQA 1BI1A 5ICFA 3ZN0A 1R58A 4L9TA 3FMSA 2XASA 4PCQA 2ZMEB 2VC1A 3TGNA 5LHIA 4G8XA 2WTEA 2G9WA 5BPDA 2E1NA 1W7PA 2FQ3A 3HRTA 1HKTA 3RKWA 4OOIA 2FBHA 5FLXK 2KKOA 1IW7F 1Z7UA 5JVTA 1FOKA 1B4AA 2QWWA 4NQWA 2BV6A 3P7NA 4MEXF 4A0YA 2YX7A 4Q47A 5H6QA 4EJUA 4BHBA 4CHUA 2ISYA 3GWZA 1ZG1A 4R8HA 5HOOA 1J59A 1LDDA 2Z9OA 1DUXC 1XCBA 2CFXA 4HX7A 3W6KB 2ACJA 1K6OA 1BM9A 3HUGA 3KZYA 4UHTA 1FLIA 2DW4A 4XLNF 2RNJA 2FOKA 2A61A 2ZFWA 5A2QK 1T2KA 1RIOH 3RYPA 1O7FA 2O61A 2GXGA 2PFBA 4MEYF 2GA1A 1EH7A 3T8TA 2RDPA 1XD7A 2RGVA 4M6YA 1TQMA 4GCVA 3V7CA 3BY6A 5HS9A 3B02A 4EMSA 4KIFA 2K7LA 4U0WA 3HOSA 4EM2A 1PUEE 2R7FA 2CG4A 4R1HA 2D45A 2VBZA 4HV6A 4P5OA 5EEGA 4ZYGA 1YW9A 1ON1A 4JBAA 3R4KA 1TLHB 4L9JA 2PLYA 2QBYA 1WKMA 3ECOA 2P8TA 3IRQA 1MJBA 1WRJA 2MBFA 3CUQC 2QVOA 4EV0A 3V8KA 3N97A 2NNYA 3F72A 4UVAA 1U5TB 3Q9SA 1J2XA 1ZARA 3CLOA 3I64A 1L0OC 2HEOA 3WTUC 1IN5A 1QO0D 3K0LA 1S7OA 3JTGA 2V6CA 2HTJA 2DK5A 2A6HF 1R1VA 4IHTA 3R0AA 1P4AA 2CW0F 4A5NA 1FC3A 1HSTA 4P9FA 3E3VA 4I0BA 1BI2A 5DD4A 4KA4A 1MDMA 2O03A 3QP5A 3LAPA 1B9MA 4CYDA 1U6GA 3LQRA 1ZREA 4ZZDA 3COAC 2QUFA 3IWFA 3IC7A 4A5MA 4U0VA 3NQOA 3J80Z 2L01A 3FX3A 3C1DA 2P6TA 3IKVA 1IUYA 1KQ0A 1FNNA 3RYRA 4HF0A 1YTYA 2ZXJA 1SMYF 3GX4X 4HDUA 4ZH4F 5D5VB 3GVAA 1LVAA 2MC3A 5D4SA 5JFRA 4M9XA 4NHJA 3JAMK 3F6OA 2K27A 1ONVA 2XGXA 1H9GA 1R1TA 3GW2A 4AIJA 3V4GA 2FMYA 3JW4A 3QAHA 4M71A 4RGRA 4FHTA 3K9TA 1T0FA 2KIMA 3C3WA 3BDDA 3WG9A 2IVMA 1ZLKA 1SAXA 5LBQA 4U7DA 1XMKA 1GXPA 3CUQB 3DEUA 2PBIA 4I7HA 3TO7A 4RAZA 5E17F 4MGRA 4Q5SF 1TW2A 2O8XA 2K86A 1ZRFA 2Z3YA 3LSTA 2OD5A 1YS6A 5DCMA 1ZN2A 3V8LA 2QQ9A 2A69F 3KP4A 4QWQA 2HS5A 3F8NA 4YG2F 3T0YA 1YW7A 1IN4A 1R5GA 3ZMDA 3FF5A 2HKXA 2ELHA 3RI4A 3FXUA 5JR3A 1FYKA 2YX4A 1JHHA 2NRAC 4OIPF 3J7AO 5HDKA 1FYMA 2MLKA 4B09A 4XSZF 1YS7A 2X4HA 2WWYA 5LLQA 4RGSA 5F6FA 1IRFA 1YLFA 1O7LA 3KP3A 4G6QA 4HZFA 1ZLJA 1B6AA 4M72A 1IN8A 3U9GA 5L3EA 1ZRDA 2RC4A 3I59B 3TOAA 3DF8A 4XSXF 3CUQA 5FFXA 5TJJA 3ABTA 1FBQA 3HRSA 4CZZA 3JAMZ 4CO8A 4TV7A 1G4DA 2PMHA 2KJCA 1W5SA 4UV8A 4Y13A 1OYWA 2ZNYA 3HTSB 2O6GE 4LJZF 2VBXA 2NYXA 3J81Z 3RPQA 3GFLA 3ISPA 3ROUA 1KQ9A 5BS6A 2R7DA 3KFWX 1J75A 3MEXA 2ZMEC 3K1MA 2QQBA 3WGHA 1S6LA 4S05A 5F1RA 2LSOA 1OYYA 1MJ9A 1I1SA 4IHSA 2EK5A 2QM3A 4IJAA 3TOBA 3D0SA 2EFWA 1HW2A 2XRNA 5JI6A 4WXHA 5D5UB 4FX0A 2CGPA 4UUVA 1U78A 4L9NA 1X3UA 3BP8A 1XGOA 1G3TA 3WGIA 1XGNA 2B0LA 3LA7A 5IT9Z 2F5FA 3DQVC 1W7PB 5BMZA 2H6BA 5HDNA 3LQQA 1Z1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BAY A;  3FXQ A;  2L4M A;  1XDS A;  2JPC A;  2LDU A;  1ZHF A;  1L3L A;  2YSR A;  5L3F A;  1J7K A;  5H6R A;  1YQA A;  1XCV A;  1BN5 A;  3F3X A;  3M8E A;  1S8N A;  4HOB A;  4Y17 A;  3HRM A;  2PMU A;  1F5T A;  4ETS A;  2KJB A;  5K5O A;  1DDN A;  2EWN A;  3WE3 A;  1D3Y A;  4HF2 A;  4OIQ F;  2IA1 A;  3WTT C;  4YFX F;  2UXX A;  2FU4 A;  1D5V A;  2HKO A;  1RNL A;  2HFH A;  5L3C A;  2VE8 A;  4IXA A;  3LA2 A;  1TW3 A;  5E18 F;  3IRR A;  2J5P A;  2MH9 A;  1T38 A;  5CVV A;  3BWG A;  5A2Q Z;  1Z9C A;  3QRF F;  5D6E A;  1KYZ A;  3IKT A;  5E20 A;  4WK8 F;  3MWM A;  1XSV A;  3FWE A;  4OIN F;  4LB5 A;  3FMR A;  2CSO A;  1WI9 A;  4M74 A;  4U88 A;  1UCR A;  1O3Q A;  3R61 A;  3TDU C;  1IAW A;  3QOP A;  1FBS A;  1XDU A;  1XN7 A;  3EUH A;  4XRF A;  2KIF A;  5ICC A;  1RZ4 A;  1R00 A;  3WE2 A;  2PEX A;  1W5T A;  3P9K A;  1HKS A;  2PI0 A;  2DQL A;  4A2U A;  1IN7 A;  3DKW A;  1KYW A;  3J80 K;  1U2W A;  2ESN A;  4RGU A;  2CYY A;  2XAQ A;  1LDJ A;  4HX4 A;  4G9Y A;  1I27 A;  4M6X A;  2R3S A;  2TDX A;  2K4J A;  2F5E A;  4GYG A;  3WTW C;  2JT1 A;  4CGZ A;  1IXR C;  3W6J B;  2VOP A;  4IRH A;  5E8I A;  2A68 F;  2OBP A;  2P4W A;  2NAZ A;  1Z05 A;  2E1C A;  4MQ9 F;  1MKM A;  2HWV A;  4G94 A;  2VBW A;  2BYV E;  1OPC A;  5LGT A;  1FP2 A;  2HGC A;  2VXZ A;  4FT8 A;  4ASN A;  5J6X A;  1J0R A;  2AXL A;  4I01 A;  2FA5 A;  2H27 A;  1REP C;  1O3R A;  3ZMU A;  1U5T C;  4S04 A;  1LNW A;  5DD8 A;  1HSJ A;  3FMQ A;  1T98 A;  2XVC A;  3SHF A;  3VOE A;  2EJR A;  4KUM A;  4LGW A;  3F8C A;  3FM3 A;  5BPI A;  5FFZ A;  4IF4 A;  1BIB A;  1MGT A;  3EDP A;  1HW1 A;  4LFU A;  3F8M A;  3JTH A;  4L5J A;  4RB1 A;  1WQ2 A;  3KCC A;  2RN7 A;  3GEZ A;  5L3G A;  1IRG A;  2L02 A;  2D1H A;  4ZYD A;  1JE8 A;  5FGM A;  3K1N A;  4IPA A;  4PGG A;  3WU1 B;  2ISZ A;  3R6S A;  2E7W A;  1WSU A;  2W85 A;  3CDH A;  2VC0 A;  3F6V A;  2HOE A;  5K5R A;  3QPT A;  4BYY A;  1Z6R A;  4P9U A;  1TNT A;  4RAY A;  4HX8 A;  4IVN A;  3MZH A;  2CWE A;  1FZP B;  1HQC A;  2STT A;  4UNO A;  3BPX A;  2EV6 A;  4O5V A;  3BZ6 A;  4I2O A;  3F22 A;  3NEU A;  2EA4 A;  1OYI A;  5ED4 A;  3MQ0 A;  3QU6 A;  3GYH X;  2A3S A;  2IA0 A;  1R5H A;  1F4K A;  1OKR A;  2PG4 A;  4YIF A;  1U3E M;  5E1Z B;  2WC2 A;  5D8K B;  2IP2 A;  4EQQ A;  4U0Y A;  1JGS A;  1DP7 P;  4PDK A;  3DXJ F;  2H94 A;  2MLG A;  2ZBK A;  3R0J A;  1FX7 A;  1ZGA A;  5ILU A;  3TDZ C;  2EB7 A;  2W57 A;  1JXS A;  4ENM A;  2P5L C;  3O6B B;  5KK1 A;  4BH9 A;  5IT3 A;  3BOQ A;  3IL2 A;  1CF7 A;  1IF1 A;  1EH8 A;  1CGP A;  1XSX A;  1P4W A;  3R60 A;  3FXR A;  1T6S A;  2M45 A;  2FML A;  4MHG A;  1YYV A;  2GAU A;  5K5Q A;  2HYF A;  5K1Y A;  2UXN A;  5HVQ C;  4LG0 A;  3MAJ A;  4WXD A;  5LGU A;  2OZU A;  4I02 A;  3RTR A;  2LF8 A;  3JSO A;  1XSD A;  3SFZ A;  2DAO A;  4KYW A;  3L2C A;  2RKH A;  2FXA A;  2PQ8 A;  4GYI A;  3M7G A;  2JRT A;  4O3M A;  1QZZ A;  2F2E A;  5ERI A;  5LEJ A;  3P9C A;  3KET A;  1ZH5 A;  3J81 K;  1TTY A;  3RPU A;  2HQR A;  4EGZ A;  1K78 A;  1R23 A;  1ODD A;  2Q8K A;  4DNC A;  1F9N A;  2ESH A;  2XUB A;  3QU3 A;  3NRV A;  4Q4Z F;  3V7S A;  2MH2 A;  2FSW A;  4KDP A;  5L3B A;  4EJW A;  4AIH A;  3CO7 C;  2GZW A;  5JHU A;  4E70 A;  2DFI A;  1P6R A;  2BGC A;  4ZYH A;  1FSH A;  2ZO4 A;  2V1X A;  3PQK A;  2VBY A;  1G3S A;  4HDV A;  4HF1 A;  1MZB A;  4KN7 X;  3M8F A;  3ZP5 A;  2ZKZ A;  1H9T A;  3F8F A;  1XGM A;  2DTR A;  3B73 A;  4AIK A;  1KQ8 A;  1OR7 A;  1Q1H A;  2XAJ A;  1I5Z A;  3ABU A;  3MCZ A;  2OZ6 A;  1FYL A;  1OMI A;  1E2X A;  1O57 A;  3ZQ7 A;  3OOP A;  3E5Q A;  3VOD A;  4ENK A;  1NHA A;  2DI3 A;  1SD7 A;  2OA4 A;  2FE3 A;  5IT9 K;  3WGG A;  1B9N A;  4UXN A;  4WXC A;  1S7A A;  1TQI A;  2FEZ A;  1F1Z A;  4JK1 X;  4P96 A;  4L0Z B;  2KRF A;  2VT3 A;  4G7O F;  3WTV C;  4KMU X;  3ZPL A;  1KU7 A;  3I53 A;  3CTA A;  3P9I A;  3TO6 A;  1FP1 D;  3U1D A;  1IXC A;  2DO7 A;  2RVC A;  3E97 A;  1PP7 U;  4K2E A;  3C7J A;  5D8L B;  3E5U A;  1KGS A;  1QBJ A;  2GA2 A;  5DCF A;  4MTE A;  1BI3 A;  1GVJ A;  5L3D A;  2ZJ2 A;  2BE5 F;  2CO5 A;  1SD5 A;  2G7H A;  5D5W B;  4ESF A;  3HSE A;  1ZG3 A;  3LA3 A;  4XLP F;  5LHG A;  1SMT A;  2V1D A;  3DV8 A;  4BXU A;  3HSR A;  3DPL C;  1KU3 A;  4RS8 A;  3GZ6 A;  3E5X A;  3N4M A;  1LQ1 A;  1QPM A;  2A6E F;  6PAX A;  2GIV A;  4YII A;  3SZT A;  3K1P A;  3BRO A;  5BQT A;  4EJV A;  2XRO A;  2DBB A;  4RB3 C;  4MTD A;  2Y48 A;  4KT5 C;  2G7U A;  4XBF A;  3RIR A;  1IXS B;  3TKY A;  2HR3 A;  3ZMT A;  1FSE A;  2PJP A;  1QNT A;  5CLS A;  2MD5 A;  2DLL A;  1R22 A;  3REO A;  4IRG A;  2EFQ A;  5FD5 A;  1YO5 C;  2W84 A;  2XV4 S;  2XKP A;  1J9I A;  3I71 A;  2M1B A;  3KP2 A;  2PN6 A;  1Z6T A;  3DFG A;  3EQL F;  4M9Z A;  1I6X A;  2V1U