1U5TC

Structure of the escrt-ii endosomal trafficking complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
198
structure length
178
Chain Sequence
b'SALPPVYSFPPLYTRQPNSLTRRQQISTWIDIISQYCKTKKIWYMSVDGTSKNLFNNEDIQRSVSQVFIDEIWSQMTKEGKCLPIDQSGRRSSNTTTTRYFILWKSLDSWASLILQWFEDSGKLNQVITLYELSEGDETVNWEFHRMPESLLYYCLKPLCDRNRATMLKDENDKVIAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords appears to be functionally related to SNF7; Snf8p
publication title Structure of ESCRT-II endosomal trafficking complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
total genus 37
structure length 178
sequence length 198
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF05871 ESCRT-II ESCRT-II complex subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1u5tC02
1.10.10.570 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A "Winged helix" DNA-binding domain. Chain C. Domain 1 1u5tC01
1P4WA 3GW2A 3F21A 3KP2A 2K02A 4IVNA 5F64A 5DUKA 3WE3A 2ZFWA 5L3DA 1ONVA 2QYOA 4ASNA 5E1WA 3CJNA 2V6CA 4P55A 1V4RA 4A0ZA 1VTNC 2YU3A 4I09A 2LNBA 3ECOA 4MHGA 3TGNA 4M9XA 3FZVA 3VB2A 4KIBA 2DLLA 1XGMA 3WGHA 1Q1HA 2HKXA 2H94A 3T5XA 3V8KA 3EUHA 5H6QA 1FYMA 1MJ9A 1S29A 1FPQA 4KUMA 4FX4A 4WXHA 2EK5A 5FD6A 2D1VA 3CDHA 3RKXA 4EVIA 2HFHA 3TDZC 2DBBA 3GLXA 5J8CA 1D5VA 3ZMDA 1MDMA 3CUOA 2FBHA 2DW4A 2ISZA 4NHJA 3M9AA 3ABUA 5LBQA 3OV8A 2FOKA 4A12A 5BS6A 4Z2YA 3TO7A 3FHZA 4A2UA 3GX4X 1OR7A 1ZREA 2LDUA 1I6XA 2ZNZA 4MQ9F 1EH8A 5CYVA 1B9NA 3R6SA 1HSJA 3IKTA 1QZYA 1L0OC 3BP8A 3Q5FA 2M30A 2IA2A 1O7FA 3J80K 3TO6A 3BJAA 2RV8A 4YIIA 2ETHA 2QWWA 2CYYA 3ZPLA 4A0YA 2HQNA 2L4AA 5AIPA 2VBYA 1WSUA 4Y15A 3MAJA 5FO5A 2HTJA 1ZG3A 3FMRA 5HOOA 1YW8A 3I59B 3MWMA 3CUQC 2NNYA 1PUEE 2Z33A 1EV7A 1U5TA 1ZGJA 4BH9A 5ICGA 2BGCA 3LSTA 3KFWX 1HKQA 1LVAA 4ON0A 5E18F 2FBKA 3BDDA 4I01A 4IRGA 1FBQA 1XGSA 2R3SA 4UHTA 1XSXA 4LG0A 3NEUA 2AXLA 2XAJA 1LEBA 2DAOA 4HX7A 1YLFA 1FOKA 2GAUA 4HBLA 2FXAA 1JGSA 2QVOA 1HXDA 4EJUA 3F3XA 3JSPA 3E97A 1FT9A 3DXJF 1LJ9A 2E1CA 3L09A 2P6TA 2Q8KA 1KQ9A 3H92A 3ECHA 2VBXA 1LEAA 4G6QA 4EV0A 3DP7A 1XSDA 1XGNA 4B09A 3LA2A 2V1DA 1YFHA 5LEKA 3VODA 1HQCA 2F5EA 1L3LA 1LB2A 1FYLA 2EFOA 4AIHA 4BHCA 2FQ3A 3P9IA 4CICA 1FZPB 3T0YA 3R0JA 2GZWA 5LRRA 3BROA 5ERIA 3I4PA 4U0VA 4U0WA 2YPRA 5FFXA 2L4MA 2ZMEC 2QLZA 4UVAA 2Z3YA 2PQ8A 2R7DA 2XVCA 1R1VA 1W4MA 1YW9A 3KP3A 1Y0UA 6PAXA 1I1SA 2O6GE 2KIFA 4P5OA 1TNSA 4HLXA 4XSZF 5JR3A 2W84A 3HUGA 4R1HA 2A68F 4IXAA 5CVIA 3FXRA 1BN5A 3BZ6A 1SFEA 4IF4A 3W6JB 4HV5A 5BQTA 4ESFA 4Q5SF 1R5HA 2STTA 2DT5A 3J80Z 1OYIA 2VT3A 4HAMA 1UFMA 4RGXA 5HDNA 5D8KB 2FU4A 3F22A 2EV0A 1Z6RA 2CSOA 3EQLF 3GFLA 1YS6A 2PFBA 3ZMSA 4ZYGA 5D4RA 3GWZA 3QU3A 2DO7A 3CTAA 4U7DA 1BC7C 2WV0A 5CVJA 3M1EA 3HRUA 1NHAA 4EJWA 5CVVA 2MLGA 2XUBA 1J2XA 5DCMB 4JBAA 2L02A 3T8TA 4I2OA 1J9IA 4KN4X 4R79A 1W7PA 4Y13A 2XAGA 4KA4A 1XGOA 3U2RA 2VBWA 2DQRA 1ON2A 2M8EA 4P9UA 4RB2C 5D6FA 4B8XA 3RJPA 4BXUA 1ZLKA 1ZH5A 5FLXK 1JHFA 2YSRA 3GZ6A 3I64A 5DUIA 1P4XA 3ZMVA 3KETA 1I1GA 5BPIA 4WXCA 4F7ZA 5D8LB 4HOBA 2A3SA 2ZBKA 3PQJA 3JTHA 4NQWA 5DCFA 2O61A 2GA1A 2MH9A 1REPC 3CUQA 1H9GA 3TOBA 1RNLA 1SD7A 4BHPA 4YG2F 4CHUA 4WF2A 3JAMZ 2EV5A 1HW5A 3N4MA 4YFXF 1QPMA 4E70A 5ILUA 3F6OA 4OIRF 2UWMA 3Q9VA 1O3TA 3QPTA 5E8GA 2IVMA 1RIOH 3ZMZA 2K4BA 3D5LA 2XASA 2WC2A 2QBYB 3ABTA 3BPVA 4AVPA 2ZNYA 1FP2A 3EETA 1FC3A 1FX7A 2XHKA 1R1UA 4U0YA 4O6JA 4L0YB 1UCRA 4XRFA 2EWNA 2M1BA 1SMTA 3ROUA 2PMUA 4HQMA 4LB6B 4GXOA 4G6DA 1U8RA 1Z1DA 3F72A 3QP6A 2VC1A 4XLPF 2UXNA 3WTXC 3V7CA 1YYVA 4G7ZF 3I53A 5D6EA 4S04A 4LJZF 4RGRA 1FLIA 1TBXA 5BOXA 3ZQ7A 3BPXA 2CG4A 2VN2A 4RAZA 5AIQA 1B9MA 2Z99A 1SFXA 3J81Z 3LAPA 1GXQA 1J5YA 1EH7A 2KIUA 1HBXG 2OAZA 5BMZA 4LLNA 3WU0A 4ZYDA 3QRFF 3GZ5A 5JI6A 1OPCA 1WRJA 2DPUA 3MQ0A 4MEXF 2HTSA 5D5WB 4MTEA 2IP2A 1FSEA 4MQVA 1LDJA 5J8FA 1X3UA 4CZZA 3HHHA 2BEOA 2F5DA 3P9KA 3I59A 5HLGA 4UV9A 5HS7A 2MD5A 1I27A 1J0RA 2XKPA 3KCCA 3GYHX 1HW1A 1H0MA 3GXOA 1TTYA 1BI0A 5H6RA 1PP8F 5FLXZ 2VBZA 1DDNA 4OIOF 3VEPA 4M6XA 3RPUA 4G7HF 4IHTA 2P7CB 1YQAA 2PN6A 4OIPF 4HF0A 4KDPA 1IAWA 3M8FA 1K78B 2NS0A 2MBFA 2PEXA 4XSXF 3KZYA 3WTUC 3DFGA 1MD0A 4HDVA 4L0ZB 1FSHA 3EYIA 4PGGA 1TW2A 4A6EA 1BI2A 4ZYEA 1YG2A 2XGXA 4R8HA 4RGUA 1BC8C 2F5CA 1G3TA 1Z7UA 2VODA 2G7HA 3FWEA 2DQLA 4LB5A 3GFJA 3FX3A 2A6HF 4CDGA 3SZPA 4EM1A 1K7AA 4L18B 2M87A 5ILSA 1P4AA 4KIGA 5E1ZB 4HLYA 2EV6A 2ESHA 3MCZA 2CGPA 1BOAA 5A2QZ 1O7LA 2CWEA 1DPUA 2PJPA 3V4GA 1CF7B 3ZN0A 1A04A 1O3SA 1I5ZA 3IC7A 1MGTA 5LGNA 3WTTC 1EH6A 1TNTA 1IN4A 2O03A 4Q48A 2IJLA 3MZYA 2VE9A 4G7OF 2V1XA 1USSA 1XCVA 2J5OA 1IXSB 2IT0A 2H6BA 5J6XA 2HYGD 1USTA 1FBUA 2FA5A 3REOA 2HGCA 2NNNA 4MTDA 1O57A 1IRFA 1S7AA 2KRFA 1ON1A 2VOOA 2FRHA 3HSRA 4DNCA 2FEZA 2VXZA 2FBIA 3HRTA 4BQAA 3HSEA 4I02A 3I58A 1RI7A 1P6RA 5LHIA 1G6NA 5CJ9A 1D3YA 3K2ZA 1XMAA 2OZ6A 4LK0F 1Z91A 2XAQA 1ZAOA 4EJOA 4YIFA 4M71A 5LGTA 4WWCA 2W25A 4EGZA 2CW0F 2ZO4A 3KP7A 4ENJA 3KP6A 2PG4A 3K1PA 2K7LA 3KEOA 4G8XA 3F23A 3ISPA 3PQKA 2HS5A 1SMYF 4HZFA 3O6BB 4A5NA 5DCMA 3I71A 5LEJA 2P5LC 2KIMA 5HS9A 1TQIA 3RKWA 3O3KA 3U1DA 4ENMA 4L9JA 1V3FA 4L5JA 3RIRA 3GO5A 2CFXA 4Q4ZF 1K79A 3JAMK 1E2XA 3WU1B 3NQOA 3HYIA 4QWQA 2IW5A 2JPBA 3C1DA 1JXSA 4AIKA 5JFRA 2KKOA 3WTYC 3LQQA 1TLHB 3FM3A 2MH2A 1BIAA 1IW7F 1SFUA 1R1TA 3TQNA 4O3MA 3IL2A 2V79A 2Y48A 1GXPA 3WTVC 1MJAA 1ZGAA 3HRMA 5TJJA 2O0YA 3R60A 4I98B 2FMLA 4Q47A 1HSTA 2RVCA 3LFKA 1FY7A 4N9IA 1T0FA 1RZ4A 1WKMA 2E1NA 5HDGA 1G3YA 1ZHFA 5ICEA 3B02A 4M6YA 4L9TA 4RGSA 2FSWA 1Z05A 1QQIA 3V8LA 2FE3A 4M72A 2XKOA 2OBPA 2XV4S 3R4KA 3HOTA 1YS7A 2P4WA 4AIJA 5HLHA 5EEGA 3H3ZA 4GO1A 1IXCA 5E20A 1R7JA 1XMKA 4UVBA 3CO7C 4KMUX 5E1XA 2QBYA 3F8FA 2RQPA 1E17A 1MZBA 1DP7P 1BJAA 4CYDA 2IPQX 3BWGA 1J59A 4KYWA 3RYRA 3F8NA 1MJBA 4YFNF 5IT3A 3ERED 1SAXA 1BBYA 2OQGA 1U6GA 3J81K 4WX9A 2QQAA 1U5TB 3KEQA 1QZZA 4ZYHA 3HRSA 2P7VB 1ZG1A 2J5PA 3C3WA 3GF2A 5HS8A 2EB7A 2DTRA 3KE2A 1F1ZA 2FNPA 3J7AO 1TQPA 2DK5A 1R5GA 4IJAA 3CO6C 4LG0B 4M9ZA 1SD4A 2F5FA 1CGPA 3L00A 2Z5UA 3I5UA 1R00A 3IRQA 1D8JA 3KP4A 4CXFA 2W24A 4M73A 4HDUA 3ZMTA 5LHGA 4GYIA 5CVUA 1ZYRF 1AOYA 2STWA 1ULYA 4A6DA 1ZRDA 3FMSA 1YW7A 2DI3A 3TKYA 2B0LA 1XSVA 4CO8A 4WK8F 3V7SA 3D0SA 3V8JA 1ZN2A 3LQRA 1YTYA 4HW0A 4LK1F 1O3QA 1ZLJA 3ULQB 2L01A 4L5IA 5E8IA 3GUDA 1ODDA 2ELHA 4RAYA 2PLYA 5BPDA 1QNTA 2GXBA 1LDKB 2QM3A 1PDNC 4UXNA 3DV8A 3HOSA 2V9VA 3COAC 4CGZA 2L3DA 2O3FA 2H27A 2GA2A 3GFIA 5F6FA 1AWCA 1JHHA 2ISYA 5A2QK 3EYYA 2BV6A 5KK1A 5ED4A 2JTVA 5DD4A 1OYWA 1P92A 4ZH4F 3O2PE 3MZHA 3E5QA 1Z9CA 4ETSA 2VT2A 2VE8A 1OYYA 3ML6A 3TDUC 2FNAA 2ZXJA 4RS8A 2G7UA 1T2KA 3K1MA 2PMHA 2YR2A 4NB5A 4H0EA 3CLOA 1QBJA 4KT5C 3FXUA 3WTWC 2XROA 3G73A 2D2WA 2BBYA 3QAHA 2EFQA 1D8KA 3E6BA 2E7XA 1TW3A 4MGRA 2RNJA 2DU9A 5L3CA 1O3RA 1W7PD 1FBSA 2YX7A 3Q9SA 3F8MA 3WODF 1B6AA 1GHCA 1U78A 1SD5A 2E7WA 2IA0A 1GVJA 2Y75A 2Z9OA 3H3UA 3JSOA 1KYZA 2HOEA 3BOQA 2QQ9A 1U2WA 3P9CA 4HX8A 3HIFA 4XLNF 3GFMA 2M45A 1KU2A 3HSFA 3W6KB 4FHTA 3G3ZA 2P5VA 3EDPA 3NRVA 3IHUA 4BAYA 3F6VA 5LRSA 4HF1A 4GCVA 3T8RA 3SZTA 4FT8A 2NRAC 3RPQA 2V1UA 3C18A 4G94A 2FMYA 1RUNA 4OOIA 4JQFA 3AAFA 2EA4A 1HW2A 3RKYA 4G9YA 1KQ0A 2KJCA 3LWFA 1IZ1A 2LSOA 4LLGF 1SD6A 4IRHA 1LNWA 3CUQB 3ELKA 2X0LA 4BHBA 4GGGA 1KYWA 2COMA 2K27A 2JZYA 1DPRA 3LA3A 2VONA 2X4HA 2G9WA 2MA3A 4I7HA 4ZZDA 3E5XA 3E3VA 2HKOA 5D4SA 4U7BA 1XN7A 1T6SA 2HYFA 3LA7A 1KQ8A 2HWVA 3IRRA 2LF8A 3C7JA 3WE2A 1B4AA 3HTSB 1FWZA 5ICFA 4QLCU 5L3EA 2OA4A 2EA2A 3L7WA 1WI9A 1S7OA 3DPTA 2HEOA 5D5UB 2JPCA 4XBFA 2W85A 2K86A 3V7RA 4KICA 2Q0OA 3E6CC 2A69F 3SHFA 1S6LA 3DPLC 5L3BA 5FFZA 2KJBA 3ZN1A 2K4JA 5K5RA 1P2FA 2MC3A 4N9HA 2BE5F 2JSCA 5AONA 5IT9K 2AS5F 4OMYA 2CQKA 4Y17A 4BYYA 1UHMA 5CVRA 2OD5A 4WXDA 1T39A 3E6MA 5CLSA 4KIFA 1IF1A 4D0PA 2ZMEB 2H09A 1B1BA 3M8EA 5DV5A 3QP5A 3K9TA 2LF7A 4MNUA 4P9FA 3JTGA 2D1HA 2W57A 4DQ2A 3FMQA 1XDSA 2ZKZA 3DKWA 3S2WA 4RB3C 2GWRA 2FF4A 4UNOA 3DEUA 4A0XA 3QPHA 2A5YB 1G3WA 1UHWA 5FB2A 3VFZA 2ZJ2A 1BM9A 4FX0A 3FM5A 1XCBA 4LLLA 5DEQA 4RB1A 5D5VB 4LD5A 2O8XA 4YFKF 1KA8A 2EFPA 3F8CA 3MEXA 2NAZA 4A5MA 4I0AA 2VC0A 4BNCA 1ZRFA 5KVRA 4AWXB 4KMFA 4IPAA 3FXQA 1LDDA 3KLNA 2EFNA 1KU7A 1W5SA 3L9FA 1QO0D 2GQQA 3QOPA 4EQQA 3DF8A 4U88A 4LFUA 3RYPA 3F8BA 4TV7A 2ACJA 1DUXC 1R23A 2P6SA 4L9NA 3KZZA 4ENNA 1MDMB 1XB4A 3K0LA 2ADUA 2UZKA 1TQMA 2HZTA 1R58A 1KU3A 4L9VA 3HHGA 4RB0A 2A07F 3I0TA 1IXRC 1WWXA 3WGGA 5K5QA 3TO9A 5JHUA 2C6YA 3WG9A 2EFWA 1IN8A 3ZP5A 2RN7A 5DDGA 4ZZLA 3GVAA 4PCQA 2DPDA 1XDUA 1R36A 4HF2A 3MFKA 2MLKA 1HKTA 5DYMA 2GXGA 4OIQF 4EM2A 4M74A 1FYKA 3HTUA 1Z6TA 1KGSA 2RDPA 4KN7X 2WWYA 1S8NA 1T98A 1IN5A 3TOAA 4IHSA 5IT9Z 2TDXA 5FD5A 1WQ2A 4WCGA 5D5XB 5HLIA 3L2CA 4EM0B 4EMSA 5EEHA 1T38A 2YX4A 5F1RA 2VOPA 2QZ8A 3K69A 2XIGA 1ZRCA 4KNYA 2HR3A 4M9SA 1H9TA 3WGIA 1G3SA 3E5UA 3DQVC 2ESNA 1PP7U 1XD7A 1LQ1A 5FGMA 4HQEA 2D45A 4OU0A 5K1YA 3LAJA 3K1NA 3T1BA 2P5KA 3SFZA 2HDCA 4AD9A 2JRTA 1OMIA 2NYXA 4EGYA 4HV6A 3PFIA 3BY6A 2EJRA 3RTRA 2R7FA 5ILVA 3BJOA 2XAFA 1J7KA 2QENA 2DFIA 1STZA 3IKVA 1YIOA 4PDKA 2IA1A 1FP1D 4PGHA 1K6OA 2F2EA 4N0BA 5TRDA 1BI3A 2A6EF 5L3GA 2A61A 1ZARA 2L54A 1F4KA 1W5TA 4OMZA 1G4DA 3IWFA 4I0BA 5E17F 5H20A 2CO5A 2UXXA 3WTZA 4PZJA 1F9NA 1UB9A 2QUFA 1KU9A 3FF5A 1BIBA 4MEYF 3ZMUA 1JE8A 1ZG5A 5LGUA 2RKHA 2HQRA 4HX4A 2H6CA 1K78A 2IRFG 3E6DA 2DK8A 3SQNA 1OKRA 2WTEA 5K5OA 4HA8A 3JW4A 4LGWA 1IUYA 3SXYA 3R0AA 3KLOA 2Y0MA 2XRNA 1B59A 2OZUA 1U5TC 5LLQA 4UUVA 2LKPA 4EJTA 1S3JA 4JK1X 2OU2A 1FNNA 3IWZA 4KFCA 5LHHA 3I54A 2PI0A 4LMYA 5ICCA 2QQBA 4OINF 3RI4A 2M5WA 1BI1A 5DD8A 2BYVE 1HKSA 3RDIA 1J75A 3GEZA 3M7GA 4UVCA 3QU6A 3BJ6A 2Q2EA 2P8TA 5JVTA 1CF7A 3B73A 3P7NA 1YO5C 2JT1A 2RGVA 1RUOA 3R61A 4S05A 3N97A 4EJVA 1F5TA 5L3FA 2PBIA 2RC4A 2XAHA 1C0WA 2OQRA 4ESBA 3KP5A 3U9GA 2GIVA 1MKMA 4HYEA 4ENKA 3WTSC 4GYGA 5HVQC 3VOEA 4IRIA 1IN7A 1QGPA 2ZMEA 4ESJA 1W7PB 4UV8A 5HDKA 4P96A 1U3EM 4K2EA 3OOPA 1R22A 4O5VA 1IRGA 1IN6A 2ZCWA
chains in the Genus database with same CATH superfamily
2GBYA 1WGXA 5B1BH 1P4WA 3CDLA 2DMQA 3JRHA 1N77A 2VL8A 3GW2A 3F21A 3KP2A 2JVHA 1A36A 2K02A 4IVNA 5F64A 4JOMA 5DUKA 3WE3A 4AVZA 3CJRB 2DDAA 2ZFWA 1YE9A 5L3DA 1ONVA 2QYOA 3A01B 2GXAA 4ASNA 4C2UA 5E1WA 4OAYA 4C30A 3CJNA 2DDBA 5CPRB 2BHYA 2KL4A 2E1OA 4ZC3A 2LTPA 3H3VK 4NQWB 3HEFA 2V6CA 4P55A 1V4RA 4A0ZA 1VTNC 1TP4A 1JUPA 3FK6A 2GOMA 4CYCB 2YU3A 3RSNA 4I09A 2LNBA 3ECOA 5H2FC 4MHGA 3TGNA 4M9XA 2Z1DA 2M7BA 3C2GA 3FISA 4E7HA 5GPCA 3FZVA 3VB2A 4KIBA 2CMPA 1JGGA 2X6XA 1O4XA 3G1MA 2DLLA 2IGKA 3HL2A 2DFHA 1XGMA 2QGUA 5KCMA 4XN0A 1YOVB 3WGHA 1Q1HA 2HKXA 2H94A 3T5XA 3CMAI 1HF0A 3V8KA 1ZR4A 1TT0A 2BVLA 3EUHA 5H6QA 2W48A 1SFOJ 2Y9ZA 1FYMA 1MJ9A 3OYKA 1ACIA 1S29A 1FPQA 3HKZN 4KUMA 4FX4A 9ANTA 4WXHA 2EK5A 5FD6A 3S16J 2D1VA 1IV6A 3FK7A 3CDHA 3RKXA 4EVIA 2O8KA 2R7ZJ 2HFHA 4CCKA 5IP7J 3ZRGA 1DP3A 2IS1A 3TDZC 2DBBA 1WH5A 3GLXA 5J8CA 3ESWB 1D5VA 1WJAA 2X6OA 4XORA 3ZMDA 1MDMA 3CUOA 2FBHA 1D1CA 2NS7A 1R71A 3CCYA 2DW4A 4IOAF 5FLMJ 1TWGJ 1WJDA 3JCUC 3LNQA 2ISZA 4M3FA 3BTIA 1D0XA 3J7ZI 4NHJA 3M9AA 3ABUA 5LBQA 2JA6J 4AM3A 3OV8A 2FOKA 4PJMA 2NOJB 5BS6A 4A12A 4Z2YA 1ETKA 3TO7A 2CJJA 2VJ4A 3L2VA 3U1KA 3FHZA 4A2UA 2HXIA 1OR7A 2ECCA 3GX4X 1ZREA 2LDUA 1I6XA 2ZNZA 2K9MA 4MQ9F 1EH8A 5CYVA 4XRSG 1B9NA 3R6SA 1LFUP 3ZGKA 3KIOA 1HSJA 3IKTA 2VIXA 2MYSA 1QZYA 2AXTC 3UNGC 4DYCA 4HPQA 1JKPC 5TISC 1L0OC 3BLYA 3EUKL 5TGTA 3BP8A 4QPQA 1HC8A 3Q5FA 1FTTA 2M30A 2KPMA 1LE8A 2IA2A 1O7FA 2R7OA 3J80K 3TO6A 3BR3A 3BJAA 3RKQA 2RV8A 4YIIA 2ETHA 2QWWA 2CYYA 2X1CA 1JKQC 2IS6A 3ZPLA 1QPIA 4A0YA 1MNMC 2HQNA 2V26A 4E7SA 4V2FA 5E79C 2L4AA 4FASD 3CCQI 5AIPA 5FRMA 2VBYA 3S32A 1WSUA 4Y15A 1H89C 3MAJA 5DM7F 2E60A 5FO5A 2HTJA 1ZG3A 3FMRA 5HOOA 1YW8A 2VPLA 2L9SA 3I59B 2HYJA 3MWMA 4A3KJ 3CUQC 4MIMA 2NNYA 2FD5A 1PUEE 2LBFA 1PVEA 2Z33A 