1U60A

Mcsg apc5046 probable glutaminase ybas
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
309
structure length
309
Chain Sequence
b'LDANKLQQAVDQAYTQFHSLNGGQNADYIPFLANVPGQLAAVAIVTCDGNVYSAGDSDYRFALESISKVCTLALALEDVGPQAVQDKIGADPTGLPFNSVIALELHGGKPLSPLVNAGAIATTSLINAENVEQRWQRILHIQQQLAGEQVALSDEVNQSEQTTNFHNRAIAWLLYSAGYLYCDAMEACDVYTRQCSTLLNTIELATLGATLAAGGVNPLTHKRVLQADNVPYILAEMMMEGLYGRSGDWAYRVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDEDGNSVRGQKMVASVAKQLGYNVFKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable glutaminase ybaS
publication title Functional and structural characterization of four glutaminases from Escherichia coli and Bacillus subtilis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 111
structure length 309
sequence length 309
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.2: Glutaminase.
pdb deposition date 2004-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04960 Glutaminase Glutaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1u60A00
4K0WA 1K4EA 2JC7A 3OC2A 3ZNYA 1W8YA 3W8KA 3LY3A 1YMSA 1RGZA 2WAFA 2WGVA 3GV9A 3CG5A 3ISGA 4DRTA 3GSGA 2Y2LA 3UDFA 4WELA 3ZDJA 2ZC4B 5HAQA 1ES3A 4PPRA 1L0DA 1IEMA 4WMCD 5KSCA 3HLFA 4BLMA 1TDLA 1FCNA 2B5RA 4L0LA 2J9OA 5FAQA 1BZAA 1PWGA 3RXXA 1I2WA 1BT5A 1K38A 1E4DA 2I72A 2ZM8A 4S2LA 2EX6A 5BOHA 4QU3A 3PBQA 5DTSA 5GHZA 3CJMA 4WZ5A 2CC1A 1N9BA 5I94A 3IF5A 3IXGA 4FD8A 4CJNA 4MBHA 4R3JA 4FCFA 3N8SA 5FATA 3NDEA 3HREA 5EVIA 1TVFA 1ONGA 4MLLA 4JF6A 4U0XA 4F94A 3LO7A 1XA7A 1L2SA 2H5SA 3O87A 4C6YA 3WS0A 1H5XA 4DE1A 3SH8A 4X6TA 3OPHA 4JF4A 1KVLA 4QB8A 5CEBA 4P87A 1RGYA 1XA1A 5EOOA 4EUZA 3G35A 5M18A 3G34A 3RJUA 3E2KA 3M6HA 5EVIB 2ZQDA 4WZ5C 5F1GA 1FCMA 2EFUA 1L0GA 5JYOA 3B3XA 4KENB 3FV7A 5EVIC 4E3JA 4WEKA 1KGEA 3UDXA 2UWXA 4LV2A 5FASA 4GZBA 5AQ7A 5AQAA 1YM1A 2JCHA 5KZHA 4OPQA 4HEFA 1K25A 4E3KA 4IBRA 3ZCZA 3HVFA 5KMWA 4DKIA 1WYCA 4B88A 4DE3A 5JYPA 4OOMA 4QY5A 3HL9A 3NBLA 4KZ9A 1E25A 3BLSA 3M6BA 1BLHA 4OLDA 5CHMA 3PTEA 1LI9A 1ZKJA 3EQVA 2G2UA 2XDMA 2HDUA 5FI2A 4A5RA 2G2WA 2ZMAA 3GMWA 3FZCA 2A3UA 4KZ3A 3PBSA 1ES5A 1KDSA 2IWDA 2ZM0A 1PI4A 4S2NA 5FQJA 2ZC6B 3JYIA 3WS1A 1ZG6A 1XGIA 4QHCA 3PBRA 3LEZA 3VP1A 4EQIA 5L2FA 5DF7A 1MWUA 1FR6A 1LI0A 1FSWA 5E2EA 2EX2A 3HUNA 4IVIA 4R3BA 2XFTA 3BFEA 4PM9A 4QD4A 3TG9A 3ZFZA 3ZVWA 4DDSA 1DY6A 4R4RA 4E3IA 1YQSA 1IYOA 2ZLYA 4PMAA 1MWTA 2WADA 3HUOA 2PU2A 4JXWA 2WKEA 3BM6A 4MEZA 3W4QA 4BL2A 1K55A 4YINA 5EUAA 3UPNA 1M40A 3BRMA 4GOGA 4EBLA 1W5DA 2EX8A 2OLUA 2R9WA 2WZZA 3AGEA 4KZ4A 3N7WA 1TDGA 5HFOA 4Y0TA 4M3KA 1PWDA 1K54A 3MKEA 2WK0A 4FSFA 5F82A 1LLBA 3G31A 3BFDA 2XLNA 1XPBA 4WMCA 1XKZA 3BFCA 4S2NC 2WAEA 4WM9A 1C3BA 5FDHA 5AQ9A 5HW3A 3FYZA 2DRWA 5G18A 4E3NA 2VGJA 5U47A 1JTGA 5DF9A 1GCEA 1N4OA 2HDSA 4OPRA 2IWBA 3WRZA 1NYYA 4RX2A 3SH9A 3SS4A 5F1FA 3BECA 4BJPA 4OVDA 1PZPA 3A3DA 5HAPA 4DXCA 2EXAA 1RP5A 2PBYA 3IQAA 2XEPA 1SDNA 3M2JA 4NETA 4DDYA 3IXDA 2Y2PA 1GA0A 1K55C 3QNCA 2P9VA 1KE3A 4U3TA 1QMEA 1K57C 1TEMA 1XXMA 5A91A 1GA9A 1JWVA 3Q7VA 1K54C 1WYBA 2XGNA 2RCXA 2HDRA 3S22A 4OLGA 1H8ZA 4GB7A 5FQMA 1ES2A 4DE2A 4KZBA 1FR1A 3D4FA 4KQOA 2ZM2A 5CTMA 1SDEA 1ERQA 3GTCA 2E8IA 1KGGA 4LCMA 3UNWA 5M19A 1PZOA 5GLCA 3ZG7B 4GD6A 4ZBEA 3PAGA 4ID4A 4KZ8A 2Y2GA 5TFQA 3C7UA 1LL9A 2QZ6A 3CZDA 1QMFA 4EWFA 1W8QA 2Q9MA 2XK1A 3AGDA 4OH0A 5GLBA 4LCLA 3Q7VB 3VFHA 3HLDA 4OP8A 4XXRA 1FSYA 1SHVA 3OCNA 5CRFA 1MY8A 1YT4A 1PW8A 1MWRA 1XP4A 3AGFA 5E43A 2IWCA 4GNUA 5FQKA 1M6KA 3VSKA 2Y2NA 1S6RA 4S2KA 4WYYA 2ZQCA 5A92A 2WGWA 3IWIA 4GKUA 3ITAA 2ZD8A 3O3VA 4JF5A 5M1AA 1NJ4A 1I2SA 1J9MA 1MXOA 2C5WB 1S0WA 2J9PA 4KQQA 5EVLA 1XX2A 4R1GA 5HL1A 1IYPA 5CGWA 1ZC2A 1NY0A 4XUXA 5CXWA 3EQUA 2ZJ9A 3V3SA 2Q9NA 3HLCA 4HESA 1AXBA 5GHXA 1O7EA 1PIOA 1K6RA 3P98A 3Q1FA 2EFXA 3HLWA 3PBTA 3HBRA 2ZQ8A 3VSLA 5A93A 3S1YA 1MWSA 3MXRA 3MBZA 1NXYA 2BG1A 1HVBA 2Y2IA 1ALQA 3Q7ZA 1YLJA 4OP5A 3WS5A 3UE3A 2HDQA 4BQMA 4OQHA 3FKVA 1G6AA 4Y0UA 5FQQA 4S2IA 2XQZA 1W7FA 3DTMA 2Y2JA 3C4PA 3N8RA 3A3IA 3PBOA 3DWKA 5DF8A 1K56D 4P0MA 1Y54A 5HAIA 4WEJA 1EWZA 5EOEA 5TR7A 1KE4A 3BYDA 2Y2MA 3PAEA 1NZOA 2HP6A 4H8RA 4OONA 5GLDA 4P6BA 3ZHHA 3FWLA 2H0TA 1HD8A 1XGJA 4UA9A 3ZG8B 1FCOA 2XD5A 4DXBA 4OPZA 3IF6C 4R0QA 1DJAA 2QPNA 1E3UD 1OMEA 5FSRA 4LV0A 2WUQA 4LENA 3E2LA 3OPPA 5E2GA 1MPLA 1YMXA 4N1XA 1I5QA 1H8YA 1K57A 2Z2LB 4KZ6A 1GHIA 4Y7PA 3IT9A 4UA7A 4X55A 1RCJA 3UDIA 3VP4A 4R23A 4OOYA 2EX9A 2ZC3B 1WE4A 3G2YA 1DJCA 1BSGA 4ZJ1A 2OLVA 2R9XA 1PI5A 3NIAA 3C5AA 4CPKA 3UO9A 3SOIA 4YFMA 5E2FA 5CGXA 5EE8A 3MXSA 3WWXA 2BLSA 4LV3A 3Q81A 4GDNA 3SS3A 1KDWA 3OZHA 1DJBA 3NI9A 4RVAA 2FFFB 3IWQA 2Z2MB 2Y2OA 1BLPA 4JKTA 4DF6A 1EI5A 5AQBA 4RA7A 1YLWA 3MFDA 2EXBA 1U60A 3A3FA 1IKGA 4JXGA 1HZOA 4PM8A 4UA6A 1JVJA 3TSGA 3GVBA 4K91A 1GHPA 4Z9QA 1O07A 3RXWA 4PM6A 3OPRA 3SH7A 2HP5A 2XF3A 2HP9A 1MBLA 3IWOA 4IVKA 5CGSA 4P85A 3A3JA 4ZDXA 1BLCA 1CEFA 2ZQAA 1NRFA 2GDNA 1YLZA 4JLFA 5CERA 3ZGAB 4GN2A 4S2MA 3GQZA 4WZ4A 3ZG9B 1KGFA 5E2HA 1JWZA 4JPMA 2X02A 3HLBA 3Q82A 3VFFA 4BENA 4OOLA 2RL3A 3MKFA 5A90A 3OCLA 1YLYA 2X01A 1G68A 4BD0A 4X53A 4KZ5A 3QNBA 4ZJ3A 1ESUA 4O7DA 2OSUA 2Y2KA 4N1HA 3WS4A 2XR0A 2P9VB 4E6WA 5DTKA 4E3LA 3HLGA 4QJGA 3UY6A 3S4XA 3V3RA 3IXBA 4B4ZA 2C6WB 1SCWA 2Y55A 3P09A 4S2PA 1CK3A 1LHYA 4GDBA 3QHYA 2HPBA 3UPOA 2ZC7A 4OQIA 1BUEA 5D3OA 1MKIA 3HUMA 2P74A 3WRTA 2Y59A 3VP2A 4X68A 3DW0A 1ES4A 2H10A 1SKFA 4E3OA 4PM7A 5GLAA 3IH9A 3MZFA 5FI6A 3V50A 1FQGA 2Y4AA 1W79A 2V2FF 5FAOA 4KG5A 3W4PA 3ZG5A 1ZG4A 3IHAA 4K0XA 2WZXA 3Q07A 5CEDA 3G2ZA 4KQRA 4QY6A 1IYSA 1FOFA 2FFYA 2JE5A 2Y2QA 4NK3A 4B4XA 1HTZA 4N92A 3CMZA 4JXVA 3O86A 4HBUA 1CI8A 3IH8A 4MBFA 4RX3A 5HARA 1K4FA 3ZNTA 4D2OA 1K56A 5IHVA 3G30A 5KSHA 1IELA 2ZC5B 1KVMA 2WKHA 3IF6A 4S2JA 3UE1A 4C3QA 5CECA 5EVID 3VP3A 3NCKA 4MBKA 1BULA 1YLPA 4IBXA 3DWZA 4EBNA 1GHMA 3NY4A 4JBFA 3SS5A 1VM1A 2XFSA 2WGWB 1E3UA 4BD1A 4N9LA 3HLEA 1BTLA 1ERMA 4IEDA 4C75A 2A49A 4S2OA 4KZAA 2ZQ7A 4OKPA 4OPYA 5EPHA 3NDGA 4JXSA 4X69A 5F83A 3N8LA 4ZTKA 4RYEA 1JTDA 1PW1A 5GL9A 3IHBA 3ITBA 2J8YA 3O88A 5HX9A 4EV4A 3IF6B 3G32A 1BLSA 2H0YA 3C4OA 4BL3A 2JBFA 3PBNA 3UN7A 3GR2A 5TGFA 3TOIA 1K6SA 3V5MA 2QMIA 2Y91A 3OPLA 3UPPA 2XD1A 3BFGA 4OQ0A 4E3MA 4KG2A 4GD8A 4Q8IA 1Z6FA 1L0EA 4KZ7A 5FQIA 1ESIA 5DVAA 1VQQA 3GRJA 5FAPA 1PYYA 3N6IA 3VP0A 3WS2A 4E6XA 4KG6A 4HBTA 1KE0A 1IKIA 4WBGA 3G4PA 5CTNA 4LV1A 1Q2PA 1EROA 4Y0OA 3ZVTA 3LY4A 4N9KA 2X71A 1CEGA 4ZJ2A 2VGKA 3A3EA 1YLTA 3BFFA 1JWPA 2V1ZA 5FQ9A 2J7VA 3V39A 3NC8A 3I7JA 4UAAA 3N4IA 4OQGA 5GHYA 1LL5A 4MNRA 4X56A 3VOZA 5FI7A 4FH2A 2DNSA 4U0TA 5CHUA 2WKIA 3IXHA 1IYQA 3MZDA 3FKWA 4XUZA 5DTTA 3ZG0A 3MZEA 4PM5A 5CHJA 1Q2QA 3BLMA 3LCEA 1NYMA 2WYXA 2WGIA 2DCFA 4UHUA 5FA7A 3UE0A 2ZQ9A 3VOYA 2OV5A 1NZUA 1ONHA 3W4OA 2XH9A 5J8XA 1L0FA 3C7VA 2V20A 2Y2HA 3VMAA 1CI9A 3M2KA 4EBPA 5EECA 4ZAMA 3BEBA 4R4SA 4DE0A 4FH4A 1PWCA 2PU4A
chains in the Genus database with same CATH superfamily