A;  4HQM A;  1RUN A;  2OQR A;  2LF7 A;  4YFN F;  5D5X B;  1UB9 A;  3I0T A;  5ICG A;  1QGP A;  4PGH A;  5AIP A;  2EFP A;  4L0Y B;  2QYO A;  2IPQ X;  4CDG A;  3GZ5 A;  1P4X A;  2WV0 A;  2VON A;  1J5Y A;  1FPQ A;  1H0M A;  2GQQ A;  3HHG A;  2QEN A;  3WTY C;  2O0Y A;  1AOY A;  3MZY A;  3L09 A;  4ON0 A;  4G7Z F;  1AWC A;  2P5V A;  2V9V A;  5HLI A;  1K78 B;  5D4R A;  3BJO A;  1I1G A;  5BOX A;  2DQR A;  1ON2 A;  1G3W A;  2HTS A;  2O3F A;  2FNP A;  2XAH A;  5FB2 A;  2HQN A;  2P7C B;  1P2F A;  4CXF A;  2Z99 A;  2YPR A;  4BHC A;  4GO1 A;  1TQP A;  3RJP A;  4LLL A;  1R7J A;  3WU0 A;  2H09 A;  2VN2 A;  3G3Z A;  4ESJ A;  3KP6 A;  4KNY A;  2E7X A;  3H3Z A;  4LK0 F;  2QZ8 A;  3H92 A;  5LGN A;  4OU0 A;  1VTN C;  4WWC A;  4WX9 A;  2A07 F;  1UHW A;  2XHK A;  5CVU A;  4P55 A;  5DYM A;  3K2Z A;  2GXB A;  1MJA A;  2RV8 A;  3SQN A;  4MQV A;  1B59 A;  3KE2 A;  2ZME A;  4I0A A;  3KP5 A;  4KIG A;  2VE9 A;  1DPU A;  2IW5 A;  3EET A;  2HYG D;  5F64 A;  2EFO A;  4LB6 B;  1A04 A;  1S29 A;  1ZYR F;  3LWF A;  5HLH A;  3KZZ A;  2IJL A;  3L7W A;  3GO5 A;  2XKO A;  3BJA A;  1USS A;  4KN4 X;  3IHU A;  2DK8 A;  2X0L A;  4NB5 A;  2VT2 A;  1ZRC A;  3F23 A;  4LLN A;  4O6J A;  1SD6 A;  3I54 A;  1EH6 A;  2W24 A;  1FY7 A;  1U8R A;  1GHC A;  3CJN A;  1ZG5 A;  4IRI A;  2FBI A;  3V7R A;  3GUD A;  4H0E A;  1XB4 A;  2P7V B;  2JSC A;  3EYI A;  5HS7 A;  4RB0 A;  1TBX A;  3BPV A;  1BBY A;  1O3T A;  5DDG A;  2C6Y A;  1XMA A;  4AWX B;  4HW0 A;  2XAF A;  1SFE A;  1G3Y A;  3Q9V A;  2Q2E A;  4UVC A;  2F5D A;  1Y0U A;  3ECH A;  1BIA A;  1R1U A;  3OV8 A;  4ENN A;  2FRH A;  4WCG A;  1YIO A;  2M5W A;  4Q48 A;  4OIO F;  3FM5 A;  3BJ6 A;  1QZY A;  2UWM A;  2K02 A;  2RQP A;  4HAM A;  5CVI A;  2OQG A;  2A5Y B;  4L5I A;  1KU9 A;  1LDK B;  3G73 A;  3GFM A;  4OIR F;  1ZGJ A;  1ZAO A;  2OAZ A;  2L4A A;  5CYV A;  3HYI A;  2Z5U A;  4N9I A;  3GLX A;  2COM A;  2XAG A;  4D0P A;  3LAJ A;  2FF4 A;  2ZNZ A;  3I4P A;  1BJA A;  2P5K A;  1S3J A;  3E6C C;  3S2W A;  3E6M A;  3EYY A;  2IRF G;  3ZMV A;  5D6F A;  1Z91 A;  2QQA A;  1RI7 A;  3D5L A;  3VFZ A;  3L00 A;  3F21 A;  2IA2 A;  5DUK A;  3WOD F;  1U5T A;  3RKY A;  4KIC A;  3DPT A;  4EJT A;  1IN6 A;  4BNC A;  2V79 A;  2JPB A;  3KLN A;  4U7B A;  2HZT A;  2QBY B;  4A0Z A;  1IZ1 A;  1SFX A;  4QLC U;  4A6D A;  5FO5 A;  3T5X A;  2ETH A;  1V3F A;  2HDC A;  1V4R A;  4M9S A;  4BHP A;  3LFK A;  1PP8 F;  1LEA A;  5LEK A;  2M30 A;  4HV5 A;  3DP7 A;  2DPD A;  5DUI A;  1D8K A;  4ZYE A;  4R79 A;  3VEP A;  2EFN A;  1K7A A;  3ML6 A;  5LRR A;  4YFK F;  1MD0 A;  3ERE D;  5ILV A;  4OMY A;  1YG2 A;  2VOO A;  3ELK A;  3E6D A;  2LNB A;  4CIC A;  1HKQ A;  1KU2 A;  3I58 A;  4HQE A;  4L9V A;  5EEH A;  4EGY A;  3HHH A;  4AVP A;  1KA8 A;  1UST A;  2IT0 A;  1B1B A;  3GXO A;  3PQJ A;  4UV9 A;  3KP7 A;  3JSP A;  2D2W A;  4KIB A;  5CVR A;  2Z33 A;  4RGX A;  4RB2 C;  3I59 A;  4F7Z A;  5LHH A;  3HOT A;  5CJ9 A;  1JHF A;  4AD9 A;  3K69 A;  4B8X A;  2Q0O A;  1SFU A;  4HLY A;  1W7P D;  1FBU A;  4DQ2 A;  5E1W A;  1FT9 A;  3I5U A;  3HTU A;  2CQK A;  2MA3 A;  2JTV A;  3KLO A;  2FBK A;  4LMY A;  5H20 A;  3IWZ A;  2DT5 A;  2BBY A;  2J5O A;  4ENJ A;  1C0W A;  5HDG A;  4I09 A;  3ZMZ A;  1XGS A;  1D8J A;  3H3U A;  3HIF A;  2L54 A;  5ILS A;  2QLZ A;  5ICE A;  3GFI A;  5LRS A;  3M9A A;  5AON A;  4KFC A;  3GFJ A;  1HBX G;  2Y0M A;  2DPU A;  4Z2Y A;  2W25 A;  3VB2 A;  4G7H F;  5TRD A;  5FLX Z;  3T8R A;  1YFH A;  1HXD A;  1BI0 A;  5E1X A;  2EV5 A;  1RUO A;  2UZK A;  4WF2 A;  4HA8 A;  1UHM A;  2XIG A;  1LB2 A;  3FZV A;  2EV0 A;  2VOD A;  1W4M A;  2JZY A;  1G6N A;  5J8C A;  2ZCW A;  3TQN A;  1HW5 A;  2NNN A;  3WTX C;  4MNU A;  5KVR A;  3E6B A;  3MFK A;  1FWZ A;  2STW A;  4LG0 B;  1DPR A;  4HBL A;  2H6C A;  4A12 A;  2FNA A;  5HS8 A;  4HYE A;  3HRU A;  2D1V A;  4LLG F;  1WWX A;  4JQF A;  1EV7 A;  5DV5 A;  3ZN1 A;  1TNS A;  2F5C A;  1BOA A;  1GXQ A;  2LKP A;  4G6D A;  4BQA A;  1MDM B;  2EA2 A;  3O2P E;  4A0X A;  5J8F A;  1LEB A;  3SZP A;  4N0B A;  2YU3 A;  2GWR A;  2YR2 A;  3AAF A;  3V8J A;  3RKX A;  4EM0 B;  5FD6 A;  3KEO A;  3CUO A;  3M1E A;  2NS0 A;  1BC8 C;  3O3K A;  4EVI A;  3TO9 A;  4Y15 A;  1QQI A;  5CVJ A;  4LD5 A;  3WTZ A;  1STZ A;  3FHZ A;  3HSF A;  1O3S A;  2M87 A;  4L18 B;  3PFI A;  4GXO A;  1CF7 B;  3RDI A;  1SD4 A;  3C18 A;  4M73 A;  1UFM A;  2M8E A;  4OMZ A;  3Q5F A;  4EM1 A;  4N9H A;  1T39 A;  1K79 A;  3WTS C;  4PZJ A;  5E8G A;  3F8B A;  4HLX A;  1LJ9 A;  1R36 A;  4A6E A;  2Y75 A;  3GF2 A;  3ZMS A;  3L9F A;  2AS5 F;  3KEQ A;  3SXY A;  4I98 B;  1BC7 C;  4GGG A;  2KIU A;  2DU9 A;  2P6S A;  2ADU A;  4ZZL A;  2BEO A;  2L3D A;  4LK1 F;  3U2R A;  1ULY A;  4KMF A;  3QPH A;  5DCM B;  2OU2 A;  3CO6 C;  4FX4 A;  4ESB A;  4EJO A;  3T1B A;  3QP6 A;  3ULQ B;  1YW8 A;  5DEQ A;  1PDN C;  1E17 A;  1P92 A;  5HLG A;  2K4B A;  4UVB A;  5AIQ A;  1BI1 A;  5ICF A;  3ZN0 A;  1R58 A;  4L9T A;  3FMS A;  2XAS A;  4PCQ A;  2ZME B;  2VC1 A;  3TGN A;  5LHI A;  4G8X A;  2WTE A;  2G9W A;  5BPD A;  2E1N A;  1W7P A;  2FQ3 A;  3HRT A;  1HKT A;  3RKW A;  4OOI A;  2FBH A;  5FLX K;  2KKO A;  1IW7 F;  1Z7U A;  5JVT A;  1FOK A;  1B4A A;  2QWW A;  4NQW A;  2BV6 A;  3P7N A;  4MEX F;  4A0Y A;  2YX7 A;  4Q47 A;  5H6Q A;  4EJU A;  4BHB A;  4CHU A;  2ISY A;  3GWZ A;  1ZG1 A;  4R8H A;  5HOO A;  1J59 A;  1LDD A;  2Z9O A;  1DUX C;  1XCB A;  2CFX A;  4HX7 A;  3W6K B;  2ACJ A;  1K6O A;  1BM9 A;  3HUG A;  3KZY A;  4UHT A;  1FLI A;  2DW4 A;  4XLN F;  2RNJ A;  2FOK A;  2A61 A;  2ZFW A;  5A2Q K;  1T2K A;  1RIO H;  3RYP A;  1O7F A;  2O61 A;  2GXG A;  2PFB A;  4MEY F;  2GA1 A;  1EH7 A;  3T8T A;  2RDP A;  1XD7 A;  2RGV A;  4M6Y A;  1TQM A;  4GCV A;  3V7C A;  3BY6 A;  5HS9 A;  3B02 A;  4EMS A;  4KIF A;  2K7L A;  4U0W A;  3HOS A;  4EM2 A;  1PUE E;  2R7F A;  2CG4 A;  4R1H A;  2D45 A;  2VBZ A;  4HV6 A;  4P5O A;  5EEG A;  4ZYG A;  1YW9 A;  1ON1 A;  4JBA A;  3R4K A;  1TLH B;  4L9J A;  2PLY A;  2QBY A;  1WKM A;  3ECO A;  2P8T A;  3IRQ A;  1MJB A;  1WRJ A;  2MBF A;  3CUQ C;  2QVO A;  4EV0 A;  3V8K A;  3N97 A;  2NNY A;  3F72 A;  4UVA A;  1U5T B;  3Q9S A;  1J2X A;  1ZAR A;  3CLO A;  3I64 A;  1L0O C;  2HEO A;  3WTU C;  1IN5 A;  1QO0 D;  3K0L A;  1S7O A;  3JTG A;  2V6C A;  2HTJ A;  2DK5 A;  2A6H F;  1R1V A;  4IHT A;  3R0A A;  1P4A A;  2CW0 F;  4A5N A;  1FC3 A;  1HST A;  4P9F A;  3E3V A;  4I0B A;  1BI2 A;  5DD4 A;  4KA4 A;  1MDM A;  2O03 A;  3QP5 A;  3LAP A;  1B9M A;  4CYD A;  1U6G A;  3LQR A;  1ZRE A;  4ZZD A;  3COA C;  2QUF A;  3IWF A;  3IC7 A;  4A5M A;  4U0V A;  3NQO A;  3J80 Z;  2L01 A;  3FX3 A;  3C1D A;  2P6T A;  3IKV A;  1IUY A;  1KQ0 A;  1FNN A;  3RYR A;  4HF0 A;  1YTY A;  2ZXJ A;  1SMY F;  3GX4 X;  4HDU A;  4ZH4 F;  5D5V B;  3GVA A;  1LVA A;  2MC3 A;  5D4S A;  5JFR A;  4M9X A;  4NHJ A;  3JAM K;  3F6O A;  2K27 A;  1ONV A;  2XGX A;  1H9G A;  1R1T A;  3GW2 A;  4AIJ A;  3V4G A;  2FMY A;  3JW4 A;  3QAH A;  4M71 A;  4RGR A;  4FHT A;  3K9T A;  1T0F A;  2KIM A;  3C3W A;  3BDD A;  3WG9 A;  2IVM A;  1ZLK A;  1SAX A;  5LBQ A;  4U7D A;  1XMK A;  1GXP A;  3CUQ B;  3DEU A;  2PBI A;  4I7H A;  3TO7 A;  4RAZ A;  5E17 F;  4MGR A;  4Q5S F;  1TW2 A;  2O8X A;  2K86 A;  