1U60A

Mcsg apc5046 probable glutaminase ybas
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
309
structure length
309
Chain Sequence
LDANKLQQAVDQAYTQFHSLNGGQNADYIPFLANVPGQLAAVAIVTCDGNVYSAGDSDYRFALESISKVCTLALALEDVGPQAVQDKIGADPTGLPFNSVIALELHGGKPLSPLVNAGAIATTSLINAENVEQRWQRILHIQQQLAGEQVALSDEVNQSEQTTNFHNRAIAWLLYSAGYLYCDAMEACDVYTRQCSTLLNTIELATLGATLAAGGVNPLTHKRVLQADNVPYILAEMMMEGLYGRSGDWAYRVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDEDGNSVRGQKMVASVAKQLGYNVFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable glutaminase ybaS
publication title Functional and structural characterization of four glutaminases from Escherichia coli and Bacillus subtilis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 111
structure length 309
sequence length 309
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.2: Glutaminase.
pdb deposition date 2004-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04960 Glutaminase Glutaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1u60A00
4N1XA 1PWCA 4OP5A 4BENA 2WKHA 3WS4A 3BECA 4RVAA 1FSYA 1H8ZA 3G32A 3WS5A 4OPRA 4QJGA 3UPOA 2XK1A 3D4FA 5GLAA 2PBYA 4UAAA 1DJBA 4MNRA 2Z2MB 5TFQA 3SOIA 3UPPA 1IYQA 1BUEA 4JBFA 1MWTA 2H10A 3VP2A 4E3JA 3V3SA 4PM6A 1BTLA 2ZM2A 1W7FA 5JYOA 1RGYA 4MBHA 3M2JA 3N4IA 4QD4A 3FYZA 5TGFA 1QMFA 1GHIA 4JXWA 2EXAA 2HDQA 3PAEA 3ZCZA 4X6TA 3FWLA 4U0TA 4P0MA 4QU3A 2Y2IA 1K38A 1NYYA 2WAFA 3IXBA 1Y54A 3VP0A 1ERQA 4HBUA 1K54A 1AXBA 3A3EA 2J8YA 1ALQA 3M6HA 1LLBA 1YM1A 2Y2QA 4MBKA 2EX6A 1PIOA 4KZ7A 5FATA 1PZPA 1ZG4A 2V20A 2Y4AA 3O3VA 4S2OA 5CEBA 2QZ6A 5FA7A 4F94A 2I72A 3BRMA 3G34A 4E3MA 5CEDA 2WGWA 5DVAA 2EFUA 1L0DA 4R4SA 1L0EA 4UA9A 1J9MA 3UDFA 1ESIA 1SKFA 4KG6A 2H0TA 5G18A 1TDGA 4P6BA 5EUAA 2Y2NA 3O86A 5CECA 1ESUA 1NXYA 3PAGA 4R23A 4CJNA 5HAQA 3IWIA 2H5SA 2G2WA 1FCNA 5M18A 3NCKA 5CRFA 3W4QA 4DE1A 4BQMA 4QHCA 1LL5A 4X53A 2XFTA 4PM5A 4ZTKA 1OMEA 2WK0A 2ZQ8A 4M3KA 2OLVA 1KE3A 4JPMA 2XD5A 3OPRA 1PWDA 3OCLA 3VFHA 3IF6A 4JF6A 4HEFA 3IWOA 5EOOA 3CG5A 1I2WA 4WMCD 4XXRA 5AQ9A 2XLNA 4XUZA 4C6YA 2EXBA 2Y2MA 3MXRA 3OCNA 5FQ9A 4FH2A 4Y0OA 3OPPA 1TDLA 3G4PA 2ZMAA 2ZLYA 3Q81A 4GD8A 1BULA 2WKEA 4RX3A 5F82A 3VMAA 4O7DA 5A92A 1YLTA 4KZ9A 4DE2A 4S2LA 4EBPA 4LCLA 1L2SA 1NJ4A 1NYMA 2XF3A 3IHAA 4OQ0A 5A93A 5HL1A 2PU2A 3IXHA 3ZG7B 4UA6A 1FR1A 2VGJA 3N7WA 2EX9A 4Y0UA 4KZ5A 