2K40A 3L2QA 1EV7A 5BNGA 1IO2A 2O5RA 2LREA 1U5TA 2X51A 1ZGJA 4BXXJ 1NK3P 4BH9A 5ICGA 2BGCA 2WBMA 3LSTA 1MBFA 4BY1J 3KFWX 1HKQA 1ZKGA 1LVAA 4NDLA 4ON0A 5B66C 4UUSA 5E18F 2FBKA 3BDDA 2NVYJ 4I01A 4IRGA 4DBRA 2LY1A 4FQGA 5J40A 4FCYA 1FBQA 1XGSA 2A6TA 2LC2A 3SJMA 2R3SA 5EZHA 4UHTA 1XSXA 4LG0A 4A3BJ 3NEUA 3OYFA 4IX7A 2AXLA 2XAJA 1LEBA 3GTJJ 2DAOA 4HX7A 2WV1A 2GOXB 4V19K 1YLFA 1VQ9I 5EGOA 1FOKA 2GAUA 4HBLA 2JA2A 2FXAA 3L2UA 1JGSA 2QVOA 1HXDA 3HGYA 1I50J 4XL9A 4EJUA 3OS2A 3F3XA 3JSPA 3E97A 1FT9A 2F4OB 3DXJF 2XF6A 1LJ9A 2R7XA 4PFOA 2E1CA 3L09A 1E0EA 2HNHA 4J00A 2P6TA 2K9QA 2Q8KA 1KQ9A 3H92A 2TCTA 3ECHA 2VBXA 1YRNA 1MNEA 2ZB9A 3SDBA 1LEAA 4B4CA 2AHQA 4G6QA 4EV0A 3DP7A 1XSDA 1GUUA 1XGNA 3RZOJ 4B09A 2N8GA 3LA2A 2V1DA 1YFHA 3D5RC 5LEKA 3VODA 1HQCA 2F5EA 2VQLA 3FXJA 1TZLA 1L3LA 1LB2A 3GMEA 1FYLA 2EFOA 1T56A 2HVQA 2QA4I 1XPXA 2BXZA 4AIHA 4BHCA 3DBHB 1BJZA 2FQ3A 3P9IA 2Y0SN 4CICA 4I99C 3T0YA 1FZPB 1VQKI 3R0JA 2GZWA 3A0HC 3BR6A 5LRRA 3BROA 5ERIA 3I4PA 4U0VA 4U0WA 3PUFA 4HNUA 2YPRA 5FFXA 2L4MA 2ZMEC 3VWBA 4Y7NJ 4XKBA 2QLZA 3I56I 2M9HA 1VQ7I 4UVAA 2L0KA 2Z3YA 2HVRA 4C3HJ 2D5VA 2PQ8A 2R7DA 2XVCA 1R1VA 1W4MA 1QZEA 1YW9A 2MSYA 2M4KA 1MMNA 5IP6A 3KP3A 5FRNA 3MZ8A 1Y0UA 6PAXA 1I1SA 1I3AA 3OL3A 2O6GE 2OC6A 3GCMA 3OS0A 3DEWA 1HLVA 2RREA 1T33A 2K9SA 3FXLA 2KIFA 4IHYA 4P5OA 1TNSA 2BVMA 4HLXA 4XR6A 4CH7A 2F48A 3K2AA 4XSZF 2B9SA 3S15J 5JR3A 2W84A 2VJJA 3HUGA 1YX5A 4R1HA 4ZYAA 2DMTA 2LD5A 2A68F 2E36A 4IXAA 5CVIA 2PJRA 3FXRA 1BN5A 2F4IA 3BZ6A 3LOCA 3BZCA 1SFEA 4IF4A 1ETOA 4E7JA 2X6WA 1FIAA 3W6JB 4HV5A 5BQTA 4ESFA 2KZVA 4BKXA 4Q5SF 1R5HA 1F36A 2HI3A 2X85A 2STTA 4U87A 1IRZA 3QQAA 1FOWA 2DT5A 3VSLA 3J80Z 1OYIA 2VT3A 2BW3B 4HAMA 1UFMA 1ETVA 4RGXA 3OYCA 1ITYA 3WU2C 2IGOA 2OF7A 5HDNA 5D8KB 2AO9A 2FU4A 3F22A 2NOGA 4XKVA 2EV0A 1A6IA 1Z6RA 2COBA 2CSOA 3EQLF 4RLQA 1W36D 2R7UA 2JRMA 3GFLA 2EIKH 3EUHC 4XRMA 4QSHA 1YS6A 3DKYA 1GDTA 1XX5A 3MD2A 2PFBA 3ZMSA 3QPSA 5EZGA 1WH7A 4ZYGA 5D4RA 3IP4B 3GWZA 3QU3A 1X2MA 5C3EJ 4HRIA 2DO7A 2YUSA 1MSFC 3CTAA 4UB8C 1JKRC 3G2BA 3AL0C 4A3GJ 4U7DA 2LR8A 3PFYA 2BOLA 4AC0A 1BC7C 2WV0A 4FE7A 3M1EA 5CVJA 3HRUA 1NHAA 2KT0A 3ASNH 1FMVA 3BG3A 4EJWA 2L9VA 1XS9A 5CVVA 2MLGA 2XUBA 3BG5A 4IKFA 1J2XA 5DCMB 4JBAA 2L02A 3T8TA 2M7AA 4I2OA 1MH3A 1J9IA 4KN4X 1IGNA 4R79A 1W7PA 4IEJA 3BQZA 3S3MA 3FBIB 4Y13A 2XAGA 4P1WA 1XGOA 3U2RA 4KA4A 4BQQA 2CUFA 2VBWA 2DQRA 2VLAA 4W97A 4JP0A 1ON2A 3PO2J 2M8EA 4P9UA 4RB2C 3LSKA 5D6FA 2XSJC 4B8XA 3RJPA 1VQPI 3BR1A 1AKHB 2LKSA 4BXUA 1ZLKA 1ZH5A 5FLXK 1JHFA 2YSRA 3GZ6A 3HKZA 3I64A 5DUIA 1PJRA 3AG1H 1P4XA 4N4NB 3QYBA 3S17J 1XC5A 4PFPA 3NAUA 3ZMVA 3KETA 1I1GA 5BPIA 4WXCA 4F7ZA 5D8LB 4HOBA 1IDYA 2A3SA 2ZBKA 3ABMH 3PQJA 4DYQA 3JTHA 4NQWA 5DCFA 4XLHA 2O61A 2GA1A 2MH9A 1REPC 4M3DA 2H1KA 3CUQA 3DWLE 2KDOA 1H9GA 4XK4A 1A6QA 3TOBA 5B1AH 1RNLA 1SD7A 4BHPA 4YG2F 4PJLA 4CYCA 4CHUA 4WF2A 2I8DA 4F55A 3JAMZ 2EV5A 1HW5A 3N4MA 1RPWA 4YFXF 3DU6A 3AG2H 1QPMA 4E70A 5ILUA 3F6OA 1LFBA 4OIRF 1D1AA 3SZGA 3K7AJ 1A31A 2QCOA 2UWMA 2X9DA 1V5EA 2V9PA 3Q9VA 1O3TA 3QPTA 5E8GA 4XKCA 1WJCA 3EPZA 2QSGX 3F9KA 2IVMA 3K4LA 1RIOH 2DJNA 3ZMZA 2K4BA 3D5LA 4GRIA 3E1SA 2XASA 3OYAA 2WC2A 2QBYB 3KEYA 3ABTA 2DOFA 3BPVA 4CCLA 4AVPA 2PMZN 2ZNYA 1FP2A 3EETA 4C2MJ 1FC3A 1FX7A 2XPUA 2XGEA 2XHKA 1SANA 3OYHA 4KT6A 1R1UA 4U0YA 4G12A 4O6JA 2EPFA 2L5QA 4YELA 4RBOA 3JRIA 1UCRA 4L0YB 2W82A 3PL8A 2K9NA 3C2HA 3Q3SA 4XRFA 2EWNA 1LPQA 2M1BA 5GAGJ 1SMTA 2DA5A 3ROUA 1AU7A 1Z77A 3DLLF 2L7FP 2PMUA 5J1UA 4HQMA 4LB6B 2ECBA 3CJQB 4GXOA 3FXKA 4G6DA 2JA7J 1U8RA 1Z1DA 2HOSA 3F72A 3QP6A 1VF9A 4A3JJ 2VC1A 3BQYA 4XLPF 4E4HA 4X0GA 2UXNA 3WTXC 3V7CA 4ZDOA 1YYVA 3TW6A 3CC2I 4G7ZF 4BY7J 2VJIA 3WHBA 3I53A 5D6EA 4S04A 4LJZF 4PSWA 4RGRA 4QTRA 1FLIA 1TBXA 5BOXA 5EEAA 5EG0B 4XOTA 3ZQ7A 3MKWB 2JMWA 2L9NA 3BPXA 3SEZA 3PUBA 2EIMH 2CG4A 4GFBA 2VN2A 2WY8Q 4RAZA 4PUSA 4Y52J 5AIQA 1B9MA 2JWTA 2Z99A 2CFOA 4F3QA 1SFXA 3A02A 4IHXA 2LH9A 2ZFUA 3J81Z 3BTJA 1GXQA 3LAPA 1J5YA 1EH7A 2KIUA 1HBXG 4MLOA 4B44A 2OAZA 2ZSIB 3S1MJ 5BMZA 4LLNA 3WU0A 1GV5A 4ZYDA 3QRFF 3GZ5A 4KITB 5JI6A 1SEUA 1TWCJ 3MMYB 1OPCA 1QU3A 1WRJA 2DPUA 2VKHA 3MQ0A 4MEXF 4BBSJ 2CQQA 2HTSA 2M4GA 5D5WB 2NVTJ 4MTEA 2IP2A 1FSEA 4CCMA 5KAFC 3BZKA 4MQVA 1FOXA 2MABA 1LDJA 5J8FA 2LLKA 1X3UA 4BL0B 2BY0A 2E5ZA 3NARA 4CZZA 3JRDA 3M4OJ 5FKMA 3HHHA 3MVPA 2BEOA 1UJ8A 1QHGA 4N4OB 2HQAA 5GPAA 2ZC2A 2F5DA 2ZXHA 3P9KA 4BS9A 3I59A 5HLGA 1HDDC 4IHWA 4UV9A 4BEHB 3A4CA 5HS7A 1Y0NA 2MD5A 1I27A 2WAQA 1J0RA 2XKPA 3OMYA 5E3NA 3KCCA 3S14J 3GYHX 2HPIA 1HW1A 3K4BA 5FROA 2DA1A 1H0MA 2OTJI 3GXOA 1TTYA 3PNTA 2R5ZB 1BI0A 5H6RA 1PP8F 1JT0A 3HGGA 3PO3J 5FLXZ 2VBZA 1DDNA 4OIOF 3VEPA 1U9OA 4M6XA 3RPUA 4G7HF 3N05A 4IHTA 2P7CB 5C4XJ 1YQAA 1WPKA 3ABLH 3QPLA 1K83J 5F0HA 3ZQHA 2PN6A 4OIPF 2XF7A 4HF0A 4KDPA 1IAWA 2MC4A 3M8FA 1K78B 2VJ5A 2NS0A 2MBFA 2Q1ZB 4M3GA 2PEXA 4XSXF 3KZYA 2HVSA 2JN6A 3JRFA 3WTUC 2DT7B 3D5SC 4XRSA 3DFGA 1MD0A 4HDVA 5F08A 2EZIA 4L0ZB 2O9LA 1FSHA 1B8IB 3EYIA 3S2HJ 2R7VA 2L7KA 2LFBA 4PGGA 1TW2A 4A6EA 3CCSI 1BI2A 2ZSHB 2HQ5A 1M1EB 3ZOBA 2JUCA 5JHFA 3ZQCA 2WAEA 3CF2A 2KFDA 4ZYEA 1YG2A 2IS4A 2XGXA 4R8HA 3GTMJ 3OYJA 4RGUA 1BC8C 2F5CA 1G3TA 5GP9A 3S8PA 1Z7UA 2VODA 2G7HA 1W1WE 2DQLA 3FWEA 2KRHA 4LB5A 2A05A 3GFJA 3FX3A 2E1MB 4IZZA 2A6HF 4CDGA 3DKXA 5K7ZA 3SZPA 4EM1A 1K7AA 4ZDPA 2XPVA 1RETA 2L7MP 4L18B 3HOUJ 2M87A 5ILSA 1P4AA 1EF4A 4KIGA 5E1ZB 1X1BA 4HLYA 3FXOA 2LMDA 2EV6A 2X6YA 5IOYA 1JT6A 1P7JA 2HZDA 3FHNA 2ESHA 3CC7I 3MCZA 2K9LA 2CGPA 1X1DA 1BOAA 2VKVA 5A2QZ 1Z3YA 3K10A 1O7LA 2CWEA 1DPUA 1UG0A 4BE1A 2PJPA 4BE2A 3V4GA 1RRJA 1CF7B 3ZN0A 3E7LA 4XONA 1A04A 2VKDA 1O3SA 4D7MA 5J47A 4OWRB 2CU7A 2CQXA 1I5ZA 2FX0A 3IC7A 1MGTA 4FISA 5LGNA 2EBIA 3ZQFA 3WTTC 1EH6A 1TNTA 1IN4A 2P81A 2O03A 1V54H 1Y8RB 4Q48A 5CKTA 2IJLA 3H0DA 2QSFX 2MD0A 3FKIJ 3MZYA 2W00A 2VE9A 1YI2I 3HJEA 1FOYA 3TW7A 1R6RA 4G7OF 3BCAA 1WFXA 1EJ9A 2E19A 2V1XA 1USSA 2LY9A 2V1NA 4II3A 1XCVA 2J5OA 3WG7H 3IAM2 1IXSB 3IH2A 2IT0A 2H6BA 3CLQA 4LIUA 5J6XA 2HYGD 1USTA 4UY8I 1FBUA 2FA5A 3REOA 2OUMA 1ETXA 2HGCA 2LP0A 1MH4A 2B7EA 2NNNA 4RA2A 4DYRA 3JRCA 4MTDA 2EILH 1O57A 3Q0UA 1IRFA 1S7AA 2KRFA 1ON1A 4HG2A 2FRHA 4RAGA 2VOOA 3HSRA 2BHZA 1UG2A 4DNCA 1ETYA 4DZPA 3ABKH 3OS1A 2FEZA 2DYRH 2VXZA 2NVQJ 2FBIA 3HRTA 1JTXA 4BQAA 2K3PA 3HSEA 1R4NB 4I02A 1Z21A 1YITI 3I58A 1RI7A 1P6RA 3M3YJ 1A35A 1G2HA 4IHVA 5LHIA 1G6NA 3AKZA 1WJEA 5CJ9A 3ZCOA 1D3YA 2LYCA 3K2ZA 1XMAA 2I5UA 2OZ6A 4LK0F 2DA2A 2M0CA 1SVLA 2QKMB 1Z91A 3QYFA 4MFEA 2XAQA 2HPMA 3TL4X 1ZAOA 3GZNB 3CCVI 4M3EA 4EJOA 4YIFA 4M71A 5LGTA 4E7IA 4D1QA 4WWCA 2W25A 5M5XJ 2KQRA 4EGZA 2CW0F 2ZO4A 3KP7A 1Z67A 2K3FA 3Q0WA 3KP6A 4ENJA 2PG4A 1VQOI 4NUBA 1POGA 1I6HJ 3K1PA 2K7LA 3KEOA 1VFCA 4E6KG 5HLTA 4Y3OA 4G8XA 3HPGA 3F23A 3ISPA 3PQKA 1SVOA 3NWTA 2HS5A 1SMYF 1WJBA 4HZFA 3O6BB 3WHCA 4A5NA 3H36A 3I71A 4L5EA 5DCMA 5LEJA 2P5LC 2KIMA 3S1QJ 5HS9A 1GVDA 2Y31A 1BR2A 2K5CA 1VQLI 3ZQGA 1S7EA 4CCNA 1TQIA 3RKWA 1T08B 3O3KA 3U1DA 4ENMA 4L9JA 1V3FA 5KAIC 4L5JA 2CV1A 3RIRA 5E3LA 4CA0A 1UAAA 4HNTA 3AFHA 3GO5A 2CFXA 4Q4ZF 3DCFA 1K79A 3JAMK 1E2XA 3WU1B 3NQOA 3HYIA 4QWQA 1MMDA 3S1RJ 2IW5A 2JPBA 3C1DA 3A03A 3OSFA 3ERMA 1JXSA 3CCRI 1QHHD 4A93J 4AIKA 5JFRA 2KKOA 3GBGA 3WTYC 3LQQA 1TLHB 1OCZH 1X1PA 3FM3A 2MH2A 1BIAA 1IW7F 4XLFA 3K4KA 1SFUA 2QQ8A 1R1TA 3TQNA 4O3MA 3KPHA 4M6VA 1MBEA 1OCRH 4BJTA 3IL2A 2V79A 5E3MA 2Y48A 1GV2A 1GXPA 3VYUB 3WTVC 1MJAA 4A3IJ 1ZGAA 3HRMA 1TL8A 2E2IJ 5TJJA 2O0YA 3R60A 3QODA 1SAUA 4I98B 2FMLA 4Q47A 1HSTA 2RVCA 3LFKA 3M1CA 1FY7A 2XGDA 3E0JB 4N9IA 2EIJH 1T0FA 1RZ4A 1WKMA 2E1NA 3DTIA 2LOOA 5HDGA 1G3YA 3VYSB 1ZHFA 1S72I 4PK4A 5ICEA 3B02A 4M6YA 4PJNA 4L9TA 4PJ0C 1H8AC 3VPRA 4RGSA 2FSWA 1Z05A 3W3CA 1QQIA 3V8LA 2FE3A 3G4SI 4M72A 2XKOA 2OBPA 2XV4S 3R4KA 3HOTA 1YS7A 2P4WA 2W4SA 4QIWN 4AIJA 5HLHA 2WB1A 5EEGA 1LE8B 3H3ZA 4GO1A 1D0YA 1IXCA 3H9GA 5E20A 1R7JA 1XMKA 4D7NA 3BG9A 2DOEA 4UVBA 4GDFA 3OYMA 3CO7C 4KMUX 5EJCA 3ZQQA 5E1XA 2QBYA 2HOAA 3F8FA 2RQPA 4A3EJ 2H8RA 3ZR8X 1Y1WJ 3RCOA 3I4NJ 1E17A 1MZBA 1DP7P 2FJ1A 1BJAA 3H5AA 5IOZA 4CYDA 2IPQX 3BWGA 4NNJA 5FJ8J 1J59A 1OFCX 4KYWA 3RYRA 3F8NA 2ZJPF 3S1NJ 1MJBA 2IGNA 4G6TB 4YFNF 1AHDP 2CQ7A 5IT3A 3ERED 1SAXA 1BBYA 2OQGA 5M3FJ 1U6GA 4XM3A 3J81K 1RESA 5C44J 4WX9A 5HODA 3OYEA 2QQAA 1U5TB 3AG4H 3KEQA 3W2WA 3J7YJ 4E7LA 1B72A 2UV1A 1QZZA 1JUMA 4ZYHA 3HRSA 1APLC 2P7VB 1ZG1A 4RLFA 2J5PA 3C3WA 3CP8A 3GF2A 5HS8A 2EB7A 2DTRA 2VB6A 3KE2A 3L2RA 1F1ZA 1SFKA 1WJFA 4CCOA 2FNPA 2HXOA 3B6CA 3CP2A 3DTKA 3J7AO 3I4MJ 3LSHA 1TQPA 2DK5A 4LOCA 1R5GA 2MFZA 4IJAA 3CO6C 3OWTA 4LG0B 3ONQA 4M9ZA 1SD4A 2F5FA 2XRLA 4E7ZA 1CGPA 3L00A 1OISA 2Z5UA 3UR3C 1JUSA 3I5UA 1R00A 3LSMA 3JRGA 3IRQA 1D8JA 3KP4A 4RM3A 4CXFA 1U9NA 3DU5A 2W24A 4M73A 4HDUA 3K6GA 2V7FA 2NVUB 1PUFB 4RAFA 2WAFA 1VQNI 4BDYA 3LSJA 2ZJRF 2G0EA 3ZMTA 5LHGA 4GYIA 1OCTC 5CVUA 1ZYRF 1AOYA 2STWA 1ULYA 4XN3A 2V9KA 4A6DA 1ZRDA 3FMSA 2OTLI 2IAIA 2CV2A 3EUAA 1YW7A 1V5FA 2DI3A 5F0CA 1KONA 2WADA 3TKYA 2B0LA 3CD6I 1XSVA 2M2EA 3OYIA 4CO8A 1NTCA 1UMQA 4CUGA 3A01A 4A3MJ 4DJAA 2E5NA 1LKXA 4WK8F 5GTIC 1YJ9I 4XQFA 3V7SA 4J19A 3D0SA 2L2OA 3V8JA 1ZN2A 3LQRA 1YTYA 4HW0A 2M34A 4LK1F 4EEFG 1O3QA 3A1YA 1ZLJA 3IH4A 2FUG2 3ULQB 1Y56A 2L01A 2R5ZA 1W5CC 2DA3A 1YIJI 3GTKJ 4A3LJ 3F0CA 3JRBA 3TP0A 4L5IA 4BXFA 4Y4RA 3GUDA 1E3PA 5E8IA 4YIRX 2CW7A 2P0WA 4BE0A 2OPTA 4E7KA 4DIQA 1ODDA 1R9TJ 2ELHA 4RAYA 3KX2A 2PLYA 5DTDA 5BPDA 1I39A 1QNTA 2BY2A 2ME0A 2GXBA 2OV7A 2EZLA 3MKYB 4J01A 1LDKB 4B48A 2QM3A 2CV0A 1PDNC 4UXNA 5F04A 5CQEA 1W0TA 3DV8A 3HOSA 4PSXA 2V9VA 3HC7A 3SFIA 3COAC 4CGZA 1OCCH 1ZQ3P 2E2JJ 2L3DA 2O3FA 2H27A 4H4KC 3H35A 1X58A 2UUZA 4Y33A 3I55I 1ZR2A 2GA2A 3GFIA 2ID3A 3CQZJ 3I9V2 5F6FA 1NK2P 1AWCA 1JHHA 2ISYA 2EZKA 5A2QK 1QVTA 3EYYA 3LSIA 2BV6A 4AUXA 2L9RA 1VI0A 5KK1A 1BA5A 2BXYA 5ED4A 2JTVA 1ENHA 2IXSA 5DD4A 2X1DA 4RM2A 1OYWA 1P92A 4ZH4F 4DOZA 3O2PE 3K4JA 3MZHA 3E5QA 4Z6YA 1Z9CA 5IPAA 1Y6IA 4ETSA 2VT2A 1OQYA 2VE8A 2ELJA 3HOYJ 1OYYA 3ML6A 3TDUC 2FNAA 3PIOF 3G6EI 2ZXJA 1VNDA 4RS8A 2LK2A 2G7UA 4A3CJ 1T2KA 1R49A 2PX9A 3U21A 5M5WJ 2PMHA 2YR2A 3CLOA 3K1MA 4NB5A 4H0EA 1QBJA 3H1CA 4AU7A 4KT5C 3FXUA 3WTWC 2XROA 3G73A 1V5GA 2D2WA 1EA3A 2BBYA 5HNHA 3QAHA 5FKNA 3CMMA 2EFQA 2Y30A 2LKXA 3ZQLA 1D8KA 3E6BA 2E7XA 1TW3A 2RAEA 2TRTA 5LD2C 2KIQA 2W1OA 1BOBA 1Y1VJ 2RNJA 4MGRA 2DU9A 5L3CA 1O3RA 1W7PD 1X1CA 2ID6A 1FBSA 2YX7A 3Q9SA 3F8MA 1I3QJ 3WODF 2VASA 4HEA2 1B6AA 1GHCA 3HOZJ 3BTLA 4BQNA 1RR8C 1U78A 1SD5A 2E7WA 1MMGA 2IA0A 3A0BC 1GVJA 2Y2ZA 5EF6A 3PJRA 2Y75A 2XDVA 2DXIA 2MW8A 2Z9OA 3GTPJ 2DMUA 3H3UA 3JSOA 1KYZA 1AA7A 2HOEA 2V4JC 3BOQA 2QQ9A 4ABZA 4BJ5C 1HCRA 1U2WA 3P9CA 4HX8A 3HIFA 1WHUA 2VQCA 2ZXIA 4XLNF 3PM1A 4JX4A 2R5YB 3BG6A 3GFMA 2M45A 2OJED 1KU2A 3HSFA 2H1LA 2R7QA 3W6KB 4FHTA 4F92B 4FTHA 1IC8A 1K61A 3G3ZA 2P5VA 1ZK8A 2B63J 4EATA 3EDPA 5JLWA 1DGRM 2V6EA 3NRVA 1D1BA 3IHUA 1FEXA 5GAEJ 4BAYA 1MBHA 1D0ZA 4F91B 3MKZA 3CC4I 3F6VA 1P7IA 5LRSA 2DJIA 5K7FA 4HF1A 2LY2A 4GCVA 3T8RA 3SZTA 4FT8A 3GTOJ 3G1LA 1WZ2A 3OIOA 2DN0A 3LL7A 3QOEA 2CRGA 1TWAJ 4CZCA 4ZTJA 3RPQA 1T0FC 3CZ6A 4BBRJ 2NRAC 2V1UA 5HNFA 3C18A 4G94A 3RQIA 2FMYA 1RUNA 4OOIA 5GADJ 4A69C 4JQFA 3AAFA 2EA4A 2DOAA 2OCEA 2FQ4A 4UB6C 1HW2A 3RKYA 4G9YA 1KQ0A 2KJCA 1MBGA 4II2A 3H5NA 3LWFA 1IZ1A 2EINH 2VI6A 2LSOA 2LVSA 2MGQA 4LLGF 1SD6A 4IRHA 2E35A 1LNWA 3CCUI 3CUQB 5EYRA 5IYDJ 3X2QH 3ELKA 2X0LA 4BHBA 3PSFA 3RQ4A 2H8WA 1IRXA 4B1RA 4GGGA 1KYWA 3KZIC 2COMA 3DLAA 2K27A 2JZYA 2DCEA 1DPRA 3LA3A 3K70C 2VONA 4AYBA 2X4HA 2DYSH 2R7SA 2G9WA 3OR1C 1X2NA 4S0HB 1VQ4I 3CMEI 2EH3A 2A5WA 2MA3A 4I7HA 4ZZDA 3E5XA 3E3VA 2QKLB 1VQ6I 2HKOA 5D4SA 4U7BA 1XN7A 1K4SA 1T6SA 2HYFA 3LA7A 1KQ8A 3J7AY 2BZTA 2IBDA 1R4MB 2HWVA 1MBJA 3IRRA 2LF8A 3C7JA 3WE2A 4IOCF 2M3AA 1B4AA 4RMNA 3HTSB 4NC7A 3VYRB 