1ZRF A;  2Z3Y A;  3LST A;  2OD5 A;  1YS6 A;  5DCM A;  1ZN2 A;  3V8L A;  2QQ9 A;  2A69 F;  3KP4 A;  4QWQ A;  2HS5 A;  3F8N A;  4YG2 F;  3T0Y A;  1YW7 A;  1IN4 A;  1R5G A;  3ZMD A;  3FF5 A;  2HKX A;  2ELH A;  3RI4 A;  3FXU A;  5JR3 A;  1FYK A;  2YX4 A;  1JHH A;  2NRA C;  4OIP F;  3J7A O;  5HDK A;  1FYM A;  2MLK A;  4B09 A;  4XSZ F;  1YS7 A;  2X4H A;  2WWY A;  5LLQ A;  4RGS A;  5F6F A;  1IRF A;  1YLF A;  1O7L A;  3KP3 A;  4G6Q A;  4HZF A;  1ZLJ A;  1B6A A;  4M72 A;  1IN8 A;  3U9G A;  5L3E A;  1ZRD A;  2RC4 A;  3I59 B;  3TOA A;  3DF8 A;  4XSX F;  3CUQ A;  5FFX A;  5TJJ A;  3ABT A;  1FBQ A;  3HRS A;  4CZZ A;  3JAM Z;  4CO8 A;  4TV7 A;  1G4D A;  2PMH A;  2KJC A;  1W5S A;  4UV8 A;  4Y13 A;  1OYW A;  2ZNY A;  3HTS B;  2O6G E;  4LJZ F;  2VBX A;  2NYX A;  3J81 Z;  3RPQ A;  3GFL A;  3ISP A;  3ROU A;  1KQ9 A;  5BS6 A;  2R7D A;  3KFW X;  1J75 A;  3MEX A;  2ZME C;  3K1M A;  2QQB A;  3WGH A;  1S6L A;  4S05 A;  5F1R A;  2LSO A;  1OYY A;  1MJ9 A;  1I1S A;  4IHS A;  2EK5 A;  2QM3 A;  4IJA A;  3TOB A;  3D0S A;  2EFW A;  1HW2 A;  2XRN A;  5JI6 A;  4WXH A;  5D5U B;  4FX0 A;  2CGP A;  4UUV A;  1U78 A;  4L9N A;  1X3U A;  3BP8 A;  1XGO A;  1G3T A;  3WGI A;  1XGN A;  2B0L A;  3LA7 A;  5IT9 Z;  2F5F A;  3DQV C;  1W7P B;  5BMZ A;  2H6B A;  5HDN A;  3LQQ A;  1Z1D A; 
#chains in the Genus database with same CATH topology
 4BAY A;  3JRB A;  3FXQ A;  3CZ6 A;  2L4M A;  1XDS A;  2JPC A;  1S72 I;  2R7Q A;  2LDU A;  1ZHF A;  4X1E A;  1L3L A;  2YSR A;  5L3F A;  1J7K A;  3LSR A;  5H6R A;  1YQA A;  3ZQI A;  1XCV A;  2O9L A;  1BN5 A;  3F3X A;  3LMM A;  1T33 A;  3M8E A;  2ZSH B;  1S8N A;  4HOB A;  4Y17 A;  3HRM A;  2PMU A;  2LRD A;  3HZJ A;  1YHQ I;  5IY5 H;  1R4M B;  1F5T A;  4ETS A;  1FMW A;  2KJB A;  1IUF A;  1S9H A;  5K5O A;  1TZL A;  2XPU A;  1DDN A;  3FKJ A;  2R7W A;  2EWN A;  3AG3 H;  3F0C A;  2W1O A;  5E3M A;  3WE3 A;  2LMD A;  4E6K G;  1D3Y A;  4HF2 A;  4OIQ F;  2IA1 A;  3WTT C;  4YFX F;  3PJR A;  1QHH D;  2UXX A;  2FU4 A;  2LRE A;  1D5V A;  2ECC A;  2HKO A;  1RNL A;  1UG0 A;  2HFH A;  4BY7 J;  5L3C A;  1X1C A;  2VE8 A;  4IXA A;  3LA2 A;  1TW3 A;  1YOV B;  5E18 F;  4OAZ A;  3IRR A;  3TW7 A;  2J5P A;  4JX6 A;  3H9Q A;  2MH9 A;  3BTL A;  3D5S C;  3IP4 B;  4HNU A;  1T38 A;  1V5F A;  2XSJ C;  5CVV A;  2FJ1 A;  2Q1Z B;  5J4Y A;  3BWG A;  5A2Q Z;  1Z9C A;  1JJ6 C;  3QRF F;  5D6E A;  3HBL A;  1KYZ A;  2P0W A;  3MKY B;  2M7A A;  3IKT A;  5E20 A;  4WK8 F;  3MWM A;  1XSV A;  3FWE A;  2WY7 Q;  4OIN F;  4LB5 A;  2H1K A;  3BZK A;  3FMR A;  2H1L A;  2CSO A;  1WI9 A;  3GTQ J;  4M74 A;  1X2N A;  1Y1V J;  4U88 A;  3AKZ A;  1UCR A;  2K3F A;  2VB6 A;  2BZT A;  2JUG A;  3R61 A;  3TDU C;  1O3Q A;  1IAW A;  1Z0X A;  3QOP A;  4XID A;  1FBS A;  1XDU A;  4BDZ A;  1XN7 A;  4CCL A;  4UB8 C;  2DFE A;  3EUH A;  5J4V A;  4AID A;  1JKR C;  1E3H A;  1X4P A;  4IHX A;  3WHB A;  2DOA A;  2COB A;  3A1Y A;  4XRF A;  2KIF A;  5ICC A;  3JRA A;  2KP6 A;  1RZ4 A;  2HQA A;  1R00 A;  2HDW A;  3WE2 A;  2MAB A;  1UZC A;  2PEX A;  3BCA A;  3IUO A;  1V5G A;  1W5T A;  3P9K A;  1HKS A;  2PI0 A;  2DQL A;  3ZRG A;  5GPC A;  3LSK A;  1IN7 A;  3DKW A;  1KYW A;  4A2U A;  5F04 A;  2DTZ A;  1U2W A;  4W97 A;  2ESN A;  3J80 K;  4IX7 A;  3BZC A;  2M3A A;  4RGU A;  2CYY A;  2XAQ A;  1U9O A;  2VJ5 A;  1ZTR A;  3HGY A;  3OYL A;  1LDJ A;  4HX4 A;  2MG4 A;  4G9Y A;  2D5V A;  1I27 A;  4M6X A;  5B1A H;  4LOC A;  2R3S A;  2A6T A;  2TDX A;  1Z21 A;  2K4J A;  2F5E A;  4GYG A;  3WTW C;  2JT1 A;  3LOC A;  4CCJ A;  4CGZ A;  4FQG A;  2L2O A;  4A93 J;  1IXR C;  1OQY A;  3W6J B;  3BCB A;  2VOP A;  1HA8 A;  4IRH A;  2QSG X;  2DMQ A;  2A68 F;  2OBP A;  5E8I A;  4BQQ A;  1R9T J;  1LPQ A;  1LE8 A;  2TRT A;  2P4W A;  2NAZ A;  3L2U A;  1Z05 A;  2IS4 A;  2E1C A;  3OYN A;  2M4K A;  4MQ9 F;  1A36 A;  1MKM A;  1NTC A;  2HWV A;  2ICW G;  4NQW B;  2JA2 A;  3TL4 X;  4G94 A;  4DIQ A;  4DBQ A;  2XC7 A;  2VBW A;  3HM5 A;  4A3D J;  1U0J A;  2GBY A;  3BLY A;  2BYV E;  1ZK8 A;  2WAQ A;  1OPC A;  5LGT A;  1FP2 A;  2HGC A;  4IL6 C;  2VXZ A;  3GTK J;  4V19 K;  3BG6 A;  4FT8 A;  1DP3 A;  2CH0 A;  4ASN A;  5J6X A;  1J0R A;  3HPG A;  3UKG A;  2AHQ A;  4RAG A;  5EG0 A;  5J1Y A;  2AXL A;  4YEJ A;  1GV5 A;  4I01 A;  2FA5 A;  2H27 A;  2IBD A;  3UNG C;  2R5Z A;  5K7F A;  4RBO A;  3SYT A;  4DBR A;  1REP C;  2DA4 A;  3ZMU A;  1O3R A;  1U5T C;  4FIS A;  4S04 A;  1VQN I;  2DJI A;  1R5I D;  1JKQ C;  1LNW A;  5DD8 A;  1HSJ A;  3FMQ A;  1DGR M;  4NUB A;  4YEL A;  1MBF A;  1T98 A;  1YX5 A;  2XVC A;  3H5R A;  2X48 A;  5IYC J;  4KIT B;  2IXS A;  5E3L A;  3SHF A;  1X3W B;  1WZ2 A;  2B63 J;  3VOE A;  2EJR A;  4KUM A;  3F9K A;  2VPR A;  4LGW A;  3J7Z I;  3F8C A;  3FM3 A;  4ANJ A;  5BPI A;  4PK4 A;  5FFZ A;  4IF4 A;  1VQM I;  1E3P A;  1BIB A;  1MMG A;  1MGT A;  3EDP A;  1HW1 A;  3BTC A;  4LFU A;  1YRN B;  1RKT A;  4CUG A;  3F8M A;  3JTH A;  1D0Z A;  2K9L A;  3ZOB A;  3IAS 2;  4D7N A;  4X6A J;  2HZD A;  4L5J A;  2DXI A;  4E7J A;  4RB1 A;  1WQ2 A;  2MFZ A;  4RAF A;  2VQL A;  3KCC A;  2R5Y B;  2RN7 A;  3BQZ A;  3GEZ A;  2VQC A;  3LSP A;  3ZQL A;  5L3G A;  1IRG A;  2F6C A;  2KDO A;  1V55 H;  1XPX A;  3HG9 A;  2L02 A;  2D1H A;  4ZYD A;  4IO9 F;  1JE8 A;  3CCL I;  5FGM A;  4EEF G;  3K1N A;  4IPA A;  4PGG A;  2M0M A;  3WU1 B;  1X1B A;  1Y56 A;  2ISZ A;  1MMD A;  3R6S A;  1HDD C;  2E7W A;  1WSU A;  2W85 A;  3CDH A;  2MSY A;  2XPV A;  2VC0 A;  1XX5 A;  4XLH A;  2LTP A;  5E3O A;  3F6V A;  2CQX A;  2VLA A;  2HOE A;  4F52 A;  3S1Q J;  5K5R A;  1DQU A;  5FRO A;  2NS7 A;  4IZZ A;  1YJN I;  2M8G X;  3QPT A;  4BYY A;  2OJE D;  1Z6R A;  2MYS A;  4Y33 A;  1D1C A;  3LSG A;  1XMX A;  4P9U A;  1TNT A;  4RAY A;  2VKV A;  4HX8 A;  4IVN A;  3MZH A;  2CWE A;  2EQR A;  1HQC A;  4CYC A;  1FZP B;  2STT A;  4UNO A;  3BPX A;  1QZE A;  4LIV A;  1M1E B;  2R7U A;  2EV6 A;  4O5V A;  3BZ6 A;  1VQ6 I;  4I2O A;  3PNY A;  4FE7 A;  3F22 A;  3NEU A;  2EA4 A;  1UG2 A;  1OYI A;  2V4J C;  5M5W J;  5ED4 A;  4IOC F;  3MQ0 A;  4I76 A;  1IDZ A;  3QU6 A;  2LVS A;  3DTI A;  2X51 A;  3GYH X;  2A3S A;  3LSM A;  1YIT I;  2IA0 A;  1YJW I;  4ZYA A;  1R5H A;  5FKK A;  1F4K A;  4BEH A;  1OKR A;  1KZH A;  2PG4 A;  4YIF A;  1U3E M;  1I39 A;  5F08 A;  3VYR B;  1QVT A;  5E1Z B;  2WC2 A;  2CUZ A;  2DA5 A;  5D8K B;  2IP2 A;  2M9H A;  4DGW B;  3K4L A;  4EQQ A;  5EGO B;  4U0Y A;  1JGS A;  3L2V A;  4DJA A;  1T08 B;  3PL8 A;  1DP7 P;  4PDK A;  3DXJ F;  1U8B A;  1W0U A;  1MBG A;  3SDB A;  3A0B C;  2H94 A;  2MLG A;  2ZBK A;  4A3C J;  2FX0 A;  3R0J A;  1FX7 A;  2GLO A;  1ZGA A;  1JJ8 C;  3MD2 A;  2JA8 J;  2L9V A;  2ID3 A;  5ILU A;  2XF5 A;  3TDZ C;  2LG4 A;  3AG1 H;  2EB7 A;  1Y8Q B;  2W57 A;  1JXS A;  1B8I A;  4ENM A;  2P5L C;  3RCO A;  5GAD J;  5DM6 F;  2EBI A;  3O6B B;  5KK1 A;  1NK3 P;  3S32 A;  4BH9 A;  5IT3 A;  3BOQ A;  4C2T A;  3IL2 A;  2JWT A;  3G71 I;  1CF7 A;  1IF1 A;  1EH8 A;  1CGP A;  1XSX A;  2WAQ N;  1P4W A;  5FRN A;  3K4J A;  3R60 A;  2R5Y A;  3FXR A;  1T6S A;  2M45 A;  2GXA A;  2FML A;  2JA5 J;  4MHG A;  1YYV A;  4CSW A;  2GAU A;  2IS1 A;  1EKE A;  5K5Q A;  2HYF A;  4N4O B;  3HKZ A;  5K1Y A;  4CH7 A;  2UXN A;  5HVQ C;  