4S2NC 1KDWA 2OSUA 3GVBA 5EE8A 1CEFA 4WZ5C 2HP9A 2WGVA 1I2SA 1YMXA 4JLFA 3FZCA 5CERA 3VFFA 3ZDJA 4OQHA 3N8RA 1FQGA 4BL3A 5AQBA 3V39A 4S2KA 5KSCA 2IWBA 4ZBEA 2WUQA 2JCHA 1K57C 3ZG0A 1G68A 1ONHA 5FQQA 2Y2LA 4K91A 5FAOA 5BOHA 1K55C 1MWSA 1XA7A 2ZQ7A 2FFYA 5DTSA 5I94A 1NZUA 2ZQDA 4ID4A 3UY6A 4DDSA 4OPZA 4EV4A 1XX2A 1W79A 2IWDA 3DTMA 3HLFA 4GB7A 4S2NA 1K25A 3O87A 3Q7ZA 3S4XA 3IQAA 3ITAA 4GOGA 1E3UA 3A3JA 1K54C 4WZ5A 5EOEA 1RCJA 3DWZA 3VP4A 2QPNA 3GRJA 3ZG5A 2ZQCA 1O7EA 4OP8A 1RP5A 4LV3A 1Z6FA 1FSWA 1LI0A 1LI9A 3FV7A 5FI6A 4MLLA 5EVIC 3VP1A 4ZDXA 4S2JA 1GA9A 1K4FA 4MEZA 5EVLA 5HFOA 3WRZA 4KZ8A 5EECA 3SH8A 3N8SA 3TSGA 2XH9A 3MZEA 4DE0A 1CK3A 2HP6A 1K6RA 1DJAA 1K57A 3WS2A 1IYPA 2HP5A 3A3IA 4GKUA 2JE5A 1K55A 3TG9A 3MKFA 1JWPA 1KVLA 3HUMA 3MFDA 3BFGA 5GL9A 5FDHA 4GNUA 1JWVA 4IVKA 1WE4A 3PBNA 2X71A 3AGEA 5EPHA 3C4PA 4R4RA 1YLWA 3ZNTA 4OLGA 3HUNA 4PM8A 1IYSA 3VP3A 3ITBA 3NI9A 3IF6C 5HX9A 2UWXA 4DXBA 5FQKA 3IXDA 1BLHA 1YLJA 2RCXA 3G35A 5FQJA 3ZNYA 3OC2A 4WYYA 3MZDA 5F1GA 2PU4A 1FR6A 2VGKA 4S2IA 5E2EA 3C5AA 5EVIA 1XP4A 3LY3A 3IF5A 1YLZA 3Q1FA 5FSRA 5GHXA 3IH9A 2ZC6B 4WM9A 4LV1A 2P74A 5AQAA 1XPBA 4E3OA 3V5MA 2DCFA 4X56A 2WKIA 1SCWA 1W5DA 1MXOA 3A3DA 2Y59A 1IKIA 4X55A 5HARA 4RX2A 1E3UD 2ZM0A 5HAPA 4R3BA 1VQQA 4KG2A 3HLEA 3LEZA 2ZJ9A 4EQIA 2EX2A 4ZAMA 3ZHHA 3MZFA 3ZVTA 1Q2PA 3BM6A 4R0QA 3B3XA 3FKVA 1YMSA 5E2FA 4GZBA 2Y55A 3HL9A 4EBLA 1ZG6A 5CGXA 4FH4A 3WWXA 3C4OA 2ZC7A 1WYCA 4OQIA 5FI7A 4R3JA 4P85A 2X02A 4S2MA 3HLWA 5J8XA 5EVIB 2XFSA 3QHYA 5D3OA 3Q7VA 4OPYA 3BLSA 2WGWB 5F1FA 2J9OA 3DWKA 4KZ3A 3VOZA 3NBLA 5F83A 3Q82A 2RL3A 3ZGAB 5TR7A 3S1YA 5CGSA 1WYBA 1LHYA 4DF6A 4BLMA 3E2LA 1L0FA 1KGEA 1XGIA 3TOIA 1S6RA 3G30A 1TVFA 2JC7A 4JXVA 4H8RA 3V50A 3SH7A 4PM9A 4C75A 1SHVA 1PYYA 1K56A 2ZC3B 4OLDA 2H0YA 5EVID 3S22A 3WS1A 4RA7A 3IF6B 2Q9MA 1ZKJA 4KQRA 4N1HA 4OH0A 3G31A 1DY6A 4WELA 2ZM8A 1I5QA 3OZHA 3BFCA 1YLYA 1H5XA 2OV5A 1SDNA 3BEBA 2A49A 3V3RA 4KZ6A 1RGZA 1E4DA 2BLSA 3CZDA 3SS5A 1Q2QA 3HBRA 1GCEA 4Z9QA 4FD8A 2ZC4B 1JVJA 3IT9A 3Q07A 3RJUA 4FCFA 5A90A 4B88A 3UDXA 3AGDA 3IXGA 4OPQA 1GHMA 3NDEA 3OPLA 3IHBA 1PI5A 4EUZA 2WYXA 1JTGA 4PMAA 3M2KA 2Y2KA 5CHUA 3LY4A 1BT5A 1W8YA 4QB8A 3QNCA 1XGJA 3MBZA 3SS4A 4UHUA 4EBNA 1GA0A 4U3TA 2X01A 4BL2A 3I7JA 5DF9A 3HLCA 1ERMA 3VOYA 3EQUA 4FSFA 2Y2OA 3BFFA 1QMEA 4MBFA 5IHVA 4E3IA 1EI5A 2Y2HA 4KZAA 5FASA 3UN7A 