2PT7A 2JC7A 1W8YA 3RTYA 4MDZA 1YMSA 1RGZA 3MMHA 2WAFA 3ISGA 3CG5A 3JVUA 3ZQ5A 4WELA 2W3FA 1AWIA 4EEUA 5HAQA 3NOUC 4WMCD 2I9VA 5KSCA 2O9BA 1IFQA 5FAQA 3RXXA 1Y28A 1LSVA 1OTEA 2ZMVA 2I72A 2Z6DA 4BMWA 4YWZA 2V8CA 5AJGA 4EERA 3CJMA 5TBMB 1XJ2A 4CJNA 1PRQA 4R3JA 3N8SA 1KOUA 2HZ5A 1TVFA 1JNUA 3RFBA 3KSHA 3KYZA 4NXBA 4QPRA 3OPHA 1STZA 3G35A 5EVIB 2ZQDA 4GCZA 3GECA 4WZ5C 5F1GA 2INWA 3CUEC 4KENB 1N9NA 3FV7A 5AQ7A 5AQAA 5KZHA 3LIEA 3IS2A 3HVFA 1WYCA 4QY5A 4KZ9A 1E25A 4Q0JA 1ZKJA 3KSIA 2XDMA 2G2WA 3PBSA 4HY8A 1PI4A 4S2NA 3S7NA 1GSVA 3DTEA 1XGIA 5MC7A 5HZHA 2J3TD 2O9CA 5DF7A 5I5LA 4PM9A 5F6AA 3ZVWA 3ZFZA 4R4RA 4H6JB 3T4QA 4PKYA 1MWTA 3HUOA 3LGOA 2WKEA 3BM6A 1K55A 3B47A 4YINA 3H9WA 4GOGA 2XA7M 3AGEA 4KZ4A 3N7WA 2WK0A 3T1RA 1LLBA 4WMCA 4JGPA 3T4JA 5AQ9A 1OTIA 3U4LP 3LIDA 2P08A 3WRZA 5F1FA 1IOUA 4OVDA 2EXAA 4IJGA 3IQAA 4NETA 4Y5FA 3LICA 3V67A 1GA9A 2PDRA 1H8ZA 1G5UA 3FG8A 4KZBA 1H8MA 1SDEA 3JVVA 1OJ5A 4LPZA 3F1NA 1KGGA 3UNWA 4YNRA 2IA2A 1PZOA 5GLCA 3ZG7B 4GD6A 4KZ8A 3C7UA 2QZ6A 1W8QA 2XK1A 4OH0A 3Q7VB 4IHQA 4G3WA 1DRMA 1VEUB 4L9FA 3LFVA 1MWRA 5E43A 1M6KA 4I39A 4S2KA 4WYYA 2PBDP 2NUTC 3O3VA 3CWFA 2J9PA 1XX2A 4PKYG 3BW6A 1IYPA 5CGWA 3MS6A 2Q9NA 3HLCA 2M7VA 5DJUA 2EFXA 1W63Q 5A93A 3S1YA 3MXRA 1HVBA 3QP5A 1YLJA 3WS5A 3UE3A 3T4TA 1NLZA 3FKVA 4Y0UA 2B02A 3DTMA 2Y2JA 3C4PA 1TF1A 2Y2MA 3MR0A 3FWLA 1FCOA 4OPZA 4R0QA 2QKPA 2WUQA 3LIBA 1EW0A 4N1XA 2ZL1B 4Y7PA 4LFUA 3IT9A 4YOFA 2EX9A 2ZC3B 3G2YA 1DJCA 4QWOA 2OLVA 4I5SA 1PI5A 2Z6CA 3UO9A 4YFMA 5EE8A 2BLSA 3U2AA 2VV7A 1KDWA 1DJBA 3NI9A 3IWQA 4JKTA 3IX8A 4DF6A 3UE6A 4O01A 1YLWA 1OT6A 3CPTB 4PM8A 4K91A 1L3LA 4RQ9A 1O07A 4II7A 3OPRA 1VETA 4Y3IA 1DP8A 3IWOA 3NOTC 4P85A 5HDCA 1CEFA 5CERA 2WKRA 4GN2A 3ZGAB 4S2MA 3S7PA 3CHWP 5AVFA 2QYBA 1GSXA 1YLYA 1G68A 4BD0A 4X53A 3T4LA 1FILA 3WS4A 3SW1A 5L10A 3UY6A 3IXBA 3D72A 2Y55A 1SCWA 3P09A 3QHYA 1Z09A 1ZHHB 5F69A 3E4QA 4WUJA 3DW0A 2H10A 4EU0A 5GLAA 3IH9A 5FI6A 1FQGA 5FAOA 1OPXA 3PR6A 4KQRA 4IUHA 4JXVA 4UQIS 1CI8A 5HARA 1UGUA 4C3QA 2ZC5B 1G28A 5EVID 1TS8A 4WF0A 4G3VA 4IBXA 1XJ4A 4JBFA 4GS9B 2XFSA 1BTLA 4C75A 4S2OA 3P01A 4RYEA 3B33A 1PW1A 3VE4A 3G32A 3C4OA 2H0YA 1OTBA 5EFWA 3OPLA 2PAVP 4OQ0A 4Q8IA 1ESIA 2JKTM 2D02A 1PYYA 2W27A 3N6IA 4KG6A 3F1PB 5K5BA 3H82A 5CTNA 4LV1A 3ZVTA 2X71A 3A3EA 1JWPA 2V1ZA 5FQ9A 3V39A 4AFIA 4BBTA 3I7JA 5GHYA 4OQGA 4X56A 3VOZA 2GZAA 5CHUA 2WKIA 3MZDA 3FPWA 2KDKA 4XUZA 3ZG0A 3MZEA 1MKMA 4Y13A 1Q2QA 3BLMA 1NYMA 2WGIA 2DCFA 2ZQ9A 3T1XA 3M2KA 5EECA 4DE0A 4DDSA 1PWCA 4CLCD 5TBMA 2XSSA 2WGVA 3ZDJA 3MQQA 4PPRA 4KUOA 4BLMA 3L7HA 2B5RA 1BT5A 1K38A 4FUWA 3K3DA 4S2LA 2VA0A 1VHMA 2EX6A 2GJ3A 2CC1A 3IXGA 1S67L 5FEFA 3ICYA 5FATA 3T1QB 3HREA 5EVIA 3MJQA 4U0XA 3WS0A 4R6LA 2M1CA 4X6TA 2LB9A 2VKSA 4QB8A 2O99A 1NRJA 3NULA 4EUZA 5M18A 1FIKA 1VB6A 2VGLM 1D06A 1FCMA 2JKRM 4E04A 4I3IA 1GSWA 1KGEA 3A0VA 4GZBA 1YM1A 2K31A 1YSQA 4OPQA 4Y15A 3ZCZA 4B88A 2GX5A 3BLSA 4H6JA 3PTEA 3EQVA 5FI2A 2O9AA 2ZMAA 3GMWA 3FZCA 2IWDA 2ZM0A 4EESA 5FQJA 1T1CA 3JYIA 3WS1A 2VZWA 3PBRA 3LEZA 3IBJA 2K2NA 1FSWA 1X0OA 2QJ7A 1T19A 4R3BA 3L9KA 4CLCA 2LB5A 2ZLYA 4JXWA 2PU2A 1F2KA 3W4QA 5EUAA 2EX8A 1J3WA 5HFOA 4M3KA 1K54A 3G31A 3BFDA 1T18A 4S2NC 4WM9A 3UB9A 1C3BA 1TS7A 5FDHA 3FYZA 2DRWA 5IU1A 1JTGA 5DF9A 1N4OA 4ME4A 4GLQA 3SH9A 2ZOIA 3BECA 3CAXA 1PZPA 5HAPA 1RP5A 1SDNA 3M2JA 4DDYA 4EW7A 2Y2PA 1K55C 3OBFA 1K57C 1TEMA 1XXMA 3Q7VA 3S22A 1UWPX 4GB7A 5FQMA 3SZTA 1VEUA 3NECA 4DJ2A 3GTCA 4XT2B 5M19A 3LUQA 4EETB 1LL8A 2P04A 4ZBEA 4ID4A 4WN5A 3BWLA 1LL9A 2VV8A 5HSQA 4ARZB 4B93A 3CZDA 2QJ5A 1QMFA 4P6ZM 3AGDA 2Q9MA 4LCLA 2JKRI 3HLDA 3ULFA 4XXRA 1ZTUA 1FSYA 4HH3A 4I38A 5CRFA 2GNXA 3AGFA 1XP4A 5HDSA 1S6RA 4IUKA 3IBRA 2PD8A 3IWIA 3ITAA 2ZD8A 5M1AA 1NJ4A 1I2SA 1J9MA 4KQQA 5EVLA 5HL1A 1PFLA 2WKQA 4HNBA 1OTAA 3UB5P 3EQUA 3V3SA 4HESA 1K6RA 2NUPC 3MBZA 2BG1A 1ALQA 4F3LB 2HDQA 2ZL1A 4BQMA 1G6AA 5FQQA 4S2IA 3N8RA 3A3IA 1K56D 4P0MA 1Y54A 5HAIA 4WEJA 5TR7A 3PAEA 3T50A 4H8RA 5GLDA 1HD8A 1XGJA 4MMNA 4UA9A 4Z1WA 3ZG8B 2XD5A 2J3TC 1DJAA 2QPNA 1E3UD 4LV0A 2W0NA 3D3OA 4HJ6A 2FH5A 1K57A 2Z2LB 3CPTA 2V9AA 1RCJA 4LGWA 4OOYA 4MCWA 1BSGA 4G3KA 3NIAA 3C5AA 5E2FA 2OAP1 5CGXA 3KSFA 3SS3A 3OZHA 5KIZA 3LR0A 5AQBA 4PHTA 4CLCB 5G4ZA 1U60A 4JXGA 1JVJA 3TSGA 3IX4A 2W1TB 4X1MA 3RXWA 2HP5A 4IVKA 2BASA 3A3JA 3GQZA 4WZ4A 3ZG9B 1KGFA 3T4KA 2X02A 4BENA 3OCLA 3EGXC 2XR0A 3V3RA 4B4ZA 2B18A 1CK3A 1LHYA 4GDBA 3UPOA 1MKIA 1YSPA 1ACFA 2Y59A 3VP2A 1SKFA 4GS9A 1F98A 1CF0A 1W79A 3ZG5A 1HLUP 3UMDA 2WZXA 3Q07A 2YKHA 3P7NA 5EV0A 1IYSA 1FOFA 2JE5A 2Y2QA 1DP9A 4B4XA 1HTZA 3O86A 4HBUA 4D2OA 2W3HA 1K56A 1T1BA 5KSHA 2WKHA 5CECA 3NCKA 4EEPA 4D60A 5HWWA 5EM1A 3LIAA 1BULA 2K7SA 1GHMA 1E3UA 4N9LA 3CI6A 3F1PA 5F83A 2ZQ7A 4OKPA 3NDGA 3LR3A 4JXSA 4X69A 3BY9A 3NHQA 5GL9A 3A0SA 2J8YA 3O88A 3CITA 5HX9A 4EV4A 3IF6B 3VE3A 3PBNA 5TGFA 2Y91A 3UPPA 2XD1A 3BFGA 4E3MA 3HCYA 2H28A 4KZ7A 4HJ4A 5FQIA 1VQQA 3GRJA 1IKIA 3OLOA 1Q2PA 1EROA 3LY4A 1CEGA 4L9EA 1YLTA 3LR4A 2J7VA 3NC8A 2V1AA 4FH2A 2DNSA 2V0UA 3FKWA 3K3CA 4PM5A 5CHJA 4UHUA 2WYXA 5FA7A 1ONHA 5L07A 2A24B 1V9YA 4M4XA 3W4OA 1L0FA 2V20A 2Y2HA 1CI9A 4R4SA 4ETXA 1S4SA 4DJ3A 4K0WA 3OC2A 3ZNYA 5EM0A 3LY3A 3LI9A 4DRTA 5HDDA 3GSGA 3UDFA 2ZC4B 3TJZC 1L0DA 1IEMA 2EWWA 2OWJA 1FCNA 4L0LA 2J9OA 1I2WA 2ZM8A 3NOPC 5BOHA 4QU3A 5DTSA 5GHZA 3IF5A 4FD8A 4MBHA 4FCFA 1UWNX 3KYEA 2J80A 4WLAA 1L2SA 2R78A 3SH8A 4JF4A 1KVLA 1OTDA 1WA9A 1Y4OA 1XA1A 4JGQA 4NKPA 1XFQA 3RJUA 2L1MA 3M6HA 5JYOA 2EFUA 1L0GA 3B3XA 3EWKA 5EVIC 3QP2A 4E3JA 2JCHA 1S4RA 4DKIA 4DE3A 5JYPA 3NBLA 5AVEA 5IS1A 1BLHA 2WKPA 1TD5A 2A3UA 1A0KA 1ES5A 1F5MA 2ZC6B 2HJ9C 2VX8A 4QHCA 1YKDA 5L2FA 2VGLS 5HWTA 1FR6A 1LSXA 2CMNA 3MSHA 2EX2A 3HUNA 3KO6A 3DBAA 4IVIA 3NJAA 2XFTA 1MZUA 3TG9A 1YQSA 1IYOA 5HD3A 2WADA 4NXEA 4BL2A 1M40A 4EBLA 3VOLA 1W5DA 2OLUA 2WZZA 4LRYC 3MKEA 5F82A 2XLNA 1XPBA 1XKZA 4L9GA 3R4KA 5J3WA 5G18A 2VGJA 3MXQA 1K0KA 1GCEA 2VEAA 4EUVA 4R70A 4MN5A 2Q0OA 2IWBA 1CJFA 1NYYA 1XJ6A 3H7WA 4XT2A 2OOLA 4DXCA 3W2ZA 1N9OA 5LBRA 4CLCC 3E4PA 3IXDA 2L0WA 4ARZA 3HJKA 1KE3A 4U3TA 1K54C 2RCXA 2HDRA 4OLGA 1FR1A 3D4FA 4KQOA 2ZM2A 4B9OA 5CTMA 4ETZA 1S1ZA 4O8GA 4ZRRA 5TFQA 3KSGA 4EXOA 2PYPA 1H3QA 4EWFA 3VFHA 2ZBBA 4OP8A 4BBVA 3JPUA 1SHVA 1MY8A 1YT4A 5FQKA 3VSKA 2Y2NA 2ZQCA 4F3LA 5A92A 4MN6A 4GW9A 1MXOA 2C5WB 5CX7A 1ZC2A 2B95A 5F5YA 5CXWA 2OAQ1 2JKTI 4GHIB 1TS6A 1PIOA 3P98A 3Q1FA 3PBTA 3HLWA 3VSLA 4P6ZS 2VJWA 3Q7ZA 2HV1A 3DTKA 4OQHA 2XQZA 5A8BA 1BYWA 3UB6A 2DMWA 5EOEA 1KE4A 3BYDA 2HP6A 2H0TA 2PR5A 3E98A 4HJ3A 4PAUA 3QP6A 3IF6C 1SZVA 5FSRA 4LENA 3E2LA 1MPLA 4CLCE 1I5QA 3UDIA 4UA7A 2W1TA 4R23A 1WE4A 4ZJ1A 2R9XA 3T4SA 3SOIA 3K2NA 4GDNA 5DFXA 3HJIA 4RVAA 1MC0A 5G4YA 4RA7A 3MFDA 2EXBA 3A3FA 4HH2A 1IKGA 3LEQA 1HZOA 2QWSA 4PM6A 3SH7A 4KUKA 2XF3A 4JGOA 5L8MA 5CGSA 2XA7S 1BLCA 2ZQAA 1NRFA 2GDNA 1YLZA 3QP8A 5E2HA 4JPMA 4NXFA 3Q82A 3T1SA 3H7WB 4OOLA 2RL3A 3MKFA 5A90A 4FOFA 4UEYA 4KZ5A 3QNBA 1ESUA 2OSUA 4N1HA 5HPIA 5DTKA 4E3LA 3HLGA 3FC7A 2C6WB 