4LG0 A;  2X9D A;  2VL8 A;  1ZR4 A;  2XF6 A;  3CMY A;  3MAJ A;  4E4H A;  5CQE A;  4WXD A;  5C4X J;  1H8A C;  5LGU A;  2OZU A;  4I02 A;  3RTR A;  2LF8 A;  5J3L A;  4ZDL A;  3JSO A;  2HYJ A;  1KON A;  3SFZ A;  3Q0U A;  1XSD A;  5J1U A;  1N78 A;  2DAO A;  3CCV I;  4KYW A;  1U9N A;  1LFU P;  4A3B J;  4M3B A;  5FKO A;  3L2C A;  2RKH A;  1YI2 I;  2FXA A;  2PQ8 A;  1JGG A;  4GYI A;  3OS1 A;  3SEZ A;  2X6X A;  4FET A;  3M7G A;  2JRT A;  4O3M A;  1QZZ A;  2HQ5 A;  2F2E A;  5ERI A;  5EF6 A;  5LEJ A;  3O8H A;  3P9C A;  1TP4 A;  1MSE C;  2PJR B;  2VIX A;  3PO3 J;  2BXY A;  4AYB N;  3KET A;  4E7H A;  3KZI C;  1IRZ A;  3H0D A;  1ZH5 A;  3J81 K;  4XON A;  2X1E A;  1TTY A;  4HST A;  3RPU A;  3ZCO A;  2NOJ B;  2HQR A;  4RM2 A;  1R4N B;  4EGZ A;  1K78 A;  1R23 A;  5EJC A;  1ODD A;  4NC7 A;  2Q8K A;  2DMN A;  3S1R J;  4IOA F;  4DNC A;  1F9N A;  5M3M J;  4CA0 A;  2EZL A;  4ZJZ A;  2ESH A;  2XUB A;  3QU3 A;  3NRV A;  1X19 A;  4Q4Z F;  3V7S A;  1VZ0 A;  4J01 A;  4YIR X;  2MH2 A;  2R7S A;  5IYB J;  2FSW A;  1SVM A;  2IAI A;  4KDP A;  1IV6 A;  3HC7 A;  5L3B A;  3H1C A;  2ZJQ F;  4M6V A;  3QPS A;  2NVX J;  1FEX A;  4EJW A;  4B4C A;  3BR1 A;  3DPU A;  4AIH A;  4D1Q A;  2KDZ A;  3CO7 C;  1MIJ A;  3OYC A;  3LNQ A;  2CQ7 A;  1QVU A;  1FIP A;  2GZW A;  3OS2 A;  5JHU A;  3PUF A;  4E70 A;  2W7N A;  2DFI A;  1P6R A;  2BGC A;  4ZYH A;  1FSH A;  4F91 B;  3C2B A;  2ZO4 A;  2V1X A;  3PQK A;  4XNF A;  2VBY A;  1G3S A;  3I56 I;  1QA6 A;  2E2J J;  4HDV A;  3CP2 A;  2R4G A;  4HF1 A;  1MZB A;  4KN7 X;  3M8F A;  3ZP5 A;  2ZKZ A;  1N75 A;  1H9T A;  3F8F A;  5HLT A;  1XGM A;  2DTR A;  1TT0 A;  3TP3 A;  1PUF B;  3B73 A;  5E3N A;  5EEA A;  4AIK A;  1KQ8 A;  1OR7 A;  1Q1H A;  2XAJ A;  1W5C C;  1I5Z A;  2ME6 A;  5LD2 C;  3ABU A;  3H5A A;  3MCZ A;  4OAY A;  5IPA A;  1SFO J;  1IV8 A;  2OZ6 A;  1OJL A;  1FYL A;  1OMI A;  1E2X A;  1O57 A;  3ZQ7 A;  3CME I;  3OOP A;  3E5Q A;  1RR8 C;  3GZN B;  2WAF A;  3IH3 A;  3K4C A;  3VOD A;  3A01 B;  1BR2 A;  3Q0W A;  1I6H J;  3DEE A;  5KNL A;  4ENK A;  1NHA A;  4AC0 A;  1YIJ I;  3IV5 A;  3K70 D;  2DI3 A;  1SD7 A;  2OA4 A;  2XAU A;  1ITY A;  2FE3 A;  5IT9 K;  3WGG A;  4CZC A;  1B9N A;  3S17 J;  2R7R A;  4UXN A;  4WXC A;  4E7L A;  3MZ8 A;  3NWT A;  1S7A A;  2M7B A;  3EUA A;  3DTK A;  4PSW A;  1TQI A;  3K2A A;  2FEZ A;  1F1Z A;  2F4O B;  3FXL A;  4JK1 X;  4P96 A;  4A3K J;  1WHU A;  4L0Z B;  2KRF A;  1P9Q C;  2VT3 A;  4G7O F;  3WTV C;  2PMZ N;  3B6A A;  1BOB A;  4KMU X;  3ZPL A;  3X2Q H;  1KU7 A;  3D5R C;  3I53 A;  3CTA A;  3K70 C;  1D1B A;  3SFI A;  3P9I A;  3TO6 A;  1FP1 D;  3U1D A;  1IXC A;  2DO7 A;  1FOX A;  2RVC A;  1R6R A;  3E97 A;  1PP7 U;  3DEW A;  4K2E A;  5GP9 A;  1JT6 A;  4B3X A;  2DMU A;  3C7J A;  5D8L B;  3E5U A;  1R49 A;  2KIQ A;  1KGS A;  4AU7 A;  4XIC A;  1QBJ A;  4M3G A;  5EYR A;  2GA2 A;  4DYR A;  2DCE A;  5DCF A;  4MTE A;  2KMU A;  1BI3 A;  1GVJ A;  1RKW A;  2EIL H;  4AUX A;  1WFX A;  1X3Z B;  2CV0 A;  5L3D A;  2ZJ2 A;  2BE5 F;  5B1B H;  2CO5 A;  3OYB A;  1SD5 A;  2Z1D A;  2G7H A;  2K85 A;  5D5W B;  4ESF A;  3HSE A;  1WI3 A;  2ZJR F;  5EZG A;  1ZG3 A;  1Y8R B;  3LA3 A;  4XLP F;  5LHG A;  1SMT A;  2XB0 X;  4HPQ A;  2V1D A;  3DV8 A;  2R7O A;  4BXU A;  3CCR I;  1Z7L A;  3HSR A;  3DPL C;  1KU3 A;  4PJJ A;  4RS8 A;  3GZ6 A;  4MIM A;  3E5X A;  2CW7 A;  1PYV A;  3N4M A;  3M07 A;  1LQ1 A;  4XRS G;  3JRI A;  1TT5 B;  2ZXW H;  1ETV A;  1QPM A;  2A6E F;  3E0J B;  3ERM A;  3H9J A;  6PAX A;  5CPR B;  5JHF A;  3CJT B;  2GIV A;  4YII A;  4C3I J;  3SZT A;  2JA6 J;  3K1P A;  3KIO A;  5CKT A;  4FCY A;  3BRO A;  3CQZ J;  5BQT A;  3K7A J;  4EJV A;  2XRO A;  5B5E C;  2DBB A;  4RB3 C;  2BW3 A;  2Y48 A;  4MTD A;  4KT5 C;  2G7U A;  4XBF A;  3RIR A;  3CES A;  4PJM A;  1OFC X;  4C3J J;  1IXS B;  1ETY A;  3PUB A;  3L2Q A;  5KCM A;  4BQN A;  3TKY A;  2HR3 A;  3ZMT A;  1FSE A;  2Y0S N;  1ETX A;  2W4S A;  2PJP A;  1QNT A;  1Z67 A;  5CLS A;  3NWS A;  2MD5 A;  2DLL A;  1R22 A;  3REO A;  5M3F J;  3BTI A;  4HRI A;  2BVM A;  1JUP A;  4IRG A;  2EFQ A;  2L9S A;  5FD5 A;  1YO5 C;  2W84 A;  2XV4 S;  3GTP J;  2E1M C;  2XKP A;  1J9I A;  2F48 A;  2KHM A;  3FBI B;  3I71 A;  2M1B A;  3KP2 A;  2DT7 B;  1Z6T A;  2PN6 A;  3EQL F;  3DFG A;  4M9Z A;  1I6X A;  4E7K A;  2I5U A;  2V1U A;  4HQM A;  2ZJP F;  3CF5 F;  1RUN A;  2R7X A;  2OQR A;  2LF7 A;  4YFN F;  5FLV A;  5D5X B;  1UB9 A;  3I0T A;  5ICG A;  2BVL A;  1QGP A;  1ERD A;  1WPK A;  2OC6 A;  1TL8 A;  1MH4 A;  3BC8 A;  4PGH A;  5AIP A;  5GTH C;  2I8D A;  4C9Y A;  2EFP A;  4L0Y B;  2ECB A;  2ELJ A;  2M0C A;  4BXF A;  4F93 B;  2QYO A;  2LFB A;  3MN2 A;  4IHV A;  2E5N A;  3H3V K;  2IPQ X;  2BW3 B;  4CDG A;  1FOW A;  3K6G A;  2W00 A;  3GZ5 A;  1P4X A;  2WV0 A;  2VON A;  4B3A A;  1K83 J;  1J5Y A;  1FPQ A;  3CJQ B;  1H0M A;  2GQQ A;  3EPZ A;  3HUG B;  5EZH A;  3HHG A;  2QEN A;  4Y3O A;  2Q2E B;  2VJ4 A;  3WTY C;  1D5Y A;  3ASO H;  2OTJ I;  2O0Y A;  3GME A;  4HG2 A;  3N05 A;  2IEK A;  1AOY A;  4AYB A;  3MZY A;  3L09 A;  4JX5 A;  2CUF A;  3S1M J;  4ON0 A;  4G7Z F;  1AWC A;  3S2D J;  2P5V A;  2VKD A;  4BL0 B;  2V9V A;  5HLI A;  1K78 B;  4ZTF A;  4G6T B;  1LKX A;  5D4R A;  3W3C A;  3BJO A;  3QPL A;  3S3O A;  1I1G A;  5BOX A;  2DQR A;  2E60 A;  1ON2 A;  1G3W A;  2HTS A;  2O3F A;  1GUU A;  4U87 A;  2R5Z B;  2FNP A;  2XAH A;  2F4I A;  2Z2S B;  1I3Q J;  5FB2 A;  2HQN A;  1K4T A;  4BJ6 C;  2P7C B;  1P2F A;  3H0G J;  4CXF A;  3G2B A;  2Z99 A;  4A3L J;  2YPR A;  4BHC A;  2E34 A;  4GO1 A;  3OYI A;  1LE8 B;  2MGQ A;  1TQP A;  5B66 C;  5C44 J;  1FOY A;  3ESW B;  2JUC A;  3RJP A;  4LLL A;  3S8P A;  4XLC A;  1R7J A;  2IGO A;  3WU0 A;  2H09 A;  3OYJ A;  2VN2 A;  3G3Z A;  1F36 A;  3KP6 A;  4ESJ A;  4UUS B;  3I55 I;  4KNY A;  2E7X A;  2WAD A;  3BR0 A;  3H3Z A;  4IQ4 A;  4LK0 F;  1APL C;  2QZ8 A;  3PO2 J;  1WJC A;  2DMP A;  1IC8 A;  3H92 A;  5LGN A;  3KYD B;  5GTI C;  4OU0 A;  4II3 A;  2PMZ A;  1VTN C;  4WWC A;  4WX9 A;  2A07 F;  3BR2 A;  1UHW A;  4PJL A;  3VYU B;  2XHK A;  4HEA 2;  5CVU A;  3AL0 B;  4P55 A;  5DYM A;  3K2Z A;  3DBH B;  2GXB A;  1MJA A;  2RV8 A;  3SQN A;  4MQV A;  1B59 A;  3JRF A;  3KE2 A;  2ZME A;  4I0A A;  3KP5 A;  4KIG A;  4DZP A;  2VE9 A;  4MFD A;  5JVG F;  4BJT A;  4A3E J;  1B72 B;  1DPU A;  2IW5 A;  3EET A;  2HYG D;  5F64 A;  2EFO A;  4LB6 B;  1A04 A;  1S29 A;  2JQ7 A;  4KT6 A;  2NVY J;  3S2H J;  9ANT A;  1ZYR F;  1Z77 A;  4GRI A;  3W2V A;  3LWF A;  1VFC A;  2MD0 A;  1RPW A;  5HLH A;  2XRL A;  3KZZ A;  1HC8 A;  1SVL A;  2IJL A;  3L7W A;  4JYK A;  5JLX A;  2ZSI B;  3GO5 A;  2XKO A;  1HOM A;  3BJA A;  4BKX A;  1USS A;  3FXK A;  3IHU A;  3M8J A;  4KN4 X;  2DK8 A;  2X0L A;  3CDL A;  4NB5 A;  4V2F A;  2VT2 A;  3QYE A;  3F23 A;  1ZRC A;  4LLN A;  4O6J A;  2ZB9 A;  4FAS D;  2V9K A;  1SD6 A;  4DYC A;  3I54 A;  1TWF J;  1EH6 A;  2O5R A;  2W24 A;  2EIJ H;  4XK4 A;  1FY7 A;  3OYD A;  3OSG A;  1U8R A;  5EGO A;  1GHC A;  3CJN A;  1ZG5 A;  1DU0 A;  4IRI A;  2FBI A;  3V7R A;  2JSP A;  2K5C A;  3GUD A;  4H0E A;  1XB4 A;  2P7V B;  5KAF C;  1TWC J;  2JSC A;  3EYI A;  5HS7 A;  2HNH A;  4RB0 A;  1TBX A;  3BPV A;  2VUM J;  1DGW Y;  2ZXI A;  