1MBLA 1BLPA 4OOLA 5GLBA 2WZZA 3PBQA 4OONA 1C3BA 4JKTA 1KGFA 1H8YA 3GSGA 1NRFA 4S2PA 5KZHA 1BSGA 3DW0A 4HBTA 4PM7A 4NETA 5HAIA 4KZ4A 2Y91A 3A3FA 3M6BA 3PTEA 4IBRA 4N9KA 4P87A 4D2OA 3UO9A 1CEGA 3PBOA 1BLSA 4Y0TA 1PI4A 5E2GA 2E8IA 5GHZA 2R9WA 1BLCA 3ZG8B 1L0GA 3GTCA 1MKIA 3ISGA 4ZJ1A 1PW1A 3WS0A 4DDYA 4LV0A 1SDEA 4K0WA 4KQOA 1KDSA 1N9BA 3C7UA 3HLDA 2JBFA 1HVBA 4LCMA 2C5WB 4WMCA 5A91A 4GDBA 5CGWA 1MY8A 2XR0A 4Q8IA 3JYIA 4KZBA 5CHJA 5GHYA 5DTKA 4GDNA 2P9VA 4OVDA 1DJCA 2HDUA 3OPHA 3ZFZA 1XA1A 4KQQA 2DNSA 2C6WB 2J9PA 3C7VA 2Y2JA 3G2YA 5DF8A 4IEDA 4JXGA 5HW3A 4IVIA 5M1AA 3UDIA 1FOFA 1GHPA 1XKZA 5GLDA 1LL9A 3AGFA 1BZAA 4E6WA 1ZC2A 3UNWA 4K0XA 1S0WA 2ZQ9A 5FAQA 1U60A 2FFFB 2G2UA 2WZXA 4E3LA 4WBGA 1E25A 2WAEA 3LO7A 5FAPA 2XEPA 4DE3A 3BLMA 1EWZA 4CPKA 3GR2A 1ES3A 3VSLA 3N6IA 1CI8A 2R9XA 1PW8A 2HPBA 4OQGA 1PWGA 3CJMA 2WGIA 3N8LA 3P09A 4U0XA 4BD1A 4IBXA 2P9VB 1N4OA 1YLPA 1KGGA 4PPRA 5L2FA 3FKWA 1ES5A 2B5RA 4C3QA 2XQZA 4X68A 1W8QA 5E43A 2J7VA 1KE0A 3GMWA 1M40A 3HLGA 3W4OA 5KSHA 4OOMA 4XUXA 4HESA 3SS3A 1KVMA 1K4EA 2Y2GA 2ZC5B 5CTNA 4DXCA 4N9LA 5FQIA 2EX8A 1EROA 4R1GA 1G6AA 3E2KA 3MXSA 4Y7PA 4EWFA 5GLCA 3ZVWA 2XDMA 1KE4A 1YT4A 3GQZA 2OLUA 2ZD8A 3PBSA 5U47A 3UE3A 1NZOA 1MPLA 1HTZA 4L0LA 1MWRA 1HD8A 1VM1A 3P98A 3NIAA 4DKIA 3VSKA 4E3NA 4GN2A 4OKPA 3RXXA 3BYDA 1ES4A 4QY5A 3IH8A 3W4PA 4DRTA 1K6SA 5CHMA 5M19A 1ONGA 4BD0A 2XGNA 1IELA 5FQMA 4JF5A 5DTTA 4BJPA 3GV9A 2HDSA 2WADA 3Q7VB 4KG5A 4LENA 3NY4A 1PZOA 3SH9A 3W8KA 5JYPA 1XXMA 5CTMA 1IEMA 1IKGA 1TEMA 3HVFA 3QNBA 4NK3A 4E3KA 3NC8A 3UE0A 2HDRA 5FI2A 3WRTA 5CXWA 1O07A 2GDNA 4YFMA 5AQ7A 3PBRA 4WEJA 5E2HA 4A5RA 4E6XA 4B4ZA 3LCEA 4UA7A 1M6KA 3HLBA 3UPNA 3UE1A 2QMIA 1IYOA 2V1ZA 3O88A 2IWCA 1FCMA 1JWZA 4RYEA 1ES2A 2Y2PA 4B4XA 1MWUA 2XD1A 2Z2LB 3MKEA 3ZG9B 1HZOA 3HUOA 2EFXA 1NY0A 2Q9NA 4YINA 3G2ZA 4JF4A 5KMWA 4WZ4A 4JXSA 4ZJ3A 2CC1A 3BFDA 3CMZA 2DRWA 3PBTA 4GD6A 4ZJ2A 5DF7A 3EQVA 3BFEA 2ZQAA 1FCOA 3IWQA 3RXWA 4OOYA 3HREA 2V2FF 1CI9A 1YQSA 3NDGA 4KENB 2A3UA 2BG1A 4X69A 4QY6A 4N92A 4WEKA 4LV2A 1JTDA 1K56D
chains in the Genus database with same CATH superfamily