3CLOA 5DJTA 5J7EA 4S2PA 1XJ3A 1LSWA 2HPBA 4LLOB 1BUEA 5D3OA 3HUMA 1S66L 2P74A 3WRTA 4X68A 2ACGA 1ES4A 3UB7A 3MZFA 2V2FF 4KG5A 3KYQA 3QP4A 3KX0X 3G2ZA 2JKFA 4X1LA 4QY6A 3C8CA 4NK3A 2PR6A 4N92A 2V0WA 3CMZA 2D01A 1IELA 3IF6A 1KVMA 4S2JA 2BTFP 4MBKA 4WL9A 3E0YA 2JKGA 4KQDA 3NY4A 3DTIA 4IEDA 2A49A 4GJ4A 5EPHA 3N8LA 4HIAA 3RH8B 5F68A 5FDSA 1P9WA 3IHBA 3ITBA 1P97A 5DKKA 1BLSA 4BL3A 2JBFA 3UN7A 3TOIA 1DP6A 1OT9A 3LI8A 3T12B 5FAPA 4Q0IA 3WS2A 4E6XA 4HBTA 2KX6A 2A24A 4Y0OA 4N9KA 2UV0E 3EEAA 4ZJ2A 3BFFA 5L09A 3PYPA 4UAAA 1LL5A 1OJGA 4U0TA 5EVEA 1IYQA 3F1OB 2OWHA 3LCEA 2HJEA 3UE0A 1NZUA 3TE8A 3VMAA 4ZAMA 3BEBA 4FH4A 2PU4A 1K4EA 2YKFA 3W8KA 3C2WA 2VLGA 3GV9A 4LRXC 2Y2LA 2A2LA 2Y8HA 1ES3A 2Y79A 1T1AA 3HLFA 2W3EA 3R7WB 1TDLA 1V9ZA 1BZAA 1PWGA 4Y2FA 1E4DA 3VV4A 3PBQA 4WZ5A 5I94A 1N9BA 2P7JA 3CUEA 3NDEA 1ONGA 4MLLA 4JF6A 5HD5A 4F94A 3LO7A 1XA7A 2H5SA 3O87A 4JGRA 4C6YA 1H5XA 4DE1A 2ZOHA 3PHYA 3MFXA 4HQAA 2EWVA 5CEBA 4P87A 1RGYA 2V8FA 3T4OA 5EOOA 3G34A 3E2KA 2M7UA 3E4OA 4WEKA 3UDXA 2UWXA 4LV2A 5FASA 2PRFA 4HEFA 1K25A 4E3KA 4IBRA 2EA9A 5KMWA 1YPRA 4HP4A 2VV6A 4HP9A 1PNEA 4OOMA 3HL9A 3M6BA 5HL6A 2PD7A 4OLDA 5CHMA 1LI9A 2G2UA 4A5RA 2HDUA 4KZ3A 4HI4A 1KDSA 1ZG6A 4NXGA 3VP1A 4EQIA 1MWUA 3IS2B 1LI0A 3TW8A 5E2EA 1TS0A 3FPVA 4QD4A 2XRNA 3BFEA 4E3IA 1DY6A 4PMAA 4MEZA 4DMZA 2HGVA 3UPNA 3MQOA 3BRMA 2R9WA 5TJJA 3UMEA 1TDGA 4Y0TA 1PWDA 4FSFA 3LYXA 3BFCA 2WAEA 5DFYA 2MJ6A 3LR5A 5HW3A 2VK3A 4E3NA 3GDIA 5U47A 3EOIA 2HDSA 4OPRA 2W3DA 4K08A 4RX2A 3SS4A 5FL3A 4BJPA 3A3DA 1NLYA 2PBYA 2W1RA 2XEPA 4DN0A 1GA0A 3QNCA 2P9VA 1QMEA 3ZYTA 5A91A 2V1BA 1JWVA 1WYBA 2XGNA 1ES2A 4DE2A 1ERQA 2E8IA 4LCMA 4X25A 5J4EA 4O0PA 5IT5A 1SKOA 3BY8A 2J3WA 3PAGA 2Y2GA 3TRCA 3QP1A 3EEHA 5GLBA 1ODVA 3A0RA 4GHIA 3B42A 3OCNA 2JN7A 1PW8A 2IWCA 1S1YA 4GNUA 3F1NB 4I3JA 2WGWA 4GKUA 4JF5A 4Q0HA 3C30A 1S0WA 4CQHA 2XROA 4R1GA 3DAVA 4BBUA 3BQ8A 1NY0A 4XUXA 1XFNA 2ZJ9A 1AXBA 5GHXA 1O7EA 3HBRA 5DKLA 2ZQ8A 1MWSA 1NXYA 2Y2IA 4OP5A 4I3AA 1W7FA 3PBOA 3DWKA 5DF8A 1EWZA 1G6OA 4OONA 1NZOA 4P6BA 3ZHHA 4NEED 4DXBA 2O0YA 1OMEA 3OPPA 5E2GA 1YMXA 3UB8A 1H8YA 4KZ6A 1GHIA 4X55A 3PXPA 4R3AA 3VP4A 3OOVA 4Y17A 4CPKA 2G7UA 3WWXA 3MXSA 4LV3A 3Q81A 3EGDC 2FFFB 2Z2MB 2Y2OA 1BLPA 1EI5A 1D1JA 3O5YA 4BWIA 1F9IA 3BJNA 4UA6A 3GVBA 1GHPA 4Z9QA 5FEGA 2HP9A 1MBLA 2QHKA 2W3GA 4ZDXA 4JLFA 4MN7A 2KLIA 2HF6A 1JWZA 3HLBA 1H0MA 4UQIM 3VFFA 2L4RA 2X01A 4EQ1A 4ZJ3A 3D9YA 4O7DA 2Y2KA 4ESPA 2P9VB 4E6WA 4QJGA 1VETB 3S7OA 1P9RA 2PYRA 3S4XA 3C38A 2ZC7A 4OQIA 2AVXA 4LRZE 4E3OA 4PM7A 3V50A 3W4PA 2Y4AA 1SKOB 4K0XA 1ZG4A 2PHYA 3IHAA 5CEDA 4HHDA 3IX3A 2ZMFA 2FFYA 4MBFA 4RX3A 3ZNTA 3IH8A 5C5KA 1K4FA 5IHVA 3G30A 5HPFA 3UE1A 3VP3A 1NWZA 3LIFA 4EBNA 1YLPA 3DWZA 3SS5A 2KOIA 1VM1A 3MF0A 2WGWB 2E8JA 4BD1A 3BQAA 3HLEA 1ERMA 4KZAA 1W63M 4OPYA 4ZTKA 4FTXA 3G6OA 3GR2A 1K6SA 3V5MA 2QMIA 1D7EA 4KG2A 4GD8A 1YAXA 1Z6FA 3F1OA 1L0EA 5DVAA 3VP0A 1KE0A 1LT0A 1N9LA 4WBGA 3G4PA 4HOIA 2FZ0A 3S7QA 2VGKA 1P0ZA 3N4IA 2JHEA 4MNRA 5FI7A 3IXHA 3MQ0A 5DTTA 3R7WA 5HWVA 1CQAA 3VOYA 4R38A 2OV5A 4NG2A 3H82B 2XH9A 5J8XA 3C7VA 4EBPA 1JTDA
chains in the Genus database with same CATH topology
4K0WA 1K4EA 2JC7A 3OC2A 3ZNYA 1W8YA 3W8KA 3LY3A 1YMSA 1RGZA 2WAFA 2WGVA 3GV9A 3CG5A 3ISGA 4DRTA 3GSGA 2Y2LA 3UDFA 4WELA 3ZDJA 2ZC4B 5HAQA 1ES3A 4PPRA 1L0DA 1IEMA 4WMCD 5KSCA 3HLFA 4BLMA 1TDLA 1FCNA 2B5RA 4L0LA 2J9OA 5FAQA 1BZAA 1PWGA 3RXXA 1I2WA 1BT5A 1K38A 1E4DA 2I72A 2ZM8A 4S2LA 2EX6A 5BOHA 4QU3A 3PBQA 5DTSA 5GHZA 3CJMA 4WZ5A 2CC1A 1N9BA 5I94A 3IF5A 3IXGA 4FD8A 4CJNA 4MBHA 4R3JA 4FCFA 3N8SA 5FATA 3NDEA 3HREA 5EVIA 1TVFA 1ONGA 4MLLA 4JF6A 4U0XA 4F94A 3LO7A 1XA7A 1L2SA 2H5SA 3O87A 4C6YA 3WS0A 1H5XA 4DE1A 3SH8A 4X6TA 3OPHA 4JF4A 1KVLA 4QB8A 5CEBA 4P87A 1RGYA 1XA1A 5EOOA 4EUZA 3G35A 5M18A 3G34A 3RJUA 3E2KA 3M6HA 5EVIB 2ZQDA 4WZ5C 5F1GA 1FCMA 2EFUA 1L0GA 5JYOA 3B3XA 4KENB 3FV7A 5EVIC 4E3JA 4WEKA 1KGEA 3UDXA 2UWXA 4LV2A 5FASA 4GZBA 5AQ7A 5AQAA 1YM1A 2JCHA 5KZHA 4OPQA 4HEFA 1K25A 4E3KA 4IBRA 3ZCZA 3HVFA 5KMWA 4DKIA 1WYCA 4B88A 4DE3A 5JYPA 4OOMA 4QY5A 3HL9A 3NBLA 4KZ9A 1E25A 3BLSA 3M6BA 1BLHA 4OLDA 5CHMA 3PTEA 1LI9A 1ZKJA 3EQVA 2G2UA 2XDMA 2HDUA 5FI2A 4A5RA 2G2WA 2ZMAA 3GMWA 3FZCA 2A3UA 4KZ3A 3PBSA 1ES5A 1KDSA 2IWDA 2ZM0A 1PI4A 4S2NA 5FQJA 2ZC6B 3JYIA 3WS1A 1ZG6A 1XGIA 4QHCA 3PBRA 3LEZA 3VP1A 4EQIA 5L2FA 5DF7A 1MWUA 1FR6A 1LI0A 1FSWA 5E2EA 2EX2A 3HUNA 4IVIA 4R3BA 2XFTA 3BFEA 4PM9A 4QD4A 3TG9A 3ZFZA 3ZVWA 4DDSA 1DY6A 4R4RA 4E3IA 1YQSA 1IYOA 2ZLYA 4PMAA 1MWTA 2WADA 3HUOA 2PU2A 4JXWA 2WKEA 3BM6A 4MEZA 3W4QA 4BL2A 1K55A 4YINA 5EUAA 3UPNA 1M40A 3BRMA 4GOGA 4EBLA 1W5DA 2EX8A 2OLUA 2R9WA 2WZZA 3AGEA 4KZ4A 3N7WA 1TDGA 5HFOA 4Y0TA 4M3KA 1PWDA 1K54A 3MKEA 2WK0A 4FSFA 5F82A 1LLBA 3G31A 3BFDA 2XLNA 1XPBA 4WMCA 1XKZA 3BFCA 4S2NC 2WAEA 4WM9A 1C3BA 5FDHA 5AQ9A 5HW3A 3FYZA 2DRWA 5G18A 4E3NA 2VGJA 5U47A 1JTGA 5DF9A 1GCEA 1N4OA 2HDSA 4OPRA 2IWBA 3WRZA 1NYYA 4RX2A 3SH9A 3SS4A 5F1FA 3BECA 4BJPA 4OVDA 1PZPA 3A3DA 5HAPA 4DXCA 2EXAA 1RP5A 2PBYA 3IQAA 2XEPA 1SDNA 3M2JA 4NETA 4DDYA 3IXDA 2Y2PA 1GA0A 1K55C 3QNCA 2P9VA 1KE3A 4U3TA 1QMEA 1K57C 1TEMA 1XXMA 5A91A 1GA9A 1JWVA 3Q7VA 1K54C 1WYBA 2XGNA 2RCXA 2HDRA 3S22A 4OLGA 1H8ZA 4GB7A 5FQMA 1ES2A 4DE2A 4KZBA 1FR1A 3D4FA 4KQOA 2ZM2A 5CTMA 1SDEA 1ERQA 3GTCA 2E8IA 1KGGA 4LCMA 3UNWA 5M19A 1PZOA 5GLCA 3ZG7B 4GD6A 4ZBEA 3PAGA 4ID4A 4KZ8A 2Y2GA 5TFQA 3C7UA 1LL9A 2QZ6A 3CZDA 1QMFA 4EWFA 1W8QA 2Q9MA 2XK1A 3AGDA 4OH0A 5GLBA 4LCLA 3Q7VB 3VFHA 3HLDA 4OP8A 4XXRA 1FSYA 1SHVA 3OCNA 5CRFA 1MY8A 1YT4A 1PW8A 1MWRA 1XP4A 3AGFA 5E43A 2IWCA 4GNUA 5FQKA 1M6KA 3VSKA 2Y2NA 1S6RA 4S2KA 4WYYA 2ZQCA 5A92A 2WGWA 3IWIA 4GKUA 3ITAA 2ZD8A 3O3VA 4JF5A 5M1AA 1NJ4A 1I2SA 1J9MA 1MXOA 2C5WB 1S0WA 2J9PA 4KQQA 5EVLA 1XX2A 4R1GA 5HL1A 1IYPA 5CGWA 1ZC2A 1NY0A 4XUXA 5CXWA 3EQUA 2ZJ9A 3V3SA 2Q9NA 3HLCA 4HESA 1AXBA 5GHXA 1O7EA 1PIOA 1K6RA 3P98A 3Q1FA 2EFXA 3HLWA 3PBTA 3HBRA 2ZQ8A 3VSLA 5A93A 3S1YA 1MWSA 3MXRA 3MBZA 1NXYA 2BG1A 1HVBA 2Y2IA 1ALQA 3Q7ZA 1YLJA 4OP5A 3WS5A 3UE3A 2HDQA 4BQMA 4OQHA 3FKVA 1G6AA 4Y0UA 5FQQA 4S2IA 2XQZA 1W7FA 3DTMA 2Y2JA 3C4PA 3N8RA 3A3IA 3PBOA 3DWKA 5DF8A 1K56D 4P0MA 1Y54A 5HAIA 4WEJA 1EWZA 5EOEA 5TR7A 1KE4A 3BYDA 2Y2MA 3PAEA 1NZOA 2HP6A 4H8RA 4OONA 5GLDA 4P6BA 3ZHHA 3FWLA 2H0TA 1HD8A 1XGJA 4UA9A 3ZG8B 1FCOA 2XD5A 4DXBA 4OPZA 3IF6C 4R0QA 1DJAA 2QPNA 1E3UD 1OMEA 5FSRA 4LV0A 2WUQA 4LENA 3E2LA 3OPPA 5E2GA 1MPLA 1YMXA 4N1XA 1I5QA 1H8YA 1K57A 2Z2LB 4KZ6A 1GHIA 4Y7PA 3IT9A 4UA7A 4X55A 1RCJA 3UDIA 3VP4A 4R23A 4OOYA 2EX9A 2ZC3B 1WE4A 3G2YA 1DJCA 1BSGA 4ZJ1A 2OLVA 2R9XA 1PI5A 3NIAA 3C5AA 4CPKA 3UO9A 3SOIA 4YFMA 5E2FA 5CGXA 5EE8A 3MXSA 3WWXA 2BLSA 4LV3A 3Q81A 4GDNA 3SS3A 1KDWA 3OZHA 1DJBA 3NI9A 4RVAA 2FFFB 3IWQA 2Z2MB 2Y2OA 1BLPA 4JKTA 4DF6A 1EI5A 5AQBA 4RA7A 1YLWA 3MFDA 2EXBA 1U60A 3A3FA 1IKGA 4JXGA 1HZOA 4PM8A 4UA6A 1JVJA 3TSGA 3GVBA 4K91A 1GHPA 4Z9QA 1O07A 3RXWA 4PM6A 3OPRA 3SH7A 2HP5A 2XF3A 2HP9A 1MBLA 