1FWZA 3V42A 2Y9YA 1IJWC 5ICFA 2XC7A 2KMUA 4QLCU 5L3EA 2OA4A 4IO9F 2WAQN 2EA2A 3L7WA 1WI9A 1S7OA 3DPTA 2HEOA 3BC8A 5D5UB 2JPCA 1X4OA 4XBFA 2W85A 2K86A 1MMAA 1DQUA 3V7RA 4KICA 2DFFA 3VSKA 2Q0OA 2NS8A 3E6CC 2A69F 5DS9A 1MNDA 3HXLA 3FBNB 4V2GA 4YRVA 2Q2EB 5CQGA 3SHFA 1FIPA 1S6LA 3DPLC 3VDXA 4IQ4A 5L3BA 5FFZA 1N78A 1FTZA 3CCJI 4IL6C 2KJBA 3KYDB 1XMXA 2K4JA 3ZN1A 2JA5J 5K5RA 1P2FA 3NWSA 3O8HA 2MC3A 4N9HA 2FOWA 3TBIA 2BE5F 4BUPA 3LMMA 2JSCA 5AONA 5IT9K 2AS5F 4X1EA 1NH3A 4OMYA 2CQKA 4AYBN 4Y17A 4BYYA 1UHMA 5CVRA 5FKOA 2OD5A 4QPOA 4WXDA 2R7WA 3CCEI 1T39A 3E6MA 3SYTA 4I6ZA 5CLSA 5KNLA 4W1UA 4B47A 4KIFA 1IF1A 4D0PA 1MSEC 2ZMEB 3TP3A 2H09A 1H88C 4D5CA 1YHQI 1B1BA 3M8EA 2OCCH 5GTHC 1BL0A 3IV5A 4F52A 5DV5A 3QP5A 3K9TA 2JSPA 1BW5A 1U8BA 2LF7A 1VZ0A 4MNUA 1SVMA 4P9FA 2RQQA 2EQRA 3JTGA 2KP6A 4ZJZA 5B3SH 1Z3XA 2D1HA 2W57A 4DQ2A 3FMQA 1XDSA 1ETQA 2ZKZA 3DKWA 3PIPF 1WVRA 3OYDA 3KYLA 1QVUA 4X6AJ 3S2WA 1JJ8C 2E2HJ 4CCJA 3OL4A 3RPUD 4RB3C 4HSTA 2GWRA 2FF4A 2BW3A 1TC3C 5GAHJ 2MG4A 1Z0XA 4UNOA 4DGWB 3DEUA 4A0XA 3QPHA 2A5YB 3KYCB 1BR1A 3Q0VA 2BY1A 5B5EC 1G3WA 1UHWA 5FB2A 3VFZA 2ZJ2A 1BM9A 4LIVA 1HDPA 4FX0A 1TWHJ 3FM5A 1XCBA 3JRAA 2CUEA 1JTYA 3BR0A 4LLLA 4B3AA 2KLOA 2Y0SA 3FIWA 1YJNI 3IH3A 5DEQA 1WI3A 4RB1A 2WA0A 3PNYA 3CESA 1FMWA 5D5VB 2CS3A 4LD5A 2O8XA 1LUJB 4YFKF 1KA8A 3G71I 3H5RA 2Z2SB 3IAS2 2EFPA 5M5YJ 3F8CA 3MEXA 2NAZA 4A5MA 4JX6A 1K4TA 2XSDC 4I0AA 1TT5B 2VC0A 1OJLA 4FE4A 2E1MC 1IUFA 1VQ5I 4BNCA 2DMNA 3A2KA 3HOWJ 1ZRFA 5KVRA 1U0JA 1Z7LA 3C2BA 1ZELA 4BJ6C 5FKLA 1IDZA 4AWXB 4KMFA 4IPAA 1BR4A 3FXQA 1LDDA 3FKJA 2XB0X 3KLNA 2EFNA 2F6CA 1OCOH 1KU7A 4C3JJ 2DMPA 1W5SA 3L9FA 2I10A 1VQ8I 1QO0D 2GQQA 1T95A 2NVXJ 1W0UA 5J3LA 3QOPA 4EQQA 3DF8A 2VUMJ 1PUFA 4UUTA 4XOPA 3AL0B 4U88A 4LFUA 4YEJA 3RYPA 3F8BA 4TV7A 5JVGF 2ACJA 1X4PA 3HOXJ 4OAZA 1DUXC 1AKHA 4DBQA 2O7OA 1R23A 2P6SA 4L9NA 3KZZA 1OLTA 3MKLA 4ENNA 1MDMB 5J4YA 3HOVJ 3B6AA 1XB4A 5K7HA 3K0LA 2R4GA 2ADUA 3OYGA 3H0GJ 3BR5A 2UZKA 1Q1VA 4CSWA 1TQMA 2HZTA 1R58A 3GTQJ 1KU3A 3HPHA 1MIJA 4BU2A 4L9VA 3HHGA 1EKEA 4RB0A 2A07F 3I0TA 1IXRC 1P9QC 2VPRA 3CCMI 1ZTRA 4BACA 3BT9A 3G1OA 4HNVA 1UELB 1WWXA 3WGGA 2E34A 5K5QA 3TO9A 5JHUA 3OYNA 2C6YA 3WG9A 2EFWA 1ORKA 1IN8A 1BW6A 3ZP5A 2KHMA 2RN7A 5DDGA 4ZZLA 3GVAA 1QA6A 2QEXI 4PCQA 2DPDA 1XDUA 1R36A 4HF2A 3MFKA 4JYKA 2HDDA 3OYBA 3FXMA 5LFAA 2MLKA 1RR7A 1HKTA 1NG6A 3TEDA 5DYMA 3IUOA 5E3OA 2GXGA 1KZHA 3K4MA 1DU6A 4OIQF 1MBKA 3SDGA 2KZGA 4B43A 4EM2A 4M74A 4ITVA 2IGMA 3HTUA 1FYKA 1Z6TA 5J1RA 1KGSA 1MW7A 2RDPA 4KN7X 2WWYA 1S8NA 1T98A 1IN5A 5DM6F 3TOAA 3GTGJ 4IHSA 5IT9Z 2Y69H 2TDXA 4KJZA 3K4NA 1ERDA 3I3LA 5FD5A 4B3XA 4AIDA 1UZCA 1WQ2A 4WCGA 1LVKA 1RC9A 1Y39A 5EDNA 4F93B 5D5XB 3OIPA 2M8GX 4C2TA 5HLIA 2RNGA 3AG3H 1JJ6C 1D5YA 2LRDA 3BTCA 3L2CA 4EM0B 3BR2A 5EEHA 4EMSA 1SC7A 1T38A 2YX4A 5F1RA 3JREA 2VOPA 2QZ8A 1WCMJ 3K69A 2LBFB 2XIGA 3W2VA 4C3IJ 1ZRCA 4KNYA 2VKEA 2HR3A 3MN2A 2M0MA 1JI8A 1T8IA 1YX3A 4M9SA 1H9TA 3WGIA 1G3SA 3PSIA 3S3OA 3DBLB 2JJ7A 1S5LC 3E5UA 2HU9A 3DQVC 2JVGA 4XIDA 3L1PA 2ESNA 3PNVA 1PP7U 1XD7A 2ELKA 3DBRB 3HZJA 3DEEA 1LQ1A 5FGMA 4HQEA 2D45A 2JQ7A 4UUSB 1A5JA 4OU0A 3TMOA 5K1YA 4RDUA 3LAJA 3K1NA 2XGCA 4BQOA 1E3OC 5IYCJ 3T1BA 2P5KA 4BDZA 4PJJA 5EG0A 3SFZA 4D5FA 2HDCA 4AD9A 2JRTA 1OMIA 1X3ZB 2NYXA 3BG7A 1HA8A 3DPUA 3HDDA 3VYTB 4LITA 4EGYA 2VQHA 1HOMA 2QSHX 4A3FJ 4HV6A 1OCPA 3PFIA 3BY6A 2WB1N 2F4MB 2W7NA 2EJRA 3GLLA 3RTRA 2R7FA 1GLNA 5ILVA 5EGOB 2DT6A 3BJOA 2XAFA 2HOTA 1J7KA 3ASOH 2QENA 3RZDJ 1NG7A 3HM5A 2XB5A 2DFIA 5C4JJ 3OOUA 4BGDA 2VQGA 1STZA 1J09A 2AQEA 2R7TA 2KRCA 3M07A 3IKVA 3HBLA 4LG3A 1JKOC 1YIOA 5J1YA 1X3WB 4PDKA 2R5YA 2IA1A 1E3HA 1FP1D 4PGHA 1YRNB 3OSGA 2XPWA 2IEKA 3HG9A 1K6OA 4IQJA 2DODA 4D9JA 1LFPA 2Z16A 2F2EA 4N0BA 2VXDA 3CCLI 5TRDA 1ZGWA 3OY9A 3LFUA 2QF7A 1BI3A 2A6EF 2DA4A 5L3GA 2A61A 1ZARA 2L54A 1F4KA 4MFDA 2PMZA 1W5TA 4OMZA 3DTEA 1OR7C 1G4DA 3IWFA 4BEHA 1VQMI 4I0BA 5E17F 4I76A 2CQNA 3GTLJ 5H20A 3SEQA 3HB9A 5FLVA 2K85A 5FKKA 2CO5A 2UXXA 3WTZA 2L7ZA 3S3NA 1PYVA 2ZXWH 3CF5F 2IS2A 2CW8A 2NXNB 2WY7Q 4PZJA 4DW6A 1S9HA 1GT0C 4XLEA 4MO7A 2R7RA 1K6YA 3OIQA 4FETA 5IYBJ 4C9YA 1F9NA 1XG1A 1UB9A 3M8JA 2QUFA 2XAUA 3S93A 1KU9A 5JLXA 5F0FA 1ETWA 3FF5A 1BIBA 4MEYF 3ZMUA 1JE8A 1ZG5A 5LGUA 4XLAA 1N75A 3W6VA 2RKHA 4NBQA 2HQRA 4HX4A 2H6CA 2YU9J 1K78A 2IRFG 3E6DA 2XF5A 1G59A 2DK8A 3SQNA 1OKRA 3K70D 2ZJQF 2R0QC 4A3DJ 3OR2C 3UKGA 2R92J 5M3MJ 2WTEA 5K5OA 2DA7A 4HA8A 3JW4A 1G8XA 4LGWA 4ZDLA 2BY3A 1B8IA 3O8GA 1IUYA 3HUGB 3SXYA 3H9JA 3R0AA 2X48A 3KLOA 3LSRA 3CMYA 3FDYA 2CH0A 2PJRB 2Y0MA 2XRNA 3QWLA 4XMYA 1QRYA 1WJ5A 1B59A 3JR9A 2OZUA 1U5TC 4HSRA 5LLQA 4UUVA 2LKPA 4EJTA 4XICA 2E71A 3K4CA 1S3JA 1CQTA 4JK1X 3P5JA 2OU2A 4NC6A 3H9QA 1FNNA 3IWZA 3ZQIA 4KFCA 4ANJA 1XTAA 5LHHA 2EZHA 2JUGA 3I54A 2PI0A 4LMYA 5ICCA 1V55H 2AQFA 2QQBA 3D1NI 3S2DJ 4XNFA 4OINF 3RI4A 2M5WA 5J4VA 1IG7A 3ZXSA 1BI1A 5DD8A 3LSPA 2BYVE 5KHDA 1HKSA 4NC8A 3RDIA 3GEZA 3M7GA 3L2WA 1J75A 4UVCA 2DA6A 1IV8A 3QU6A 2R93J 1UHSA 3LSGA 2KISA 3BJ6A 2Q2EA 1B72B 4XKWA 2P8TA 5F1JA 1X1AA 3OYLA 5JVTA 1CF7A 2JK3A 2ME6A 4XLCA 1W36C 1DU0A 3B73A 3CJTB 3P7NA 1YO5C 1FJLA 2JT1A 2RGVA 1X19A 2X1EA 1RUOA 3R61A 4ZTFA 2DFEA 5F27A 2ICWG 4S05A 3N97A 4EJVA 2DTZA 1F5TA 5L3FA 2PBIA 2RC4A 5IY5H 1RKTA 2XAHA 1MMSA 4DZJA 1F43A 1C0WA 2OQRA 4JX5A 4ESBA 3KP5A 3U9GA 2GIVA 1R5ID 1MKMA 4KISA 4HYEA 2F5VA 2LG4A 2KDZA 4ENKA 2GLOA 3WTSC 1YJWI 1TWFJ 3BCBA 2YS9A 4GYGA 1RKWA 5HVQC 3VOEA 2CUZA 3W2AA 2GIZA 4IRIA 1Y8QB 1IN7A 2HDWA 1QGPA 2ZMEA 4ESJA 1W7PB 4UV8A 5HDKA 4P96A 3QYEA 1U3EM 2JA8J 4K2EA 3OOPA 1N25A 1R22A 4M3BA 2CUJA 4O5VA 1DGWY 2GM4A 5IP9J 1IRGA 1IN6A 3CDIA 2ZCWA
chains in the Genus database with same CATH topology
1P4WA 3GW2A 3F21A 3KP2A 2K02A 4IVNA 5F64A 5DUKA 3WE3A 2ZFWA 5L3DA 1ONVA 2QYOA 4ASNA 5E1WA 3CJNA 2V6CA 4P55A 1V4RA 4A0ZA 1VTNC 2YU3A 4I09A 2LNBA 3ECOA 4MHGA 3TGNA 4M9XA 3FZVA 3VB2A 4KIBA 2DLLA 1XGMA 3WGHA 1Q1HA 2HKXA 2H94A 3T5XA 3V8KA 3EUHA 5H6QA 1FYMA 1MJ9A 1S29A 1FPQA 4KUMA 4FX4A 4WXHA 2EK5A 5FD6A 2D1VA 3CDHA 3RKXA 4EVIA 2HFHA 3TDZC 2DBBA 3GLXA 5J8CA 1D5VA 3ZMDA 1MDMA 3CUOA 2FBHA 2DW4A 2ISZA 4NHJA 3M9AA 3ABUA 5LBQA 3OV8A 2FOKA 4A12A 5BS6A 4Z2YA 3TO7A 3FHZA 4A2UA 3GX4X 1OR7A 1ZREA 2LDUA 1I6XA 2ZNZA 4MQ9F 1EH8A 5CYVA 1B9NA 3R6SA 1HSJA 3IKTA 1QZYA 1L0OC 3BP8A 3Q5FA 2M30A 2IA2A 1O7FA 3J80K 3TO6A 3BJAA 2RV8A 4YIIA 2ETHA 2QWWA 2CYYA 3ZPLA 4A0YA 2HQNA 2L4AA 5AIPA 2VBYA 1WSUA 4Y15A 3MAJA 5FO5A 2HTJA 1ZG3A 3FMRA 5HOOA 1YW8A 3I59B 3MWMA 3CUQC 2NNYA 1PUEE 2Z33A 1EV7A 1U5TA 1ZGJA 4BH9A 5ICGA 2BGCA 3LSTA 3KFWX 1HKQA 1LVAA 4ON0A 5E18F 2FBKA 3BDDA 4I01A 4IRGA 1FBQA 1XGSA 2R3SA 4UHTA 1XSXA 4LG0A 3NEUA 2AXLA 2XAJA 1LEBA 2DAOA 4HX7A 1YLFA 1FOKA 2GAUA 4HBLA 2FXAA 1JGSA 2QVOA 1HXDA 4EJUA 3F3XA 3JSPA 3E97A 1FT9A 3DXJF 1LJ9A 2E1CA 3L09A 2P6TA 2Q8KA 1KQ9A 3H92A 3ECHA 2VBXA 1LEAA 4G6QA 4EV0A 3DP7A 1XSDA 1XGNA 4B09A 3LA2A 2V1DA 1YFHA 5LEKA 3VODA 1HQCA 2F5EA 1L3LA 1LB2A 1FYLA 2EFOA 4AIHA 4BHCA 2FQ3A 3P9IA 4CICA 1FZPB 3T0YA 3R0JA 2GZWA 5LRRA 3BROA 5ERIA 3I4PA 4U0VA 4U0WA 2YPRA 5FFXA 2L4MA 2ZMEC 2QLZA 4UVAA 2Z3YA 2PQ8A 2R7DA 2XVCA 1R1VA 1W4MA 1YW9A 3KP3A 1Y0UA 6PAXA 1I1SA 2O6GE 2KIFA 4P5OA 1TNSA 4HLXA 4XSZF 5JR3A 2W84A 3HUGA 4R1HA 2A68F 4IXAA 5CVIA 3FXRA 1BN5A 3BZ6A 1SFEA 4IF4A 3W6JB 4HV5A 5BQTA 4ESFA 4Q5SF 1R5HA 2STTA 2DT5A 3J80Z 1OYIA 2VT3A 4HAMA 1UFMA 4RGXA 5HDNA 5D8KB 2FU4A 3F22A 2EV0A 1Z6RA 2CSOA 3EQLF 3GFLA 1YS6A 2PFBA 3ZMSA 4ZYGA 5D4RA 3GWZA 3QU3A 2DO7A 3CTAA 4U7DA 1BC7C 2WV0A 5CVJA 3M1EA 3HRUA 1NHAA 4EJWA 5CVVA 2MLGA 2XUBA 1J2XA 5DCMB 4JBAA 2L02A 3T8TA 4I2OA 1J9IA 4KN4X 4R79A 1W7PA 4Y13A 2XAGA 4KA4A 1XGOA 3U2RA 2VBWA 2DQRA 1ON2A 2M8EA 4P9UA 4RB2C 5D6FA 4B8XA 3RJPA 4BXUA 1ZLKA 1ZH5A 5FLXK 1JHFA 2YSRA 3GZ6A 3I64A 5DUIA 1P4XA 3ZMVA 3KETA 1I1GA 5BPIA 4WXCA 4F7ZA 5D8LB 4HOBA 2A3SA 2ZBKA 3PQJA 3JTHA 4NQWA 5DCFA 2O61A 2GA1A 2MH9A 1REPC 3CUQA 1H9GA 3TOBA 1RNLA 1SD7A 4BHPA 4YG2F 4CHUA 4WF2A 3JAMZ 2EV5A 1HW5A 3N4MA 4YFXF 1QPMA 4E70A 5ILUA 3F6OA 4OIRF 2UWMA 3Q9VA 1O3TA 3QPTA 5E8GA 2IVMA 1RIOH 3ZMZA 2K4BA 3D5LA 2XASA 2WC2A 2QBYB 3ABTA 3BPVA 4AVPA 2ZNYA 1FP2A 3EETA 1FC3A 1FX7A 2XHKA 1R1UA 4U0YA 4O6JA 4L0YB 1UCRA 4XRFA 2EWNA 2M1BA 1SMTA 3ROUA 2PMUA 4HQMA 4LB6B 4GXOA 4G6DA 1U8RA 1Z1DA 3F72A 3QP6A 2VC1A 4XLPF 2UXNA 3WTXC 3V7CA 1YYVA 4G7ZF 3I53A 5D6EA 4S04A 4LJZF 4RGRA 1FLIA 1TBXA 5BOXA 3ZQ7A 3BPXA 2CG4A 2VN2A 4RAZA 5AIQA 1B9MA 2Z99A 1SFXA 3J81Z 3LAPA 1GXQA 1J5YA 1EH7A 2KIUA 1HBXG 2OAZA 5BMZA 4LLNA 3WU0A 4ZYDA 3QRFF 3GZ5A 5JI6A 1OPCA 1WRJA 2DPUA 3MQ0A 4MEXF 2HTSA 5D5WB 4MTEA 2IP2A 1FSEA 4MQVA 1LDJA 5J8FA 1X3UA 4CZZA 3HHHA 2BEOA 2F5DA 3P9KA 3I59A 5HLGA 4UV9A 5HS7A 2MD5A 1I27A 1J0RA 2XKPA 3KCCA 3GYHX 1HW1A 1H0MA 3GXOA 1TTYA 1BI0A 5H6RA 1PP8F 5FLXZ 2VBZA 1DDNA 4OIOF 3VEPA 4M6XA 3RPUA 4G7HF 4IHTA 2P7CB 1YQAA 2PN6A 4OIPF 4HF0A 4KDPA 1IAWA 3M8FA 1K78B 2NS0A 2MBFA 2PEXA 4XSXF 3KZYA 3WTUC 3DFGA 1MD0A 4HDVA 4L0ZB 1FSHA 3EYIA 4PGGA 1TW2A 4A6EA 1BI2A 4ZYEA 1YG2A 2XGXA 4R8HA 4RGUA 1BC8C 2F5CA 1G3TA 1Z7UA 2VODA 2G7HA 3FWEA 2DQLA 4LB5A 3GFJA 3FX3A 2A6HF 4CDGA 3SZPA 4EM1A 1K7AA 4L18B 2M87A 5ILSA 1P4AA 4KIGA 5E1ZB 4HLYA 2EV6A 2ESHA 3MCZA 2CGPA 1BOAA 5A2QZ 1O7LA 2CWEA 1DPUA 2PJPA 3V4GA 1CF7B 3ZN0A 1A04A 1O3SA 1I5ZA 3IC7A 1MGTA 5LGNA 3WTTC 1EH6A 1TNTA 1IN4A 2O03A 4Q48A 2IJLA 3MZYA 2VE9A 4G7OF 2V1XA 1USSA 1XCVA 2J5OA 1IXSB 2IT0A 2H6BA 5J6XA 2HYGD 1USTA 1FBUA 2FA5A 3REOA 2HGCA 2NNNA 4MTDA 1O57A 1IRFA 1S7AA 2KRFA 1ON1A 2VOOA 2FRHA 3HSRA 4DNCA 2FEZA 2VXZA 2FBIA 3HRTA 4BQAA 3HSEA 4I02A 3I58A 1RI7A 1P6RA 5LHIA 1G6NA 5CJ9A 1D3YA 3K2ZA 1XMAA 2OZ6A 4LK0F 1Z91A 2XAQA 1ZAOA 4EJOA 4YIFA 4M71A 5LGTA 4WWCA 2W25A 4EGZA 2CW0F 2ZO4A 3KP7A 4ENJA 3KP6A 2PG4A 3K1PA 2K7LA 3KEOA 4G8XA 3F23A 3ISPA 3PQKA 2HS5A 1SMYF 4HZFA 3O6BB 4A5NA 5DCMA 3I71A 5LEJA 2P5LC 2KIMA 5HS9A 1TQIA 3RKWA 3O3KA 3U1DA 4ENMA 4L9JA 1V3FA 4L5JA 3RIRA 3GO5A 2CFXA 4Q4ZF 1K79A 3JAMK 1E2XA 3WU1B 3NQOA 3HYIA 4QWQA 2IW5A 2JPBA 3C1DA 1JXSA 4AIKA 5JFRA 2KKOA 3WTYC 3LQQA 1TLHB 3FM3A 2MH2A 1BIAA 1IW7F 1SFUA 1R1TA 3TQNA 4O3MA 3IL2A 2V79A 2Y48A 1GXPA 3WTVC 1MJAA 1ZGAA 3HRMA 5TJJA 2O0YA 3R60A 4I98B 2FMLA 4Q47A 1HSTA 2RVCA 3LFKA 1FY7A 4N9IA 1T0FA 1RZ4A 1WKMA 2E1NA 5HDGA 1G3YA 1ZHFA 5ICEA 3B02A 4M6YA 4L9TA 4RGSA 2FSWA 1Z05A 1QQIA 3V8LA 2FE3A 4M72A 2XKOA 2OBPA 2XV4S 3R4KA 3HOTA 1YS7A 2P4WA 4AIJA 5HLHA 5EEGA 3H3ZA 4GO1A 1IXCA 5E20A 1R7JA 1XMKA 4UVBA 3CO7C 4KMUX 5E1XA 2QBYA 3F8FA 2RQPA 1E17A 1MZBA 1DP7P 1BJAA 4CYDA 2IPQX 3BWGA 1J59A 4KYWA 3RYRA 3F8NA 1MJBA 4YFNF 5IT3A 3ERED 1SAXA 1BBYA 2OQGA 1U6GA 3J81K 4WX9A 2QQAA 1U5TB 3KEQA 1QZZA 4ZYHA 3HRSA 2P7VB 1ZG1A 2J5PA 3C3WA 3GF2A 5HS8A 2EB7A 2DTRA 3KE2A 1F1ZA 2FNPA 3J7AO 1TQPA 2DK5A 1R5GA 4IJAA 3CO6C 4LG0B 4M9ZA 1SD4A 2F5FA 1CGPA 3L00A 2Z5UA 3I5UA 1R00A 3IRQA 1D8JA 3KP4A 4CXFA 2W24A 4M73A 4HDUA 3ZMTA 5LHGA 4GYIA 5CVUA 1ZYRF 1AOYA 2STWA 1ULYA 4A6DA 1ZRDA 3FMSA 1YW7A 2DI3A 3TKYA 2B0LA 1XSVA 4CO8A 4WK8F 3V7SA 3D0SA 3V8JA 1ZN2A 3LQRA 1YTYA 4HW0A 4LK1F 1O3QA 1ZLJA 3ULQB 2L01A 4L5IA 5E8IA 3GUDA 1ODDA 2ELHA 4RAYA 2PLYA 5BPDA 1QNTA 2GXBA 1LDKB 2QM3A 1PDNC 4UXNA 3DV8A 3HOSA 2V9VA 3COAC 4CGZA 2L3DA 2O3FA 2H27A 2GA2A 3GFIA 5F6FA 1AWCA 1JHHA 2ISYA 5A2QK 3EYYA 2BV6A 5KK1A 5ED4A 2JTVA 5DD4A 1OYWA 1P92A 4ZH4F 3O2PE 3MZHA 3E5QA 1Z9CA 4ETSA 2VT2A 2VE8A 1OYYA 3ML6A 3TDUC 2FNAA 2ZXJA 4RS8A 2G7UA 1T2KA 3K1MA 2PMHA 2YR2A 4NB5A 4H0EA 3CLOA 1QBJA 4KT5C 3FXUA 3WTWC 2XROA 3G73A 2D2WA 2BBYA 3QAHA 2EFQA 1D8KA 3E6BA 2E7XA 1TW3A 4MGRA 2RNJA 2DU9A 5L3CA 1O3RA 1W7PD 1FBSA 2YX7A 3Q9SA 3F8MA 3WODF 1B6AA 1GHCA 1U78A 1SD5A 2E7WA 2IA0A 1GVJA 2Y75A 2Z9OA 3H3UA 3JSOA 1KYZA 2HOEA 3BOQA 2QQ9A 1U2WA 3P9CA 4HX8A 3HIFA 4XLNF 3GFMA 2M45A 1KU2A 3HSFA 3W6KB 4FHTA 3G3ZA 2P5VA 3EDPA 3NRVA 