3WS4A 1FSYA 2XK1A 4R38A 2PBYA 1DJBA 2VEAA 1VETB 2V8FA 1IYQA 1BUEA 2GZAA 2ZM2A 4RQ9A 3QP1A 3ICYA 3PAEA 4X6TA 3IX4A 2Y2IA 4MN5A 1Y54A 1ALQA 1LLBA 4QPRA 1EW0A 1T1CA 1PZPA 2V20A 3O3VA 3LR3A 4P6ZM 4EW7A 4E3MA 5CEDA 2W1RA 1L0EA 1SKFA 4HP9A 2H0TA 3F1PA 2Y2NA 3PHYA 1ESUA 4R23A 1SKOB 2XFTA 3NULA 4PM5A 2WKQA 1OMEA 2PAVP 3RTYA 1XJ4A 2VGLM 3OCLA 3VFHA 3IF6A 1TS7A 4NXBA 4HEFA 3IWOA 5EOOA 3CG5A 4WMCD 4ETXA 1STZA 2Y2MA 3UB5P 3T1SA 4GJ4A 4Y0OA 1TDLA 3Q81A 5CX7A 4RX3A 3VMAA 4FOFA 2L1MA 4DE2A 4LCLA 4GCZA 3IHAA 5HL1A 3ZQ5A 1L3LA 1W63Q 4ARZB 4EEUA 3HJIA 5F6AA 3UMDA 2WGVA 5J4EA 3VFFA 4OQHA 4S2KA 4CQHA 2EWVA 2Y2LA 1K55C 1XA7A 2FFYA 3C8CA 4EV4A 1W79A 3DTMA 2W3EA 5EOEA 1RCJA 3DWZA 3VP4A 2QPNA 2ZQCA 4WL9A 1RP5A 4EQ1A 3NECA 1LI9A 5EVIC 3VP1A 4ZDXA 4MEZA 4KZ8A 3TSGA 3MZEA 4DE0A 2HP6A 1K6RA 4Y2FA 1DJAA 3LR5A 3BQAA 3WS2A 2HP5A 3R4KA 2JE5A 3BFGA 3A0RA 4NXFA 2J80A 3PBNA 2X71A 4LRYC 3AGEA 5EPHA 4R4RA 1YLWA 2Q0OA 4OLGA 2XRNA 3IF6C 4DXBA 2PD7A 3IXDA 1BLHA 1NLZA 1YLJA 2GJ3A 3MZDA 1KOUA 2PU4A 3LY3A 5GHXA 4WM9A 4IUKA 2P74A 2ZMVA 3E98A 1SCWA 1MXOA 2ZM0A 1W63M 4R3BA 1YAXA 5DKKA 4EUVA 2EX2A 4DJ3A 4R0QA 4EBLA 1ZG6A 2VKSA 4FH4A 4OQIA 2ZC7A 3B47A 4R3JA 2HJ9C 3SW1A 3FPWA 2XFSA 2WGWB 2J9OA 3LGOA 4KZ3A 4XT2B 3S1YA 2B02A 3CAXA 4KUOA 4Y15A 3T1RA 1PRQA 3G30A 3LEQA 1T1BA 1TVFA 3CHWP 3V50A 4PM9A 1SHVA 1PYYA 2ZC3B 2H0YA 3H82A 5EVID 3S22A 3WS1A 1LT0A 2A24A 4HOIA 2ZOHA 4MN7A 4KQRA 1H5XA 3KO6A 2OV5A 3V3RA 1E4DA 2BLSA 3LUQA 3LIEA 3HBRA 3Q07A 3RJUA 2ACGA 3DTKA 1GHMA 3OPLA 4UEYA 3M2KA 2Y2KA 3BY8A 3LY4A 3B42A 1BT5A 3MBZA 1MKMA 3PXPA 4U3TA 3KYZA 3EQUA 4FSFA 3BFFA 1QMEA 3UB9A 4MBFA 1EI5A 4OOLA 3IS2A 2WZZA 4OONA 5LBRA 4CLCE 5TBMB 3NOTC 1A0KA 4NETA 2Y91A 3A3FA 4N9KA 4P87A 4I39A 3MS6A 1CEGA 4H6JA 4NG2A 3CPTA 1BLSA 3VE3A 5E2GA 1S1ZA 4Y5FA 3ZG8B 1L0GA 3GTCA 4ZJ1A 1SDEA 2UV0E 3C7UA 3HLDA 5FEFA 5A91A 4GDBA 1MY8A 4Q8IA 2QJ7A 1NWZA 3GECA 2P9VA 3FPVA 2HDUA 1XA1A 2DNSA 2J9PA 4K08A 3G2YA 5DF8A 4JXGA 4IVIA 4E6WA 1N9NA 2WZXA 4DE3A 1E25A 2EWWA 3LO7A 1T18A 4X1LA 4I3AA 4CPKA 1ES3A 3VSLA 5HPFA 1CI8A 1BYWA 4OQGA 4BD1A 2I9VA 1YLPA 1N4OA 2FH5A 4PPRA 5L2FA 3FKWA 2B5RA 5EM0A 4C3QA 2XQZA 1W8QA 2E8JA 4NXGA 4OOMA 3SS3A 4CLCC 2Y2GA 5CTNA 1S66L 5EV0A 4X25A 1G6AA 2XDMA 3A0SA 3CLOA 3PBSA 5U47A 3UE3A 1NZOA 4L0LA 1VM1A 3NIAA 4OKPA 3BYDA 3KYQA 5M19A 1K6SA 1H3QA 4BD0A 1IELA 2QWSA 5DTTA 4Q0IA 2VA0A 2WADA 3GV9A 4KG5A 2KDKA 1PZOA 3W8KA 1YSPA 3DAVA 3NC8A 4IUHA 3WRTA 1DP8A 1O07A 5AQ7A 4D60A 3EGDC 4A5RA 4UA7A 3HLBA 3UE1A 2V0WA 2QMIA 3EWKA 5HDSA 2IWCA 2Y2PA 1MWUA 5DJTA 3ZG9B 3P01A 3G2ZA 4WZ4A 2PR5A 3BFDA 4IHQA 2DRWA 4F3LB 2JN7A 5AVFA 3EQVA 