3IWOA 4IVKA 5CGSA 4P85A 3A3JA 4ZDXA 1BLCA 1CEFA 2ZQAA 1NRFA 2GDNA 1YLZA 4JLFA 5CERA 3ZGAB 4GN2A 4S2MA 3GQZA 4WZ4A 3ZG9B 1KGFA 5E2HA 1JWZA 4JPMA 2X02A 3HLBA 3Q82A 3VFFA 4BENA 4OOLA 2RL3A 3MKFA 5A90A 3OCLA 1YLYA 2X01A 1G68A 4BD0A 4X53A 4KZ5A 3QNBA 4ZJ3A 1ESUA 4O7DA 2OSUA 2Y2KA 4N1HA 3WS4A 2XR0A 2P9VB 4E6WA 5DTKA 4E3LA 3HLGA 4QJGA 3UY6A 3S4XA 3V3RA 3IXBA 4B4ZA 2C6WB 1SCWA 2Y55A 3P09A 4S2PA 1CK3A 1LHYA 4GDBA 3QHYA 2HPBA 3UPOA 2ZC7A 4OQIA 1BUEA 5D3OA 1MKIA 3HUMA 2P74A 3WRTA 2Y59A 3VP2A 4X68A 3DW0A 1ES4A 2H10A 1SKFA 4E3OA 4PM7A 5GLAA 3IH9A 3MZFA 5FI6A 3V50A 1FQGA 2Y4AA 1W79A 2V2FF 5FAOA 4KG5A 3W4PA 3ZG5A 1ZG4A 3IHAA 4K0XA 2WZXA 3Q07A 5CEDA 3G2ZA 4KQRA 4QY6A 1IYSA 1FOFA 2FFYA 2JE5A 2Y2QA 4NK3A 4B4XA 1HTZA 4N92A 3CMZA 4JXVA 3O86A 4HBUA 1CI8A 3IH8A 4MBFA 4RX3A 5HARA 1K4FA 3ZNTA 4D2OA 1K56A 5IHVA 3G30A 5KSHA 1IELA 2ZC5B 1KVMA 2WKHA 3IF6A 4S2JA 3UE1A 4C3QA 5CECA 5EVID 3VP3A 3NCKA 4MBKA 1BULA 1YLPA 4IBXA 3DWZA 4EBNA 1GHMA 3NY4A 4JBFA 3SS5A 1VM1A 2XFSA 2WGWB 1E3UA 4BD1A 4N9LA 3HLEA 1BTLA 1ERMA 4IEDA 4C75A 2A49A 4S2OA 4KZAA 2ZQ7A 4OKPA 4OPYA 5EPHA 3NDGA 4JXSA 4X69A 5F83A 3N8LA 4ZTKA 4RYEA 1JTDA 1PW1A 5GL9A 3IHBA 3ITBA 2J8YA 3O88A 5HX9A 4EV4A 3IF6B 3G32A 1BLSA 2H0YA 3C4OA 4BL3A 2JBFA 3PBNA 3UN7A 3GR2A 5TGFA 3TOIA 1K6SA 3V5MA 2QMIA 2Y91A 3OPLA 3UPPA 2XD1A 3BFGA 4OQ0A 4E3MA 4KG2A 4GD8A 4Q8IA 1Z6FA 1L0EA 4KZ7A 5FQIA 1ESIA 5DVAA 1VQQA 3GRJA 5FAPA 1PYYA 3N6IA 3VP0A 3WS2A 4E6XA 4KG6A 4HBTA 1KE0A 1IKIA 4WBGA 3G4PA 5CTNA 4LV1A 1Q2PA 1EROA 4Y0OA 3ZVTA 3LY4A 4N9KA 2X71A 1CEGA 4ZJ2A 2VGKA 3A3EA 1YLTA 3BFFA 1JWPA 2V1ZA 5FQ9A 2J7VA 3V39A 3NC8A 3I7JA 4UAAA 3N4IA 4OQGA 5GHYA 1LL5A 4MNRA 4X56A 3VOZA 5FI7A 4FH2A 2DNSA 4U0TA 5CHUA 2WKIA 3IXHA 1IYQA 3MZDA 3FKWA 4XUZA 5DTTA 3ZG0A 3MZEA 4PM5A 5CHJA 1Q2QA 3BLMA 3LCEA 1NYMA 2WYXA 2WGIA 2DCFA 4UHUA 5FA7A 3UE0A 2ZQ9A 3VOYA 2OV5A 1NZUA 1ONHA 3W4OA 2XH9A 5J8XA 1L0FA 3C7VA 2V20A 2Y2HA 3VMAA 1CI9A 3M2KA 4EBPA 5EECA 4ZAMA 3BEBA 4R4SA 4DE0A 4FH4A 1PWCA 2PU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K0W A;  1K4E A;  2JC7 A;  3OC2 A;  3ZNY A;  1W8Y A;  3W8K A;  3LY3 A;  1YMS A;  1RGZ A;  2WAF A;  2WGV A;  3GV9 A;  3CG5 A;  3ISG A;  4DRT A;  3GSG A;  2Y2L A;  3UDF A;  4WEL A;  3ZDJ A;  2ZC4 B;  5HAQ A;  1ES3 A;  4PPR A;  1L0D A;  1IEM A;  4WMC D;  5KSC A;  3HLF A;  4BLM A;  1TDL A;  1FCN A;  2B5R A;  4L0L A;  2J9O A;  5FAQ A;  1BZA A;  1PWG A;  3RXX A;  1I2W A;  1BT5 A;  1K38 A;  1E4D A;  2I72 A;  2ZM8 A;  4S2L A;  2EX6 A;  5BOH A;  4QU3 A;  3PBQ A;  5DTS A;  5GHZ A;  3CJM A;  4WZ5 A;  2CC1 A;  1N9B A;  5I94 A;  3IF5 A;  3IXG A;  4FD8 A;  4CJN A;  4MBH A;  4R3J A;  4FCF A;  3N8S A;  5FAT A;  3NDE A;  3HRE A;  5EVI A;  1TVF A;  1ONG A;  4MLL A;  4JF6 A;  4U0X A;  4F94 A;  3LO7 A;  1XA7 A;  1L2S A;  2H5S A;  3O87 A;  4C6Y A;  3WS0 A;  1H5X A;  4DE1 A;  3SH8 A;  4X6T A;  3OPH A;  4JF4 A;  1KVL A;  4QB8 A;  5CEB A;  4P87 A;  1RGY A;  1XA1 A;  5EOO A;  4EUZ A;  3G35 A;  5M18 A;  3G34 A;  3RJU A;  3E2K A;  3M6H A;  5EVI B;  2ZQD A;  4WZ5 C;  5F1G A;  1FCM A;  2EFU A;  1L0G A;  5JYO A;  3B3X A;  4KEN B;  3FV7 A;  5EVI C;  4E3J A;  4WEK A;  1KGE A;  3UDX A;  2UWX A;  4LV2 A;  5FAS A;  4GZB A;  5AQ7 A;  5AQA A;  1YM1 A;  2JCH A;  5KZH A;  4OPQ A;  4HEF A;  1K25 A;  4E3K A;  4IBR A;  3ZCZ A;  3HVF A;  5KMW A;  4DKI A;  1WYC A;  4B88 A;  4DE3 A;  5JYP A;  4OOM A;  4QY5 A;  3HL9 A;  3NBL A;  4KZ9 A;  1E25 A;  3BLS A;  3M6B A;  1BLH A;  4OLD A;  5CHM A;  3PTE A;  1LI9 A;  1ZKJ A;  3EQV A;  2G2U A;  2XDM A;  2HDU A;  5FI2 A;  4A5R A;  2G2W A;  2ZMA A;  3GMW A;  3FZC A;  2A3U A;  4KZ3 A;  3PBS A;  1ES5 A;  1KDS A;  2IWD A;  2ZM0 A;  1PI4 A;  4S2N A;  5FQJ A;  2ZC6 B;  3JYI A;  3WS1 A;  1ZG6 A;  1XGI A;  4QHC A;  3PBR A;  3LEZ A;  3VP1 A;  4EQI A;  5L2F A;  5DF7 A;  1MWU A;  1FR6 A;  1LI0 A;  1FSW A;  5E2E A;  2EX2 A;  3HUN A;  4IVI A;  4R3B A;  2XFT A;  3BFE A;  4PM9 A;  4QD4 A;  3TG9 A;  3ZFZ A;  3ZVW A;  4DDS A;  1DY6 A;  4R4R A;  4E3I A;  1YQS A;  1IYO A;  2ZLY A;  4PMA A;  1MWT A;  2WAD A;  3HUO A;  2PU2 A;  4JXW A;  2WKE A;  3BM6 A;  4MEZ A;  3W4Q A;  4BL2 A;  1K55 A;  4YIN A;  5EUA A;  3UPN A;  1M40 A;  3BRM A;  4GOG A;  4EBL A;  1W5D A;  2EX8 A;  2OLU A;  2R9W A;  2WZZ A;  3AGE A;  4KZ4 A;  3N7W A;  1TDG A;  5HFO A;  4Y0T A;  4M3K A;  1PWD A;  1K54 A;  3MKE A;  2WK0 A;  4FSF A;  5F82 A;  1LLB A;  3G31 A;  3BFD A;  2XLN A;  1XPB A;  4WMC A;  1XKZ A;  3BFC A;  4S2N C;  2WAE A;  4WM9 A;  1C3B A;  5FDH A;  5AQ9 A;  5HW3 A;  3FYZ A;  2DRW A;  5G18 A;  4E3N A;  2VGJ A;  5U47 A;  1JTG A;  5DF9 A;  1GCE A;  1N4O A;  2HDS A;  4OPR A;  2IWB A;  3WRZ A;  1NYY A;  4RX2 A;  3SH9 A;  3SS4 A;  5F1F A;  3BEC A;  4BJP A;  4OVD A;  1PZP A;  3A3D A;  5HAP A;  4DXC A;  2EXA A;  1RP5 A;  2PBY A;  3IQA A;  2XEP A;  1SDN A;  3M2J A;  4NET A;  4DDY A;  3IXD A;  2Y2P A;  1GA0 A;  1K55 C;  3QNC A;  2P9V A;  1KE3 A;  4U3T A;  1QME A;  1K57 C;  1TEM A;  1XXM A;  5A91 A;  1GA9 A;  1JWV A;  3Q7V A;  1K54 C;  1WYB A;  2XGN A;  2RCX A;  2HDR A;  3S22 A;  4OLG A;  1H8Z A;  4GB7 A;  5FQM A;  1ES2 A;  4DE2 A;  4KZB A;  1FR1 A;  3D4F A;  4KQO A;  2ZM2 A;  5CTM A;  1SDE A;  1ERQ A;  3GTC A;  2E8I A;  1KGG A;  4LCM A;  3UNW A;  5M19 A;  1PZO A;  5GLC A;  3ZG7 B;  4GD6 A;  4ZBE A;  3PAG A;  4ID4 A;  4KZ8 A;  2Y2G A;  5TFQ A;  3C7U A;  1LL9 A;  2QZ6 A;  3CZD A;  1QMF A;  4EWF A;  1W8Q A;  2Q9M A;  2XK1 A;  3AGD A;  4OH0 A;  5GLB A;  4LCL A;  3Q7V B;  3VFH A;  3HLD A;  4OP8 A;  4XXR A;  1FSY A;  1SHV A;  3OCN A;  5CRF A;  1MY8 A;  1YT4 A;  1PW8 A;  1MWR A;  1XP4 A;  3AGF A;  5E43 A;  2IWC A;  4GNU A;  5FQK A;  1M6K A;  3VSK A;  2Y2N A;  1S6R A;  4S2K A;  4WYY A;  2ZQC A;  5A92 A;  2WGW A;  3IWI A;  4GKU A;  3ITA A;  2ZD8 A;  3O3V A;  4JF5 A;  5M1A A;  1NJ4 A;  1I2S A;  1J9M A;  1MXO A;  2C5W B;  1S0W A;  2J9P A;  4KQQ A;  5EVL A;  1XX2 A;  4R1G A;  5HL1 A;  1IYP A;  5CGW A;  1ZC2 A;  1NY0 A;  4XUX A;  5CXW A;  3EQU A;  2ZJ9 A;  3V3S A;  2Q9N A;  3HLC A;  4HES A;  1AXB A;  5GHX A;  1O7E A;  1PIO A;  1K6R A;  3P98 A;  3Q1F A;  2EFX A;  3HLW A;  3PBT A;  3HBR A;  2ZQ8 A;  3VSL A;  5A93 A;  3S1Y A;  1MWS A;  3MXR A;  3MBZ A;  1NXY A;  2BG1 A;  1HVB A;  2Y2I A;  1ALQ A;  3Q7Z A;  1YLJ A;  4OP5 A;  3WS5 A;  3UE3 A;  2HDQ A;  4BQM A;  4OQH A;  3FKV A;  1G6A A;  4Y0U A;  5FQQ A;  4S2I A;  2XQZ A;  1W7F A;  3DTM A;  2Y2J A;  3C4P A;  3N8R A;  3A3I A;  3PBO A;  3DWK A;  5DF8 A;  1K56 D;  4P0M A;  1Y54 A;  5HAI A;  4WEJ A;  1EWZ A;  5EOE A;  5TR7 A;  1KE4 A;  3BYD A;  2Y2M A;  3PAE A;  1NZO A;  2HP6 A;  4H8R A;  4OON A;  5GLD A;  4P6B A;  3ZHH A;  3FWL A;  2H0T A;  1HD8 A;  1XGJ A;  4UA9 A;  3ZG8 B;  1FCO A;  2XD5 A;  4DXB A;  4OPZ A;  3IF6 C;  4R0Q A;  1DJA A;  2QPN A;  1E3U D;  1OME A;  5FSR A;  4LV0 A;  2WUQ A;  4LEN A;  3E2L A;  3OPP A;  5E2G A;  1MPL A;  1YMX A;  4N1X