3IHUA 4BAYA 3F6VA 5LRSA 4HF1A 4GCVA 3T8RA 3SZTA 4FT8A 2NRAC 3RPQA 2V1UA 3C18A 4G94A 2FMYA 1RUNA 4OOIA 4JQFA 3AAFA 2EA4A 1HW2A 3RKYA 4G9YA 1KQ0A 2KJCA 3LWFA 1IZ1A 2LSOA 4LLGF 1SD6A 4IRHA 1LNWA 3CUQB 3ELKA 2X0LA 4BHBA 4GGGA 1KYWA 2COMA 2K27A 2JZYA 1DPRA 3LA3A 2VONA 2X4HA 2G9WA 2MA3A 4I7HA 4ZZDA 3E5XA 3E3VA 2HKOA 5D4SA 4U7BA 1XN7A 1T6SA 2HYFA 3LA7A 1KQ8A 2HWVA 3IRRA 2LF8A 3C7JA 3WE2A 1B4AA 3HTSB 1FWZA 5ICFA 4QLCU 5L3EA 2OA4A 2EA2A 3L7WA 1WI9A 1S7OA 3DPTA 2HEOA 5D5UB 2JPCA 4XBFA 2W85A 2K86A 3V7RA 4KICA 2Q0OA 3E6CC 2A69F 3SHFA 1S6LA 3DPLC 5L3BA 5FFZA 2KJBA 3ZN1A 2K4JA 5K5RA 1P2FA 2MC3A 4N9HA 2BE5F 2JSCA 5AONA 5IT9K 2AS5F 4OMYA 2CQKA 4Y17A 4BYYA 1UHMA 5CVRA 2OD5A 4WXDA 1T39A 3E6MA 5CLSA 4KIFA 1IF1A 4D0PA 2ZMEB 2H09A 1B1BA 3M8EA 5DV5A 3QP5A 3K9TA 2LF7A 4MNUA 4P9FA 3JTGA 2D1HA 2W57A 4DQ2A 3FMQA 1XDSA 2ZKZA 3DKWA 3S2WA 4RB3C 2GWRA 2FF4A 4UNOA 3DEUA 4A0XA 3QPHA 2A5YB 1G3WA 1UHWA 5FB2A 3VFZA 2ZJ2A 1BM9A 4FX0A 3FM5A 1XCBA 4LLLA 5DEQA 4RB1A 5D5VB 4LD5A 2O8XA 4YFKF 1KA8A 2EFPA 3F8CA 3MEXA 2NAZA 4A5MA 4I0AA 2VC0A 4BNCA 1ZRFA 5KVRA 4AWXB 4KMFA 4IPAA 3FXQA 1LDDA 3KLNA 2EFNA 1KU7A 1W5SA 3L9FA 1QO0D 2GQQA 3QOPA 4EQQA 3DF8A 4U88A 4LFUA 3RYPA 3F8BA 4TV7A 2ACJA 1DUXC 1R23A 2P6SA 4L9NA 3KZZA 4ENNA 1MDMB 1XB4A 3K0LA 2ADUA 2UZKA 1TQMA 2HZTA 1R58A 1KU3A 4L9VA 3HHGA 4RB0A 2A07F 3I0TA 1IXRC 1WWXA 3WGGA 5K5QA 3TO9A 5JHUA 2C6YA 3WG9A 2EFWA 1IN8A 3ZP5A 2RN7A 5DDGA 4ZZLA 3GVAA 4PCQA 2DPDA 1XDUA 1R36A 4HF2A 3MFKA 2MLKA 1HKTA 5DYMA 2GXGA 4OIQF 4EM2A 4M74A 1FYKA 3HTUA 1Z6TA 1KGSA 2RDPA 4KN7X 2WWYA 1S8NA 1T98A 1IN5A 3TOAA 4IHSA 5IT9Z 2TDXA 5FD5A 1WQ2A 4WCGA 5D5XB 5HLIA 3L2CA 4EM0B 4EMSA 5EEHA 1T38A 2YX4A 5F1RA 2VOPA 2QZ8A 3K69A 2XIGA 1ZRCA 4KNYA 2HR3A 4M9SA 1H9TA 3WGIA 1G3SA 3E5UA 3DQVC 2ESNA 1PP7U 1XD7A 1LQ1A 5FGMA 4HQEA 2D45A 4OU0A 5K1YA 3LAJA 3K1NA 3T1BA 2P5KA 3SFZA 2HDCA 4AD9A 2JRTA 1OMIA 2NYXA 4EGYA 4HV6A 3PFIA 3BY6A 2EJRA 3RTRA 2R7FA 5ILVA 3BJOA 2XAFA 1J7KA 2QENA 2DFIA 1STZA 3IKVA 1YIOA 4PDKA 2IA1A 1FP1D 4PGHA 1K6OA 2F2EA 4N0BA 5TRDA 1BI3A 2A6EF 5L3GA 2A61A 1ZARA 2L54A 1F4KA 1W5TA 4OMZA 1G4DA 3IWFA 4I0BA 5E17F 5H20A 2CO5A 2UXXA 3WTZA 4PZJA 1F9NA 1UB9A 2QUFA 1KU9A 3FF5A 1BIBA 4MEYF 3ZMUA 1JE8A 1ZG5A 5LGUA 2RKHA 2HQRA 4HX4A 2H6CA 1K78A 2IRFG 3E6DA 2DK8A 3SQNA 1OKRA 2WTEA 5K5OA 4HA8A 3JW4A 4LGWA 1IUYA 3SXYA 3R0AA 3KLOA 2Y0MA 2XRNA 1B59A 2OZUA 1U5TC 5LLQA 4UUVA 2LKPA 4EJTA 1S3JA 4JK1X 2OU2A 1FNNA 3IWZA 4KFCA 5LHHA 3I54A 2PI0A 4LMYA 5ICCA 2QQBA 4OINF 3RI4A 2M5WA 1BI1A 5DD8A 2BYVE 1HKSA 3RDIA 1J75A 3GEZA 3M7GA 4UVCA 3QU6A 3BJ6A 2Q2EA 2P8TA 5JVTA 1CF7A 3B73A 3P7NA 1YO5C 2JT1A 2RGVA 1RUOA 3R61A 4S05A 3N97A 4EJVA 1F5TA 5L3FA 2PBIA 2RC4A 2XAHA 1C0WA 2OQRA 4ESBA 3KP5A 3U9GA 2GIVA 1MKMA 4HYEA 4ENKA 3WTSC 4GYGA 5HVQC 3VOEA 4IRIA 1IN7A 1QGPA 2ZMEA 4ESJA 1W7PB 4UV8A 5HDKA 4P96A 1U3EM 4K2EA 3OOPA 1R22A 4O5VA 1IRGA 1IN6A 2ZCWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P4W A;  3GW2 A;  3F21 A;  3KP2 A;  2K02 A;  4IVN A;  5F64 A;  5DUK A;  3WE3 A;  2ZFW A;  5L3D A;  1ONV A;  2QYO A;  4ASN A;  5E1W A;  3CJN A;  2V6C A;  4P55 A;  1V4R A;  4A0Z A;  1VTN C;  2YU3 A;  4I09 A;  2LNB A;  3ECO A;  4MHG A;  3TGN A;  4M9X A;  3FZV A;  3VB2 A;  4KIB A;  2DLL A;  1XGM A;  3WGH A;  1Q1H A;  2HKX A;  2H94 A;  3T5X A;  3V8K A;  3EUH A;  5H6Q A;  1FYM A;  1MJ9 A;  1S29 A;  1FPQ A;  4KUM A;  4FX4 A;  4WXH A;  2EK5 A;  5FD6 A;  2D1V A;  3CDH A;  3RKX A;  4EVI A;  2HFH A;  3TDZ C;  2DBB A;  3GLX A;  5J8C A;  1D5V A;  3ZMD A;  1MDM A;  3CUO A;  2FBH A;  2DW4 A;  2ISZ A;  4NHJ A;  3M9A A;  3ABU A;  5LBQ A;  3OV8 A;  2FOK A;  4A12 A;  5BS6 A;  4Z2Y A;  3TO7 A;  3FHZ A;  4A2U A;  3GX4 X;  1OR7 A;  1ZRE A;  2LDU A;  1I6X A;  2ZNZ A;  4MQ9 F;  1EH8 A;  5CYV A;  1B9N A;  3R6S A;  1HSJ A;  3IKT A;  1QZY A;  1L0O C;  3BP8 A;  3Q5F A;  2M30 A;  2IA2 A;  1O7F A;  3J80 K;  3TO6 A;  3BJA A;  2RV8 A;  4YII A;  2ETH A;  2QWW A;  2CYY A;  3ZPL A;  4A0Y A;  2HQN A;  2L4A A;  5AIP A;  2VBY A;  1WSU A;  4Y15 A;  3MAJ A;  5FO5 A;  2HTJ A;  1ZG3 A;  3FMR A;  5HOO A;  1YW8 A;  3I59 B;  3MWM A;  3CUQ C;  2NNY A;  1PUE E;  2Z33 A;  1EV7 A;  1U5T A;  1ZGJ A;  4BH9 A;  5ICG A;  2BGC A;  3LST A;  3KFW X;  1HKQ A;  1LVA A;  4ON0 A;  5E18 F;  2FBK A;  3BDD A;  4I01 A;  4IRG A;  1FBQ A;  1XGS A;  2R3S A;  4UHT A;  1XSX A;  4LG0 A;  3NEU A;  2AXL A;  2XAJ A;  1LEB A;  2DAO A;  4HX7 A;  1YLF A;  1FOK A;  2GAU A;  4HBL A;  2FXA A;  1JGS A;  2QVO A;  1HXD A;  4EJU A;  3F3X A;  3JSP A;  3E97 A;  1FT9 A;  3DXJ F;  1LJ9 A;  2E1C A;  3L09 A;  2P6T A;  2Q8K A;  1KQ9 A;  3H92 A;  3ECH A;  2VBX A;  1LEA A;  4G6Q A;  4EV0 A;  3DP7 A;  1XSD A;  1XGN A;  4B09 A;  3LA2 A;  2V1D A;  1YFH A;  5LEK A;  3VOD A;  1HQC A;  2F5E A;  1L3L A;  1LB2 A;  1FYL A;  2EFO A;  4AIH A;  4BHC A;  2FQ3 A;  3P9I A;  4CIC A;  1FZP B;  3T0Y A;  3R0J A;  2GZW A;  5LRR A;  3BRO A;  5ERI A;  3I4P A;  4U0V A;  4U0W A;  2YPR A;  5FFX A;  2L4M A;  2ZME C;  2QLZ A;  4UVA A;  2Z3Y A;  2PQ8 A;  2R7D A;  2XVC A;  1R1V A;  1W4M A;  1YW9 A;  3KP3 A;  1Y0U A;  6PAX A;  1I1S A;  2O6G E;  2KIF A;  4P5O A;  1TNS A;  4HLX A;  4XSZ F;  5JR3 A;  2W84 A;  3HUG A;  4R1H A;  2A68 F;  4IXA A;  5CVI A;  3FXR A;  1BN5 A;  3BZ6 A;  1SFE A;  4IF4 A;  3W6J B;  4HV5 A;  5BQT A;  4ESF A;  4Q5S F;  1R5H A;  2STT A;  2DT5 A;  3J80 Z;  1OYI A;  2VT3 A;  4HAM A;  1UFM A;  4RGX A;  5HDN A;  5D8K B;  2FU4 A;  3F22 A;  2EV0 A;  1Z6R A;  2CSO A;  3EQL F;  3GFL A;  1YS6 A;  2PFB A;  3ZMS A;  4ZYG A;  5D4R A;  3GWZ A;  3QU3 A;  2DO7 A;  3CTA A;  4U7D A;  1BC7 C;  2WV0 A;  5CVJ A;  3M1E A;  3HRU A;  1NHA A;  4EJW A;  5CVV A;  2MLG A;  2XUB A;  1J2X A;  5DCM B;  4JBA A;  2L02 A;  3T8T A;  4I2O A;  1J9I A;  4KN4 X;  4R79 A;  1W7P A;  4Y13 A;  2XAG A;  4KA4 A;  1XGO A;  3U2R A;  2VBW A;  2DQR A;  1ON2 A;  2M8E A;  4P9U A;  4RB2 C;  5D6F A;  4B8X A;  3RJP A;  4BXU A;  1ZLK A;  1ZH5 A;  5FLX K;  1JHF A;  2YSR A;  3GZ6 A;  3I64 A;  5DUI A;  1P4X A;  3ZMV A;  3KET A;  1I1G A;  5BPI A;  4WXC A;  4F7Z A;  5D8L B;  4HOB A;  2A3S A;  2ZBK A;  3PQJ A;  3JTH A;  4NQW A;  5DCF A;  2O61 A;  2GA1 A;  2MH9 A;  1REP C;  3CUQ A;  1H9G A;  3TOB A;  1RNL A;  1SD7 A;  4BHP A;  4YG2 F;  4CHU A;  4WF2 A;  3JAM Z;  2EV5 A;  1HW5 A;  3N4M A;  4YFX F;  1QPM A;  4E70 A;  5ILU A;  3F6O A;  4OIR F;  2UWM A;  3Q9V A;  1O3T A;  3QPT A;  5E8G A;  2IVM A;  1RIO H;  3ZMZ A;  2K4B A;  3D5L A;  2XAS A;  2WC2 A;  2QBY B;  3ABT A;  3BPV A;  4AVP A;  2ZNY A;  1FP2 A;  3EET A;  1FC3 A;  1FX7 A;  2XHK A;  1R1U A;  4U0Y A;  4O6J A;  4L0Y B;  1UCR A;  4XRF A;  2EWN A;  2M1B A;  1SMT A;  3ROU A;  2PMU A;  4HQM A;  4LB6 B;  4GXO A;  4G6D A;  1U8R A;  1Z1D A;  3F72 A;  3QP6 A;  2VC1 A;  4XLP F;  2UXN A;  3WTX C;  3V7C A;  1YYV A;  4G7Z F;  3I53 A;  5D6E A;  4S04 A;  4LJZ F;  4RGR A;  1FLI A;  1TBX A;  5BOX A;  3ZQ7 A;  3BPX A;  2CG4 A;  2VN2 A;  4RAZ A;  5AIQ A;  1B9M A;  2Z99 A;  1SFX A;  3J81 Z;  3LAP A;  1GXQ A;  1J5Y A;  1EH7 A;  2KIU A;  1HBX G;  2OAZ A;  5BMZ A;  4LLN A;  3WU0 A;  4ZYD A;  3QRF F;  3GZ5 A;  5JI6 A;  1OPC A;  1WRJ A;  2DPU A;  3MQ0 A;  4MEX F;  2HTS A;  5D5W B;  4MTE A;  2IP2 A;  1FSE A;  4MQV A;  1LDJ A;  5J8F A;  1X3U A;  4CZZ A;  3HHH A;  2BEO A;  2F5D A;  3P9K A;  3I59 A;  5HLG A;  4UV9 A;  5HS7 A;  2MD5 A;  1I27 A;  1J0R A;  2XKP A;  3KCC A;  3GYH X;  1HW1 A;  1H0M A;  3GXO A;  1TTY A;  1BI0 A;  5H6R A;  1PP8 F;  5FLX Z;  2VBZ A;  1DDN A;  4OIO F;  3VEP A;  4M6X A;  3RPU A;  4G7H F;  4IHT A;  2P7C B;  1YQA A;  2PN6 A;  4OIP F;  4HF0 A;  4KDP A;  1IAW A;  3M8F A;  1K78 B;  2NS0 A;  2MBF A;  2PEX A;  4XSX F;  3KZY A;  3WTU C;  3DFG A;  1MD0 A;  4HDV A;  4L0Z B;  1FSH A;  3EYI A;  4PGG A;  1TW2 A;  4A6E A;  1BI2 A;  4ZYE A;  1YG2 A;  2XGX A;  4R8H A;  4RGU A;  1BC8 C;  2F5C A;  1G3T A;  1Z7U A;  2VOD A;  2G7H A;  3FWE A;  2DQL A;  4LB5 A;  3GFJ A;  3FX3 A;  2A6H F;  4CDG A;  3SZP A;  4EM1 A;  1K7A A;  4L18 B;  2M87 A;  5ILS A;  1P4A A;  4KIG A;  5E1Z B;  4HLY A;  2EV6 A;  2ESH A;  3MCZ A;  2CGP A;  1BOA A;  5A2Q Z;  1O7L A;  2CWE A;  1DPU A;  2PJP A;  3V4G A;  1CF7 B;  3ZN0 A;  1A04 A;  1O3S A;  1I5Z A;  3IC7 A;  1MGT A;  5LGN A;  3WTT C;  1EH6 A;  1TNT A;  1IN4 A;  2O03 A;  4Q48 A;  2IJL A;  3MZY A;  2VE9 A;  4G7O F;  2V1X A;  1USS A;  1XCV A;  2J5O A;  1IXS B;  2IT0 A;  2H6B A;  5J6X A;  2HYG D;  1UST A;  1FBU A;  2FA5 A;  3REO A;  2HGC A;  2NNN A;  4MTD A;  1O57 A;  1IRF A;  1S7A A;  2KRF A;  1ON1 A;  2VOO A;  2FRH A;  3HSR A;  4DNC A;  2FEZ A;  2VXZ A;  2FBI A;  3HRT A;  4BQA A;  3HSE A;  4I02 A;  3I58 A;  1RI7 A;  1P6R A;  5LHI A;  1G6N A;  5CJ9 A;  1D3Y A;  3K2Z A;  1XMA A;  2OZ6 A;  4LK0 F;  1Z91 A;  2XAQ A;  1ZAO A;  4EJO A;  4YIF A;  4M71 A;  5LGT A;  4WWC A;  2W25 A;  4EGZ A;  2CW0 F;  2ZO4 A;  3KP7 A;  4ENJ A;  3KP6 A;  2PG4 A;  3K1P A;  2K7L A;  3KEO A;  4G8X A;  3F23 A;  3ISP A;  3PQK A;  2HS5 A;  1SMY F;  4HZF A;  3O6B B;  4A5N A;  5DCM A;  3I71 A;  5LEJ A;  2P5L C;  2KIM A;  5HS9 A;  1TQI A;  3RKW A;  3O3K A;  3U1D A;  4ENM A;  4L9J A;  1V3F A;  4L5J A;  3RIR A;  3GO5 A;  2CFX A;  4Q4Z F;  1K79 A;  3JAM K;  1E2X A;  3WU1 B;  3NQO A;  3HYI A;  4QWQ A;  2IW5 A;  2JPB A;  3C1D A;  1JXS A;  4AIK A;  5JFR A;  2KKO A;  3WTY C;  3LQQ A;  1TLH B;  3FM3 A;  2MH2 A;  1BIA A;  1IW7 F;  1SFU A;  1R1T A;  3TQN A;  4O3M A;  3IL2 A;  2V79 A;  2Y48 A;  1GXP A;  3WTV C;  1MJA A;  1ZGA A;  3HRM A;  5TJJ A;  2O0Y A;  3R60 A;  4I98 B;  2FML A;  4Q47 A;  1HST A;  2RVC A;  3LFK A;  1FY7 A;  4N9I A;  1T0F A;  1RZ4 A;  1WKM A;  2E1N A;  5HDG A;  1G3Y A;  1ZHF A;  5ICE A;  3B02 A;  4M6Y A;  4L9T A;  4RGS A;  2FSW A;  1Z05 A;  1QQI A;  3V8L A;  2FE3 A;  4M72 A;  2XKO A;  2OBP A;  2XV4 S;  3R4K A;  3HOT A;  1YS7 A;  2P4W A;  4AIJ A;  5HLH A;  5EEG A;  3H3Z A;  4GO1 A;  1IXC A;  5E20 A;  1R7J A;  1XMK A;  4UVB A;  3CO7 C;  4KMU X;  5E1X A;  2QBY A;  3F8F A;  2RQP A;  1E17 A;  1MZB A;  1DP7 P;  1BJA A;  4CYD A;  2IPQ X;  3BWG A;  1J59 A;  4KYW A;  3RYR A;  3F8N A;  1MJB A;  4YFN F;  5IT3 A;  3ERE D;  1SAX A;  1BBY A;  2OQG A;  1U6G A;  3J81 K;  4WX9 A;  2QQA A;  1U5T B;  3KEQ A;  1QZZ A;  4ZYH A;  3HRS A;  2P7V B;  1ZG1 A;  2J5P A;  3C3W A;  3GF2 A;  5HS8 A;  2EB7 A;  2DTR A;  3KE2 A;  1F1Z A;  2FNP A;  3J7A O;  1TQP A;  2DK5 A;  1R5G A;  4IJA A;  3CO6 C;  4LG0 B;  4M9Z A;  1SD4 A;  2F5F A;  1CGP A;  3L00 A;  2Z5U A;  3I5U A;  1R00 A;  3IRQ A;  1D8J A;  3KP4 A;  4CXF A;  2W24 A;  4M73 A;  4HDU A;  3ZMT A;  5LHG A;  4GYI A;  5CVU A;  1ZYR F;  1AOY A;  2STW A;  1ULY A;  4A6D A;  1ZRD A;  3FMS A;  1YW7 A;  2DI3 A;  3TKY A;  2B0L A;  1XSV A;  4CO8 A;  4WK8 F;  3V7S A;  3D0S A;  3V8J A;  1ZN2 A;  3LQR A;  1YTY A;  4HW0 A;  4LK1 F;  1O3Q A;  1ZLJ A;  3ULQ B;  2L01 A;  4L5I A;  5E8I A;  3GUD A;  1ODD A;  2ELH A;  4RAY A;  2PLY A;  5BPD A;  1QNT A;  2GXB A;  1LDK B;  2QM3 A;  1PDN C;  4UXN A;  3DV8 A;  3HOS A;  2V9V A;  3COA C;  4CGZ A;  2L3D A;  2O3F A;  2H27 A;  2GA2 A;  3GFI A;  5F6F A;  1AWC A;  1JHH A;  2ISY A;  5A2Q K;  3EYY A;  2BV6 A;  5KK1 A;  5ED4 A;  2JTV A;  5DD4 A;  1OYW A;  1P92 A;  4ZH4 F;  3O2P E;  3MZH A;  3E5Q A;  1Z9C A;  4ETS A;  2VT2 A;  2VE8 A;  1OYY A;  3ML6 A;  3TDU C;  2FNA A;  2ZXJ A;  4RS8 A;  2G7U A;  1T2K A;  3K1M A;  2PMH A;  2YR2 A;  4NB5 A;  4H0E A;  3CLO A;  1QBJ A;  4KT5 C;  3FXU A;  3WTW C;  2XRO A;  3G73 A;  2D2W A;  2BBY A;  3QAH A;  2EFQ A;  1D8K A;  3E6B A;  2E7X A;  1TW3 A;  4MGR A;  2RNJ A;  2DU9 A;  5L3C A;  1O3R A;  1W7P D;  1FBS A;  2YX7 A;  3Q9S A;  3F8M A;  3WOD F;  1B6A A;  1GHC A;  1U78 A;  1SD5 