1ENH A;  3LSI A;  1BBY A;  1O3T A;  5DDG A;  2C6Y A;  1XMA A;  2MW8 A;  4AWX B;  4HW0 A;  3A0H C;  2XAF A;  1SFE A;  3DBL B;  2LK2 A;  2NVT J;  1G3Y A;  3Q9V A;  3H35 A;  3HL2 A;  2Q2E A;  4XLF A;  4UVC A;  4CCN A;  2F5D A;  2WA0 A;  1Y0U A;  2HXI A;  3ECH A;  1BIA A;  1R1U A;  3OV8 A;  1YE9 A;  4ENN A;  2FRH A;  4WCG A;  1YIO A;  3OYH A;  2M5W A;  2LY2 A;  4Q48 A;  4JP0 A;  3FM5 A;  3BJ6 A;  3PFY A;  1QZY A;  4OIO F;  2UWM A;  1E3O C;  1T8I A;  2K02 A;  1OCC H;  3K4M A;  4ZC3 A;  1A6Q A;  2E36 A;  2RQP A;  4HAM A;  5CVI A;  3CCJ I;  2KZG A;  2OQG A;  2A5Y B;  2EZH A;  4L5I A;  1XTA A;  1KU9 A;  3PNV A;  1LDK B;  1X1P A;  4ZTJ A;  3G73 A;  1JUM A;  3GFM A;  1IDY A;  4OIR F;  2LBF B;  2QF7 A;  1ZGJ A;  1J09 A;  3GCM A;  2JVH A;  2K9S A;  1ZAO A;  5GAE J;  1FJL A;  2HOA A;  2OAZ A;  2L4A A;  2FUG 2;  2VQG A;  5CYV A;  3HYI A;  2K9M A;  3ZQQ A;  2Z5U A;  2XDV A;  3OR2 C;  3QQA A;  3TBI A;  4N9I A;  4HNT A;  3GLX A;  3U21 A;  2COM A;  3Q0V A;  3S3N A;  3HOW J;  5J1R A;  2M4G A;  1UJ8 A;  2XAG A;  3DLA A;  3BG5 A;  1NG6 A;  1EF4 A;  4D0P A;  1LFP A;  2IGN A;  3LAJ A;  2FF4 A;  1W36 C;  2ZNZ A;  3I4P A;  1BJA A;  2P5K A;  1S3J A;  5B3S H;  3E6C C;  3S2W A;  3E6M A;  3EYY A;  4LIT A;  2VQH A;  1A31 A;  1I3A A;  2IRF G;  1A5J A;  4E7I A;  3ZMV A;  5D6F A;  1Z91 A;  2QQA A;  2XF7 A;  1HLV A;  3W2A A;  2QKM B;  1RI7 A;  3D5L A;  3VFZ A;  4PSX A;  1SAU A;  3GTG J;  1ZQ3 P;  3LSH A;  2R0Q C;  1MMN A;  3L00 A;  4Z6Y A;  3F21 A;  2IA2 A;  5DUK A;  3WOD F;  2DOE A;  1NH3 A;  1U5T A;  2L9N A;  1Y0N A;  3RKY A;  1PVE A;  1WJA A;  2XB5 A;  4KIC A;  3DPT A;  1H89 C;  1B8I B;  4QIW N;  4EJT A;  1QU3 A;  1IN6 A;  4BNC A;  2V79 A;  4UUT A;  2JPB A;  3KLN A;  4B43 A;  2HZT A;  4U7B A;  2QBY B;  2FD5 A;  1IZ1 A;  2H8W A;  4A0Z A;  5HNF A;  3OS0 A;  1SFX A;  4RLF A;  4QLC U;  4A6D A;  1ETO A;  5TGT A;  3PNT A;  5FO5 A;  3CC2 I;  3KPH A;  3K4K A;  3WG7 H;  4DW6 A;  1OCT C;  3T5X A;  3D1N I;  2ETH A;  1V3F A;  3MKZ A;  2HDC A;  4XR6 A;  1V4R A;  4M9S A;  2OUM A;  4BHP A;  3LFK A;  1PP8 F;  1LEA A;  5LEK A;  2FOW A;  3NAR A;  2LKS A;  2M30 A;  4HV5 A;  3S3M A;  3DP7 A;  3HOY J;  1MBJ A;  4B47 A;  4A3G J;  2Y2Z A;  2DPD A;  3LL7 A;  1MW7 A;  2KT0 A;  2RAE A;  3P5J A;  4IHY A;  4A3M J;  4C30 A;  5HOD A;  3JRC A;  5DUI A;  3OY9 A;  2IS6 A;  1T56 A;  2XGD A;  1D8K A;  4ZYE A;  4NDL A;  4R79 A;  3VEP A;  2BY0 A;  2LBF A;  2EFN A;  2VKE A;  1K7A A;  2HPM A;  4XOR A;  3ML6 A;  3FBN B;  2K9N A;  5EG0 B;  4QSH A;  5LRR A;  2M2E A;  4BUP A;  4YFK F;  2HVS A;  1MD0 A;  3GTL J;  3ERE D;  2DA7 A;  5ILV A;  2ZC2 A;  2OPT A;  4OMY A;  1YG2 A;  2VOO A;  1CQT A;  1SAN A;  3ELK A;  1N25 A;  3E6D A;  4QTR A;  2QGU A;  5GPA A;  3BR3 A;  2LNB A;  5IP9 J;  1BW6 A;  4CIC A;  1HKQ A;  2KRH A;  2CV2 A;  1KU2 A;  3I58 A;  2A05 A;  4YRV A;  1XG1 A;  4HQE A;  4L9V A;  5EEH A;  4BQO A;  4EGY A;  3HHH A;  2XSD C;  4I99 C;  2GOM A;  3A4C A;  5FKN A;  4AVP A;  3JRD A;  1KA8 A;  1UST A;  2IT0 A;  1HCR A;  1B1B A;  1Z3Y A;  2JN6 A;  3GXO A;  3PQJ A;  4UV9 A;  3KP7 A;  4Y4R A;  3JSP A;  2O7O A;  3O8G A;  2D2W A;  4KIB A;  5CVR A;  2HDD A;  1EA3 A;  2Z33 A;  4AM3 A;  2DDA A;  3PM1 A;  3OIO A;  2Y0S A;  4RGX A;  2YU9 J;  4RB2 C;  1K4S A;  1D1A A;  2BOL A;  3QYF A;  3ZQC A;  3I59 A;  4F7Z A;  5LHH A;  3HPH A;  2DA2 A;  2GIZ A;  1V5E A;  1YRN A;  3HOT A;  2Z16 A;  5CJ9 A;  1WJ5 A;  1JHF A;  2KLO A;  4AD9 A;  3K69 A;  4B8X A;  2CV1 A;  3ASN H;  3EUH C;  5GAH J;  2Q0O A;  2DJN A;  4HLY A;  1W7P D;  1SFU A;  1FBU A;  4XRM A;  5H2F C;  2HXO A;  4DQ2 A;  3ZR8 X;  5E1W A;  1FT9 A;  2ID6 A;  3IH4 A;  3I5U A;  2CS3 A;  5KHD A;  3HTU A;  2CQK A;  2MA3 A;  2JTV A;  3KLO A;  1G8X A;  1AKH B;  2FBK A;  4LMY A;  5H20 A;  1AHD P;  4BXX J;  2VKH A;  3KEY A;  2K40 A;  3IWZ A;  3OYG A;  1X1D A;  2DT5 A;  3VWB A;  2BBY A;  2J5O A;  4ENJ A;  1ETW A;  2L5Q A;  1C0W A;  2E1M B;  1AKH A;  2F5V A;  5HDG A;  4I09 A;  3ZMZ A;  1XGS A;  1D8J A;  3H3U A;  3HIF A;  2L54 A;  5ILS A;  3I4N J;  2QLZ A;  5ICE A;  3GFI A;  4IHW A;  5LRS A;  2LC2 A;  3PIO F;  1S5L C;  3HOV J;  2E71 A;  3M9A A;  5AON A;  3K4N A;  4KFC A;  3GFJ A;  2QSF X;  2WBM A;  3CMA I;  2Y0M A;  1HBX G;  2DPU A;  1W1W E;  4XLE A;  4Z2Y A;  2W25 A;  2N8G A;  4A69 C;  1V54 H;  4D5C A;  3H36 A;  2EIN H;  5DS9 A;  3VB2 A;  3A2K A;  2W48 A;  3RKQ A;  4G7H F;  2E2H J;  5TRD A;  3OOU A;  2DN0 A;  3JRE A;  2QA4 I;  1D0Y A;  5FLX Z;  3T8R A;  1YFH A;  1IGN A;  1HXD A;  1MND A;  1BI0 A;  2Y31 A;  2WB1 A;  5E1X A;  4X0G A;  2EV5 A;  1RUO A;  2UZK A;  3C2G A;  4WF2 A;  4HA8 A;  1UHM A;  2XIG A;  1LB2 A;  3DU6 A;  2WAE A;  2WB1 N;  3FZV A;  2HOS A;  4Y7N J;  2EV0 A;  2VOD A;  1W4M A;  2OF7 A;  1N77 A;  2QSH X;  3JRG A;  2R93 J;  1OCO H;  1JKO C;  2JZY A;  1G6N A;  5J8C A;  2ZCW A;  1UHS A;  3TQN A;  2YS9 A;  2EPF A;  4M3E A;  1HW5 A;  2NNN A;  3WTX C;  3HGG A;  2OCE A;  4MNU A;  3Q3S A;  4J00 A;  2LKX A;  5KVR A;  3E6B A;  4XLA A;  3MFK A;  1IO2 A;  1FWZ A;  2STW A;  4LG0 B;  4BBS J;  1DPR A;  4M3D A;  4HBL A;  2RRE A;  2YUS A;  4UB6 C;  4CCO A;  1BR4 A;  2H6C A;  4BJ5 C;  4A12 A;  2FNA A;  2V6E A;  2LYC A;  5HS8 A;  1FMV A;  2LY9 A;  4HYE A;  4XOP A;  3HRU A;  1MBH A;  2D1V A;  3M4O J;  5IP7 J;  3VYS B;  4LLG F;  2R7T A;  1WWX A;  5F0C A;  4JQF A;  3HOU J;  1ZEL A;  1EV7 A;  2K9Q A;  3FDY A;  2CQQ A;  5DV5 A;  3OL4 A;  1O4X A;  3ZN1 A;  1VF9 A;  1TNS A;  2F5C A;  1I50 J;  1BOA A;  1GXQ A;  2FQ4 A;  4RM3 A;  2LKP A;  3W2W A;  4G6D A;  4GDF A;  4XM3 A;  3VPR A;  3JR9 A;  2CUE A;  3M3Y J;  3OYA A;  5LFA A;  4PJN A;  3DCF A;  3BT9 A;  3AG4 H;  4BQA A;  1MDM B;  2EA2 A;  3O2P E;  4A0X A;  5J8F A;  3CCM I;  5BNG A;  1LEB A;  4QPQ A;  3SZP A;  4N0B A;  2YU3 A;  2GWR A;  2YR2 A;  3ZQH A;  3KYL A;  3AAF A;  2HVQ A;  3V8J A;  3IH2 A;  3RKX A;  4EM0 B;  2IGK A;  4RMN A;  5FD6 A;  3HKZ N;  3KEO A;  3QYB A;  4II2 A;  3CUO A;  3M1E A;  2DA3 A;  2NS0 A;  1JUS A;  1BC8 C;  4Y52 J;  1QRY A;  3CD6 I;  3O3K A;  3BQY A;  4EVI A;  4OWR B;  4A3I J;  3CP8 A;  3TO9 A;  1Y6I A;  4Y15 A;  1LFB A;  4D5F A;  1QQI A;  2Y9Z A;  5CVJ A;  2EZK A;  4LD5 A;  3WTZ A;  1STZ A;  1SEU A;  2XGC A;  2LH9 A;  3FHZ A;  3HSF A;  2LP0 A;  2VJI A;  2M87 A;  4ABZ A;  1O3S A;  3PFI A;  4L18 B;  4GXO A;  2I10 A;  1CF7 B;  3RDI A;  3DKY A;  1SD4 A;  3C18 A;  1W36 D;  5K7Z A;  4M73 A;  2CMP A;  3H9G A;  1UFM A;  2M8E A;  3WU2 C;  4OMZ A;  3Q5F A;  4EM1 A;  4N9H A;  3QOE A;  1MBE A;  1T39 A;  1K6Y A;  3MVP A;  3DTE A;  4N4N B;  3QWL A;  1UEL B;  1SFK A;  1K79 A;  3WTS C;  5M5X J;  3GTO J;  3ZQG A;  3S1N J;  1VQ5 I;  3G1L A;  4PZJ A;  5E8G A;  4PJ0 C;  5F1J A;  3F8B A;  4NNJ A;  1JT0 A;  4BE2 A;  2L7K A;  4HLX A;  1LJ9 A;  1R36 A;  3BR5 A;  2IGM A;  4A6E A;  2V7F A;  2Y75 A;  3GF2 A;  3ZMS A;  4J19 A;  3L9F A;  2AS5 F;  3KEQ A;  3SXY A;  1P7I A;  4I98 B;  1VQ4 I;  2BHY A;  4GGG A;  2KIU A;  1BC7 C;  2DU9 A;  3FKI J;  4RA2 A;  4QPO A;  2P6S A;  2ADU A;  4ZZL A;  5IOY A;  1G2H A;  2BEO A;  2L3D A;  1TWA J;  4LK1 F;  3U2R A;  2RNG A;  1RR7 A;  1ULY A;  4KMF A;  2BXZ A;  4KJZ A;  3CCY A;  3OIP A;  2LLK A;  3QPH A;  