4HY8A 2V2FF 2NUTC 1YQSA 4KENB 4EERA 2OWJA 4X69A 4QY6A 4LV2A 1JTDA 1PWCA 3MQQA 1PFLA 2WKHA 4UQIM 1OT9A 3WS5A 3K3CA 1T19A 1T1AA 3A0VA 4YNRA 2M7UA 4UAAA 5TFQA 3SOIA 2J3TD 3VP2A 1MWTA 1BTLA 3PR6A 4CLCD 2J3WA 4JXWA 2EXAA 1TF1A 3FWLA 3IX3A 3VP0A 1ERQA 1AXBA 2J8YA 1VEUB 3M6HA 2EX6A 5I5LA 5FATA 1ZG4A 5FA7A 3BRMA 3KSHA 4DJ2A 2WGWA 5AVEA 4XT2A 2K31A 4KG6A 5G18A 4HQAA 3PAGA 3FC7A 4NKPA 4DE1A 3CWFA 4BQMA 1LL5A 3LIBA 2WK0A 2ZQ8A 2OLVA 3E4QA 1D06A 2V8CA 4JF6A 4XXRA 3V67A 5L8MA 5AQ9A 4GLQA 3T12B 4C6YA 5FQ9A 4JGOA 1MC0A 2Z6CA 3LYXA 3OPPA 2ZLYA 5F82A 5A92A 4KZ9A 1L2SA 1NJ4A 1NYMA 2XF3A 5A93A 2PU2A 3IXHA 3ZG7B 4UA6A 4BBTA 1V9ZA 2EX9A 4Y0UA 4S2NC 4YOFA 1KDWA 3GVBA 4KUKA 5EE8A 4WZ5C 4GS9B 1XJ2A 4FUWA 1UWPX 1I2SA 1YMXA 5AQBA 3L9KA 4II7A 5TBMA 2JCHA 1K57C 2EA9A 2YKHA 2ZQ7A 1FIKA 2JKRM 5DTSA 1NZUA 3D9YA 4ME4A 4DDSA 4OPZA 1XX2A 2QYBA 1K25A 3IQAA 4GOGA 3LIAA 1O7EA 4OP8A 1Z6FA 4MLLA 4S2JA 1GA9A 1K4FA 2XH9A 2GX5A 1JNUA 5FL3A 4N92A 2D01A 1IYPA 4GKUA 4I38A 3NHQA 1K55A 3TG9A 3MKFA 1JWPA 4IVKA 1ZHHB 3OBFA 4EU0A 2FZ0A 3C4PA 4Y3IA 3ZNTA 3HUNA 3CI6A 1IYSA 3S7PA 4Y13A 3T4SA 2UWXA 5FQKA 4KQDA 3G35A 4WYYA 5HD3A 5F1GA 5E2EA 1FR6A 2VGKA 4S2IA 5EVIA 1LSVA 3BJNA 5HD5A 2ZC6B 4LV1A 5AQAA 1XPBA 4YWZA 2DCFA 4LGWA 4X56A 2W1TA 2WKIA 1W5DA 1IKIA 2PHYA 1E3UD 1VQQA 4KG2A 1OTEA 2H28A 3ZHHA 2MJ6A 3BM6A 3FKVA 1YMSA 3HL9A 3WWXA 3DBAA 4WLAA 1XFQA 4LPZA 2X02A 3HLWA 5D3OA 4OPYA 3DWKA 3VOZA 3Q82A 1UGUA 1WYBA 3UE6A 4BLMA 4PKYA 3E2LA 1L0FA 1KGEA 3TOIA 1F2KA 3F1OB 4H8RA 1MZUA 3SH7A 4HH2A 4OLDA 4RA7A 1ZKJA 4OH0A 3G31A 5HWWA 1DY6A 5F69A 2ZM8A 1I5QA 3OZHA 1YLYA 3BEBA 4KZ6A 5KIZA 2PDRA 4F3LA 3S7QA 1GCEA 1CJFA 4FD8A 3IT9A 3T4OA 5A90A 4FCFA 4X1MA 4B88A 3NDEA 4PMAA 1W8YA 1OTDA 2QJ5A 1G28A 3F1NB 2VV6A 3T4KA 1ERMA 3RFBA 4LFUA 1YSQA 4MN6A 1BLPA 3PBQA 1C3BA 3GSGA 4WF0A 1NRFA 1IFQA 4DN0A 3DW0A 2PYPA 3M6BA 4D2OA 3UO9A 4JGQA 1LSWA 1VEUA 2P04A 4Y0TA 5GHZA 1BLCA 1XJ6A 1OT6A 3ISGA 3WS0A 5AJGA 4NEED 1KDSA 4B93A 1HVBA 2C5WB 1TS6A 4GHIB 3JYIA 5GHYA 5FEGA 2PR6A 1DJCA 4KQQA 4IEDA 2O9AA 1FOFA 1GHPA 1GSWA 1LL9A 3AGFA 3QP4A 4K0XA 2ZL1B 5FAQA 2O0YA 1U60A 4O0PA 3BW6A 4HI4A 4HNBA 4WN5A 4PHTA 3MXQA 2R9XA 1PWGA 2WGIA 3P09A 1KGGA 3TRCA 1P9WA 4ETZA 1KE0A 1M40A 1DRMA 3T4LA 5FQIA 3U2AA 2EX8A 3E2KA 3ZVWA 1YT4A 2OLUA 2M1CA 1MPLA 4GN2A 3W4PA 1S67L 1ONGA 4BWIA 5FQMA 4BJPA 2A2LA 5CTMA 3EGXC 3MQ0A 3QNBA 2LB9A 