A;  2E7W A;  2IA0 A;  1GVJ A;  2Y75 A;  2Z9O A;  3H3U A;  3JSO A;  1KYZ A;  2HOE A;  3BOQ A;  2QQ9 A;  1U2W A;  3P9C A;  4HX8 A;  3HIF A;  4XLN F;  3GFM A;  2M45 A;  1KU2 A;  3HSF A;  3W6K B;  4FHT A;  3G3Z A;  2P5V A;  3EDP A;  3NRV A;  3IHU A;  4BAY A;  3F6V A;  5LRS A;  4HF1 A;  4GCV A;  3T8R A;  3SZT A;  4FT8 A;  2NRA C;  3RPQ A;  2V1U A;  3C18 A;  4G94 A;  2FMY A;  1RUN A;  4OOI A;  4JQF A;  3AAF A;  2EA4 A;  1HW2 A;  3RKY A;  4G9Y A;  1KQ0 A;  2KJC A;  3LWF A;  1IZ1 A;  2LSO A;  4LLG F;  1SD6 A;  4IRH A;  1LNW A;  3CUQ B;  3ELK A;  2X0L A;  4BHB A;  4GGG A;  1KYW A;  2COM A;  2K27 A;  2JZY A;  1DPR A;  3LA3 A;  2VON A;  2X4H A;  2G9W A;  2MA3 A;  4I7H A;  4ZZD A;  3E5X A;  3E3V A;  2HKO A;  5D4S A;  4U7B A;  1XN7 A;  1T6S A;  2HYF A;  3LA7 A;  1KQ8 A;  2HWV A;  3IRR A;  2LF8 A;  3C7J A;  3WE2 A;  1B4A A;  3HTS B;  1FWZ A;  5ICF A;  4QLC U;  5L3E A;  2OA4 A;  2EA2 A;  3L7W A;  1WI9 A;  1S7O A;  3DPT A;  2HEO A;  5D5U B;  2JPC A;  4XBF A;  2W85 A;  2K86 A;  3V7R A;  4KIC A;  2Q0O A;  3E6C C;  2A69 F;  3SHF A;  1S6L A;  3DPL C;  5L3B A;  5FFZ A;  2KJB A;  3ZN1 A;  2K4J A;  5K5R A;  1P2F A;  2MC3 A;  4N9H A;  2BE5 F;  2JSC A;  5AON A;  5IT9 K;  2AS5 F;  4OMY A;  2CQK A;  4Y17 A;  4BYY A;  1UHM A;  5CVR A;  2OD5 A;  4WXD A;  1T39 A;  3E6M A;  5CLS A;  4KIF A;  1IF1 A;  4D0P A;  2ZME B;  2H09 A;  1B1B A;  3M8E A;  5DV5 A;  3QP5 A;  3K9T A;  2LF7 A;  4MNU A;  4P9F A;  3JTG A;  2D1H A;  2W57 A;  4DQ2 A;  3FMQ A;  1XDS A;  2ZKZ A;  3DKW A;  3S2W A;  4RB3 C;  2GWR A;  2FF4 A;  4UNO A;  3DEU A;  4A0X A;  3QPH A;  2A5Y B;  1G3W A;  1UHW A;  5FB2 A;  3VFZ A;  2ZJ2 A;  1BM9 A;  4FX0 A;  3FM5 A;  1XCB A;  4LLL A;  5DEQ A;  4RB1 A;  5D5V B;  4LD5 A;  2O8X A;  4YFK F;  1KA8 A;  2EFP A;  3F8C A;  3MEX A;  2NAZ A;  4A5M A;  4I0A A;  2VC0 A;  4BNC A;  1ZRF A;  5KVR A;  4AWX B;  4KMF A;  4IPA A;  3FXQ A;  1LDD A;  3KLN A;  2EFN A;  1KU7 A;  1W5S A;  3L9F A;  1QO0 D;  2GQQ A;  3QOP A;  4EQQ A;  3DF8 A;  4U88 A;  4LFU A;  3RYP A;  3F8B A;  4TV7 A;  2ACJ A;  1DUX C;  1R23 A;  2P6S A;  4L9N A;  3KZZ A;  4ENN A;  1MDM B;  1XB4 A;  3K0L A;  2ADU A;  2UZK A;  1TQM A;  2HZT A;  1R58 A;  1KU3 A;  4L9V A;  3HHG A;  4RB0 A;  2A07 F;  3I0T A;  1IXR C;  1WWX A;  3WGG A;  5K5Q A;  3TO9 A;  5JHU A;  2C6Y A;  3WG9 A;  2EFW A;  1IN8 A;  3ZP5 A;  2RN7 A;  5DDG A;  4ZZL A;  3GVA A;  4PCQ A;  2DPD A;  1XDU A;  1R36 A;  4HF2 A;  3MFK A;  2MLK A;  1HKT A;  5DYM A;  2GXG A;  4OIQ F;  4EM2 A;  4M74 A;  1FYK A;  3HTU A;  1Z6T A;  1KGS A;  2RDP A;  4KN7 X;  2WWY A;  1S8N A;  1T98 A;  1IN5 A;  3TOA A;  4IHS A;  5IT9 Z;  2TDX A;  5FD5 A;  1WQ2 A;  4WCG A;  5D5X B;  5HLI A;  3L2C A;  4EM0 B;  4EMS A;  5EEH A;  1T38 A;  2YX4 A;  5F1R A;  2VOP A;  2QZ8 A;  3K69 A;  2XIG A;  1ZRC A;  4KNY A;  2HR3 A;  4M9S A;  1H9T A;  3WGI A;  1G3S A;  3E5U A;  3DQV C;  2ESN A;  1PP7 U;  1XD7 A;  1LQ1 A;  5FGM A;  4HQE A;  2D45 A;  4OU0 A;  5K1Y A;  3LAJ A;  3K1N A;  3T1B A;  2P5K A;  3SFZ A;  2HDC A;  4AD9 A;  2JRT A;  1OMI A;  2NYX A;  4EGY A;  4HV6 A;  3PFI A;  3BY6 A;  2EJR A;  3RTR A;  2R7F A;  5ILV A;  3BJO A;  2XAF A;  1J7K A;  2QEN A;  2DFI A;  1STZ A;  3IKV A;  1YIO A;  4PDK A;  2IA1 A;  1FP1 D;  4PGH A;  1K6O A;  2F2E A;  4N0B A;  5TRD A;  1BI3 A;  2A6E F;  5L3G A;  2A61 A;  1ZAR A;  2L54 A;  1F4K A;  1W5T A;  4OMZ A;  1G4D A;  3IWF A;  4I0B A;  5E17 F;  5H20 A;  2CO5 A;  2UXX A;  3WTZ A;  4PZJ A;  1F9N A;  1UB9 A;  2QUF A;  1KU9 A;  3FF5 A;  1BIB A;  4MEY F;  3ZMU A;  1JE8 A;  1ZG5 A;  5LGU A;  2RKH A;  2HQR A;  4HX4 A;  2H6C A;  1K78 A;  2IRF G;  3E6D A;  2DK8 A;  3SQN A;  1OKR A;  2WTE A;  5K5O A;  4HA8 A;  3JW4 A;  4LGW A;  1IUY A;  3SXY A;  3R0A A;  3KLO A;  2Y0M A;  2XRN A;  1B59 A;  2OZU A;  1U5T C;  5LLQ A;  4UUV A;  2LKP A;  4EJT A;  1S3J A;  4JK1 X;  2OU2 A;  1FNN A;  3IWZ A;  4KFC A;  5LHH A;  3I54 A;  2PI0 A;  4LMY A;  5ICC A;  2QQB A;  4OIN F;  3RI4 A;  2M5W A;  1BI1 A;  5DD8 A;  2BYV E;  1HKS A;  3RDI A;  1J75 A;  3GEZ A;  3M7G A;  4UVC A;  3QU6 A;  3BJ6 A;  2Q2E A;  2P8T A;  5JVT A;  1CF7 A;  3B73 A;  3P7N A;  1YO5 C;  2JT1 A;  2RGV A;  1RUO A;  3R61 A;  4S05 A;  3N97 A;  4EJV A;  1F5T A;  5L3F A;  2PBI A;  2RC4 A;  2XAH A;  1C0W A;  2OQR A;  4ESB A;  3KP5 A;  3U9G A;  2GIV A;  1MKM A;  4HYE A;  4ENK A;  3WTS C;  4GYG A;  5HVQ C;  3VOE A;  4IRI A;  1IN7 A;  1QGP A;  2ZME A;  4ESJ A;  1W7P B;  4UV8 A;  5HDK A;  4P96 A;  1U3E M;  4K2E A;  3OOP A;  1R22 A;  4O5V A;  1IRG A;  1IN6 A;  2ZCW A; 
#chains in the Genus database with same CATH topology
 2GBY A;  1WGX A;  5B1B H;  1P4W A;  3CDL A;  2DMQ A;  3JRH A;  1N77 A;  2VL8 A;  3GW2 A;  3F21 A;  3KP2 A;  2JVH A;  1A36 A;  2K02 A;  4IVN A;  5F64 A;  4JOM A;  5DUK A;  3WE3 A;  4AVZ A;  3CJR B;  2DDA A;  2ZFW A;  1YE9 A;  5L3D A;  1ONV A;  2QYO A;  3A01 B;  2GXA A;  4ASN A;  4C2U A;  5E1W A;  4OAY A;  4C30 A;  3CJN A;  2DDB A;  5CPR B;  2BHY A;  2KL4 A;  2E1O A;  4ZC3 A;  2LTP A;  3H3V K;  4NQW B;  3HEF A;  2V6C A;  4P55 A;  1V4R A;  4A0Z A;  1VTN C;  1TP4 A;  1JUP A;  3FK6 A;  2GOM A;  4CYC B;  2YU3 A;  3RSN A;  4I09 A;  2LNB A;  3ECO A;  5H2F C;  4MHG A;  3TGN A;  4M9X A;  2Z1D A;  2M7B A;  3C2G A;  3FIS A;  4E7H A;  5GPC A;  3FZV A;  3VB2 A;  4KIB A;  2CMP A;  1JGG A;  2X6X A;  1O4X A;  3G1M A;  2DLL A;  2IGK A;  3HL2 A;  2DFH A;  1XGM A;  2QGU A;  5KCM A;  4XN0 A;  1YOV B;  3WGH A;  1Q1H A;  2HKX A;  2H94 A;  3T5X A;  3CMA I;  1HF0 A;  3V8K A;  1ZR4 A;  1TT0 A;  2BVL A;  3EUH A;  5H6Q A;  2W48 A;  1SFO J;  2Y9Z A;  1FYM A;  1MJ9 A;  3OYK A;  1ACI A;  1S29 A;  1FPQ A;  3HKZ N;  4KUM A;  4FX4 A;  9ANT A;  4WXH A;  2EK5 A;  5FD6 A;  3S16 J;  2D1V A;  1IV6 A;  3FK7 A;  3CDH A;  3RKX A;  4EVI A;  2O8K A;  2R7Z J;  2HFH A;  4CCK A;  5IP7 J;  3ZRG A;  1DP3 A;  2IS1 A;  3TDZ C;  2DBB A;  1WH5 A;  3GLX A;  5J8C A;  3ESW B;  1D5V A;  1WJA A;  2X6O A;  4XOR A;  3ZMD A;  1MDM A;  3CUO A;  2FBH A;  1D1C A;  2NS7 A;  1R71 A;  3CCY A;  2DW4 A;  4IOA F;  5FLM J;  1TWG J;  1WJD A;  3JCU C;  3LNQ A;  2ISZ A;  4M3F A;  3BTI A;  1D0X A;  3J7Z I;  4NHJ A;  3M9A A;  3ABU A;  5LBQ A;  2JA6 J;  4AM3 A;  3OV8 A;  2FOK A;  4PJM A;  2NOJ B;  5BS6 A;  4A12 A;  4Z2Y A;  1ETK A;  3TO7 A;  2CJJ A;  2VJ4 A;  3L2V A;  3U1K A;  3FHZ A;  4A2U A;  2HXI A;  1OR7 A;  2ECC A;  3GX4 X;  1ZRE A;  2LDU A;  1I6X A;  2ZNZ A;  2K9M A;  4MQ9 F;  1EH8 A;  5CYV A;  4XRS G;  1B9N A;  3R6S A;  1LFU P;  3ZGK A;  3KIO A;  1HSJ A;  3IKT A;  2VIX A;  2MYS A;  1QZY A;  2AXT C;  3UNG C;  4DYC A;  4HPQ A;  1JKP C;  5TIS C;  1L0O C;  3BLY A;  3EUK L;  5TGT A;  3BP8 A;  4QPQ A;  1HC8 A;  3Q5F A;  1FTT A;  2M30 A;  2KPM A;  1LE8 A;  2IA2 A;  1O7F A;  2R7O A;  3J80 K;  3TO6 A;  3BR3 A;  3BJA A;  3RKQ A;  2RV8 A;  4YII A;  2ETH A;  2QWW A;  2CYY A;  2X1C A;  1JKQ C;  2IS6 A;  3ZPL A;  1QPI A;  4A0Y A;  1MNM C;  2HQN A;  2V26 A;  4E7S A;  4V2F A;  5E79 C;  2L4A A;  4FAS D;  3CCQ I;  5AIP A;  5FRM A;  2VBY A;  3S32 A;  1WSU A;  4Y15 A;  1H89 C;  3MAJ A;  5DM7 F;  2E60 A;  5FO5 A;  2HTJ A;  1ZG3 A;  3FMR A;  5HOO A;  1YW8 A;  2VPL A;  2L9S A;  3I59 B;  2HYJ A;  3MWM A;  4A3K J;  3CUQ C;  4MIM A;  2NNY A;  2FD5 A;  1PUE E;  2LBF A;  1PVE A;  2Z33 A;  2K40 A;  3L2Q A;  1EV7 A;  5BNG A;  1IO2 A;  2O5R A;  2LRE A;  1U5T A;  2X51 A;  1ZGJ A;  4BXX J;  1NK3 P;  4BH9 A;  5ICG A;  2BGC A;  2WBM A;  3LST A;  1MBF A;  4BY1 J;  3KFW X;  1HKQ A;  1ZKG A;  1LVA A;  4NDL A;  4ON0 A;  5B66 C;  4UUS A;  5E18 F;  2FBK A;  3BDD A;  2NVY J;  4I01 A;  4IRG A;  4DBR A;  2LY1 A;  4FQG A;  5J40 A;  4FCY A;  1FBQ A;  1XGS A;  2A6T A;  2LC2 A;  3SJM A;  2R3S A;  5EZH A;  4UHT A;  1XSX A;  4LG0 A;  4A3B J;  3NEU A;  3OYF A;  4IX7 A;  2AXL A;  2XAJ A;  1LEB A;  3GTJ J;  2DAO A;  4HX7 A;  2WV1 A;  2GOX B;  4V19 K;  1YLF A;  1VQ9 I;  5EGO A;  1FOK A;  2GAU A;  4HBL A;  2JA2 A;  2FXA A;  3L2U A;  1JGS A;  2QVO A;  1HXD A;  3HGY A;  1I50 J;  4XL9 A;  4EJU A;  3OS2 A;  3F3X A;  3JSP A;  3E97 A;  1FT9 A;  2F4O B;  3DXJ F;  2XF6 A;  1LJ9 A;  2R7X A;  4PFO A;  2E1C A;  3L09 A;  1E0E A;  2HNH A;  4J00 A;  2P6T A;  2K9Q A;  2Q8K A;  1KQ9 A;  3H92 A;  2TCT A;  3ECH A;  2VBX A;  1YRN A;  1MNE A;  2ZB9 A;  3SDB A;  1LEA A;  4B4C A;  2AHQ A;  4G6Q A;  4EV0 A;  3DP7 A;  1XSD A;  1GUU A;  1XGN A;  3RZO J;  4B09 A;  2N8G A;  3LA2 A;  2V1D A;  1YFH A;  3D5R C;  5LEK A;  3VOD A;  1HQC A;  2F5E A;  2VQL A;  3FXJ A;  1TZL A;  1L3L A;  1LB2 A;  3GME A;  1FYL A;  2EFO A;  1T56 A;  2HVQ A;  2QA4 I;  1XPX A;  2BXZ A;  4AIH A;  4BHC A;  3DBH B;  1BJZ A;  2FQ3 A;  3P9I A;  2Y0S N;  4CIC A;  4I99 C;  3T0Y A;  1FZP B;  1VQK I;  3R0J A;  2GZW A;  3A0H C;  3BR6 A;  5LRR A;  3BRO A;  5ERI A;  3I4P A;  4U0V A;  4U0W A;  3PUF A;  4HNU A;  2YPR A;  5FFX A;  2L4M A;  2ZME C;  3VWB A;  4Y7N J;  4XKB A;  2QLZ A;  3I56 I;  2M9H A;  1VQ7 I;  4UVA A;  2L0K A;  2Z3Y A;  2HVR A;  4C3H J;  2D5V A;  2PQ8 A;  2R7D A;  2XVC A;  1R1V A;  1W4M A;  1QZE A;  1YW9 A;  2MSY A;  2M4K A;  1MMN A;  5IP6 A;  3KP3 A;  5FRN A;  3MZ8 A;  1Y0U A;  6PAX A;  1I1S A;  1I3A A;  3OL3 A;  2O6G E;  2OC6 A;  3GCM A;  3OS0 A;  3DEW A;  1HLV A;  2RRE A;  1T33 A;  2K9S A;  3FXL A;  2KIF A;  4IHY A;  4P5O A;  1TNS A;  2BVM A;  4HLX A;  4XR6 A;  4CH7 A;  2F48 A;  3K2A A;  4XSZ F;  2B9S A;  3S15 J;  5JR3 A;  2W84 A;  2VJJ A;  3HUG A;  1YX5 A;  4R1H A;  4ZYA A;  2DMT A;  2LD5 A;  2A68 F;  2E36 A;  4IXA A;  5CVI A;  2PJR A;  3FXR A;  1BN5 A;  2F4I A;  3BZ6 A;  3LOC A;  3BZC A;  1SFE A;  4IF4 A;  1ETO A;  4E7J A;  2X6W A;  1FIA A;  3W6J B;  4HV5 A;  5BQT A;  4ESF A;  2KZV A;  4BKX A;  4Q5S F;  1R5H A;  1F36 A;  2HI3 A;  2X85 A;  2STT A;  4U87 A;  1IRZ A;  3QQA A;  1FOW A;  2DT5 A;  3VSL A;  3J80 Z;  1OYI A;  2VT3 A;  2BW3 B;  4HAM A;  1UFM A;  1ETV A;  4RGX A;  3OYC A;  1ITY A;  3WU2 C;  2IGO A;  2OF7 A;  5HDN A;  5D8K B;  2AO9 A;  2FU4 A;  3F22 A;  2NOG A;  4XKV A;  2EV0 A;  1A6I A;  1Z6R A;  2COB A;  2CSO A;  3EQL F;  4RLQ A;  1W36 D;  2R7U A;  2JRM A;  3GFL A;  2EIK H;  3EUH C;  4XRM A;  4QSH A;  1YS6 A;  3DKY A;  1GDT A;  1XX5 A;  3MD2 A;  2PFB A;  3ZMS A;  3QPS A;  5EZG A;  1WH7 A;  4ZYG A;  5D4R A;  3IP4 B;  3GWZ A;  3QU3 A;  1X2M A;  5C3E J;  4HRI A;  2DO7 A;  2YUS A;  1MSF C;  3CTA A;  4UB8 C;  1JKR C;  3G2B A;  3AL0 C;  4A3G J;  4U7D A;  2LR8 A;  3PFY A;  2BOL A;  4AC0 A;  1BC7 C;  2WV0 A;  4FE7 A;  3M1E A;  5CVJ A;  3HRU A;  1NHA A;  2KT0 A;  3ASN H;  1FMV A;  3BG3 A;  4EJW A;  2L9V A;  1XS9 A;  5CVV A;  2MLG A;  2XUB A;  3BG5 A;  4IKF A;  1J2X A;  5DCM B;  4JBA A;  2L02 A;  3T8T A;  2M7A A;  4I2O A;  1MH3 A;  1J9I A;  4KN4 X;  1IGN A;  4R79 A;  1W7P A;  4IEJ A;  3BQZ A;  3S3M A;  3FBI B;  4Y13 A;  2XAG A;  4P1W A;  1XGO A;  3U2R A;  4KA4 A;  4BQQ A;  2CUF A;  2VBW A;  2DQR A;  2VLA A;  4W97 A;  4JP0 A;  1ON2 A;  3PO2 J;  2M8E A;  4P9U A;  4RB2 C;  3LSK A;  5D6F A;  2XSJ C;  4B8X A;  3RJP A;  1VQP I;  3BR1 A;  1AKH B;  2LKS A;  4BXU A;  1ZLK A;  1ZH5 A;  5FLX K;  1JHF A;  2YSR A;  3GZ6 A;  3HKZ A;  3I64 A;  5DUI A;  1PJR A;  3AG1 H;  1P4X A;  4N4N B;  3QYB A;  3S17 J;  1XC5 A;  4PFP A;  3NAU A;  3ZMV A;  3KET A;  1I1G A;  5BPI A;  4WXC A;  4F7Z A;  5D8L B;  4HOB A;  1IDY A;  2A3S A;  2ZBK A;  3ABM H;  3PQJ A;  4DYQ A;  3JTH A;  4NQW A;  5DCF A;  4XLH A;  2O61 A;  2GA1 A;  2MH9 A;  1REP C;  4M3D A;  2H1K A;  3CUQ A;  3DWL E;  2KDO A;  1H9G A;  4XK4 A;  1A6Q A;  3TOB A;  5B1A H;  1RNL A;  1SD7 A;  4BHP A;  4YG2 F;  4PJL A;  4CYC A;  4CHU A;  4WF2 A;  2I8D A;  4F55 A;  3JAM Z;  2EV5 