5DCM B;  3OYM A;  1MMS A;  1UMQ A;  2OU2 A;  3CO6 C;  4FX4 A;  1VQO I;  1E0E A;  4ESB A;  1SVO A;  4EJO A;  1VQK I;  3ONQ A;  3T1B A;  2R7Z J;  2VXD A;  3QP6 A;  3ULQ B;  1UAA A;  2BY3 A;  1YW8 A;  3VSL A;  2A5W A;  5DEQ A;  4D9J A;  1WH7 A;  1PDN C;  1E17 A;  1P92 A;  5HLG A;  3RZO J;  2K4B A;  4UVB A;  5AIQ A;  1BI1 A;  5ICF A;  1S7E A;  2L7M P;  3ZN0 A;  3MMY B;  1R58 A;  1A35 A;  4L9T A;  2KFD A;  2HI3 A;  3G6E I;  3FMS A;  2XAS A;  2E5Z A;  4PCQ A;  2GM4 A;  2ZME B;  4JOM A;  3CMM A;  2VC1 A;  3TGN A;  3KX2 A;  3OYK A;  5LHI A;  5EDN A;  4G8X A;  2WTE A;  2G9W A;  4E7Z A;  5BPD A;  3HOZ J;  3E7L A;  1TWG J;  1BJZ A;  2E1N A;  4NC8 A;  1W7P A;  2FQ3 A;  4HNV A;  2G0E A;  1Y39 A;  3HRT A;  1OCP A;  1HKT A;  4E7S A;  3RKW A;  4LIU A;  4OOI A;  2QEX I;  1A6I A;  3VSK A;  2FBH A;  2EH3 A;  3HOX J;  5FLX K;  5J40 A;  4CCM A;  2KKO A;  1IW7 F;  1Z7U A;  1PJR A;  2UV1 A;  1YJ9 I;  3OSF A;  1HF0 A;  5JVT A;  1FOK A;  1OR7 C;  5FJ8 J;  1B4A A;  4H4K C;  1K61 A;  2QWW A;  4NQW A;  1VND A;  2BV6 A;  1VQP I;  2DOD A;  3P7N A;  5C3E J;  4MEX F;  4A0Y A;  2X6O A;  1H88 C;  2YX7 A;  4Q47 A;  2HU9 A;  2VPL A;  2B7E A;  5H6Q A;  4EJU A;  4BHB A;  3ABK H;  4CHU A;  2ISY A;  3GWZ A;  3GTJ J;  1EJ9 A;  1ZG1 A;  4R8H A;  2F4M B;  2B9S A;  2L9R A;  2PX9 A;  5HOO A;  4IQJ A;  2NVU B;  1J59 A;  1P7J A;  1LDD A;  2CFO A;  2Z9O A;  1OCZ H;  1DUX C;  2TCT A;  4PFO A;  4S0H B;  1XCB A;  2CFX A;  3AL0 C;  4HX7 A;  1RC9 A;  3LFU A;  5IP6 A;  1AU7 A;  3TED A;  3G1M A;  2DFF A;  3W6K B;  4PUS A;  2ACJ A;  1K6O A;  1BM9 A;  3HUG A;  3KZY A;  4UHT A;  2V1N A;  4XKV A;  1FLI A;  2DW4 A;  4IEJ A;  1JTX A;  4XLN F;  2RNJ A;  2FOK A;  2A61 A;  2ZFW A;  3S14 J;  5A2Q K;  2JRM A;  1T2K A;  1R71 A;  2L7F P;  3GBG A;  1VQ9 I;  3I3L A;  1RIO H;  1TWH J;  3NAU A;  3RYP A;  1O7F A;  2O61 A;  2DT6 A;  4MO7 A;  2GXG A;  2PFB A;  1WVR A;  4MEY F;  1JI8 A;  2GA1 A;  1EH7 A;  3A03 A;  3T8T A;  2KRC A;  2VI6 A;  1PUF A;  2RDP A;  2KPM A;  3OL3 A;  5HNH A;  1ORK A;  1XD7 A;  3B6C A;  4EAT A;  2RGV A;  4M6Y A;  2NVQ J;  4C3H J;  3FIS A;  1TQM A;  1FTZ A;  3AG2 H;  2AO9 A;  4GCV A;  2Y30 A;  3V7C A;  3FK7 A;  3BY6 A;  1MBK A;  5HS9 A;  5IYD J;  3K10 A;  3RQI A;  4CCK A;  2WY8 Q;  2AXT C;  1MNM C;  3B02 A;  4EMS A;  4KIF A;  2K7L A;  4U0W A;  3HOS A;  4EM2 A;  1PUE E;  2R7F A;  4B48 A;  2QKL B;  3L2R A;  2CG4 A;  4R1H A;  2D45 A;  1GLN A;  2L0K A;  3FHN A;  2PJR A;  2VBZ A;  4HV6 A;  3IAM 2;  4XOT A;  4NC6 A;  4P5O A;  5EEG A;  4ZYG A;  1YW9 A;  1ON1 A;  1DU6 A;  2H8R A;  4JBA A;  3OYE A;  3R4K A;  1TLH B;  1WGX A;  4L9J A;  2IS2 A;  1LVK A;  2PLY A;  2QBY A;  2ZFU A;  1WKM A;  3ECO A;  2CW8 A;  4IKF A;  5FRM A;  1GVD A;  4RDU A;  2P8T A;  3IRQ A;  1MJB A;  1WRJ A;  2MBF A;  1GDT A;  5JLW A;  3SEQ A;  3CUQ C;  3BR6 A;  5K7H A;  2QVO A;  4EV0 A;  2ZXH A;  1RRJ A;  1WJB A;  3V8K A;  2KL4 A;  3N97 A;  2NNY A;  3F72 A;  4UVA A;  1NG7 A;  4DZJ A;  1U5T B;  3I4M J;  3Q9S A;  1J2X A;  1ZAR A;  3CLO A;  4HSR A;  4V2G A;  1SC7 A;  3I64 A;  3V42 A;  1L0O C;  2CQN A;  2DA1 A;  3WTU C;  2HEO A;  3WHC A;  1IN5 A;  4A3J J;  3PSF A;  1QO0 D;  3K0L A;  2ELK A;  3BG7 A;  1VQ7 I;  1S7O A;  3GTM J;  3JTG A;  2V6C A;  2HTJ A;  1BR1 A;  2A6H F;  2DK5 A;  4CYC B;  1R1V A;  3FXO A;  4IHT A;  2HPI A;  3R0A A;  1P4A A;  1WCM J;  2CW0 F;  3AFH A;  3ZGK A;  4A5N A;  1FC3 A;  1HST A;  4P9F A;  3E3V A;  3U1K A;  4I0B A;  1BI2 A;  2P81 A;  1LUJ B;  1VI0 A;  5DD4 A;  4KA4 A;  1GT0 C;  2X6W A;  2CRG A;  1MDM A;  1T95 A;  2CJJ A;  1X2M A;  2O03 A;  3QP5 A;  3LAP A;  4BY1 J;  1X1A A;  1B9M A;  3JRH A;  1POG A;  4CYD A;  3S15 J;  1U6G A;  3LQR A;  1ZRE A;  2O8K A;  3HJE A;  4ZZD A;  3GLL A;  3COA C;  3HXL A;  1ACI A;  2QUF A;  3IWF A;  3IC7 A;  4A5M A;  4U0V A;  3OWT A;  4XN0 A;  3NQO A;  1MNE A;  3DBR B;  2VJJ A;  2DYR H;  3E1S A;  3J80 Z;  2L01 A;  3FX3 A;  3C1D A;  2P6T A;  4BE0 A;  3ZXS A;  1WJD A;  3IKV A;  1IUY A;  4BEH B;  4DYQ A;  4G12 A;  1BA5 A;  1KQ0 A;  1FNN A;  4FTH A;  2X1C A;  4RLQ A;  2W82 A;  2KZV A;  2XPW A;  3RYR A;  4HF0 A;  4F3Q A;  3MKW B;  4W1U A;  1YTY A;  2ZXJ A;  1SMY F;  3GX4 X;  4HDU A;  1X58 A;  1GV2 A;  3DWL E;  4ZH4 F;  2VAS A;  5DTD A;  4F92 B;  5D5V B;  3ABM H;  5FLM J;  3GVA A;  1OCR H;  2E1O A;  1LVA A;  4MFE A;  2KIS A;  4XKC A;  3G4S I;  2MC3 A;  5D4S A;  2QCO A;  1MMA A;  2OTL I;  1ETQ A;  1Z3X A;  2OV7 A;  1ETK A;  5JFR A;  4C2U A;  1BW5 A;  3W6V A;  4M9X A;  4NHJ A;  3JAM K;  2RQQ A;  3F6O A;  2R7V A;  4BBR J;  2K27 A;  1ONV A;  1Q1V A;  2XGX A;  1H9G A;  1R1T A;  1YX3 A;  3GW2 A;  4I6Z A;  4AIJ A;  3V4G A;  3FXJ A;  2CU7 A;  2FMY A;  3JW4 A;  3QAH A;  3PSI A;  1QPI A;  4M71 A;  2OCC H;  4ITV A;  2V26 A;  5DM7 F;  3I9V 2;  4FE4 A;  4RGR A;  3CDI A;  3CCE I;  2R92 J;  3TMO A;  4FHT A;  4PFP A;  3K9T A;  1T0F A;  2KIM A;  3C3W A;  3BDD A;  3WG9 A;  1FIA A;  3FIW A;  3J7A Y;  2NS8 A;  2IVM A;  1ZLK A;  2DA6 A;  1SAX A;  2DMT A;  5LBQ A;  4U7D A;  1HDP A;  1XMK A;  1GXP A;  2EIM H;  1MH3 A;  1NK2 P;  3CUQ B;  3DEU A;  3H5N A;  2PBI A;  2JVG A;  3FXM A;  4L5E A;  2LOO A;  4I7H A;  1VQL I;  2HOT A;  3TW6 A;  3OYF A;  3OMY A;  3TO7 A;  4RAZ A;  5E17 F;  2E19 A;  4MGR A;  4Q5S F;  5J47 A;  1TW2 A;  4XRS A;  2DDB A;  2O8X A;  2K86 A;  3L1P A;  1ZRF A;  5F0H A;  2Z3Y A;  1WH5 A;  3HEF A;  4BAC A;  3LST A;  1XC5 A;  5TIS C;  2OD5 A;  5FKM A;  3LSJ A;  1YS6 A;  5DCM A;  1ZN2 A;  3UR3 C;  3V8L A;  3A01 A;  4C2M J;  2QQ9 A;  2A69 F;  1OIS A;  3KP4 A;  3M1C A;  3OR1 C;  4QWQ A;  2LD5 A;  2HS5 A;  3F8N A;  2JK3 A;  4XL9 A;  4MLO A;  3CJR B;  3L2W A;  4YG2 F;  3DKX A;  3T0Y A;  1YW7 A;  2L7Z A;  3RQ4 A;  3BG3 A;  4JX4 A;  2E35 A;  2QQ8 A;  3KYC B;  1VQ8 I;  1JTY A;  3S93 A;  2DOF A;  1IN4 A;  1R5G A;  3ZMD A;  2X6Y A;  3K4B A;  5CQG A;  1ZGW A;  2M34 A;  3FF5 A;  1WJF A;  3CF2 A;  2HKX A;  2AQF A;  3CCS I;  2ELH A;  3RI4 A;  4M3F A;  3FXU A;  5JR3 A;  1FYK A;  1F43 A;  2YX4 A;  2X85 A;  3PIP F;  1JHH A;  2NRA C;  4OIP F;  3J7A O;  5HDK A;  1FYM A;  2MLK A;  4ZDP A;  4B09 A;  4D7M A;  5E79 C;  2GOX B;  4XSZ F;  1YS7 A;  2X4H A;  4A3F J;  3FK6 A;  2WWY A;  2MC4 A;  5LLQ A;  4NBQ A;  4RGS A;  5F6F A;  1IRF A;  3TP0 A;  4LG3 A;  1YLF A;  1O7L A;  3KP3 A;  1RES A;  4G6Q A;  2EIK H;  3MKL A;  4HZF A;  4DOZ A;  2JA7 J;  1ZLJ A;  3C2H A;  3SJM A;  1B6A A;  2LR8 A;  4BGD A;  4M72 A;  1IN8 A;  3U9G A;  5L3E A;  1ZRD A;  3RPU D;  2RC4 A;  1TC3 C;  1RET A;  1IG7 A;  3I59 B;  5F27 A;  3TOA A;  1IJW C;  3DF8 A;  5F0F A;  4XSX F;  3CUQ A;  2JMW A;  5FFX A;  1B72 A;  5TJJ A;  1D0X A;  3ABT A;  2ME0 A;  2Y9Y A;  3A02 A;  4KIS A;  1FBQ A;  3HRS A;  4XKW A;  1OLT A;  2XGE A;  3CC7 I;  1FTT A;  3S16 J;  4CZZ A;  3HDD A;  3RSN A;  5C4J J;  3JAM Z;  2NOG A;  4CO8 A;  4P1W A;  2BY1 A;  2HVR A;  4TV7 A;  3OIQ A;  1G4D A;  2V9P A;  3QOD A;  4XQF A;  5GAG J;  1Y1W J;  4XKB A;  2PMH A;  1ZKG A;  2KJC A;  1W5S A;  4UV8 A;  4Y13 A;  4UUS A;  1OYW A;  3HB9 A;  2ZNY A;  3HTS B;  1W0T A;  2JJ7 A;  2O6G E;  4LJZ F;  3DLL F;  2VBX A;  2NYX A;  2LY1 A;  2NXN B;  3J81 Z;  1X4O A;  1WJE A;  3RPQ A;  1ZR2 A;  4F55 A;  3GFL A;  2KQR A;  3ISP A;  1XS9 A;  4BS9 A;  3ROU A;  1AA7 A;  1KQ9 A;  1G59 A;  5BS6 A;  2R7D A;  2UUZ A;  3DU5 A;  3KFW X;  3G1O A;  1J75 A;  3MEX A;  2ZME C;  4BU2 A;  3ABL H;  2EZI A;  2X1D A;  3K1M A;  2QQB A;  2CUJ A;  3WGH A;  1S6L A;  2BHZ A;  2DYS H;  3VDX A;  4S05 A;  3SDG A;  4ZDO A;  5F1R A;  3ZQF A;  2K3P A;  2LSO A;  1OYY A;  3BTJ A;  1MJ9 A;  5FKL A;  3RZD J;  1I1S A;  4IHS A;  1T0F C;  2EK5 A;  2QM3 A;  4IJA A;  3TOB A;  3D0S A;  1QHG A;  2EFW A;  1HW2 A;  2WV1 A;  1JKP C;  2XRN A;  5JI6 A;  4WXH A;  5IOZ A;  5D5U B;  4FX0 A;  4XN3 A;  2CGP A;  4UUV A;  1U78 A;  3CLQ A;  4L9N A;  1X3U A;  3BP8 A;  4B1R A;  1IRX A;  5KAI C;  1XGO A;  4XMY A;  2Y69 H;  1G3T A;  3WGI A;  4GFB A;  1XGN A;  1BL0 A;  4B44 A;  4UY8 I;  2B0L A;  2E2I J;  4AVZ A;  2AQE A;  3LA7 A;  3JCU C;  5M5Y J;  1MSF C;  5IT9 Z;  2F5F A;  3DQV C;  3CCU I;  3BG9 A;  3VYT B;  3SZG A;  2BY2 A;  4BE1 A;  1W7P B;  3CCQ I;  5BMZ A;  2H6B A;  3EUK L;  5HDN A;  3J7Y J;  4BDY A;  2DFH A;  3LQQ A;  1Z1D A;  3CC4 I; 