4E3KA 1XJ3A 4WEJA 4E6XA 4B4ZA 3H7WB 4CLCA 1P0ZA 3UPNA 5L07A 1GSXA 3O88A 1FCMA 4RYEA 2R78A 2Z2LB 2IA2A 1VETA 4IJGA 3R7WB 4ZJ3A 5EFWA 2XA7M 4GD6A 4ZJ2A 1TS0A 3BFEA 4BBUA 3HREA 3VE4A 2W3FA 2VZWA 5HWTA 4WEKA 1P9RA 2K2NA 1CF0A 4BENA 3BECA 1X0OA 1H8ZA 3DTIA 3SZTA 3UPOA 4QJGA 5GLAA 4MNRA 2Z2MB 3UPPA 3MR0A 2H10A 4E3JA 3V3SA 4PM6A 1Y28A 2G7UA 5JYOA 3M2JA 3N4IA 4QD4A 4EXOA 3FYZA 2INWA 3ZCZA 2HDQA 3KYEA 4UQIS 1SKOA 4U0TA 4P0MA 2JKRI 4QU3A 2WAFA 1NYYA 3IXBA 2W3DA 2P7JA 4HBUA 3MSHA 1G5UA 1YM1A 2KX6A 4MBKA 4S2OA 1OJGA 4F94A 2OAP1 1AWIA 5DVAA 2EFUA 1L0DA 4R4SA 4LLOB 1TDGA 4P6BA 3LI9A 5HSQA 4CJNA 3IWIA 2H5SA 3DTEA 5M18A 3NCKA 3W4QA 2J3TC 4QHCA 4ARZA 4X53A 3JVUA 3OPRA 1PWDA 2XROA 2VJWA 3ZYTA 1I2WA 5L09A 4FH2A 3K3DA 3G4PA 3UMEA 4O7DA 4OQ0A 3EOIA 1FR1A 3N7WA 1YKDA 5HL6A 2D02A 3OOVA 1VB6A 2HP9A 5HPIA 5IT5A 3C38A 3FZCA 1FQGA 4BL3A 3V39A 2B18A 2IWBA 4ZBEA 3ZG0A 1G68A 5FQQA 4K91A 1MWSA 2ZQDA 4ID4A 3UY6A 3C2WA 2IWDA 4S2NA 3Q7ZA 1E3UA 4L9FA 4WZ5A 3GRJA 3ZG5A 1FSWA 5HFOA 5EVLA 2O99A 3IX8A 1K57A 2M7VA 1J3WA 3ULFA 3MFDA 1WE4A 3NOPC 2GNXA 1F5MA 2K7SA 4PKYG 4PM8A 3ITBA 3NI9A 3GDIA 2RCXA 3T1QB 3D3OA 3ZNYA 3OC2A 1ACFA 3C5AA 5HDDA 5FSRA 3UB8A 3IH9A 3HJKA 4E3OA 3V5MA 3A3DA 2Z6DA 4X55A 5TJJA 4RX2A 3T50A 3HLEA 2ZJ9A 5MC7A 4EQIA 1OJ5A 4ZAMA 3VOLA 3ZVTA 5E2FA 4GZBA 2Y55A 4P6ZS 1F9IA 3S7NA 5CGXA 1LSXA 5FI7A 1WYCA 2PD8A 4P85A 5J8XA 2YKFA 3QP2A 2WKPA 2VV8A 3NBLA 2RL3A 2BASA 3HCYA 4HIAA 4I5SA 1LHYA 4DF6A 4JGPA 2VGLS 1XGIA 2WKRA 5FDSA 4JXVA 4C75A 1K56A 4N1HA 2QKPA 4WELA 3BFCA 3QP5A 3CZDA 2PT7A 1Q2QA 4Z9QA 2ZC4B 4Q0JA 4OPQA 5DKLA 3IHBA 1PI5A 5CHUA 4QB8A 4EESA 3QNCA 1XGJA 3SS4A 4Y17A 4UHUA 2JKGA 3H82B 2A24B 3I7JA 5DF9A 3HLCA 3VOYA 4LRXC 2Y2OA 5IHVA 4E3IA 2Y2HA 4KZAA 5FASA 3UN7A 1MBLA 4EETB 3LIFA 1CQAA 1G6OA 1KGFA 1ODVA 4S2PA 5KZHA 4HBTA 5HAIA 3E0YA 4IBRA 3PBOA 1PI4A 2R9WA 1S1YA 1MKIA 1PW1A 4DDYA 4LV0A 2LB5A 3LR4A 4G3VA 2JBFA 4LCMA 3RH8B 5CHJA 3NJAA 3OPHA 3IS2B 4R3AA 2HV1A 4I3IA 4HJ6A 2Y2JA 4DMZA 5GLDA 1XKZA 2P08A 3T4QA 2PYRA 1BZAA 4H6JB 3CPTB 1S0WA 2ZQ9A 4E3LA 2BTFP 5DFXA 3BLMA 1EWZA 3GR2A 1OTAA 3N6IA 1PW8A 4U0XA 4IBXA 2P9VB 1V9YA 1D1JA 5EM1A 1ES5A 5E43A 1H8MA 4X68A 3GMWA 3NOUC 5HZHA 4XUXA 1ZTUA 1K4EA 2ZC5B 3EEAA 4DXCA 4EWFA 1EROA 4R1GA 4Y7PA 3JVVA 1KE4A 1UWNX 3GQZA 2ZD8A 1D7EA 2OWHA 1WA9A 1MWRA 2JKTM 3P98A 3VSKA 4E3NA 1ES4A 4QY5A 5CHMA 2V1AA 2XGNA 4JF5A 