A;  1HW5 A;  3N4M A;  1RPW A;  4YFX F;  3DU6 A;  3AG2 H;  1QPM A;  4E70 A;  5ILU A;  3F6O A;  1LFB A;  4OIR F;  1D1A A;  3SZG A;  3K7A J;  1A31 A;  2QCO A;  2UWM A;  2X9D A;  1V5E A;  2V9P A;  3Q9V A;  1O3T A;  3QPT A;  5E8G A;  4XKC A;  1WJC A;  3EPZ A;  2QSG X;  3F9K A;  2IVM A;  3K4L A;  1RIO H;  2DJN A;  3ZMZ A;  2K4B A;  3D5L A;  4GRI A;  3E1S A;  2XAS A;  3OYA A;  2WC2 A;  2QBY B;  3KEY A;  3ABT A;  2DOF A;  3BPV A;  4CCL A;  4AVP A;  2PMZ N;  2ZNY A;  1FP2 A;  3EET A;  4C2M J;  1FC3 A;  1FX7 A;  2XPU A;  2XGE A;  2XHK A;  1SAN A;  3OYH A;  4KT6 A;  1R1U A;  4U0Y A;  4G12 A;  4O6J A;  2EPF A;  2L5Q A;  4YEL A;  4RBO A;  3JRI A;  1UCR A;  4L0Y B;  2W82 A;  3PL8 A;  2K9N A;  3C2H A;  3Q3S A;  4XRF A;  2EWN A;  1LPQ A;  2M1B A;  5GAG J;  1SMT A;  2DA5 A;  3ROU A;  1AU7 A;  1Z77 A;  3DLL F;  2L7F P;  2PMU A;  5J1U A;  4HQM A;  4LB6 B;  2ECB A;  3CJQ B;  4GXO A;  3FXK A;  4G6D A;  2JA7 J;  1U8R A;  1Z1D A;  2HOS A;  3F72 A;  3QP6 A;  1VF9 A;  4A3J J;  2VC1 A;  3BQY A;  4XLP F;  4E4H A;  4X0G A;  2UXN A;  3WTX C;  3V7C A;  4ZDO A;  1YYV A;  3TW6 A;  3CC2 I;  4G7Z F;  4BY7 J;  2VJI A;  3WHB A;  3I53 A;  5D6E A;  4S04 A;  4LJZ F;  4PSW A;  4RGR A;  4QTR A;  1FLI A;  1TBX A;  5BOX A;  5EEA A;  5EG0 B;  4XOT A;  3ZQ7 A;  3MKW B;  2JMW A;  2L9N A;  3BPX A;  3SEZ A;  3PUB A;  2EIM H;  2CG4 A;  4GFB A;  2VN2 A;  2WY8 Q;  4RAZ A;  4PUS A;  4Y52 J;  5AIQ A;  1B9M A;  2JWT A;  2Z99 A;  2CFO A;  4F3Q A;  1SFX A;  3A02 A;  4IHX A;  2LH9 A;  2ZFU A;  3J81 Z;  3BTJ A;  1GXQ A;  3LAP A;  1J5Y A;  1EH7 A;  2KIU A;  1HBX G;  4MLO A;  4B44 A;  2OAZ A;  2ZSI B;  3S1M J;  5BMZ A;  4LLN A;  3WU0 A;  1GV5 A;  4ZYD A;  3QRF F;  3GZ5 A;  4KIT B;  5JI6 A;  1SEU A;  1TWC J;  3MMY B;  1OPC A;  1QU3 A;  1WRJ A;  2DPU A;  2VKH A;  3MQ0 A;  4MEX F;  4BBS J;  2CQQ A;  2HTS A;  2M4G A;  5D5W B;  2NVT J;  4MTE A;  2IP2 A;  1FSE A;  4CCM A;  5KAF C;  3BZK A;  4MQV A;  1FOX A;  2MAB A;  1LDJ A;  5J8F A;  2LLK A;  1X3U A;  4BL0 B;  2BY0 A;  2E5Z A;  3NAR A;  4CZZ A;  3JRD A;  3M4O J;  5FKM A;  3HHH A;  3MVP A;  2BEO A;  1UJ8 A;  1QHG A;  4N4O B;  2HQA A;  5GPA A;  2ZC2 A;  2F5D A;  2ZXH A;  3P9K A;  4BS9 A;  3I59 A;  5HLG A;  1HDD C;  4IHW A;  4UV9 A;  4BEH B;  3A4C A;  5HS7 A;  1Y0N A;  2MD5 A;  1I27 A;  2WAQ A;  1J0R A;  2XKP A;  3OMY A;  5E3N A;  3KCC A;  3S14 J;  3GYH X;  2HPI A;  1HW1 A;  3K4B A;  5FRO A;  2DA1 A;  1H0M A;  2OTJ I;  3GXO A;  1TTY A;  3PNT A;  2R5Z B;  1BI0 A;  5H6R A;  1PP8 F;  1JT0 A;  3HGG A;  3PO3 J;  5FLX Z;  2VBZ A;  1DDN A;  4OIO F;  3VEP A;  1U9O A;  4M6X A;  3RPU A;  4G7H F;  3N05 A;  4IHT A;  2P7C B;  5C4X J;  1YQA A;  1WPK A;  3ABL H;  3QPL A;  1K83 J;  5F0H A;  3ZQH A;  2PN6 A;  4OIP F;  2XF7 A;  4HF0 A;  4KDP A;  1IAW A;  2MC4 A;  3M8F A;  1K78 B;  2VJ5 A;  2NS0 A;  2MBF A;  2Q1Z B;  4M3G A;  2PEX A;  4XSX F;  3KZY A;  2HVS A;  2JN6 A;  3JRF A;  3WTU C;  2DT7 B;  3D5S C;  4XRS A;  3DFG A;  1MD0 A;  4HDV A;  5F08 A;  2EZI A;  4L0Z B;  2O9L A;  1FSH A;  1B8I B;  3EYI A;  3S2H J;  2R7V A;  2L7K A;  2LFB A;  4PGG A;  1TW2 A;  4A6E A;  3CCS I;  1BI2 A;  2ZSH B;  2HQ5 A;  1M1E B;  3ZOB A;  2JUC A;  5JHF A;  3ZQC A;  2WAE A;  3CF2 A;  2KFD A;  4ZYE A;  1YG2 A;  2IS4 A;  2XGX A;  4R8H A;  3GTM J;  3OYJ A;  4RGU A;  1BC8 C;  2F5C A;  1G3T A;  5GP9 A;  3S8P A;  1Z7U A;  2VOD A;  2G7H A;  1W1W E;  2DQL A;  3FWE A;  2KRH A;  4LB5 A;  2A05 A;  3GFJ A;  3FX3 A;  2E1M B;  4IZZ A;  2A6H F;  4CDG A;  3DKX A;  5K7Z A;  3SZP A;  4EM1 A;  1K7A A;  4ZDP A;  2XPV A;  1RET A;  2L7M P;  4L18 B;  3HOU J;  2M87 A;  5ILS A;  1P4A A;  1EF4 A;  4KIG A;  5E1Z B;  1X1B A;  4HLY A;  3FXO A;  2LMD A;  2EV6 A;  2X6Y A;  5IOY A;  1JT6 A;  1P7J A;  2HZD A;  3FHN A;  2ESH A;  3CC7 I;  3MCZ A;  2K9L A;  2CGP A;  1X1D A;  1BOA A;  2VKV A;  5A2Q Z;  1Z3Y A;  3K10 A;  1O7L A;  2CWE A;  1DPU A;  1UG0 A;  4BE1 A;  2PJP A;  4BE2 A;  3V4G A;  1RRJ A;  1CF7 B;  3ZN0 A;  3E7L A;  4XON A;  1A04 A;  2VKD A;  1O3S A;  4D7M A;  5J47 A;  4OWR B;  2CU7 A;  2CQX A;  1I5Z A;  2FX0 A;  3IC7 A;  1MGT A;  4FIS A;  5LGN A;  2EBI A;  3ZQF A;  3WTT C;  1EH6 A;  1TNT A;  1IN4 A;  2P81 A;  2O03 A;  1V54 H;  1Y8R B;  4Q48 A;  5CKT A;  2IJL A;  3H0D A;  2QSF X;  2MD0 A;  3FKI J;  3MZY A;  2W00 A;  2VE9 A;  1YI2 I;  3HJE A;  1FOY A;  3TW7 A;  1R6R A;  4G7O F;  3BCA A;  1WFX A;  1EJ9 A;  2E19 A;  2V1X A;  1USS A;  2LY9 A;  2V1N A;  4II3 A;  1XCV A;  2J5O A;  3WG7 H;  3IAM 2;  1IXS B;  3IH2 A;  2IT0 A;  2H6B A;  3CLQ A;  4LIU A;  5J6X A;  2HYG D;  1UST A;  4UY8 I;  1FBU A;  2FA5 A;  3REO A;  2OUM A;  1ETX A;  2HGC A;  2LP0 A;  1MH4 A;  2B7E A;  2NNN A;  4RA2 A;  4DYR A;  3JRC A;  4MTD A;  2EIL H;  1O57 A;  3Q0U A;  1IRF A;  1S7A A;  2KRF A;  1ON1 A;  4HG2 A;  2FRH A;  4RAG A;  2VOO A;  3HSR A;  2BHZ A;  1UG2 A;  4DNC A;  1ETY A;  4DZP A;  3ABK H;  3OS1 A;  2FEZ A;  2DYR H;  2VXZ A;  2NVQ J;  2FBI A;  3HRT A;  1JTX A;  4BQA A;  2K3P A;  3HSE A;  1R4N B;  4I02 A;  1Z21 A;  1YIT I;  3I58 A;  1RI7 A;  1P6R A;  3M3Y J;  1A35 A;  1G2H A;  4IHV A;  5LHI A;  1G6N A;  3AKZ A;  1WJE A;  5CJ9 A;  3ZCO A;  1D3Y A;  2LYC A;  3K2Z A;  1XMA A;  2I5U A;  2OZ6 A;  4LK0 F;  2DA2 A;  2M0C A;  1SVL A;  2QKM B;  1Z91 A;  3QYF A;  4MFE A;  2XAQ A;  2HPM A;  3TL4 X;  1ZAO A;  3GZN B;  3CCV I;  4M3E A;  4EJO A;  4YIF A;  4M71 A;  5LGT A;  4E7I A;  4D1Q A;  4WWC A;  2W25 A;  5M5X J;  2KQR A;  4EGZ A;  2CW0 F;  2ZO4 A;  3KP7 A;  1Z67 A;  2K3F A;  3Q0W A;  3KP6 A;  4ENJ A;  2PG4 A;  1VQO I;  4NUB A;  1POG A;  1I6H J;  3K1P A;  2K7L A;  3KEO A;  1VFC A;  4E6K G;  5HLT A;  4Y3O A;  4G8X A;  3HPG A;  3F23 A;  3ISP A;  3PQK A;  1SVO A;  3NWT A;  2HS5 A;  1SMY F;  1WJB A;  4HZF A;  3O6B B;  3WHC A;  4A5N A;  3H36 A;  3I71 A;  4L5E A;  5DCM A;  5LEJ A;  2P5L C;  2KIM A;  3S1Q J;  5HS9 A;  1GVD A;  2Y31 A;  1BR2 A;  2K5C A;  1VQL I;  3ZQG A;  1S7E A;  4CCN A;  1TQI A;  3RKW A;  1T08 B;  3O3K A;  3U1D A;  4ENM A;  4L9J A;  1V3F A;  5KAI C;  4L5J A;  2CV1 A;  3RIR A;  5E3L A;  4CA0 A;  1UAA A;  4HNT A;  3AFH A;  3GO5 A;  2CFX A;  4Q4Z F;  3DCF A;  1K79 A;  3JAM K;  1E2X A;  3WU1 B;  3NQO A;  3HYI A;  4QWQ A;  1MMD A;  3S1R J;  2IW5 A;  2JPB A;  3C1D A;  3A03 A;  3OSF A;  3ERM A;  1JXS A;  3CCR I;  1QHH D;  4A93 J;  4AIK A;  5JFR A;  2KKO A;  3GBG A;  3WTY C;  3LQQ A;  1TLH B;  1OCZ H;  1X1P A;  3FM3 A;  2MH2 A;  1BIA A;  1IW7 F;  4XLF A;  3K4K A;  1SFU A;  2QQ8 A;  1R1T A;  3TQN A;  4O3M A;  3KPH A;  4M6V A;  1MBE A;  1OCR H;  4BJT A;  3IL2 A;  2V79 A;  5E3M A;  2Y48 A;  1GV2 A;  1GXP A;  3VYU B;  3WTV C;  1MJA A;  4A3I J;  1ZGA A;  3HRM A;  1TL8 A;  2E2I J;  5TJJ A;  2O0Y A;  3R60 A;  3QOD A;  1SAU A;  4I98 B;  2FML A;  4Q47 A;  1HST A;  2RVC A;  3LFK A;  3M1C A;  1FY7 A;  2XGD A;  3E0J B;  4N9I A;  2EIJ H;  1T0F A;  1RZ4 A;  1WKM A;  2E1N A;  3DTI A;  2LOO A;  5HDG A;  1G3Y A;  3VYS B;  1ZHF A;  1S72 I;  4PK4 A;  5ICE A;  3B02 A;  4M6Y A;  4PJN A;  4L9T A;  4PJ0 C;  1H8A C;  3VPR A;  4RGS A;  2FSW A;  1Z05 A;  3W3C A;  1QQI A;  3V8L A;  2FE3 A;  3G4S I;  4M72 A;  2XKO A;  2OBP A;  2XV4 S;  3R4K A;  3HOT A;  1YS7 A;  2P4W A;  2W4S A;  4QIW N;  4AIJ A;  5HLH A;  2WB1 A;  5EEG A;  1LE8 B;  3H3Z A;  4GO1 A;  1D0Y A;  1IXC A;  3H9G A;  5E20 A;  1R7J A;  1XMK A;  4D7N A;  3BG9 A;  2DOE A;  4UVB A;  4GDF A;  3OYM A;  3CO7 C;  4KMU X;  5EJC A;  3ZQQ A;  5E1X A;  2QBY A;  2HOA A;  3F8F A;  2RQP A;  4A3E J;  2H8R A;  3ZR8 X;  1Y1W J;  3RCO A;  3I4N J;  1E17 A;  1MZB A;  1DP7 P;  2FJ1 A;  1BJA A;  3H5A A;  5IOZ A;  4CYD A;  2IPQ X;  3BWG A;  4NNJ A;  5FJ8 J;  1J59 A;  1OFC X;  4KYW A;  3RYR A;  3F8N A;  2ZJP F;  3S1N J;  1MJB A;  2IGN A;  4G6T B;  4YFN F;  1AHD P;  2CQ7 A;  5IT3 A;  3ERE D;  1SAX A;  1BBY A;  2OQG A;  5M3F J;  1U6G A;  4XM3 A;  3J81 K;  1RES A;  5C44 J;  4WX9 A;  5HOD A;  3OYE A;  2QQA A;  1U5T B;  3AG4 H;  3KEQ A;  3W2W A;  3J7Y J;  4E7L A;  1B72 A;  2UV1 A;  1QZZ A;  1JUM A;  4ZYH A;  3HRS A;  1APL C;  2P7V B;  1ZG1 A;  4RLF A;  2J5P A;  3C3W A;  3CP8 A;  3GF2 A;  5HS8 A;  2EB7 A;  2DTR A;  2VB6 A;  3KE2 A;  3L2R A;  1F1Z A;  1SFK A;  1WJF A;  4CCO A;  2FNP A;  2HXO A;  3B6C A;  3CP2 A;  3DTK A;  3J7A O;  3I4M J;  3LSH A;  1TQP A;  2DK5 A;  4LOC A;  1R5G A;  2MFZ A;  4IJA A;  3CO6 C;  3OWT A;  4LG0 B;  3ONQ A;  4M9Z A;  1SD4 A;  2F5F A;  2XRL A;  4E7Z A;  1CGP A;  3L00 A;  1OIS A;  2Z5U A;  3UR3 C;  1JUS A;  3I5U A;  1R00 A;  3LSM A;  3JRG A;  3IRQ A;  1D8J A;  3KP4 A;  4RM3 A;  4CXF A;  1U9N A;  3DU5 A;  2W24 A;  4M73 A;  4HDU A;  3K6G A;  2V7F A;  2NVU B;  1PUF B;  4RAF A;  2WAF A;  1VQN I;  4BDY A;  3LSJ A;  2ZJR F;  2G0E A;  3ZMT A;  5LHG A;  4GYI A;  1OCT C;  5CVU A;  1ZYR F;  1AOY A;  2STW A;  1ULY A;  4XN3 A;  2V9K A;  4A6D A;  1ZRD A;  3FMS A;  2OTL I;  2IAI A;  2CV2 A;  3EUA A;  1YW7 A;  1V5F A;  2DI3 A;  5F0C A;  1KON A;  2WAD A;  3TKY A;  2B0L A;  3CD6 I;  1XSV A;  2M2E A;  3OYI A;  4CO8 A;  1NTC A;  1UMQ A;  4CUG A;  3A01 A;  4A3M J;  4DJA A;  2E5N A;  1LKX A;  4WK8 F;  5GTI C;  1YJ9 I;  4XQF A;  3V7S A;  4J19 A;  3D0S A;  2L2O A;  3V8J A;  1ZN2 A;  3LQR A;  1YTY A;  4HW0 A;  2M34 A;  4LK1 F;  4EEF G;  1O3Q A;  3A1Y A;  1ZLJ A;  3IH4 A;  2FUG 2;  3ULQ B;  1Y56 A;  2L01 A;  2R5Z A;  1W5C C;  2DA3 A;  1YIJ I;  3GTK J;  4A3L J;  3F0C A;  3JRB A;  3TP0 A;  4L5I A;  4BXF A;  4Y4R A;  3GUD A;  1E3P A;  5E8I A;  4YIR X;  2CW7 A;  2P0W A;  4BE0 A;  2OPT A;  4E7K A;  4DIQ A;  1ODD A;  1R9T J;  2ELH A;  4RAY A;  3KX2 A;  2PLY A;  5DTD A;  5BPD A;  1I39 A;  1QNT A;  2BY2 A;  2ME0 A;  2GXB A;  2OV7 A;  2EZL A;  3MKY B;  4J01 A;  1LDK B;  4B48 A;  2QM3 A;  2CV0 A;  1PDN C;  4UXN A;  5F04 A;  5CQE A;  1W0T A;  3DV8 A;  3HOS A;  4PSX A;  2V9V A;  3HC7 A;  3SFI A;  3COA C;  4CGZ A;  1OCC H;  1ZQ3 P;  2E2J J;  2L3D A;  2O3F A;  2H27 A;  4H4K C;  3H35 A;  1X58 A;  2UUZ A;  4Y33 A;  3I55 I;  1ZR2 A;  2GA2 A;  3GFI A;  2ID3 A;  3CQZ J;  3I9V 2;  5F6F A;  1NK2 P;  1AWC A;  1JHH A;  2ISY A;  2EZK A;  5A2Q K;  1QVT A;  3EYY A;  3LSI A;  2BV6 A;  4AUX A;  2L9R A;  1VI0 A;  5KK1 A;  1BA5 A;  2BXY A;  5ED4 A;  2JTV A;  1ENH A;  2IXS A;  5DD4 A;  2X1D A;  4RM2 A;  1OYW A;  1P92 A;  4ZH4 F;  4DOZ A;  3O2P E;  3K4J A;  3MZH A;  3E5Q A;  4Z6Y A;  1Z9C A;  5IPA A;  1Y6I A;  4ETS A;  2VT2 A;  1OQY A;  2VE8 A;  2ELJ A;  3HOY J;  1OYY A;  3ML6 A;  3TDU C;  2FNA A;  3PIO F;  3G6E I;  2ZXJ A;  1VND A;  4RS8 A;  2LK2 A;  2G7U A;  4A3C J;  1T2K A;  1R49 A;  2PX9 A;  3U21 A;  5M5W J;  2PMH A;  2YR2 A;  3CLO A;  3K1M A;  4NB5 A;  4H0E A;  1QBJ A;  3H1C A;  4AU7 A;  4KT5 C;  3FXU A;  3WTW C;  2XRO A;  3G73 A;  1V5G A;  2D2W A;  1EA3 A;  2BBY A;  5HNH A;  3QAH A;  5FKN A;  3CMM A;  2EFQ A;  2Y30 A;  2LKX A;  3ZQL A;  1D8K A;  3E6B A;  2E7X A;  1TW3 A;  2RAE A;  2TRT A;  5LD2 C;  2KIQ A;  2W1O A;  1BOB A;  1Y1V J;  2RNJ A;  4MGR A;  2DU9 A;  5L3C A;  1O3R A;  1W7P D;  1X1C A;  2ID6 A;  1FBS A;  2YX7 A;  3Q9S A;  3F8M A;  1I3Q J;  3WOD F;  2VAS A;  4HEA 2;  1B6A A;  1GHC A;  3HOZ J;  3BTL A;  4BQN A;  1RR8 C;  1U78 A;  1SD5 A;  2E7W A;  1MMG A;  2IA0 A;  3A0B C;  1GVJ A;  2Y2Z A;  5EF6 A;  3PJR A;  2Y75 A;  2XDV A;  2DXI A;  2MW8 A;  2Z9O A;  3GTP J;  2DMU A;  3H3U A;  3JSO A;  1KYZ A;  1AA7 A;  2HOE A;  2V4J C;  3BOQ A;  2QQ9 A;  4ABZ A;  4BJ5 C;  1HCR A;  1U2W A;  3P9C A;  4HX8 A;  3HIF A;  1WHU A;  2VQC A;  2ZXI A;  4XLN F;  3PM1 A;  4JX4 A;  2R5Y B;  3BG6 A;  3GFM A;  2M45 A;  2OJE D;  1KU2 A;  3HSF A;  2H1L A;  2R7Q A;  3W6K B;  4FHT A;  4F92 B;  4FTH