#chains in the Genus database with same CATH homology
 4BAY A;  3FXQ A;  2L4M A;  1XDS A;  2JPC A;  2LDU A;  1ZHF A;  1L3L A;  2YSR A;  5L3F A;  1J7K A;  5H6R A;  1YQA A;  1XCV A;  1BN5 A;  3F3X A;  3M8E A;  1S8N A;  4HOB A;  4Y17 A;  3HRM A;  2PMU A;  1F5T A;  4ETS A;  2KJB A;  5K5O A;  1DDN A;  2EWN A;  3WE3 A;  1D3Y A;  4HF2 A;  4OIQ F;  2IA1 A;  3WTT C;  4YFX F;  2UXX A;  2FU4 A;  1D5V A;  2HKO A;  1RNL A;  2HFH A;  5L3C A;  2VE8 A;  4IXA A;  3LA2 A;  1TW3 A;  5E18 F;  3IRR A;  2J5P A;  2MH9 A;  1T38 A;  5CVV A;  3BWG A;  5A2Q Z;  1Z9C A;  3QRF F;  5D6E A;  1KYZ A;  3IKT A;  5E20 A;  4WK8 F;  3MWM A;  1XSV A;  3FWE A;  4OIN F;  4LB5 A;  3FMR A;  2CSO A;  1WI9 A;  4M74 A;  4U88 A;  1UCR A;  1O3Q A;  3R61 A;  3TDU C;  1IAW A;  3QOP A;  1FBS A;  1XDU A;  1XN7 A;  3EUH A;  4XRF A;  2KIF A;  5ICC A;  1RZ4 A;  1R00 A;  3WE2 A;  2PEX A;  1W5T A;  3P9K A;  1HKS A;  2PI0 A;  2DQL A;  4A2U A;  1IN7 A;  3DKW A;  1KYW A;  3J80 K;  1U2W A;  2ESN A;  4RGU A;  2CYY A;  2XAQ A;  1LDJ A;  4HX4 A;  4G9Y A;  1I27 A;  4M6X A;  2R3S A;  2TDX A;  2K4J A;  2F5E A;  4GYG A;  3WTW C;  2JT1 A;  4CGZ A;  1IXR C;  3W6J B;  2VOP A;  4IRH A;  5E8I A;  2A68 F;  2OBP A;  2P4W A;  2NAZ A;  1Z05 A;  2E1C A;  4MQ9 F;  1MKM A;  2HWV A;  4G94 A;  2VBW A;  2BYV E;  1OPC A;  5LGT A;  1FP2 A;  2HGC A;  2VXZ A;  4FT8 A;  4ASN A;  5J6X A;  1J0R A;  2AXL A;  4I01 A;  2FA5 A;  2H27 A;  1REP C;  1O3R A;  3ZMU A;  1U5T C;  4S04 A;  1LNW A;  5DD8 A;  1HSJ A;  3FMQ A;  1T98 A;  2XVC A;  3SHF A;  3VOE A;  2EJR A;  4KUM A;  4LGW A;  3F8C A;  3FM3 A;  5BPI A;  5FFZ A;  4IF4 A;  1BIB A;  1MGT A;  3EDP A;  1HW1 A;  4LFU A;  3F8M A;  3JTH A;  4L5J A;  4RB1 A;  1WQ2 A;  3KCC A;  2RN7 A;  3GEZ A;  5L3G A;  1IRG A;  2L02 A;  2D1H A;  4ZYD A;  1JE8 A;  5FGM A;  3K1N A;  4IPA A;  4PGG A;  3WU1 B;  2ISZ A;  3R6S A;  2E7W A;  1WSU A;  2W85 A;  3CDH A;  2VC0 A;  3F6V A;  2HOE A;  5K5R A;  3QPT A;  4BYY A;  1Z6R A;  4P9U A;  1TNT A;  4RAY A;  4HX8 A;  4IVN A;  3MZH A;  2CWE A;  1FZP B;  1HQC A;  2STT A;  4UNO A;  3BPX A;  2EV6 A;  4O5V A;  3BZ6 A;  4I2O A;  3F22 A;  3NEU A;  2EA4 A;  1OYI A;  5ED4 A;  3MQ0 A;  3QU6 A;  3GYH X;  2A3S A;  2IA0 A;  1R5H A;  1F4K A;  1OKR A;  2PG4 A;  4YIF A;  1U3E M;  5E1Z B;  2WC2 A;  5D8K B;  2IP2 A;  4EQQ A;  4U0Y A;  1JGS A;  1DP7 P;  4PDK A;  3DXJ F;  2H94 A;  2MLG A;  2ZBK A;  3R0J A;  1FX7 A;  1ZGA A;  5ILU A;  3TDZ C;  2EB7 A;  2W57 A;  1JXS A;  4ENM A;  2P5L C;  3O6B B;  5KK1 A;  4BH9 A;  5IT3 A;  3BOQ A;  3IL2 A;  1CF7 A;  1IF1 A;  1EH8 A;  1CGP A;  1XSX A;  1P4W A;  3R60 A;  3FXR A;  1T6S A;  2M45 A;  2FML A;  4MHG A;  1YYV A;  2GAU A;  5K5Q A;  2HYF A;  5K1Y A;  2UXN A;  5HVQ C;  4LG0 A;  3MAJ A;  4WXD A;  5LGU A;  2OZU A;  4I02 A;  3RTR A;  2LF8 A;  3JSO A;  1XSD A;  3SFZ A;  2DAO A;  4KYW A;  3L2C A;  2RKH A;  2FXA A;  2PQ8 A;  4GYI A;  3M7G A;  2JRT A;  4O3M A;  1QZZ A;  2F2E A;  5ERI A;  5LEJ A;  3P9C A;  3KET A;  1ZH5 A;  3J81 K;  1TTY A;  3RPU A;  2HQR A;  4EGZ A;  1K78 A;  1R23 A;  1ODD A;  2Q8K A;  4DNC A;  1F9N A;  2ESH A;  2XUB A;  3QU3 A;  3NRV A;  4Q4Z F;  3V7S A;  2MH2 A;  2FSW A;  4KDP A;  5L3B A;  4EJW A;  4AIH A;  3CO7 C;  2GZW A;  5JHU A;  4E70 A;  2DFI A;  1P6R A;  2BGC A;  4ZYH A;  1FSH A;  2ZO4 A;  2V1X A;  3PQK A;  2VBY A;  1G3S A;  4HDV A;  4HF1 A;  1MZB A;  4KN7 X;  3M8F A;  3ZP5 A;  2ZKZ A;  1H9T A;  3F8F A;  1XGM A;  2DTR A;  3B73 A;  4AIK A;  1KQ8 A;  1OR7 A;  1Q1H A;  2XAJ A;  1I5Z A;  3ABU A;  3MCZ A;  2OZ6 A;  1FYL A;  1OMI A;  1E2X A;  1O57 A;  3ZQ7 A;  3OOP A;  3E5Q A;  3VOD A;  4ENK A;  1NHA A;  2DI3 A;  1SD7 A;  2OA4 A;  2FE3 A;  5IT9 K;  3WGG A;  1B9N A;  4UXN A;  4WXC A;  1S7A A;  1TQI A;  2FEZ A;  1F1Z A;  4JK1 X;  4P96 A;  4L0Z B;  2KRF A;  2VT3 A;  4G7O F;  3WTV C;  4KMU X;  3ZPL A;  1KU7 A;  3I53 A;  3CTA A;  3P9I A;  3TO6 A;  1FP1 D;  3U1D A;  1IXC A;  2DO7 A;  2RVC A;  3E97 A;  1PP7 U;  4K2E A;  3C7J A;  5D8L B;  3E5U A;  1KGS A;  1QBJ A;  2GA2 A;  5DCF A;  4MTE A;  1BI3 A;  1GVJ A;  5L3D A;  2ZJ2 A;  2BE5 F;  2CO5 A;  1SD5 A;  2G7H A;  5D5W B;  4ESF A;  3HSE A;  1ZG3 A;  3LA3 A;  4XLP F;  5LHG A;  1SMT A;  2V1D A;  3DV8 A;  4BXU A;  3HSR A;  3DPL C;  1KU3 A;  4RS8 A;  3GZ6 A;  3E5X A;  3N4M A;  1LQ1 A;  1QPM A;  2A6E F;  6PAX A;  2GIV A;  4YII A;  3SZT A;  3K1P A;  3BRO A;  5BQT A;  4EJV A;  2XRO A;  2DBB A;  4RB3 C;  4MTD A;  2Y48 A;  4KT5 C;  2G7U A;  4XBF A;  3RIR A;  1IXS B;  3TKY A;  2HR3 A;  3ZMT A;  1FSE A;  2PJP A;  1QNT A;  5CLS A;  2MD5 A;  2DLL A;  1R22 A;  3REO A;  4IRG A;  2EFQ A;  5FD5 A;  1YO5 C;  2W84 A;  2XV4 S;  2XKP A;  1J9I A;  3I71 A;  2M1B A;  3KP2 A;  2PN6 A;  1Z6T A;  3DFG A;  3EQL F;  4M9Z A;  1I6X A;  2V1U A;  4HQM A;  1RUN A;  2OQR A;  2LF7 A;  4YFN F;  5D5X B;  1UB9 A;  3I0T A;  5ICG A;  1QGP A;  4PGH A;  5AIP A;  2EFP A;  4L0Y B;  2QYO A;  2IPQ X;  4CDG A;  3GZ5 A;  1P4X A;  2WV0 A;  2VON A;  1J5Y A;  1FPQ A;  1H0M A;  2GQQ A;  3HHG A;  2QEN A;  3WTY C;  2O0Y A;  1AOY A;  3MZY A;  3L09 A;  4ON0 A;  4G7Z F;  1AWC A;  2P5V A;  2V9V A;  5HLI A;  1K78 B;  5D4R A;  3BJO A;  1I1G A;  5BOX A;  2DQR A;  1ON2 A;  1G3W A;  2HTS A;  2O3F A;  2FNP A;  2XAH A;  5FB2 A;  2HQN A;  2P7C B;  1P2F A;  4CXF A;  2Z99 A;  2YPR A;  4BHC A;  4GO1 A;  1TQP A;  3RJP A;  4LLL A;  1R7J A;  3WU0 A;  2H09 A;  2VN2 A;  3G3Z A;  4ESJ A;  3KP6 A;  4KNY A;  2E7X A;  3H3Z A;  4LK0 F;  2QZ8 A;  3H92 A;  5LGN A;  4OU0 A;  1VTN C;  4WWC A;  4WX9 A;  2A07 F;  1UHW A;  2XHK A;  5CVU A;  4P55 A;  5DYM A;  3K2Z A;  2GXB A;  1MJA A;  2RV8 A;  3SQN A;  4MQV A;  1B59 A;  3KE2 A;  2ZME A;  4I0A A;  3KP5 A;  4KIG A;  2VE9 A;  1DPU A;  2IW5 A;  3EET A;  2HYG D;  5F64 A;  2EFO A;  4LB6 B;  1A04 A;  1S29 A;  1ZYR F;  3LWF A;  5HLH A;  3KZZ A;  2IJL A;  3L7W A;  3GO5 A;  2XKO A;  3BJA A;  1USS A;  4KN4 X;  3IHU A;  2DK8 A;  2X0L A;  4NB5 A;  2VT2 A;  1ZRC A;  3F23 A;  4LLN A;  4O6J A;  1SD6 A;  3I54 A;  1EH6 A;  2W24 A;  1FY7 A;  1U8R A;  1GHC A;  3CJN A;  1ZG5 A;  4IRI A;  2FBI A;  3V7R A;  3GUD A;  4H0E A;  1XB4 A;  2P7V B;  2JSC A;  3EYI