3Q7VB 4LENA 3NY4A 1XXMA 1IEMA 1IKGA 1TEMA 3UE0A 5CXWA 1TD5A 3EEHA 2HGVA 3C30A 4YFMA 5E2HA 5IS1A 2V1ZA 1JWZA 2XSSA 4B4XA 3MKEA 1HZOA 3PYPA 2EFXA 2Q9NA 1Y4OA 4JF4A 4JXSA 2KLIA 3MJQA 2ZQAA 3RXWA 5DFYA 3L7HA 1CI9A 2BG1A 4QWOA 1K56D 5CEBA 4N1XA 4OP5A 1H0MA 4MMNA 4RVAA 2L4RA 3G32A 4OPRA 3D4FA 2XA7S 3FG8A 3D72A 4BBVA 4JBFA 5F68A 1N9LA 4HJ4A 1W7FA 1RGYA 4MBHA 2HF6A 4O8GA 5TGFA 1SZVA 1QMFA 1GHIA 1K38A 1K54A 4I3JA 3A3EA 2Y2QA 1FILA 4R70A 1PIOA 4KZ7A 2Y4AA 3K2NA 2QZ6A 5F5YA 3QP8A 2I72A 3G34A 4UA9A 3BWLA 2O9BA 1J9MA 2V0UA 3CITA 1ESIA 3KSFA 4L9GA 3UDFA 4MDZA 1N9OA 5EUAA 3O86A 5CECA 1NXYA 5HAQA 2PBDP 2G2WA 1FCNA 5CRFA 4ZTKA 1VHMA 3UB6A 4M3KA 1DP6A 1KE3A 4JPMA 2XD5A 4GS9A 3P7NA 3E4PA 4Z1WA 2XLNA 4XUZA 2EXBA 3MXRA 3OCNA 1LL8A 2ZMAA 4GD8A 1BULA 2WKEA 4R6LA 1NRJA 1YLTA 1F98A 3U4LP 4EEPA 4S2LA 4EBPA 2OOLA 2VGJA 2W0NA 4KZ5A 5J7EA 2OSUA 1CEFA 3B33A 4HHDA 4Q0HA 2B95A 3LIDA 4AFIA 4JLFA 5CERA 3ZDJA 3N8RA 2KOIA 5IU1A 2VV7A 5G4ZA 1HLUP 5KSCA 2WUQA 2L0WA 1DP9A 4FTXA 3UB7A 1ONHA 5FAOA 5BOHA 3LR0A 5A8BA 4G3WA 5I94A 3HLFA 2ZMFA 4GB7A 3O87A 3S4XA 3ITAA 3A3JA 1IOUA 1K54C 3CUEA 3LICA 4LV3A 1LI0A 3FV7A 1Z09A 5FI6A 3WRZA 4PAUA 1OPXA 5EECA 3SH8A 3N8SA 5G4YA 1YPRA 1CK3A 3MQOA 3A3IA 1KVLA 3HUMA 2DMWA 1S4RA 5GL9A 5FDHA 4GNUA 1JWVA 3BY9A 3S7OA 3OLOA 1GSVA 3TW8A 1NLYA 3VP3A 2ZOIA 5HX9A 5FQJA 5K5BA 1XP4A 3IF5A 1YLZA 3Q1FA 3VV4A 5L10A 4NXEA 2VK3A 5HARA 2Y59A 2V9AA 2ZBBA 5HAPA 3LEZA 3KSIA 3MZFA 1Q2PA 3B3XA 3F1OA 4BMWA 5EVEA 3C4OA 3T4TA 3LFVA 1K0KA 4S2MA 4ESPA 5EVIB 2Y79A 3QHYA 3Q7VA 3BLSA 5F1FA 3KX0X 5F83A 3ZGAB 5TR7A 3T1XA 4HH3A 5CGSA 2W1TB 3F1PB 2PRFA 1PNEA 4HP4A 1S6RA 2JC7A 3F1NA 3CUEC 3IF6B 2Q9MA 3IBRA 1SDNA 2A49A 1RGZA 3SS5A 4JGRA 1JVJA 2Y8HA 3UDXA 3AGDA 3IXGA 3E4OA 4G3KA 4EUZA 2WYXA 1JTGA 4EBNA 1GA0A 2X01A 4BL2A 1S4SA 3KSGA 2VX8A 4GHIA 2JKTI 3LI8A 5GLBA 3TE8A 4L9EA 4JKTA 1H8YA 1BSGA 4PM7A 4KZ4A 4GW9A 3PTEA 5HWVA 2ZL1A 2HZ5A 2E8IA 3W2ZA 4K0WA 4KQOA 1N9BA 4WMCA 2W3HA 5CGWA 2HJEA 2XR0A 4KZBA 5J3WA 4GDNA 4OVDA 3ZFZA 2OAQ1 4E04A 2C6WB 3C7VA 5HW3A 5M1AA 3UDIA 3JPUA 1ZC2A 3UNWA 2G2UA 2FFFB 2QHKA 2WAEA 4WBGA 5FAPA 2XEPA 2W3GA 2HPBA 3IBJA 3CJMA 3N8LA 3MMHA 4M4XA 2JKFA 5DJUA 2V1BA 2J7VA 4B9OA 3G6OA 3HLGA 3W4OA 5KSHA 2JHEA 4ZRRA 1TS8A 4HESA 1KVMA 3H7WA 4N9LA 3MXSA 5GLCA 1HTZA 3T4JA 1HD8A 1P97A 4DKIA 3RXXA 3MF0A 3IH8A 4DRTA 3BQ8A 2AVXA 3R7WA 2NUPC 2HDSA 3O5YA 3SH9A 3H9WA 5JYPA 1OTBA 4NK3A 3HVFA 4MCWA 4HJ3A 2HDRA 5FI2A 2GDNA 1OTIA 3PBRA 2CMNA 2W27A 3LCEA 1M6KA 3MFXA 1IYOA 5C5KA 5HDCA 1XFNA 4WUJA 1ES2A 2XD1A 2VLGA 3HUOA 1NY0A 4YINA 5KMWA 3TJZC 2CC1A 3CMZA 4O01A 3PBTA 2O9CA 3QP6A 5DF7A 4LRZE 3IWQA 1FCOA 4OOYA 3NDGA 2A3UA 5DTKA 4CLCB