A;  1IC8 A;  1K61 A;  3G3Z A;  2P5V A;  1ZK8 A;  2B63 J;  4EAT A;  3EDP A;  5JLW A;  1DGR M;  2V6E A;  3NRV A;  1D1B A;  3IHU A;  1FEX A;  5GAE J;  4BAY A;  1MBH A;  1D0Z A;  4F91 B;  3MKZ A;  3CC4 I;  3F6V A;  1P7I A;  5LRS A;  2DJI A;  5K7F A;  4HF1 A;  2LY2 A;  4GCV A;  3T8R A;  3SZT A;  4FT8 A;  3GTO J;  3G1L A;  1WZ2 A;  3OIO A;  2DN0 A;  3LL7 A;  3QOE A;  2CRG A;  1TWA J;  4CZC A;  4ZTJ A;  3RPQ A;  1T0F C;  3CZ6 A;  4BBR J;  2NRA C;  2V1U A;  5HNF A;  3C18 A;  4G94 A;  3RQI A;  2FMY A;  1RUN A;  4OOI A;  5GAD J;  4A69 C;  4JQF A;  3AAF A;  2EA4 A;  2DOA A;  2OCE A;  2FQ4 A;  4UB6 C;  1HW2 A;  3RKY A;  4G9Y A;  1KQ0 A;  2KJC A;  1MBG A;  4II2 A;  3H5N A;  3LWF A;  1IZ1 A;  2EIN H;  2VI6 A;  2LSO A;  2LVS A;  2MGQ A;  4LLG F;  1SD6 A;  4IRH A;  2E35 A;  1LNW A;  3CCU I;  3CUQ B;  5EYR A;  5IYD J;  3X2Q H;  3ELK A;  2X0L A;  4BHB A;  3PSF A;  3RQ4 A;  2H8W A;  1IRX A;  4B1R A;  4GGG A;  1KYW A;  3KZI C;  2COM A;  3DLA A;  2K27 A;  2JZY A;  2DCE A;  1DPR A;  3LA3 A;  3K70 C;  2VON A;  4AYB A;  2X4H A;  2DYS H;  2R7S A;  2G9W A;  3OR1 C;  1X2N A;  4S0H B;  1VQ4 I;  3CME I;  2EH3 A;  2A5W A;  2MA3 A;  4I7H A;  4ZZD A;  3E5X A;  3E3V A;  2QKL B;  1VQ6 I;  2HKO A;  5D4S A;  4U7B A;  1XN7 A;  1K4S A;  1T6S A;  2HYF A;  3LA7 A;  1KQ8 A;  3J7A Y;  2BZT A;  2IBD A;  1R4M B;  2HWV A;  1MBJ A;  3IRR A;  2LF8 A;  3C7J A;  3WE2 A;  4IOC F;  2M3A A;  1B4A A;  4RMN A;  3HTS B;  4NC7 A;  3VYR B;  1FWZ A;  3V42 A;  2Y9Y A;  1IJW C;  5ICF A;  2XC7 A;  2KMU A;  4QLC U;  5L3E A;  2OA4 A;  4IO9 F;  2WAQ N;  2EA2 A;  3L7W A;  1WI9 A;  1S7O A;  3DPT A;  2HEO A;  3BC8 A;  5D5U B;  2JPC A;  1X4O A;  4XBF A;  2W85 A;  2K86 A;  1MMA A;  1DQU A;  3V7R A;  4KIC A;  2DFF A;  3VSK A;  2Q0O A;  2NS8 A;  3E6C C;  2A69 F;  5DS9 A;  1MND A;  3HXL A;  3FBN B;  4V2G A;  4YRV A;  2Q2E B;  5CQG A;  3SHF A;  1FIP A;  1S6L A;  3DPL C;  3VDX A;  4IQ4 A;  5L3B A;  5FFZ A;  1N78 A;  1FTZ A;  3CCJ I;  4IL6 C;  2KJB A;  3KYD B;  1XMX A;  2K4J A;  3ZN1 A;  2JA5 J;  5K5R A;  1P2F A;  3NWS A;  3O8H A;  2MC3 A;  4N9H A;  2FOW A;  3TBI A;  2BE5 F;  4BUP A;  3LMM A;  2JSC A;  5AON A;  5IT9 K;  2AS5 F;  4X1E A;  1NH3 A;  4OMY A;  2CQK A;  4AYB N;  4Y17 A;  4BYY A;  1UHM A;  5CVR A;  5FKO A;  2OD5 A;  4QPO A;  4WXD A;  2R7W A;  3CCE I;  1T39 A;  3E6M A;  3SYT A;  4I6Z A;  5CLS A;  5KNL A;  4W1U A;  4B47 A;  4KIF A;  1IF1 A;  4D0P A;  1MSE C;  2ZME B;  3TP3 A;  2H09 A;  1H88 C;  4D5C A;  1YHQ I;  1B1B A;  3M8E A;  2OCC H;  5GTH C;  1BL0 A;  3IV5 A;  4F52 A;  5DV5 A;  3QP5 A;  3K9T A;  2JSP A;  1BW5 A;  1U8B A;  2LF7 A;  1VZ0 A;  4MNU A;  1SVM A;  4P9F A;  2RQQ A;  2EQR A;  3JTG A;  2KP6 A;  4ZJZ A;  5B3S H;  1Z3X A;  2D1H A;  2W57 A;  4DQ2 A;  3FMQ A;  1XDS A;  1ETQ A;  2ZKZ A;  3DKW A;  3PIP F;  1WVR A;  3OYD A;  3KYL A;  1QVU A;  4X6A J;  3S2W A;  1JJ8 C;  2E2H J;  4CCJ A;  3OL4 A;  3RPU D;  4RB3 C;  4HST A;  2GWR A;  2FF4 A;  2BW3 A;  1TC3 C;  5GAH J;  2MG4 A;  1Z0X A;  4UNO A;  4DGW B;  3DEU A;  4A0X A;  3QPH A;  2A5Y B;  3KYC B;  1BR1 A;  3Q0V A;  2BY1 A;  5B5E C;  1G3W A;  1UHW A;  5FB2 A;  3VFZ A;  2ZJ2 A;  1BM9 A;  4LIV A;  1HDP A;  4FX0 A;  1TWH J;  3FM5 A;  1XCB A;  3JRA A;  2CUE A;  1JTY A;  3BR0 A;  4LLL A;  4B3A A;  2KLO A;  2Y0S A;  3FIW A;  1YJN I;  3IH3 A;  5DEQ A;  1WI3 A;  4RB1 A;  2WA0 A;  3PNY A;  3CES A;  1FMW A;  5D5V B;  2CS3 A;  4LD5 A;  2O8X A;  1LUJ B;  4YFK F;  1KA8 A;  3G71 I;  3H5R A;  2Z2S B;  3IAS 2;  2EFP A;  5M5Y J;  3F8C A;  3MEX A;  2NAZ A;  4A5M A;  4JX6 A;  1K4T A;  2XSD C;  4I0A A;  1TT5 B;  2VC0 A;  1OJL A;  4FE4 A;  2E1M C;  1IUF A;  1VQ5 I;  4BNC A;  2DMN A;  3A2K A;  3HOW J;  1ZRF A;  5KVR A;  1U0J A;  1Z7L A;  3C2B A;  1ZEL A;  4BJ6 C;  5FKL A;  1IDZ A;  4AWX B;  4KMF A;  4IPA A;  1BR4 A;  3FXQ A;  1LDD A;  3FKJ A;  2XB0 X;  3KLN A;  2EFN A;  2F6C A;  1OCO H;  1KU7 A;  4C3J J;  2DMP A;  1W5S A;  3L9F A;  2I10 A;  1VQ8 I;  1QO0 D;  2GQQ A;  1T95 A;  2NVX J;  1W0U A;  5J3L A;  3QOP A;  4EQQ A;  3DF8 A;  2VUM J;  1PUF A;  4UUT A;  4XOP A;  3AL0 B;  4U88 A;  4LFU A;  4YEJ A;  3RYP A;  3F8B A;  4TV7 A;  5JVG F;  2ACJ A;  1X4P A;  3HOX J;  4OAZ A;  1DUX C;  1AKH A;  4DBQ A;  2O7O A;  1R23 A;  2P6S A;  4L9N A;  3KZZ A;  1OLT A;  3MKL A;  4ENN A;  1MDM B;  5J4Y A;  3HOV J;  3B6A A;  1XB4 A;  5K7H A;  3K0L A;  2R4G A;  2ADU A;  3OYG A;  3H0G J;  3BR5 A;  2UZK A;  1Q1V A;  4CSW A;  1TQM A;  2HZT A;  1R58 A;  3GTQ J;  1KU3 A;  3HPH A;  1MIJ A;  4BU2 A;  4L9V A;  3HHG A;  1EKE A;  4RB0 A;  2A07 F;  3I0T A;  1IXR C;  1P9Q C;  2VPR A;  3CCM I;  1ZTR A;  4BAC A;  3BT9 A;  3G1O A;  4HNV A;  1UEL B;  1WWX A;  3WGG A;  2E34 A;  5K5Q A;  3TO9 A;  5JHU A;  3OYN A;  2C6Y A;  3WG9 A;  2EFW A;  1ORK A;  1IN8 A;  1BW6 A;  3ZP5 A;  2KHM A;  2RN7 A;  5DDG A;  4ZZL A;  3GVA A;  1QA6 A;  2QEX I;  4PCQ A;  2DPD A;  1XDU A;  1R36 A;  4HF2 A;  3MFK A;  4JYK A;  2HDD A;  3OYB A;  3FXM A;  5LFA A;  2MLK A;  1RR7 A;  1HKT A;  1NG6 A;  3TED A;  5DYM A;  3IUO A;  5E3O A;  2GXG A;  1KZH A;  3K4M A;  1DU6 A;  4OIQ F;  1MBK A;  3SDG A;  2KZG A;  4B43 A;  4EM2 A;  4M74 A;  4ITV A;  2IGM A;  3HTU A;  1FYK A;  1Z6T A;  5J1R A;  1KGS A;  1MW7 A;  2RDP A;  4KN7 X;  2WWY A;  1S8N A;  1T98 A;  1IN5 A;  5DM6 F;  3TOA A;  3GTG J;  4IHS A;  5IT9 Z;  2Y69 H;  2TDX A;  4KJZ A;  3K4N A;  1ERD A;  3I3L A;  5FD5 A;  4B3X A;  4AID A;  1UZC A;  1WQ2 A;  4WCG A;  1LVK A;  1RC9 A;  1Y39 A;  5EDN A;  4F93 B;  5D5X B;  3OIP A;  2M8G X;  4C2T A;  5HLI A;  2RNG A;  3AG3 H;  1JJ6 C;  1D5Y A;  2LRD A;  3BTC A;  3L2C A;  4EM0 B;  3BR2 A;  5EEH A;  4EMS A;  1SC7 A;  1T38 A;  2YX4 A;  5F1R A;  3JRE A;  2VOP A;  2QZ8 A;  1WCM J;  3K69 A;  2LBF B;  2XIG A;  3W2V A;  4C3I J;  1ZRC A;  4KNY A;  2VKE A;  2HR3 A;  3MN2 A;  2M0M A;  1JI8 A;  1T8I A;  1YX3 A;  4M9S A;  1H9T A;  3WGI A;  1G3S A;  3PSI A;  3S3O A;  3DBL B;  2JJ7 A;  1S5L C;  3E5U A;  2HU9 A;  3DQV C;  2JVG A;  4XID A;  3L1P A;  2ESN A;  3PNV A;  1PP7 U;  1XD7 A;  2ELK A;  3DBR B;  3HZJ A;  3DEE A;  1LQ1 A;  5FGM A;  4HQE A;  2D45 A;  2JQ7 A;  4UUS B;  1A5J A;  4OU0 A;  3TMO A;  5K1Y A;  4RDU A;  3LAJ A;  3K1N A;  2XGC A;  4BQO A;  1E3O C;  5IYC J;  3T1B A;  2P5K A;  4BDZ A;  4PJJ A;  5EG0 A;  3SFZ A;  4D5F A;  2HDC A;  4AD9 A;  2JRT A;  1OMI A;  1X3Z B;  2NYX A;  3BG7 A;  1HA8 A;  3DPU A;  3HDD A;  3VYT B;  4LIT A;  4EGY A;  2VQH A;  1HOM A;  2QSH X;  4A3F J;  4HV6 A;  1OCP A;  3PFI A;  3BY6 A;  2WB1 N;  2F4M B;  2W7N A;  2EJR A;  3GLL A;  3RTR A;  2R7F A;  1GLN A;  5ILV A;  5EGO B;  2DT6 A;  3BJO A;  2XAF A;  2HOT A;  1J7K A;  3ASO H;  2QEN A;  3RZD J;  1NG7 A;  3HM5 A;  2XB5 A;  2DFI A;  5C4J J;  3OOU A;  4BGD A;  2VQG A;  1STZ A;  1J09 A;  2AQE A;  2R7T A;  2KRC A;  3M07 A;  3IKV A;  3HBL A;  4LG3 A;  1JKO C;  1YIO A;  5J1Y A;  1X3W B;  4PDK A;  2R5Y A;  2IA1 A;  1E3H A;  1FP1 D;  4PGH A;  1YRN B;  3OSG A;  2XPW A;  2IEK A;  3HG9 A;  1K6O A;  4IQJ A;  2DOD A;  4D9J A;  1LFP A;  2Z16 A;  2F2E A;  4N0B A;  2VXD A;  3CCL I;  5TRD A;  1ZGW A;  3OY9 A;  3LFU A;  2QF7 A;  1BI3 A;  2A6E F;  2DA4 A;  5L3G A;  2A61 A;  1ZAR A;  2L54 A;  1F4K A;  4MFD A;  2PMZ A;  1W5T A;  4OMZ A;  3DTE A;  1OR7 C;  1G4D A;  3IWF A;  4BEH A;  1VQM I;  4I0B A;  5E17 F;  4I76 A;  2CQN A;  3GTL J;  5H20 A;  3SEQ A;  3HB9 A;  5FLV A;  2K85 A;  5FKK A;  2CO5 A;  2UXX A;  3WTZ A;  2L7Z A;  3S3N A;  1PYV A;  2ZXW H;  3CF5 F;  2IS2 A;  2CW8 A;  2NXN B;  2WY7 Q;  4PZJ A;  4DW6 A;  1S9H A;  1GT0 C;  4XLE A;  4MO7 A;  2R7R A;  1K6Y A;  3OIQ A;  4FET A;  5IYB J;  4C9Y A;  1F9N A;  1XG1 A;  1UB9 A;  3M8J A;  2QUF A;  2XAU A;  3S93 A;  1KU9 A;  5JLX A;  5F0F A;  1ETW A;  3FF5 A;  1BIB A;  4MEY F;  3ZMU A;  1JE8 A;  1ZG5 A;  5LGU A;  4XLA A;  1N75 A;  3W6V A;  2RKH A;  4NBQ A;  2HQR A;  4HX4 A;  2H6C A;  2YU9 J;  1K78 A;  2IRF G;  3E6D A;  2XF5 A;  1G59 A;  2DK8 A;  3SQN A;  1OKR A;  3K70 D;  2ZJQ F;  2R0Q C;  4A3D J;  3OR2 C;  3UKG A;  2R92 J;  5M3M J;  2WTE A;  5K5O A;  2DA7 A;  4HA8 A;  3JW4 A;  1G8X A;  4LGW A;  4ZDL A;  2BY3 A;  1B8I A;  3O8G A;  1IUY A;  3HUG B;  3SXY A;  3H9J A;  3R0A A;  2X48 A;  3KLO A;  3LSR A;  3CMY A;  3FDY A;  2CH0 A;  2PJR B;  2Y0M A;  2XRN A;  3QWL A;  4XMY A;  1QRY A;  1WJ5 A;  1B59 A;  3JR9 A;  2OZU A;  1U5T C;  4HSR A;  5LLQ A;  4UUV A;  2LKP A;  4EJT A;  4XIC A;  2E71 A;  3K4C A;  1S3J A;  1CQT A;  4JK1 X;  3P5J A;  2OU2 A;  4NC6 A;  3H9Q A;  1FNN A;  3IWZ A;  3ZQI A;  4KFC A;  4ANJ A;  1XTA A;  5LHH A;  2EZH A;  2JUG A;  3I54 A;  2PI0 A;  4LMY A;  5ICC A;  1V55 H;  2AQF A;  2QQB A;  3D1N I;  3S2D J;  4XNF A;  4OIN F;  3RI4 A;  2M5W A;  5J4V A;  1IG7 A;  3ZXS A;  1BI1 A;  5DD8 A;  3LSP A;  2BYV E;  5KHD A;  1HKS A;  4NC8 A;  3RDI A;  3GEZ A;  3M7G A;  3L2W A;  1J75 A;  4UVC A;  2DA6 A;  1IV8 A;  3QU6 A;  2R93 J;  1UHS A;  3LSG A;  2KIS A;  3BJ6 A;  2Q2E A;  1B72 B;  4XKW A;  2P8T A;  5F1J A;  1X1A A;  3OYL A;  5JVT A;  1CF7 A;  2JK3 A;  2ME6 A;  4XLC A;  1W36 C;  1DU0 A;  3B73 A;  3CJT B;  3P7N A;  1YO5 C;  1FJL A;  2JT1 A;  2RGV A;  1X19 A;  2X1E A;  1RUO A;  3R61 A;  4ZTF A;  2DFE A;  5F27 A;  2ICW G;  4S05 A;  3N97 A;  4EJV A;  2DTZ A;  1F5T A;  5L3F A;  2PBI A;  2RC4 A;  5IY5 H;  1RKT A;  2XAH A;  1MMS A;  4DZJ A;  1F43 A;  1C0W A;  2OQR A;  4JX5 A;  4ESB A;  3KP5 A;  3U9G A;  2GIV A;  1R5I D;  1MKM A;  4KIS A;  4HYE A;  2F5V A;  2LG4 A;  2KDZ A;  4ENK A;  2GLO A;  3WTS C;  1YJW I;  1TWF J;  3BCB A;  2YS9 A;  4GYG A;  1RKW A;  5HVQ C;  3VOE A;  2CUZ A;  3W2A A;  2GIZ A;  4IRI A;  1Y8Q B;  1IN7 A;  2HDW A;  1QGP A;  2ZME A;  4ESJ A;  1W7P B;  4UV8 A;  5HDK A;  4P96 A;  3QYE A;  1U3E M;  2JA8 J;  4K2E A;  3OOP A;  1N25 A;  1R22 A;  4M3B A;  2CUJ A;  4O5V A;  1DGW Y;  2GM4 A;  5IP9 J;  1IRG A;  1IN6 A;  3CDI A;  2ZCW A; 
#chains in the Genus database with same CATH homology