A;  1I5Q A;  1H8Y A;  1K57 A;  2Z2L B;  4KZ6 A;  1GHI A;  4Y7P A;  3IT9 A;  4UA7 A;  4X55 A;  1RCJ A;  3UDI A;  3VP4 A;  4R23 A;  4OOY A;  2EX9 A;  2ZC3 B;  1WE4 A;  3G2Y A;  1DJC A;  1BSG A;  4ZJ1 A;  2OLV A;  2R9X A;  1PI5 A;  3NIA A;  3C5A A;  4CPK A;  3UO9 A;  3SOI A;  4YFM A;  5E2F A;  5CGX A;  5EE8 A;  3MXS A;  3WWX A;  2BLS A;  4LV3 A;  3Q81 A;  4GDN A;  3SS3 A;  1KDW A;  3OZH A;  1DJB A;  3NI9 A;  4RVA A;  2FFF B;  3IWQ A;  2Z2M B;  2Y2O A;  1BLP A;  4JKT A;  4DF6 A;  1EI5 A;  5AQB A;  4RA7 A;  1YLW A;  3MFD A;  2EXB A;  1U60 A;  3A3F A;  1IKG A;  4JXG A;  1HZO A;  4PM8 A;  4UA6 A;  1JVJ A;  3TSG A;  3GVB A;  4K91 A;  1GHP A;  4Z9Q A;  1O07 A;  3RXW A;  4PM6 A;  3OPR A;  3SH7 A;  2HP5 A;  2XF3 A;  2HP9 A;  1MBL A;  3IWO A;  4IVK A;  5CGS A;  4P85 A;  3A3J A;  4ZDX A;  1BLC A;  1CEF A;  2ZQA A;  1NRF A;  2GDN A;  1YLZ A;  4JLF A;  5CER A;  3ZGA B;  4GN2 A;  4S2M A;  3GQZ A;  4WZ4 A;  3ZG9 B;  1KGF A;  5E2H A;  1JWZ A;  4JPM A;  2X02 A;  3HLB A;  3Q82 A;  3VFF A;  4BEN A;  4OOL A;  2RL3 A;  3MKF A;  5A90 A;  3OCL A;  1YLY A;  2X01 A;  1G68 A;  4BD0 A;  4X53 A;  4KZ5 A;  3QNB A;  4ZJ3 A;  1ESU A;  4O7D A;  2OSU A;  2Y2K A;  4N1H A;  3WS4 A;  2XR0 A;  2P9V B;  4E6W A;  5DTK A;  4E3L A;  3HLG A;  4QJG A;  3UY6 A;  3S4X A;  3V3R A;  3IXB A;  4B4Z A;  2C6W B;  1SCW A;  2Y55 A;  3P09 A;  4S2P A;  1CK3 A;  1LHY A;  4GDB A;  3QHY A;  2HPB A;  3UPO A;  2ZC7 A;  4OQI A;  1BUE A;  5D3O A;  1MKI A;  3HUM A;  2P74 A;  3WRT A;  2Y59 A;  3VP2 A;  4X68 A;  3DW0 A;  1ES4 A;  2H10 A;  1SKF A;  4E3O A;  4PM7 A;  5GLA A;  3IH9 A;  3MZF A;  5FI6 A;  3V50 A;  1FQG A;  2Y4A A;  1W79 A;  2V2F F;  5FAO A;  4KG5 A;  3W4P A;  3ZG5 A;  1ZG4 A;  3IHA A;  4K0X A;  2WZX A;  3Q07 A;  5CED A;  3G2Z A;  4KQR A;  4QY6 A;  1IYS A;  1FOF A;  2FFY A;  2JE5 A;  2Y2Q A;  4NK3 A;  4B4X A;  1HTZ A;  4N92 A;  3CMZ A;  4JXV A;  3O86 A;  4HBU A;  1CI8 A;  3IH8 A;  4MBF A;  4RX3 A;  5HAR A;  1K4F A;  3ZNT A;  4D2O A;  1K56 A;  5IHV A;  3G30 A;  5KSH A;  1IEL A;  2ZC5 B;  1KVM A;  2WKH A;  3IF6 A;  4S2J A;  3UE1 A;  4C3Q A;  5CEC A;  5EVI D;  3VP3 A;  3NCK A;  4MBK A;  1BUL A;  1YLP A;  4IBX A;  3DWZ A;  4EBN A;  1GHM A;  3NY4 A;  4JBF A;  3SS5 A;  1VM1 A;  2XFS A;  2WGW B;  1E3U A;  4BD1 A;  4N9L A;  3HLE A;  1BTL A;  1ERM A;  4IED A;  4C75 A;  2A49 A;  4S2O A;  4KZA A;  2ZQ7 A;  4OKP A;  4OPY A;  5EPH A;  3NDG A;  4JXS A;  4X69 A;  5F83 A;  3N8L A;  4ZTK A;  4RYE A;  1JTD A;  1PW1 A;  5GL9 A;  3IHB A;  3ITB A;  2J8Y A;  3O88 A;  5HX9 A;  4EV4 A;  3IF6 B;  3G32 A;  1BLS A;  2H0Y A;  3C4O A;  4BL3 A;  2JBF A;  3PBN A;  3UN7 A;  3GR2 A;  5TGF A;  3TOI A;  1K6S A;  3V5M A;  2QMI A;  2Y91 A;  3OPL A;  3UPP A;  2XD1 A;  3BFG A;  4OQ0 A;  4E3M A;  4KG2 A;  4GD8 A;  4Q8I A;  1Z6F A;  1L0E A;  4KZ7 A;  5FQI A;  1ESI A;  5DVA A;  1VQQ A;  3GRJ A;  5FAP A;  1PYY A;  3N6I A;  3VP0 A;  3WS2 A;  4E6X A;  4KG6 A;  4HBT A;  1KE0 A;  1IKI A;  4WBG A;  3G4P A;  5CTN A;  4LV1 A;  1Q2P A;  1ERO A;  4Y0O A;  3ZVT A;  3LY4 A;  4N9K A;  2X71 A;  1CEG A;  4ZJ2 A;  2VGK A;  3A3E A;  1YLT A;  3BFF A;  1JWP A;  2V1Z A;  5FQ9 A;  2J7V A;  3V39 A;  3NC8 A;  3I7J A;  4UAA A;  3N4I A;  4OQG A;  5GHY A;  1LL5 A;  4MNR A;  4X56 A;  3VOZ A;  5FI7 A;  4FH2 A;  2DNS A;  4U0T A;  5CHU A;  2WKI A;  3IXH A;  1IYQ A;  3MZD A;  3FKW A;  4XUZ A;  5DTT A;  3ZG0 A;  3MZE A;  4PM5 A;  5CHJ A;  1Q2Q A;  3BLM A;  3LCE A;  1NYM A;  2WYX A;  2WGI A;  2DCF A;  4UHU A;  5FA7 A;  3UE0 A;  2ZQ9 A;  3VOY A;  2OV5 A;  1NZU A;  1ONH A;  3W4O A;  2XH9 A;  5J8X A;  1L0F A;  3C7V A;  2V20 A;  2Y2H A;  3VMA A;  1CI9 A;  3M2K A;  4EBP A;  5EEC A;  4ZAM A;  3BEB A;  4R4S A;  4DE0 A;  4FH4 A;  1PWC A;  2PU4 A; 
#chains in the Genus database with same CATH topology
 2PT7 A;  2JC7 A;  1W8Y A;  3RTY A;  4MDZ A;  1YMS A;  1RGZ A;  3MMH A;  2WAF A;  3ISG A;  3CG5 A;  3JVU A;  3ZQ5 A;  4WEL A;  2W3F A;  1AWI A;  4EEU A;  5HAQ A;  3NOU C;  4WMC D;  2I9V A;  5KSC A;  2O9B A;  1IFQ A;  5FAQ A;  3RXX A;  1Y28 A;  1LSV A;  1OTE A;  2ZMV A;  2I72 A;  2Z6D A;  4BMW A;  4YWZ A;  2V8C A;  5AJG A;  4EER A;  3CJM A;  5TBM B;  1XJ2 A;  4CJN A;  1PRQ A;  4R3J A;  3N8S A;  1KOU A;  2HZ5 A;  1TVF A;  1JNU A;  3RFB A;  3KSH A;  3KYZ A;  4NXB A;  4QPR A;  3OPH A;  1STZ A;  3G35 A;  5EVI B;  2ZQD A;  4GCZ A;  3GEC A;  4WZ5 C;  5F1G A;  2INW A;  3CUE C;  4KEN B;  1N9N A;  3FV7 A;  5AQ7 A;  5AQA A;  5KZH A;  3LIE A;  3IS2 A;  3HVF A;  1WYC A;  4QY5 A;  4KZ9 A;  1E25 A;  4Q0J A;  1ZKJ A;  3KSI A;  2XDM A;  2G2W A;  3PBS A;  4HY8 A;  1PI4 A;  4S2N A;  3S7N A;  1GSV A;  3DTE A;  1XGI A;  5MC7 A;  5HZH A;  2J3T D;  2O9C A;  5DF7 A;  5I5L A;  4PM9 A;  5F6A A;  3ZVW A;  3ZFZ A;  4R4R A;  4H6J B;  3T4Q A;  4PKY A;  1MWT A;  3HUO A;  3LGO A;  2WKE A;  3BM6 A;  1K55 A;  3B47 A;  4YIN A;  3H9W A;  4GOG A;  2XA7 M;  3AGE A;  4KZ4 A;  3N7W A;  2WK0 A;  3T1R A;  1LLB A;  4WMC A;  4JGP A;  3T4J A;  5AQ9 A;  1OTI A;  3U4L P;  3LID A;  2P08 A;  3WRZ A;  5F1F A;  1IOU A;  4OVD A;  2EXA A;  4IJG A;  3IQA A;  4NET A;  4Y5F A;  3LIC A;  3V67 A;  1GA9 A;  2PDR A;  1H8Z A;  1G5U A;  3FG8 A;  4KZB A;  1H8M A;  1SDE A;  3JVV A;  1OJ5 A;  4LPZ A;  3F1N A;  1KGG A;  3UNW A;  4YNR A;  2IA2 A;  1PZO A;  5GLC A;  3ZG7 B;  4GD6 A;  4KZ8 A;  3C7U A;  2QZ6 A;  1W8Q A;  2XK1 A;  4OH0 A;  3Q7V B;  4IHQ A;  4G3W A;  1DRM A;  1VEU B;  4L9F A;  3LFV A;  1MWR A;  5E43 A;  1M6K A;  4I39 A;  4S2K A;  4WYY A;  2PBD P;  2NUT C;  3O3V A;  3CWF A;  2J9P A;  1XX2 A;  4PKY G;  3BW6 A;  1IYP A;  5CGW A;  3MS6 A;  2Q9N A;  3HLC A;  2M7V A;  5DJU A;  2EFX A;  1W63 Q;  5A93 A;  3S1Y A;  3MXR A;  1HVB A;  3QP5 A;  1YLJ A;  3WS5 A;  3UE3 A;  3T4T A;  1NLZ A;  3FKV A;  4Y0U A;  2B02 A;  3DTM A;  2Y2J A;  3C4P A;  1TF1 A;  2Y2M A;  3MR0 A;  3FWL A;  1FCO A;  4OPZ A;  4R0Q A;  2QKP A;  2WUQ A;  3LIB A;  1EW0 A;  4N1X A;  2ZL1 B;  4Y7P A;  4LFU A;  3IT9 A;  4YOF A;  2EX9 A;  2ZC3 B;  3G2Y A;  1DJC A;  4QWO A;  2OLV A;  4I5S A;  1PI5 A;  2Z6C A;  3UO9 A;  4YFM A;  5EE8 A;  2BLS A;  3U2A A;  2VV7 A;  1KDW A;  1DJB A;  3NI9 A;  3IWQ A;  4JKT A;  3IX8 A;  4DF6 A;  3UE6 A;  4O01 A;  1YLW A;  1OT6 A;  3CPT B;  4PM8 A;  4K91 A;  1L3L A;  4RQ9 A;  1O07 A;  4II7 A;  3OPR A;  1VET A;  4Y3I A;  1DP8 A;  3IWO A;  3NOT C;  4P85 A;  5HDC A;  1CEF A;  5CER A;  2WKR A;  4GN2 A;  3ZGA B;  4S2M A;  3S7P A;  3CHW P;  5AVF A;  2QYB A;  1GSX A;  1YLY A;  1G68 A;  4BD0 A;  4X53 A;  3T4L A;  1FIL A;  3WS4 A;  3SW1 A;  5L10 A;  3UY6 A;  3IXB A;  3D72 A;  2Y55 A;  1SCW A;  3P09 A;  3QHY A;  1Z09 A;  1ZHH B;  5F69 A;  3E4Q A;  4WUJ A;  3DW0 A;  2H10 A;  4EU0 A;  5GLA A;  3IH9 A;  5FI6 A;  1FQG A;  5FAO A;  1OPX A;  3PR6 A;  4KQR A;  4IUH A;  4JXV A;  4UQI S;  1CI8 A;  5HAR A;  1UGU A;  4C3Q A;  2ZC5 B;  1G28 A;  5EVI D;  1TS8 