A;  5HS7 A;  4RB0 A;  1TBX A;  3BPV A;  1BBY A;  1O3T A;  5DDG A;  2C6Y A;  1XMA A;  4AWX B;  4HW0 A;  2XAF A;  1SFE A;  1G3Y A;  3Q9V A;  2Q2E A;  4UVC A;  2F5D A;  1Y0U A;  3ECH A;  1BIA A;  1R1U A;  3OV8 A;  4ENN A;  2FRH A;  4WCG A;  1YIO A;  2M5W A;  4Q48 A;  4OIO F;  3FM5 A;  3BJ6 A;  1QZY A;  2UWM A;  2K02 A;  2RQP A;  4HAM A;  5CVI A;  2OQG A;  2A5Y B;  4L5I A;  1KU9 A;  1LDK B;  3G73 A;  3GFM A;  4OIR F;  1ZGJ A;  1ZAO A;  2OAZ A;  2L4A A;  5CYV A;  3HYI A;  2Z5U A;  4N9I A;  3GLX A;  2COM A;  2XAG A;  4D0P A;  3LAJ A;  2FF4 A;  2ZNZ A;  3I4P A;  1BJA A;  2P5K A;  1S3J A;  3E6C C;  3S2W A;  3E6M A;  3EYY A;  2IRF G;  3ZMV A;  5D6F A;  1Z91 A;  2QQA A;  1RI7 A;  3D5L A;  3VFZ A;  3L00 A;  3F21 A;  2IA2 A;  5DUK A;  3WOD F;  1U5T A;  3RKY A;  4KIC A;  3DPT A;  4EJT A;  1IN6 A;  4BNC A;  2V79 A;  2JPB A;  3KLN A;  4U7B A;  2HZT A;  2QBY B;  4A0Z A;  1IZ1 A;  1SFX A;  4QLC U;  4A6D A;  5FO5 A;  3T5X A;  2ETH A;  1V3F A;  2HDC A;  1V4R A;  4M9S A;  4BHP A;  3LFK A;  1PP8 F;  1LEA A;  5LEK A;  2M30 A;  4HV5 A;  3DP7 A;  2DPD A;  5DUI A;  1D8K A;  4ZYE A;  4R79 A;  3VEP A;  2EFN A;  1K7A A;  3ML6 A;  5LRR A;  4YFK F;  1MD0 A;  3ERE D;  5ILV A;  4OMY A;  1YG2 A;  2VOO A;  3ELK A;  3E6D A;  2LNB A;  4CIC A;  1HKQ A;  1KU2 A;  3I58 A;  4HQE A;  4L9V A;  5EEH A;  4EGY A;  3HHH A;  4AVP A;  1KA8 A;  1UST A;  2IT0 A;  1B1B A;  3GXO A;  3PQJ A;  4UV9 A;  3KP7 A;  3JSP A;  2D2W A;  4KIB A;  5CVR A;  2Z33 A;  4RGX A;  4RB2 C;  3I59 A;  4F7Z A;  5LHH A;  3HOT A;  5CJ9 A;  1JHF A;  4AD9 A;  3K69 A;  4B8X A;  2Q0O A;  1SFU A;  4HLY A;  1W7P D;  1FBU A;  4DQ2 A;  5E1W A;  1FT9 A;  3I5U A;  3HTU A;  2CQK A;  2MA3 A;  2JTV A;  3KLO A;  2FBK A;  4LMY A;  5H20 A;  3IWZ A;  2DT5 A;  2BBY A;  2J5O A;  4ENJ A;  1C0W A;  5HDG A;  4I09 A;  3ZMZ A;  1XGS A;  1D8J A;  3H3U A;  3HIF A;  2L54 A;  5ILS A;  2QLZ A;  5ICE A;  3GFI A;  5LRS A;  3M9A A;  5AON A;  4KFC A;  3GFJ A;  1HBX G;  2Y0M A;  2DPU A;  4Z2Y A;  2W25 A;  3VB2 A;  4G7H F;  5TRD A;  5FLX Z;  3T8R A;  1YFH A;  1HXD A;  1BI0 A;  5E1X A;  2EV5 A;  1RUO A;  2UZK A;  4WF2 A;  4HA8 A;  1UHM A;  2XIG A;  1LB2 A;  3FZV A;  2EV0 A;  2VOD A;  1W4M A;  2JZY A;  1G6N A;  5J8C A;  2ZCW A;  3TQN A;  1HW5 A;  2NNN A;  3WTX C;  4MNU A;  5KVR A;  3E6B A;  3MFK A;  1FWZ A;  2STW A;  4LG0 B;  1DPR A;  4HBL A;  2H6C A;  4A12 A;  2FNA A;  5HS8 A;  4HYE A;  3HRU A;  2D1V A;  4LLG F;  1WWX A;  4JQF A;  1EV7 A;  5DV5 A;  3ZN1 A;  1TNS A;  2F5C A;  1BOA A;  1GXQ A;  2LKP A;  4G6D A;  4BQA A;  1MDM B;  2EA2 A;  3O2P E;  4A0X A;  5J8F A;  1LEB A;  3SZP A;  4N0B A;  2YU3 A;  2GWR A;  2YR2 A;  3AAF A;  3V8J A;  3RKX A;  4EM0 B;  5FD6 A;  3KEO A;  3CUO A;  3M1E A;  2NS0 A;  1BC8 C;  3O3K A;  4EVI A;  3TO9 A;  4Y15 A;  1QQI A;  5CVJ A;  4LD5 A;  3WTZ A;  1STZ A;  3FHZ A;  3HSF A;  1O3S A;  2M87 A;  4L18 B;  3PFI A;  4GXO A;  1CF7 B;  3RDI A;  1SD4 A;  3C18 A;  4M73 A;  1UFM A;  2M8E A;  4OMZ A;  3Q5F A;  4EM1 A;  4N9H A;  1T39 A;  1K79 A;  3WTS C;  4PZJ A;  5E8G A;  3F8B A;  4HLX A;  1LJ9 A;  1R36 A;  4A6E A;  2Y75 A;  3GF2 A;  3ZMS A;  3L9F A;  2AS5 F;  3KEQ A;  3SXY A;  4I98 B;  1BC7 C;  4GGG A;  2KIU A;  2DU9 A;  2P6S A;  2ADU A;  4ZZL A;  2BEO A;  2L3D A;  4LK1 F;  3U2R A;  1ULY A;  4KMF A;  3QPH A;  5DCM B;  2OU2 A;  3CO6 C;  4FX4 A;  4ESB A;  4EJO A;  3T1B A;  3QP6 A;  3ULQ B;  1YW8 A;  5DEQ A;  1PDN C;  1E17 A;  1P92 A;  5HLG A;  2K4B A;  4UVB A;  5AIQ A;  1BI1 A;  5ICF A;  3ZN0 A;  1R58 A;  4L9T A;  3FMS A;  2XAS A;  4PCQ A;  2ZME B;  2VC1 A;  3TGN A;  5LHI A;  4G8X A;  2WTE A;  2G9W A;  5BPD A;  2E1N A;  1W7P A;  2FQ3 A;  3HRT A;  1HKT A;  3RKW A;  4OOI A;  2FBH A;  5FLX K;  2KKO A;  1IW7 F;  1Z7U A;  5JVT A;  1FOK A;  1B4A A;  2QWW A;  4NQW A;  2BV6 A;  3P7N A;  4MEX F;  4A0Y A;  2YX7 A;  4Q47 A;  5H6Q A;  4EJU A;  4BHB A;  4CHU A;  2ISY A;  3GWZ A;  1ZG1 A;  4R8H A;  5HOO A;  1J59 A;  1LDD A;  2Z9O A;  1DUX C;  1XCB A;  2CFX A;  4HX7 A;  3W6K B;  2ACJ A;  1K6O A;  1BM9 A;  3HUG A;  3KZY A;  4UHT A;  1FLI A;  2DW4 A;  4XLN F;  2RNJ A;  2FOK A;  2A61 A;  2ZFW A;  5A2Q K;  1T2K A;  1RIO H;  3RYP A;  1O7F A;  2O61 A;  2GXG A;  2PFB A;  4MEY F;  2GA1 A;  1EH7 A;  3T8T A;  2RDP A;  1XD7 A;  2RGV A;  4M6Y A;  1TQM A;  4GCV A;  3V7C A;  3BY6 A;  5HS9 A;  3B02 A;  4EMS A;  4KIF A;  2K7L A;  4U0W A;  3HOS A;  4EM2 A;  1PUE E;  2R7F A;  2CG4 A;  4R1H A;  2D45 A;  2VBZ A;  4HV6 A;  4P5O A;  5EEG A;  4ZYG A;  1YW9 A;  1ON1 A;  4JBA A;  3R4K A;  1TLH B;  4L9J A;  2PLY A;  2QBY A;  1WKM A;  3ECO A;  2P8T A;  3IRQ A;  1MJB A;  1WRJ A;  2MBF A;  3CUQ C;  2QVO A;  4EV0 A;  3V8K A;  3N97 A;  2NNY A;  3F72 A;  4UVA A;  1U5T B;  3Q9S A;  1J2X A;  1ZAR A;  3CLO A;  3I64 A;  1L0O C;  2HEO A;  3WTU C;  1IN5 A;  1QO0 D;  3K0L A;  1S7O A;  3JTG A;  2V6C A;  2HTJ A;  2DK5 A;  2A6H F;  1R1V A;  4IHT A;  3R0A A;  1P4A A;  2CW0 F;  4A5N A;  1FC3 A;  1HST A;  4P9F A;  3E3V A;  4I0B A;  1BI2 A;  5DD4 A;  4KA4 A;  1MDM A;  2O03 A;  3QP5 A;  3LAP A;  1B9M A;  4CYD A;  1U6G A;  3LQR A;  1ZRE A;  4ZZD A;  3COA C;  2QUF A;  3IWF A;  3IC7 A;  4A5M A;  4U0V A;  3NQO A;  3J80 Z;  2L01 A;  3FX3 A;  3C1D A;  2P6T A;  3IKV A;  1IUY A;  1KQ0 A;  1FNN A;  3RYR A;  4HF0 A;  1YTY A;  2ZXJ A;  1SMY F;  3GX4 X;  4HDU A;  4ZH4 F;  5D5V B;  3GVA A;  1LVA A;  2MC3 A;  5D4S A;  5JFR A;  4M9X A;  4NHJ A;  3JAM K;  3F6O A;  2K27 A;  1ONV A;  2XGX A;  1H9G A;  1R1T A;  3GW2 A;  4AIJ A;  3V4G A;  2FMY A;  3JW4 A;  3QAH A;  4M71 A;  4RGR A;  4FHT A;  3K9T A;  1T0F A;  2KIM A;  3C3W A;  3BDD A;  3WG9 A;  2IVM A;  1ZLK A;  1SAX A;  5LBQ A;  4U7D A;  1XMK A;  1GXP A;  3CUQ B;  3DEU A;  2PBI A;  4I7H A;  3TO7 A;  4RAZ A;  5E17 F;  4MGR A;  4Q5S F;  1TW2 A;  2O8X A;  2K86 A;  1ZRF A;  2Z3Y A;  3LST A;  2OD5 A;  1YS6 A;  5DCM A;  1ZN2 A;  3V8L A;  2QQ9 A;  2A69 F;  3KP4 A;  4QWQ A;  2HS5 A;  3F8N A;  4YG2 F;  3T0Y A;  1YW7 A;  1IN4 A;  1R5G A;  3ZMD A;  3FF5 A;  2HKX A;  2ELH A;  3RI4 A;  3FXU A;  5JR3 A;  1FYK A;  2YX4 A;  1JHH A;  2NRA C;  4OIP F;  3J7A O;  5HDK A;  1FYM A;  2MLK A;  4B09 A;  4XSZ F;  1YS7 A;  2X4H A;  2WWY A;  5LLQ A;  4RGS A;  5F6F A;  1IRF A;  1YLF A;  1O7L A;  3KP3 A;  4G6Q A;  4HZF A;  1ZLJ A;  1B6A A;  4M72 A;  1IN8 A;  3U9G A;  5L3E A;  1ZRD A;  2RC4 A;  3I59 B;  3TOA A;  3DF8 A;  4XSX F;  3CUQ A;  5FFX A;  5TJJ A;  3ABT A;  1FBQ A;  3HRS A;  4CZZ A;  3JAM Z;  4CO8 A;  4TV7 A;  1G4D A;  2PMH A;  2KJC A;  1W5S A;  4UV8 A;  4Y13 A;  1OYW A;  2ZNY A;  3HTS B;  2O6G E;  4LJZ F;  2VBX A;  2NYX A;  3J81 Z;  3RPQ A;  3GFL A;  3ISP A;  3ROU A;  1KQ9 A;  5BS6 A;  2R7D A;  3KFW X;  1J75 A;  3MEX A;  2ZME C;  3K1M A;  2QQB A;  3WGH A;  1S6L A;  4S05 A;  5F1R A;  2LSO A;  1OYY A;  1MJ9 A;  1I1S A;  4IHS A;  2EK5 A;  2QM3 A;  4IJA A;  3TOB A;  3D0S A;  2EFW A;  1HW2 A;  2XRN A;  5JI6 A;  4WXH A;  5D5U B;  4FX0 A;  2CGP A;  4UUV A;  1U78 A;  4L9N A;  1X3U A;  3BP8 A;  1XGO A;  1G3T A;  3WGI A;  1XGN A;  2B0L A;  3LA7 A;  5IT9 Z;  2F5F A;  3DQV C;  1W7P B;  5BMZ A;  2H6B A;  5HDN A;  3LQQ A;  1Z1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...