 1P4W A;  3GW2 A;  3F21 A;  3KP2 A;  2K02 A;  4IVN A;  5F64 A;  5DUK A;  3WE3 A;  2ZFW A;  5L3D A;  1ONV A;  2QYO A;  4ASN A;  5E1W A;  3CJN A;  2V6C A;  4P55 A;  1V4R A;  4A0Z A;  1VTN C;  2YU3 A;  4I09 A;  2LNB A;  3ECO A;  4MHG A;  3TGN A;  4M9X A;  3FZV A;  3VB2 A;  4KIB A;  2DLL A;  1XGM A;  3WGH A;  1Q1H A;  2HKX A;  2H94 A;  3T5X A;  3V8K A;  3EUH A;  5H6Q A;  1FYM A;  1MJ9 A;  1S29 A;  1FPQ A;  4KUM A;  4FX4 A;  4WXH A;  2EK5 A;  5FD6 A;  2D1V A;  3CDH A;  3RKX A;  4EVI A;  2HFH A;  3TDZ C;  2DBB A;  3GLX A;  5J8C A;  1D5V A;  3ZMD A;  1MDM A;  3CUO A;  2FBH A;  2DW4 A;  2ISZ A;  4NHJ A;  3M9A A;  3ABU A;  5LBQ A;  3OV8 A;  2FOK A;  4A12 A;  5BS6 A;  4Z2Y A;  3TO7 A;  3FHZ A;  4A2U A;  3GX4 X;  1OR7 A;  1ZRE A;  2LDU A;  1I6X A;  2ZNZ A;  4MQ9 F;  1EH8 A;  5CYV A;  1B9N A;  3R6S A;  1HSJ A;  3IKT A;  1QZY A;  1L0O C;  3BP8 A;  3Q5F A;  2M30 A;  2IA2 A;  1O7F A;  3J80 K;  3TO6 A;  3BJA A;  2RV8 A;  4YII A;  2ETH A;  2QWW A;  2CYY A;  3ZPL A;  4A0Y A;  2HQN A;  2L4A A;  5AIP A;  2VBY A;  1WSU A;  4Y15 A;  3MAJ A;  5FO5 A;  2HTJ A;  1ZG3 A;  3FMR A;  5HOO A;  1YW8 A;  3I59 B;  3MWM A;  3CUQ C;  2NNY A;  1PUE E;  2Z33 A;  1EV7 A;  1U5T A;  1ZGJ A;  4BH9 A;  5ICG A;  2BGC A;  3LST A;  3KFW X;  1HKQ A;  1LVA A;  4ON0 A;  5E18 F;  2FBK A;  3BDD A;  4I01 A;  4IRG A;  1FBQ A;  1XGS A;  2R3S A;  4UHT A;  1XSX A;  4LG0 A;  3NEU A;  2AXL A;  2XAJ A;  1LEB A;  2DAO A;  4HX7 A;  1YLF A;  1FOK A;  2GAU A;  4HBL A;  2FXA A;  1JGS A;  2QVO A;  1HXD A;  4EJU A;  3F3X A;  3JSP A;  3E97 A;  1FT9 A;  3DXJ F;  1LJ9 A;  2E1C A;  3L09 A;  2P6T A;  2Q8K A;  1KQ9 A;  3H92 A;  3ECH A;  2VBX A;  1LEA A;  4G6Q A;  4EV0 A;  3DP7 A;  1XSD A;  1XGN A;  4B09 A;  3LA2 A;  2V1D A;  1YFH A;  5LEK A;  3VOD A;  1HQC A;  2F5E A;  1L3L A;  1LB2 A;  1FYL A;  2EFO A;  4AIH A;  4BHC A;  2FQ3 A;  3P9I A;  4CIC A;  1FZP B;  3T0Y A;  3R0J A;  2GZW A;  5LRR A;  3BRO A;  5ERI A;  3I4P A;  4U0V A;  4U0W A;  2YPR A;  5FFX A;  2L4M A;  2ZME C;  2QLZ A;  4UVA A;  2Z3Y A;  2PQ8 A;  2R7D A;  2XVC A;  1R1V A;  1W4M A;  1YW9 A;  3KP3 A;  1Y0U A;  6PAX A;  1I1S A;  2O6G E;  2KIF A;  4P5O A;  1TNS A;  4HLX A;  4XSZ F;  5JR3 A;  2W84 A;  3HUG A;  4R1H A;  2A68 F;  4IXA A;  5CVI A;  3FXR A;  1BN5 A;  3BZ6 A;  1SFE A;  4IF4 A;  3W6J B;  4HV5 A;  5BQT A;  4ESF A;  4Q5S F;  1R5H A;  2STT A;  2DT5 A;  3J80 Z;  1OYI A;  2VT3 A;  4HAM A;  1UFM A;  4RGX A;  5HDN A;  5D8K B;  2FU4 A;  3F22 A;  2EV0 A;  1Z6R A;  2CSO A;  3EQL F;  3GFL A;  1YS6 A;  2PFB A;  3ZMS A;  4ZYG A;  5D4R A;  3GWZ A;  3QU3 A;  2DO7 A;  3CTA A;  4U7D A;  1BC7 C;  2WV0 A;  5CVJ A;  3M1E A;  3HRU A;  1NHA A;  4EJW A;  5CVV A;  2MLG A;  2XUB A;  1J2X A;  5DCM B;  4JBA A;  2L02 A;  3T8T A;  4I2O A;  1J9I A;  4KN4 X;  4R79 A;  1W7P A;  4Y13 A;  2XAG A;  4KA4 A;  1XGO A;  3U2R A;  2VBW A;  2DQR A;  1ON2 A;  2M8E A;  4P9U A;  4RB2 C;  5D6F A;  4B8X A;  3RJP A;  4BXU A;  1ZLK A;  1ZH5 A;  5FLX K;  1JHF A;  2YSR A;  3GZ6 A;  3I64 A;  5DUI A;  1P4X A;  3ZMV A;  3KET A;  1I1G A;  5BPI A;  4WXC A;  4F7Z A;  5D8L B;  4HOB A;  2A3S A;  2ZBK A;  3PQJ A;  3JTH A;  4NQW A;  5DCF A;  2O61 A;  2GA1 A;  2MH9 A;  1REP C;  3CUQ A;  1H9G A;  3TOB A;  1RNL A;  1SD7 A;  4BHP A;  4YG2 F;  4CHU A;  4WF2 A;  3JAM Z;  2EV5 A;  1HW5 A;  3N4M A;  4YFX F;  1QPM A;  4E70 A;  5ILU A;  3F6O A;  4OIR F;  2UWM A;  3Q9V A;  1O3T A;  3QPT A;  5E8G A;  2IVM A;  1RIO H;  3ZMZ A;  2K4B A;  3D5L A;  2XAS A;  2WC2 A;  2QBY B;  3ABT A;  3BPV A;  4AVP A;  2ZNY A;  1FP2 A;  3EET A;  1FC3 A;  1FX7 A;  2XHK A;  1R1U A;  4U0Y A;  4O6J A;  4L0Y B;  1UCR A;  4XRF A;  2EWN A;  2M1B A;  1SMT A;  3ROU A;  2PMU A;  4HQM A;  4LB6 B;  4GXO A;  4G6D A;  1U8R A;  1Z1D A;  3F72 A;  3QP6 A;  2VC1 A;  4XLP F;  2UXN A;  3WTX C;  3V7C A;  1YYV A;  4G7Z F;  3I53 A;  5D6E A;  4S04 A;  4LJZ F;  4RGR A;  1FLI A;  1TBX A;  5BOX A;  3ZQ7 A;  3BPX A;  2CG4 A;  2VN2 A;  4RAZ A;  5AIQ A;  1B9M A;  2Z99 A;  1SFX A;  3J81 Z;  3LAP A;  1GXQ A;  1J5Y A;  1EH7 A;  2KIU A;  1HBX G;  2OAZ A;  5BMZ A;  4LLN A;  3WU0 A;  4ZYD A;  3QRF F;  3GZ5 A;  5JI6 A;  1OPC A;  1WRJ A;  2DPU A;  3MQ0 A;  4MEX F;  2HTS A;  5D5W B;  4MTE A;  2IP2 A;  1FSE A;  4MQV A;  1LDJ A;  5J8F A;  1X3U A;  4CZZ A;  3HHH A;  2BEO A;  2F5D A;  3P9K A;  3I59 A;  5HLG A;  4UV9 A;  5HS7 A;  2MD5 A;  1I27 A;  1J0R A;  2XKP A;  3KCC A;  3GYH X;  1HW1 A;  1H0M A;  3GXO A;  1TTY A;  1BI0 A;  5H6R A;  1PP8 F;  5FLX Z;  2VBZ A;  1DDN A;  4OIO F;  3VEP A;  4M6X A;  3RPU A;  4G7H F;  4IHT A;  2P7C B;  1YQA A;  2PN6 A;  4OIP F;  4HF0 A;  4KDP A;  1IAW A;  3M8F A;  1K78 B;  2NS0 A;  2MBF A;  2PEX A;  4XSX F;  3KZY A;  3WTU C;  3DFG A;  1MD0 A;  4HDV A;  4L0Z B;  1FSH A;  3EYI A;  4PGG A;  1TW2 A;  4A6E A;  1BI2 A;  4ZYE A;  1YG2 A;  2XGX A;  4R8H A;  4RGU A;  1BC8 C;  2F5C A;  1G3T A;  1Z7U A;  2VOD A;  2G7H A;  3FWE A;  2DQL A;  4LB5 A;  3GFJ A;  3FX3 A;  2A6H F;  4CDG A;  3SZP A;  4EM1 A;  1K7A A;  4L18 B;  2M87 A;  5ILS A;  1P4A A;  4KIG A;  5E1Z B;  4HLY A;  2EV6 A;  2ESH A;  3MCZ A;  2CGP A;  1BOA A;  5A2Q Z;  1O7L A;  2CWE A;  1DPU A;  2PJP A;  3V4G A;  1CF7 B;  3ZN0 A;  1A04 A;  1O3S A;  1I5Z A;  3IC7 A;  1MGT A;  5LGN A;  3WTT C;  1EH6 A;  1TNT A;  1IN4 A;  2O03 A;  4Q48 A;  2IJL A;  3MZY A;  2VE9 A;  4G7O F;  2V1X A;  1USS A;  1XCV A;  2J5O A;  1IXS B;  2IT0 A;  2H6B A;  5J6X A;  2HYG D;  1UST A;  1FBU A;  2FA5 A;  3REO A;  2HGC A;  2NNN A;  4MTD A;  1O57 A;  1IRF A;  1S7A A;  2KRF A;  1ON1 A;  2VOO A;  2FRH A;  3HSR A;  4DNC A;  2FEZ A;  2VXZ A;  2FBI A;  3HRT A;  4BQA A;  3HSE A;  4I02 A;  3I58 A;  1RI7 A;  1P6R A;  5LHI A;  1G6N A;  5CJ9 A;  1D3Y A;  3K2Z A;  1XMA A;  2OZ6 A;  4LK0 F;  1Z91 A;  2XAQ A;  1ZAO A;  4EJO A;  4YIF A;  4M71 A;  5LGT A;  4WWC A;  2W25 A;  4EGZ A;  2CW0 F;  2ZO4 A;  3KP7 A;  4ENJ A;  3KP6 A;  2PG4 A;  3K1P A;  2K7L A;  3KEO A;  4G8X A;  3F23 A;  3ISP A;  3PQK A;  2HS5 A;  1SMY F;  4HZF A;  3O6B B;  4A5N A;  5DCM A;  3I71 A;  5LEJ A;  2P5L C;  2KIM A;  5HS9 A;  1TQI A;  3RKW A;  3O3K A;  3U1D A;  4ENM A;  4L9J A;  1V3F A;  4L5J A;  3RIR A;  3GO5 A;  2CFX A;  4Q4Z F;  1K79 A;  3JAM K;  1E2X A;  3WU1 B;  3NQO A;  3HYI A;  4QWQ A;  2IW5 A;  2JPB A;  3C1D A;  1JXS A;  4AIK A;  5JFR A;  2KKO A;  3WTY C;  3LQQ A;  1TLH B;  3FM3 A;  2MH2 A;  1BIA A;  1IW7 F;  1SFU A;  1R1T A;  3TQN A;  4O3M A;  3IL2 A;  2V79 A;  2Y48 A;  1GXP A;  3WTV C;  1MJA A;  1ZGA A;  3HRM A;  5TJJ A;  2O0Y A;  3R60 A;  4I98 B;  2FML A;  4Q47 A;  1HST A;  2RVC A;  3LFK A;  1FY7 A;  4N9I A;  1T0F A;  1RZ4 A;  1WKM A;  2E1N A;  5HDG A;  1G3Y A;  1ZHF A;  5ICE A;  3B02 A;  4M6Y A;  4L9T A;  4RGS A;  2FSW A;  1Z05 A;  1QQI A;  3V8L A;  2FE3 A;  4M72 A;  2XKO A;  2OBP A;  2XV4 S;  3R4K A;  3HOT A;  1YS7 A;  2P4W A;  4AIJ A;  5HLH A;  5EEG A;  3H3Z A;  4GO1 A;  1IXC A;  5E20 A;  1R7J A;  1XMK A;  4UVB A;  3CO7 C;  4KMU X;  5E1X A;  2QBY A;  3F8F A;  2RQP A;  1E17 A;  1MZB A;  1DP7 P;  1BJA A;  4CYD A;  2IPQ X;  3BWG A;  1J59 A;  4KYW A;  3RYR A;  3F8N A;  1MJB A;  4YFN F;  5IT3 A;  3ERE D;  1SAX A;  1BBY A;  2OQG A;  1U6G A;  3J81 K;  4WX9 A;  2QQA A;  1U5T B;  3KEQ A;  1QZZ A;  4ZYH A;  3HRS A;  2P7V B;  1ZG1 A;  2J5P A;  3C3W A;  3GF2 A;  5HS8 A;  2EB7 A;  2DTR A;  3KE2 A;  1F1Z A;  2FNP A;  3J7A O;  1TQP A;  2DK5 A;  1R5G A;  4IJA A;  3CO6 C;  4LG0 B;  4M9Z A;  1SD4 A;  2F5F A;  1CGP A;  3L00 A;  2Z5U A;  3I5U A;  1R00 A;  3IRQ A;  1D8J A;  3KP4 A;  4CXF A;  2W24 A;  4M73 A;  4HDU A;  3ZMT A;  5LHG A;  4GYI A;  5CVU A;  1ZYR F;  1AOY A;  2STW A;  1ULY A;  4A6D A;  1ZRD A;  3FMS A;  1YW7 A;  2DI3 A;  3TKY A;  2B0L A;  1XSV A;  4CO8 A;  4WK8 F;  3V7S A;  3D0S A;  3V8J A;  1ZN2 A;  3LQR A;  1YTY A;  4HW0 A;  4LK1 F;  1O3Q A;  1ZLJ A;  3ULQ B;  2L01 A;  4L5I A;  5E8I A;  3GUD A;  1ODD A;  2ELH A;  4RAY A;  2PLY A;  5BPD A;  1QNT A;  2GXB A;  1LDK B;  2QM3 A;  1PDN C;  4UXN A;  3DV8 A;  3HOS A;  2V9V A;  3COA C;  4CGZ A;  2L3D A;  2O3F A;  2H27 A;  2GA2 A;  3GFI A;  5F6F A;  1AWC A;  1JHH A;  2ISY A;  5A2Q K;  3EYY A;  2BV6 A;  5KK1 A;  5ED4 A;  2JTV A;  5DD4 A;  1OYW A;  1P92 A;  4ZH4 F;  3O2P E;  3MZH A;  3E5Q A;  1Z9C A;  4ETS A;  2VT2 A;  2VE8 A;  1OYY A;  3ML6 A;  3TDU C;  2FNA A;  2ZXJ A;  4RS8 A;  2G7U A;  1T2K A;  3K1M A;  2PMH A;  2YR2 A;  4NB5 A;  4H0E A;  3CLO A;  1QBJ A;  4KT5 C;  3FXU A;  3WTW C;  2XRO A;  3G73 A;  2D2W A;  2BBY A;  3QAH A;  2EFQ A;  1D8K A;  3E6B A;  2E7X A;  1TW3 A;  4MGR A;  2RNJ A;  2DU9 A;  5L3C A;  1O3R A;  1W7P D;  1FBS A;  2YX7 A;  3Q9S A;  3F8M A;  3WOD F;  1B6A A;  1GHC A;  1U78 A;  1SD5 A;  2E7W A;  2IA0 A;  1GVJ A;  2Y75 A;  2Z9O A;  3H3U A;  3JSO A;  1KYZ A;  2HOE A;  3BOQ A;  2QQ9 A;  1U2W A;  3P9C A;  4HX8 A;  3HIF A;  4XLN F;  3GFM A;  2M45 A;  1KU2 A;  3HSF A;  3W6K B;  4FHT A;  3G3Z A;  2P5V A;  3EDP A;  3NRV A;  3IHU A;  4BAY A;  3F6V A;  5LRS A;  4HF1 A;  4GCV A;  3T8R A;  3SZT A;  4FT8 A;  2NRA C;  3RPQ A;  2V1U A;  3C18 A;  4G94 A;  2FMY A;  1RUN A;  4OOI A;  4JQF A;  3AAF A;  2EA4 A;  1HW2 A;  3RKY A;  4G9Y A;  1KQ0 A;  2KJC A;  3LWF A;  1IZ1 A;  2LSO A;  4LLG F;  1SD6 A;  4IRH A;  1LNW A;  3CUQ B;  3ELK A;  2X0L A;  4BHB A;  4GGG A;  1KYW A;  2COM A;  2K27 A;  2JZY A;  1DPR A;  3LA3 A;  2VON A;  2X4H A;  2G9W A;  2MA3 A;  4I7H A;  4ZZD A;  3E5X A;  3E3V A;  2HKO A;  5D4S A;  4U7B A;  1XN7 A;  1T6S A;  2HYF A;  3LA7 A;  1KQ8 A;  2HWV A;  3IRR A;  2LF8 A;  3C7J A;  3WE2 A;  1B4A A;  3HTS B;  1FWZ A;  5ICF A;  4QLC U;  5L3E A;  2OA4 A;  2EA2 A;  3L7W A;  1WI9 A;  1S7O A;  3DPT A;  2HEO A;  5D5U B;  2JPC A;  4XBF A;  2W85 A;  2K86 A;  3V7R A;  4KIC A;  2Q0O A;  3E6C C;  2A69 F;  3SHF A;  1S6L A;  3DPL C;  5L3B A;  5FFZ A;  2KJB A;  3ZN1 A;  2K4J A;  5K5R A;  1P2F A;  2MC3 A;  4N9H A;  2BE5 F;  2JSC A;  5AON A;  5IT9 K;  2AS5 F;  4OMY A;  2CQK A;  4Y17 A;  4BYY A;  1UHM A;  5CVR A;  2OD5 A;  4WXD A;  1T39 A;  3E6M A;  5CLS A;  4KIF A;  1IF1 A;  4D0P A;  2ZME B;  2H09 A;  1B1B A;  3M8E A;  5DV5 A;  3QP5 A;  3K9T A;  2LF7 A;  4MNU A;  4P9F A;  3JTG A;  2D1H A;  2W57 A;  4DQ2 A;  3FMQ A;  1XDS A;  2ZKZ A;  3DKW A;  3S2W A;  4RB3 C;  2GWR A;  2FF4 A;  4UNO A;  3DEU A;  4A0X A;  3QPH A;  2A5Y B;  1G3W A;  1UHW A;  5FB2 A;  3VFZ A;  2ZJ2 A;  1BM9 A;  4FX0 A;  3FM5 A;  1XCB A;  4LLL A;  5DEQ A;  4RB1 A;  5D5V B;  4LD5 A;  2O8X A;  4YFK F;  1KA8 A;  2EFP A;  3F8C A;  3MEX A;  2NAZ A;  4A5M A;  4I0A A;  2VC0 A;  4BNC A;  1ZRF A;  5KVR A;  4AWX B;  4KMF A;  4IPA A;  3FXQ A;  1LDD A;  3KLN A;  2EFN A;  1KU7 A;  1W5S A;  3L9F A;  1QO0 D;  2GQQ A;  3QOP A;  4EQQ A;  3DF8 A;  4U88 A;  4LFU A;  3RYP A;  3F8B A;  4TV7 A;  2ACJ A;  1DUX C;  1R23 A;  2P6S A;  4L9N A;  3KZZ A;  4ENN A;  1MDM B;  1XB4 A;  3K0L A;  2ADU A;  2UZK A;  1TQM A;  2HZT A;  1R58 A;  1KU3 A;  4L9V A;  3HHG A;  4RB0 A;  2A07 F;  3I0T A;  1IXR C;  1WWX A;  3WGG A;  5K5Q A;  3TO9 A;  5JHU A;  2C6Y A;  3WG9 A;  2EFW A;  1IN8 A;  3ZP5 A;  2RN7 A;  5DDG A;  4ZZL A;  3GVA A;  4PCQ A;  2DPD A;  1XDU A;  1R36 A;  4HF2 A;  3MFK A;  2MLK A;  1HKT A;  5DYM A;  2GXG A;  4OIQ F;  4EM2 A;  4M74 A;  1FYK A;  3HTU A;  1Z6T A;  1KGS A;  2RDP A;  4KN7 X;  2WWY A;  1S8N A;  1T98 A;  1IN5 A;  3TOA A;  4IHS A;  5IT9 Z;  2TDX A;  5FD5 A;  1WQ2 A;  4WCG A;  5D5X B;  5HLI A;  3L2C A;  4EM0 B;  4EMS A;  5EEH A;  1T38 A;  2YX4 A;  5F1R A;  2VOP A;  2QZ8 A;  3K69 A;  2XIG A;  1ZRC A;  4KNY A;  2HR3 A;  4M9S A;  1H9T A;  3WGI A;  1G3S A;  3E5U A;  3DQV C;  2ESN A;  1PP7 U;  1XD7 A;  1LQ1 A;  5FGM A;  4HQE A;  2D45 A;  4OU0 A;  5K1Y A;  3LAJ A;  3K1N A;  3T1B A;  2P5K A;  3SFZ A;  2HDC A;  4AD9 A;  2JRT A;  1OMI A;  2NYX A;  4EGY A;  4HV6 A;  3PFI A;  3BY6 A;  2EJR A;  3RTR A;  2R7F A;  5ILV A;  3BJO A;  2XAF A;  1J7K A;  2QEN A;  2DFI A;  1STZ A;  3IKV A;  1YIO A;  4PDK A;  2IA1 A;  1FP1 D;  4PGH A;  1K6O A;  2F2E A;  4N0B A;  5TRD A;  1BI3 A;  2A6E F;  5L3G A;  2A61 A;  1ZAR A;  2L54 A;  1F4K A;  1W5T A;  4OMZ A;  1G4D A;  3IWF A;  4I0B A;  5E17 F;  5H20 A;  2CO5 A;  2UXX A;  3WTZ A;  4PZJ A;  1F9N A;  1UB9 A;  2QUF A;  1KU9 A;  3FF5 A;  1BIB A;  4MEY F;  3ZMU A;  1JE8 A;  1ZG5 A;  5LGU A;  2RKH A;  2HQR A;  4HX4 A;  2H6C A;  1K78 A;  2IRF G;  3E6D A;  2DK8 A;  3SQN A;  1OKR A;  2WTE A;  5K5O A;  4HA8 A;  3JW4 A;  4LGW A;  1IUY A;  3SXY A;  3R0A A;  3KLO A;  2Y0M A;  2XRN A;  1B59 A;  2OZU A;  1U5T C;  5LLQ A;  4UUV A;  2LKP A;  4EJT A;  1S3J A;  4JK1 X;  2OU2 A;  1FNN A;  3IWZ A;  4KFC A;  5LHH A;  3I54 A;  2PI0 A;  4LMY A;  5ICC A;  2QQB A;  4OIN F;  3RI4 A;  2M5W A;  1BI1 A;  5DD8 A;  2BYV E;  1HKS A;  3RDI A;  1J75 A;  3GEZ A;  3M7G A;  4UVC A;  3QU6 A;  3BJ6 A;  2Q2E A;  2P8T A;  5JVT A;  1CF7 A;  3B73 A;  3P7N A;  1YO5 C;  2JT1 A;  2RGV A;  1RUO A;  3R61 A;  4S05 A;  3N97 A;  4EJV A;  1F5T A;  5L3F A;  2PBI A;  2RC4 A;  2XAH A;  1C0W A;  2OQR A;  4ESB A;  3KP5 A;  3U9G A;  2GIV A;  1MKM A;  4HYE A;  4ENK A;  3WTS C;  4GYG A;  5HVQ C;  3VOE A;  4IRI A;  1IN7 A;  1QGP A;  2ZME A;  4ESJ A;  1W7P B;  4UV8 A;  5HDK A;  4P96 A;  1U3E M;  4K2E A;  3OOP A;  1R22 A;  4O5V A;  1IRG A;  1IN6 A;  2ZCW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...