A;  4WF0 A;  4G3V A;  4IBX A;  1XJ4 A;  4JBF A;  4GS9 B;  2XFS A;  1BTL A;  4C75 A;  4S2O A;  3P01 A;  4RYE A;  3B33 A;  1PW1 A;  3VE4 A;  3G32 A;  3C4O A;  2H0Y A;  1OTB A;  5EFW A;  3OPL A;  2PAV P;  4OQ0 A;  4Q8I A;  1ESI A;  2JKT M;  2D02 A;  1PYY A;  2W27 A;  3N6I A;  4KG6 A;  3F1P B;  5K5B A;  3H82 A;  5CTN A;  4LV1 A;  3ZVT A;  2X71 A;  3A3E A;  1JWP A;  2V1Z A;  5FQ9 A;  3V39 A;  4AFI A;  4BBT A;  3I7J A;  5GHY A;  4OQG A;  4X56 A;  3VOZ A;  2GZA A;  5CHU A;  2WKI A;  3MZD A;  3FPW A;  2KDK A;  4XUZ A;  3ZG0 A;  3MZE A;  1MKM A;  4Y13 A;  1Q2Q A;  3BLM A;  1NYM A;  2WGI A;  2DCF A;  2ZQ9 A;  3T1X A;  3M2K A;  5EEC A;  4DE0 A;  4DDS A;  1PWC A;  4CLC D;  5TBM A;  2XSS A;  2WGV A;  3ZDJ A;  3MQQ A;  4PPR A;  4KUO A;  4BLM A;  3L7H A;  2B5R A;  1BT5 A;  1K38 A;  4FUW A;  3K3D A;  4S2L A;  2VA0 A;  1VHM A;  2EX6 A;  2GJ3 A;  2CC1 A;  3IXG A;  1S67 L;  5FEF A;  3ICY A;  5FAT A;  3T1Q B;  3HRE A;  5EVI A;  3MJQ A;  4U0X A;  3WS0 A;  4R6L A;  2M1C A;  4X6T A;  2LB9 A;  2VKS A;  4QB8 A;  2O99 A;  1NRJ A;  3NUL A;  4EUZ A;  5M18 A;  1FIK A;  1VB6 A;  2VGL M;  1D06 A;  1FCM A;  2JKR M;  4E04 A;  4I3I A;  1GSW A;  1KGE A;  3A0V A;  4GZB A;  1YM1 A;  2K31 A;  1YSQ A;  4OPQ A;  4Y15 A;  3ZCZ A;  4B88 A;  2GX5 A;  3BLS A;  4H6J A;  3PTE A;  3EQV A;  5FI2 A;  2O9A A;  2ZMA A;  3GMW A;  3FZC A;  2IWD A;  2ZM0 A;  4EES A;  5FQJ A;  1T1C A;  3JYI A;  3WS1 A;  2VZW A;  3PBR A;  3LEZ A;  3IBJ A;  2K2N A;  1FSW A;  1X0O A;  2QJ7 A;  1T19 A;  4R3B A;  3L9K A;  4CLC A;  2LB5 A;  2ZLY A;  4JXW A;  2PU2 A;  1F2K A;  3W4Q A;  5EUA A;  2EX8 A;  1J3W A;  5HFO A;  4M3K A;  1K54 A;  3G31 A;  3BFD A;  1T18 A;  4S2N C;  4WM9 A;  3UB9 A;  1C3B A;  1TS7 A;  5FDH A;  3FYZ A;  2DRW A;  5IU1 A;  1JTG A;  5DF9 A;  1N4O A;  4ME4 A;  4GLQ A;  3SH9 A;  2ZOI A;  3BEC A;  3CAX A;  1PZP A;  5HAP A;  1RP5 A;  1SDN A;  3M2J A;  4DDY A;  4EW7 A;  2Y2P A;  1K55 C;  3OBF A;  1K57 C;  1TEM A;  1XXM A;  3Q7V A;  3S22 A;  1UWP X;  4GB7 A;  5FQM A;  3SZT A;  1VEU A;  3NEC A;  4DJ2 A;  3GTC A;  4XT2 B;  5M19 A;  3LUQ A;  4EET B;  1LL8 A;  2P04 A;  4ZBE A;  4ID4 A;  4WN5 A;  3BWL A;  1LL9 A;  2VV8 A;  5HSQ A;  4ARZ B;  4B93 A;  3CZD A;  2QJ5 A;  1QMF A;  4P6Z M;  3AGD A;  2Q9M A;  4LCL A;  2JKR I;  3HLD A;  3ULF A;  4XXR A;  1ZTU A;  1FSY A;  4HH3 A;  4I38 A;  5CRF A;  2GNX A;  3AGF A;  1XP4 A;  5HDS A;  1S6R A;  4IUK A;  3IBR A;  2PD8 A;  3IWI A;  3ITA A;  2ZD8 A;  5M1A A;  1NJ4 A;  1I2S A;  1J9M A;  4KQQ A;  5EVL A;  5HL1 A;  1PFL A;  2WKQ A;  4HNB A;  1OTA A;  3UB5 P;  3EQU A;  3V3S A;  4HES A;  1K6R A;  2NUP C;  3MBZ A;  2BG1 A;  1ALQ A;  4F3L B;  2HDQ A;  2ZL1 A;  4BQM A;  1G6A A;  5FQQ A;  4S2I A;  3N8R A;  3A3I A;  1K56 D;  4P0M A;  1Y54 A;  5HAI A;  4WEJ A;  5TR7 A;  3PAE A;  3T50 A;  4H8R A;  5GLD A;  1HD8 A;  1XGJ A;  4MMN A;  4UA9 A;  4Z1W A;  3ZG8 B;  2XD5 A;  2J3T C;  1DJA A;  2QPN A;  1E3U D;  4LV0 A;  2W0N A;  3D3O A;  4HJ6 A;  2FH5 A;  1K57 A;  2Z2L B;  3CPT A;  2V9A A;  1RCJ A;  4LGW A;  4OOY A;  4MCW A;  1BSG A;  4G3K A;  3NIA A;  3C5A A;  5E2F A;  2OAP 1;  5CGX A;  3KSF A;  3SS3 A;  3OZH A;  5KIZ A;  3LR0 A;  5AQB A;  4PHT A;  4CLC B;  5G4Z A;  1U60 A;  4JXG A;  1JVJ A;  3TSG A;  3IX4 A;  2W1T B;  4X1M A;  3RXW A;  2HP5 A;  4IVK A;  2BAS A;  3A3J A;  3GQZ A;  4WZ4 A;  3ZG9 B;  1KGF A;  3T4K A;  2X02 A;  4BEN A;  3OCL A;  3EGX C;  2XR0 A;  3V3R A;  4B4Z A;  2B18 A;  1CK3 A;  1LHY A;  4GDB A;  3UPO A;  1MKI A;  1YSP A;  1ACF A;  2Y59 A;  3VP2 A;  1SKF A;  4GS9 A;  1F98 A;  1CF0 A;  1W79 A;  3ZG5 A;  1HLU P;  3UMD A;  2WZX A;  3Q07 A;  2YKH A;  3P7N A;  5EV0 A;  1IYS A;  1FOF A;  2JE5 A;  2Y2Q A;  1DP9 A;  4B4X A;  1HTZ A;  3O86 A;  4HBU A;  4D2O A;  2W3H A;  1K56 A;  1T1B A;  5KSH A;  2WKH A;  5CEC A;  3NCK A;  4EEP A;  4D60 A;  5HWW A;  5EM1 A;  3LIA A;  1BUL A;  2K7S A;  1GHM A;  1E3U A;  4N9L A;  3CI6 A;  3F1P A;  5F83 A;  2ZQ7 A;  4OKP A;  3NDG A;  3LR3 A;  4JXS A;  4X69 A;  3BY9 A;  3NHQ A;  5GL9 A;  3A0S A;  2J8Y A;  3O88 A;  3CIT A;  5HX9 A;  4EV4 A;  3IF6 B;  3VE3 A;  3PBN A;  5TGF A;  2Y91 A;  3UPP A;  2XD1 A;  3BFG A;  4E3M A;  3HCY A;  2H28 A;  4KZ7 A;  4HJ4 A;  5FQI A;  1VQQ A;  3GRJ A;  1IKI A;  3OLO A;  1Q2P A;  1ERO A;  3LY4 A;  1CEG A;  4L9E A;  1YLT A;  3LR4 A;  2J7V A;  3NC8 A;  2V1A A;  4FH2 A;  2DNS A;  2V0U A;  3FKW A;  3K3C A;  4PM5 A;  5CHJ A;  4UHU A;  2WYX A;  5FA7 A;  1ONH A;  5L07 A;  2A24 B;  1V9Y A;  4M4X A;  3W4O A;  1L0F A;  2V20 A;  2Y2H A;  1CI9 A;  4R4S A;  4ETX A;  1S4S A;  4DJ3 A;  4K0W A;  3OC2 A;  3ZNY A;  5EM0 A;  3LY3 A;  3LI9 A;  4DRT A;  5HDD A;  3GSG A;  3UDF A;  2ZC4 B;  3TJZ C;  1L0D A;  1IEM A;  2EWW A;  2OWJ A;  1FCN A;  4L0L A;  2J9O A;  1I2W A;  2ZM8 A;  3NOP C;  5BOH A;  4QU3 A;  5DTS A;  5GHZ A;  3IF5 A;  4FD8 A;  4MBH A;  4FCF A;  1UWN X;  3KYE A;  2J80 A;  4WLA A;  1L2S A;  2R78 A;  3SH8 A;  4JF4 A;  1KVL A;  1OTD A;  1WA9 A;  1Y4O A;  1XA1 A;  4JGQ A;  4NKP A;  1XFQ A;  3RJU A;  2L1M A;  3M6H A;  5JYO A;  2EFU A;  1L0G A;  3B3X A;  3EWK A;  5EVI C;  3QP2 A;  4E3J A;  2JCH A;  1S4R A;  4DKI A;  4DE3 A;  5JYP A;  3NBL A;  5AVE A;  5IS1 A;  1BLH A;  2WKP A;  1TD5 A;  2A3U A;  1A0K A;  1ES5 A;  1F5M A;  2ZC6 B;  2HJ9 C;  2VX8 A;  4QHC A;  1YKD A;  5L2F A;  2VGL S;  5HWT A;  1FR6 A;  1LSX A;  2CMN A;  3MSH A;  2EX2 A;  3HUN A;  3KO6 A;  3DBA A;  4IVI A;  3NJA A;  2XFT A;  1MZU A;  3TG9 A;  1YQS A;  1IYO A;  5HD3 A;  2WAD A;  4NXE A;  4BL2 A;  1M40 A;  4EBL A;  3VOL A;  1W5D A;  2OLU A;  2WZZ A;  4LRY C;  3MKE A;  5F82 A;  2XLN A;  1XPB A;  1XKZ A;  4L9G A;  3R4K A;  5J3W A;  5G18 A;  2VGJ A;  3MXQ A;  1K0K A;  1GCE A;  2VEA A;  4EUV A;  4R70 A;  4MN5 A;  2Q0O A;  2IWB A;  1CJF A;  1NYY A;  1XJ6 A;  3H7W A;  4XT2 A;  2OOL A;  4DXC A;  3W2Z A;  1N9O A;  5LBR A;  4CLC C;  3E4P A;  3IXD A;  2L0W A;  4ARZ A;  3HJK A;  1KE3 A;  4U3T A;  1K54 C;  2RCX A;  2HDR A;  4OLG A;  1FR1 A;  3D4F A;  4KQO A;  2ZM2 A;  4B9O A;  5CTM A;  4ETZ A;  1S1Z A;  4O8G A;  4ZRR A;  5TFQ A;  3KSG A;  4EXO A;  2PYP A;  1H3Q A;  4EWF A;  3VFH A;  2ZBB A;  4OP8 A;  4BBV A;  3JPU A;  1SHV A;  1MY8 A;  1YT4 A;  5FQK A;  3VSK A;  2Y2N A;  2ZQC A;  4F3L A;  5A92 A;  4MN6 A;  4GW9 A;  1MXO A;  2C5W B;  5CX7 A;  1ZC2 A;  2B95 A;  5F5Y A;  5CXW A;  2OAQ 1;  2JKT I;  4GHI B;  1TS6 A;  1PIO A;  3P98 A;  3Q1F A;  3PBT A;  3HLW A;  3VSL A;  4P6Z S;  2VJW A;  3Q7Z A;  2HV1 A;  3DTK A;  4OQH A;  2XQZ A;  5A8B A;  1BYW A;  3UB6 A;  2DMW A;  5EOE A;  1KE4 A;  3BYD A;  2HP6 A;  2H0T A;  2PR5 A;  3E98 A;  4HJ3 A;  4PAU A;  3QP6 A;  3IF6 C;  1SZV A;  5FSR A;  4LEN A;  3E2L A;  1MPL A;  4CLC E;  1I5Q A;  3UDI A;  4UA7 A;  2W1T A;  4R23 A;  1WE4 A;  4ZJ1 A;  2R9X A;  3T4S A;  3SOI A;  3K2N A;  4GDN A;  5DFX A;  3HJI A;  4RVA A;  1MC0 A;  5G4Y A;  4RA7 A;  3MFD A;  2EXB A;  3A3F A;  4HH2 A;  1IKG A;  3LEQ A;  1HZO A;  2QWS A;  4PM6 A;  3SH7 A;  4KUK A;  2XF3 A;  4JGO A;  5L8M A;  5CGS A;  2XA7 S;  1BLC A;  2ZQA A;  1NRF A;  2GDN A;  1YLZ A;  3QP8 A;  5E2H A;  4JPM A;  4NXF A;  3Q82 A;  3T1S A;  3H7W B;  4OOL A;  2RL3 A;  3MKF A;  5A90 A;  4FOF A;  4UEY A;  4KZ5 A;  3QNB A;  1ESU A;  2OSU A;  4N1H A;  5HPI A;  5DTK A;  4E3L A;  3HLG A;  3FC7 A;  2C6W B;  3CLO A;  5DJT A;  5J7E A;  4S2P A;  1XJ3 A;  1LSW A;  2HPB A;  4LLO B;  1BUE A;  5D3O A;  3HUM A;  1S66 L;  2P74 A;  3WRT A;  4X68 A;  2ACG A;  1ES4 A;  3UB7 A;  3MZF A;  2V2F F;  4KG5 A;  3KYQ A;  3QP4 A;  3KX0 X;  3G2Z A;  2JKF A;  4X1L A;  4QY6 A;  3C8C A;  4NK3 A;  2PR6 A;  4N92 A;  2V0W A;  3CMZ A;  2D01 A;  1IEL A;  3IF6 A;  1KVM A;  4S2J A;  2BTF P;  4MBK A;  4WL9 A;  3E0Y A;  2JKG A;  4KQD A;  3NY4 A;  3DTI A;  4IED A;  2A49 A;  4GJ4 A;  5EPH A;  3N8L A;  4HIA A;  3RH8 B;  5F68 A;  5FDS A;  1P9W A;  3IHB A;  3ITB A;  1P97 A;  5DKK A;  1BLS A;  4BL3 A;  2JBF A;  3UN7 A;  3TOI A;  1DP6 A;  1OT9 A;  3LI8 A;  3T12 B;  5FAP A;  4Q0I A;  3WS2 A;  4E6X A;  4HBT A;  2KX6 A;  2A24 A;  4Y0O A;  4N9K A;  2UV0 E;  3EEA A;  4ZJ2 A;  3BFF A;  5L09 A;  3PYP A;  4UAA A;  1LL5 A;  1OJG A;  4U0T A;  5EVE A;  1IYQ A;  3F1O B;  2OWH A;  3LCE A;  2HJE A;  3UE0 A;  1NZU A;  3TE8 A;  3VMA A;  4ZAM A;  3BEB A;  4FH4 A;  2PU4 A;  1K4E A;  2YKF A;  3W8K A;  3C2W A;  2VLG A;  3GV9 A;  4LRX C;  2Y2L A;  2A2L A;  2Y8H A;  1ES3 A;  2Y79 A;  1T1A A;  3HLF A;  2W3E A;  3R7W B;  1TDL A;  1V9Z A;  1BZA A;  1PWG A;  4Y2F A;  1E4D A;  3VV4 A;  3PBQ A;  4WZ5 A;  5I94 A;  1N9B A;  2P7J A;  3CUE A;  3NDE A;  1ONG A;  4MLL A;  4JF6 A;  5HD5 A;  4F94 A;  3LO7 A;  1XA7 A;  2H5S A;  3O87 A;  4JGR A;  4C6Y A;  1H5X A;  4DE1 A;  2ZOH A;  3PHY A;  3MFX A;  4HQA A;  2EWV A;  5CEB A;  4P87 A;  1RGY A;  2V8F A;  3T4O A;  5EOO A;  3G34 A;  3E2K A;  2M7U A;  3E4O A;  4WEK A;  3UDX A;  2UWX A;  4LV2 A;  5FAS A;  2PRF A;  4HEF A;  1K25 A;  4E3K A;  4IBR A;  2EA9 A;  5KMW A;  1YPR A;  4HP4 A;  2VV6 A;  4HP9 A;  1PNE A;  4OOM A;  3HL9 A;  3M6B A;  5HL6 A;  2PD7 A;  4OLD A;  5CHM A;  1LI9 A;  2G2U A;  4A5R A;  2HDU A;  4KZ3 A;  4HI4 A;  1KDS A;  1ZG6 A;  4NXG A;  3VP1 A;  4EQI A;  1MWU A;  3IS2 B;  1LI0 A;  3TW8 A;  5E2E A;  1TS0 A;  3FPV A;  4QD4 A;  2XRN A;  3BFE A;  4E3I A;  1DY6 A;  4PMA A;  4MEZ A;  4DMZ A;  2HGV A;  3UPN A;  3MQO A;  3BRM A;  2R9W A;  5TJJ A;  3UME A;  1TDG A;  4Y0T A;  1PWD A;  4FSF A;  3LYX A;  3BFC A;  2WAE A;  5DFY A;  2MJ6 A;  3LR5 A;  5HW3 A;  2VK3 A;  4E3N A;  3GDI A;  5U47 A;  3EOI A;  2HDS A;  4OPR A;  2W3D A;  4K08 A;  4RX2 A;  3SS4 A;  5FL3 A;  4BJP A;  3A3D A;  1NLY A;  2PBY A;  2W1R A;  2XEP A;  4DN0 A;  1GA0 A;  3QNC A;  2P9V A;  1QME A;  3ZYT A;  5A91 A;  2V1B A;  1JWV A;  1WYB A;  2XGN A;  1ES2 A;  4DE2 A;  1ERQ A;  2E8I A;  4LCM A;  4X25 A;  5J4E A;  4O0P A;  5IT5 A;  1SKO A;  3BY8 A;  2J3W A;  3PAG A;  2Y2G A;  3TRC A;  3QP1 A;  3EEH A;  5GLB A;  1ODV A;  3A0R A;  4GHI A;  3B42 A;  3OCN A;  2JN7 A;  1PW8 A;  2IWC A;  1S1Y A;  4GNU A;  3F1N B;  4I3J A;  2WGW A;  4GKU A;  4JF5 A;  4Q0H A;  3C30 A;  1S0W A;  4CQH A;  2XRO A;  4R1G A;  3DAV A;  4BBU A;  3BQ8 A;  1NY0 A;  4XUX A;  1XFN A;  2ZJ9 A;  1AXB A;  5GHX A;  1O7E A;  3HBR A;  5DKL A;  2ZQ8 A;  1MWS A;  1NXY A;  2Y2I A;  4OP5 A;  4I3A A;  1W7F A;  3PBO A;  3DWK A;  5DF8 A;  1EWZ A;  1G6O A;  4OON A;  1NZO A;  4P6B A;  3ZHH A;  4NEE D;  4DXB A;  2O0Y A;  1OME A;  3OPP A;  5E2G A;  1YMX A;  3UB8 A;  1H8Y A;  4KZ6 A;  1GHI A;  4X55 A;  3PXP A;  4R3A A;  3VP4 A;  3OOV A;  4Y17 A;  4CPK A;  2G7U A;  3WWX A;  3MXS A;  4LV3 A;  3Q81 A;  3EGD C;  2FFF B;  2Z2M B;  2Y2O A;  1BLP A;  1EI5 A;  1D1J A;  3O5Y A;  4BWI A;  1F9I A;  3BJN A;  4UA6 A;  3GVB A;  1GHP A;  4Z9Q A;  5FEG A;  2HP9 A;  1MBL A;  2QHK A;  2W3G A;  4ZDX A;  4JLF A;  4MN7 A;  2KLI A;  2HF6 A;  1JWZ A;  3HLB A;  1H0M A;  4UQI M;  3VFF A;  2L4R A;  2X01 A;  4EQ1 A;  4ZJ3 A;  3D9Y A;  4O7D A;  2Y2K A;  4ESP A;  2P9V B;  4E6W A;  4QJG A;  1VET B;  3S7O A;  1P9R A;  2PYR A;  3S4X A;  3C38 A;  2ZC7 A;  4OQI A;  2AVX A;  4LRZ E;  4E3O A;  4PM7 A;  3V50 A;  3W4P A;  2Y4A A;  1SKO B;  4K0X A;  1ZG4 A;  2PHY A;  3IHA A;  5CED A;  4HHD A;  3IX3 A;  2ZMF A;  2FFY A;  4MBF A;  4RX3 A;  3ZNT A;  3IH8 A;  5C5K A;  1K4F A;  5IHV A;  3G30 A;  5HPF A;  3UE1 A;  3VP3 A;  1NWZ A;  3LIF A;  4EBN A;  1YLP A;  3DWZ A;  3SS5 A;  2KOI A;  1VM1 A;  3MF0 A;  2WGW B;  2E8J A;  4BD1 A;  3BQA A;  3HLE A;  1ERM A;  4KZA A;  1W63 M;  4OPY A;  4ZTK A;  4FTX A;  3G6O A;  3GR2 A;  1K6S A;  3V5M A;  2QMI A;  1D7E A;  4KG2 A;  4GD8 A;  1YAX A;  1Z6F A;  3F1O A;  1L0E A;  5DVA A;  3VP0 A;  1KE0 A;  1LT0 A;  1N9L A;  4WBG A;  3G4P A;  4HOI A;  2FZ0 A;  3S7Q A;  2VGK A;  1P0Z A;  3N4I A;  2JHE A;  4MNR A;  5FI7 A;  3IXH A;  3MQ0 A;  5DTT A;  3R7W A;  5HWV A;  1CQA A;  3VOY A;  4R38 A;  2OV5 A;  4NG2 A;  3H82 B;  2XH9 A;  5J8X A;  3C7V A;  4EBP A;  1JTD A; 
#chains in the Genus database with same CATH homology
 4K0W A;  1K4E A;  2JC7 A;  3OC2 A;  3ZNY A;  1W8Y A;  3W8K A;  3LY3 A;  1YMS A;  1RGZ A;  2WAF A;  2WGV A;  3GV9 A;  3CG5 A;  3ISG A;  4DRT A;  3GSG A;  2Y2L A;  3UDF A;  4WEL A;  3ZDJ A;  2ZC4 B;  5HAQ A;  1ES3 A;  4PPR A;  1L0D A;  1IEM A;  4WMC D;  5KSC A;  3HLF A;  4BLM A;  1TDL A;  1FCN A;  2B5R A;  4L0L A;  2J9O A;  5FAQ A;  1BZA A;  1PWG A;  3RXX A;  1I2W A;  1BT5 A;  1K38 A;  1E4D A;  2I72 A;  2ZM8 A;  4S2L A;  2EX6 A;  5BOH A;  4QU3 A;  3PBQ A;  5DTS A;  5GHZ A;  3CJM A;  4WZ5 A;  2CC1 A;  1N9B A;  5I94 A;  3IF5 A;  3IXG A;  4FD8 A;  4CJN A;  4MBH A;  4R3J A;  4FCF A;  3N8S A;  5FAT A;  3NDE A;  3HRE A;  5EVI A;  1TVF A;  1ONG A;  4MLL A;  4JF6 A;  4U0X A;  4F94 A;  3LO7 A;  1XA7 A;  1L2S A;  2H5S A;  3O87 A;  4C6Y A;  3WS0 A;  1H5X A;  4DE1 A;  3SH8 A;  4X6T A;  3OPH A;  4JF4 A;  1KVL A;  4QB8 A;  5CEB A;  4P87 A;  1RGY A;  1XA1 A;  5EOO A;  4EUZ A;  3G35 A;  5M18 A;  3G34 A;  3RJU A;  3E2K A;  3M6H A;  5EVI B;  2ZQD A;  4WZ5 C;  5F1G A;  1FCM A;  2EFU A;  1L0G A;  5JYO A;  3B3X A;  4KEN B;  3FV7 A;  5EVI C;  4E3J A;  4WEK A;  1KGE A;  3UDX A;  2UWX A;  4LV2 A;  5FAS A;  4GZB A;  5AQ7 A;  5AQA A;  1YM1 A;  2JCH A;  5KZH A;  4OPQ A;  4HEF A;  1K25 A;  4E3K A;  4IBR A;  3ZCZ A;  3HVF A;  5KMW A;  4DKI A;  1WYC A;  4B88 A;  4DE3 A;  5JYP A;  4OOM A;  4QY5 A;  3HL9 A;  3NBL A;  4KZ9 A;  1E25 A;  3BLS A;  3M6B A;  1BLH A;  4OLD A;  5CHM A;  3PTE A;  1LI9 A;  1ZKJ A;  3EQV A;  2G2U A;  2XDM A;  2HDU A;  5FI2 A;  4A5R A;  2G2W A;  2ZMA A;  3GMW A;  3FZC A;  2A3U A;  4KZ3 A;  3PBS A;  1ES5 A;  1KDS A;  2IWD A;  2ZM0 A;  1PI4 A;  4S2N A;  5FQJ A;  2ZC6 B;  3JYI A;  3WS1 A;  1ZG6 A;  1XGI A;  4QHC A;  3PBR A;  3LEZ A;  3VP1 A;  4EQI A;  5L2F A;  5DF7 A;  1MWU A;  1FR6 A;  1LI0 A;  1FSW A;  5E2E A;  2EX2 A;  3HUN A;  4IVI A;  4R3B A;  2XFT A;  3BFE A;  4PM9 A;  4QD4 A;  3TG9 A;  3ZFZ A;  3ZVW A;  4DDS A;  1DY6 A;  4R4R A;  4E3I A;  1YQS A;  1IYO A;  2ZLY A;  4PMA A;  1MWT A;  2WAD A;  3HUO A;  2PU2 A;  4JXW A;  2WKE A;  3BM6 A;  4MEZ A;  3W4Q A;  4BL2 A;  1K55 A;  4YIN A;  5EUA A;  3UPN A;  1M40 A;  3BRM A;  4GOG A;  4EBL A;  1W5D A;  2EX8 A;  2OLU A;  2R9W A;  2WZZ A;  3AGE A;  4KZ4 A;  3N7W A;  1TDG A;  5HFO A;  4Y0T A;  4M3K A;  1PWD A;  1K54 A;  3MKE A;  2WK0 A;  4FSF A;  5F82 A;  1LLB A;  3G31 A;  3BFD A;  2XLN A;  1XPB A;  4WMC A;  1XKZ A;  3BFC A;  4S2N C;  2WAE A;  4WM9 A;  1C3B A;  5FDH A;  5AQ9 A;  5HW3 A;  3FYZ A;  2DRW A;  5G18 A;  4E3N A;  2VGJ A;  5U47 A;  1JTG A;  5DF9 A;  1GCE A;  1N4O A;  2HDS A;  4OPR A;  2IWB A;  3WRZ A;  1NYY A;  4RX2 A;  3SH9 A;  3SS4 A;  5F1F A;  3BEC A;  4BJP A;  4OVD A;  1PZP A;  3A3D A;  5HAP A;  4DXC A;  2EXA A;  1RP5 A;  2PBY A;  3IQA A;  2XEP A;  1SDN A;  3M2J A;  4NET A;  4DDY A;  3IXD A;  2Y2P A;  1GA0 A;  1K55 C;  3QNC A;  2P9V A;  1KE3 A;  4U3T A;  1QME A;  1K57 C;  1TEM A;  1XXM A;  5A91 A;  1GA9 A;  1JWV A;  3Q7V A;  1K54 C;  1WYB A;  2XGN A;  2RCX A;  2HDR A;  3S22 A;  4OLG A;  1H8Z A;  4GB7 A;  5FQM A;  1ES2 A;  4DE2 A;  4KZB A;  1FR1 A;  3D4F A;  4KQO A;  2ZM2 A;  5CTM A;  1SDE A;  1ERQ A;  3GTC A;  2E8I A;  1KGG A;  4LCM A;  3UNW A;  5M19 A;  1PZO A;  5GLC A;  3ZG7 B;  4GD6 A;  4ZBE A;  3PAG A;  4ID4 A;  4KZ8 A;  2Y2G A;  5TFQ A;  3C7U A;  1LL9 A;  2QZ6 A;  3CZD A;  1QMF A;  4EWF A;  1W8Q A;  2Q9M A;  2XK1 A;  3AGD A;  4OH0 A;  5GLB A;  4LCL A;  3Q7V B;  3VFH A;  3HLD A;  4OP8 A;  4XXR A;  1FSY A;  1SHV A;  3OCN A;  5CRF A;  1MY8 A;  1YT4 A;  1PW8 A;  1MWR A;  1XP4 A;  3AGF A;  5E43 A;  2IWC A;  4GNU A;  5FQK A;  1M6K A;  3VSK A;  2Y2N A;  1S6R A;  4S2K A;  4WYY A;  2ZQC A;  5A92 A;  2WGW A;  3IWI A;  4GKU A;  3ITA A;  2ZD8 A;  3O3V A;  4JF5 A;  5M1A A;  1NJ4 A;  1I2S A;  1J9M A;  1MXO A;  2C5W B;  1S0W A;  2J9P A;  4KQQ A;  5EVL A;  1XX2 A;  4R1G A;  5HL1 A;  1IYP A;  5CGW A;  1ZC2 A;  1NY0 A;  4XUX A;  5CXW A;  3EQU A;  2ZJ9 A;  3V3S A;  2Q9N A;  3HLC A;  4HES A;  1AXB A;  5GHX A;  1O7E A;  1PIO A;  1K6R A;  3P98 A;  3Q1F A;  2EFX A;  3HLW A;  3PBT A;  3HBR A;  2ZQ8 A;  3VSL A;  5A93 A;  3S1Y A;  1MWS A;  3MXR A;  3MBZ A;  1NXY A;  2BG1 A;  1HVB A;  2Y2I A;  1ALQ A;  3Q7Z A;  1YLJ A;  4OP5 A;  3WS5 A;  3UE3 A;  2HDQ A;  4BQM A;  4OQH A;  3FKV A;  1G6A A;  4Y0U A;  5FQQ A;  4S2I A;  2XQZ A;  1W7F A;  3DTM A;  2Y2J A;  3C4P A;  3N8R A;  3A3I A;  3PBO A;  3DWK A;  5DF8 A;  1K56 D;  4P0M A;  1Y54 A;  5HAI A;  4WEJ A;  1EWZ A;  5EOE A;  5TR7 A;  1KE4 A;  3BYD A;  2Y2M A;  3PAE A;  1NZO A;  2HP6 A;  4H8R A;  4OON A;  5GLD A;  4P6B A;  3ZHH A;  3FWL A;  2H0T A;  1HD8 A;  1XGJ A;  4UA9 A;  3ZG8 B;  1FCO A;  2XD5 A;  4DXB A;  4OPZ A;  3IF6 C;  4R0Q A;  1DJA A;  2QPN A;  1E3U D;  1OME A;  5FSR A;  4LV0 A;  2WUQ A;  4LEN A;  3E2L A;  3OPP A;  5E2G A;  1MPL A;  1YMX A;  4N1X A;  1I5Q A;  1H8Y A;  1K57 A;  2Z2L B;  4KZ6 A;  1GHI A;  4Y7P A;  3IT9 A;  4UA7 A;  4X55 A;  1RCJ A;  3UDI A;  3VP4 A;  4R23 A;  4OOY A;  2EX9 A;  2ZC3 B;  1WE4 A;  3G2Y A;  1DJC A;  1BSG A;  4ZJ1 A;  2OLV A;  2R9X A;  1PI5 A;  3NIA A;  3C5A A;  4CPK A;  3UO9 A;  3SOI A;  4YFM A;  5E2F A;  5CGX A;  5EE8 A;  3MXS A;  3WWX A;  2BLS A;  4LV3 A;  3Q81 A;  4GDN A;  3SS3 A;  1KDW A;  3OZH A;  1DJB A;  3NI9 A;  4RVA A;  2FFF B;  3IWQ A;  2Z2M B;  2Y2O A;  1BLP A;  4JKT A;  4DF6 A;  1EI5 A;  5AQB A;  4RA7 A;  1YLW A;  3MFD A;  2EXB A;  1U60 A;  3A3F A;  1IKG A;  4JXG A;  1HZO A;  4PM8 A;  4UA6 A;  1JVJ A;  3TSG A;  3GVB A;  4K91 A;  1GHP A;  4Z9Q A;  1O07 A;  3RXW A;  4PM6 A;  3OPR A;  3SH7 A;  2HP5 A;  2XF3 A;  2HP9 A;  1MBL A;  3IWO A;  4IVK A;  5CGS A;  4P85 A;  3A3J A;  4ZDX A;  1BLC A;  1CEF A;  2ZQA A;  1NRF A;  2GDN A;  1YLZ A;  4JLF A;  5CER A;  3ZGA B;  4GN2 A;  4S2M A;  3GQZ A;  4WZ4 A;  3ZG9 B;  1KGF A;  5E2H A;  1JWZ A;  4JPM A;  2X02 A;  3HLB A;  3Q82 A;  3VFF A;  4BEN A;  4OOL A;  2RL3 A;  3MKF A;  5A90 A;  3OCL A;  1YLY A;  2X01 A;  1G68 A;  4BD0 A;  4X53 A;  4KZ5 A;  3QNB A;  4ZJ3 A;  1ESU A;  4O7D A;  2OSU A;  2Y2K A;  4N1H A;  3WS4 A;  2XR0 A;  2P9V B;  4E6W A;  5DTK A;  4E3L A;  3HLG A;  4QJG A;  3UY6 A;  3S4X A;  3V3R A;  3IXB A;  4B4Z A;  2C6W B;  1SCW A;  2Y55 A;  3P09 A;  4S2P A;  1CK3 A;  1LHY A;  4GDB A;  3QHY A;  2HPB A;  3UPO A;  2ZC7 A;  4OQI A;  1BUE A;  5D3O A;  1MKI A;  3HUM A;  2P74 A;  3WRT A;  2Y59 A;  3VP2 A;  4X68 A;  3DW0 A;  1ES4 A;  2H10 A;  1SKF A;  4E3O A;  4PM7 A;  5GLA A;  3IH9 A;  3MZF A;  5FI6 A;  3V50 A;  1FQG A;  2Y4A A;  1W79 A;  2V2F F;  5FAO A;  4KG5 A;  3W4P A;  3ZG5 A;  1ZG4 A;  3IHA A;  4K0X A;  2WZX A;  3Q07 A;  5CED A;  3G2Z A;  4KQR A;  4QY6 A;  1IYS A;  1FOF A;  2FFY A;  2JE5 A;  2Y2Q A;  4NK3 A;  4B4X A;  1HTZ A;  4N92 A;  3CMZ A;  4JXV A;  3O86 A;  4HBU A;  1CI8 A;  3IH8 A;  4MBF A;  4RX3 A;  5HAR A;  1K4F A;  3ZNT A;  4D2O A;  1K56 A;  5IHV A;  3G30 A;  5KSH A;  1IEL A;  2ZC5 B;  1KVM A;  2WKH A;  3IF6 A;  4S2J A;  3UE1 A;  4C3Q A;  5CEC A;  5EVI D;  3VP3 A;  3NCK A;  4MBK A;  1BUL A;  1YLP A;  4IBX A;  3DWZ A;  4EBN A;  1GHM A;  3NY4 A;  4JBF A;  3SS5 A;  1VM1 A;  2XFS A;  2WGW B;  1E3U A;  4BD1 A;  4N9L A;  3HLE A;  1BTL A;  1ERM A;  4IED A;  4C75 A;  2A49 A;  4S2O A;  4KZA A;  2ZQ7 A;  4OKP A;  4OPY A;  5EPH A;  3NDG A;  4JXS A;  4X69 A;  5F83 A;  3N8L A;  4ZTK A;  4RYE A;  1JTD A;  1PW1 A;  5GL9 A;  3IHB A;  3ITB A;  2J8Y A;  3O88 A;  5HX9 A;  4EV4 A;  3IF6 B;  3G32 A;  1BLS A;  2H0Y A;  3C4O A;  4BL3 A;  2JBF A;  3PBN A;  3UN7 A;  3GR2 A;  5TGF A;  3TOI A;  1K6S A;  3V5M A;  2QMI A;  2Y91 A;  3OPL A;  3UPP A;  2XD1 A;  3BFG A;  4OQ0 A;  4E3M A;  4KG2 A;  4GD8 A;  4Q8I A;  1Z6F A;  1L0E A;  4KZ7 A;  5FQI A;  1ESI A;  5DVA A;  1VQQ A;  3GRJ A;  5FAP A;  1PYY A;  3N6I A;  3VP0 A;  3WS2 A;  4E6X A;  4KG6 A;  4HBT A;  1KE0 A;  1IKI A;  4WBG A;  3G4P A;  5CTN A;  4LV1 A;  1Q2P A;  1ERO A;  4Y0O A;  3ZVT A;  3LY4 A;  4N9K A;  2X71 A;  1CEG A;  4ZJ2 A;  2VGK A;  3A3E A;  1YLT A;  3BFF A;  1JWP A;  2V1Z A;  5FQ9 A;  2J7V A;  3V39 A;  3NC8 A;  3I7J A;  4UAA A;  3N4I A;  4OQG A;  5GHY A;  1LL5 A;  4MNR A;  4X56 A;  3VOZ A;  5FI7 A;  4FH2 A;  2DNS A;  4U0T A;  5CHU A;  2WKI A;  3IXH A;  1IYQ A;  3MZD A;  3FKW A;  4XUZ A;  5DTT A;  3ZG0 A;  3MZE A;  4PM5 A;  5CHJ A;  1Q2Q A;  3BLM A;  3LCE A;  1NYM A;  2WYX A;  2WGI A;  2DCF A;  4UHU A;  5FA7 A;  3UE0 A;  2ZQ9 A;  3VOY A;  2OV5 A;  1NZU A;  1ONH A;  3W4O A;  2XH9 A;  5J8X A;  1L0F A;  3C7V A;  2V20 A;  2Y2H A;  3VMA A;  1CI9 A;  3M2K A;  4EBP A;  5EEC A;  4ZAM A;  3BEB A;  4R4S A;  4DE0 A;  4FH4 A;  1PWC A;  2PU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...