chains in the Genus database with same CATH topology
4N1XA 1PWCA 4OP5A 4BENA 2WKHA 3WS4A 3BECA 4RVAA 1FSYA 1H8ZA 3G32A 3WS5A 4OPRA 4QJGA 3UPOA 2XK1A 3D4FA 5GLAA 2PBYA 4UAAA 1DJBA 4MNRA 2Z2MB 5TFQA 3SOIA 3UPPA 1IYQA 1BUEA 4JBFA 1MWTA 2H10A 3VP2A 4E3JA 3V3SA 4PM6A 1BTLA 2ZM2A 1W7FA 5JYOA 1RGYA 4MBHA 3M2JA 3N4IA 4QD4A 3FYZA 5TGFA 1QMFA 1GHIA 4JXWA 2EXAA 2HDQA 3PAEA 3ZCZA 4X6TA 3FWLA 4U0TA 4P0MA 4QU3A 2Y2IA 1K38A 1NYYA 2WAFA 3IXBA 1Y54A 3VP0A 1ERQA 4HBUA 1K54A 1AXBA 3A3EA 2J8YA 1ALQA 3M6HA 1LLBA 1YM1A 2Y2QA 4MBKA 2EX6A 1PIOA 4KZ7A 5FATA 1PZPA 1ZG4A 2V20A 2Y4AA 3O3VA 4S2OA 5CEBA 2QZ6A 5FA7A 4F94A 2I72A 3BRMA 3G34A 4E3MA 5CEDA 2WGWA 5DVAA 2EFUA 1L0DA 4R4SA 1L0EA 4UA9A 1J9MA 3UDFA 1ESIA 1SKFA 4KG6A 2H0TA 5G18A 1TDGA 4P6BA 5EUAA 2Y2NA 3O86A 5CECA 1ESUA 1NXYA 3PAGA 4R23A 4CJNA 5HAQA 3IWIA 2H5SA 2G2WA 1FCNA 5M18A 3NCKA 5CRFA 3W4QA 4DE1A 4BQMA 4QHCA 1LL5A 4X53A 2XFTA 4PM5A 4ZTKA 1OMEA 2WK0A 2ZQ8A 4M3KA 2OLVA 1KE3A 4JPMA 2XD5A 3OPRA 1PWDA 3OCLA 3VFHA 3IF6A 4JF6A 4HEFA 3IWOA 5EOOA 3CG5A 1I2WA 4WMCD 4XXRA 5AQ9A 2XLNA 4XUZA 4C6YA 2EXBA 2Y2MA 3MXRA 3OCNA 5FQ9A 4FH2A 4Y0OA 3OPPA 1TDLA 3G4PA 2ZMAA 2ZLYA 3Q81A 4GD8A 1BULA 2WKEA 4RX3A 5F82A 3VMAA 4O7DA 5A92A 1YLTA 4KZ9A 4DE2A 4S2LA 4EBPA 4LCLA 1L2SA 1NJ4A 1NYMA 2XF3A 3IHAA 4OQ0A 5A93A 5HL1A 2PU2A 3IXHA 3ZG7B 4UA6A 1FR1A 2VGJA 3N7WA 2EX9A 4Y0UA 4KZ5A 4S2NC 1KDWA 2OSUA 3GVBA 5EE8A 1CEFA 4WZ5C 2HP9A 2WGVA 1I2SA 1YMXA 4JLFA 3FZCA 5CERA 3VFFA 3ZDJA 4OQHA 3N8RA 1FQGA 4BL3A 5AQBA 3V39A 4S2KA 5KSCA 2IWBA 4ZBEA 2WUQA 2JCHA 1K57C 3ZG0A 1G68A 1ONHA 5FQQA 2Y2LA 4K91A 5FAOA 5BOHA 1K55C 1MWSA 1XA7A 2ZQ7A 2FFYA 5DTSA 5I94A 1NZUA 2ZQDA 4ID4A 3UY6A 4DDSA 4OPZA 4EV4A 1XX2A 1W79A 2IWDA 3DTMA 3HLFA 4GB7A 4S2NA 1K25A 3O87A 3Q7ZA 3S4XA 3IQAA 3ITAA 4GOGA 1E3UA 3A3JA 1K54C 4WZ5A 5EOEA 1RCJA 3DWZA 3VP4A 2QPNA 3GRJA 3ZG5A 2ZQCA 1O7EA 4OP8A 1RP5A 4LV3A 1Z6FA 1FSWA 1LI0A 1LI9A 3FV7A 5FI6A 4MLLA 5EVIC 3VP1A 4ZDXA 4S2JA 1GA9A 1K4FA 4MEZA 5EVLA 5HFOA 3WRZA 4KZ8A 5EECA 3SH8A 3N8SA 3TSGA 2XH9A 3MZEA 4DE0A 1CK3A 2HP6A 1K6RA 1DJAA 1K57A 3WS2A 1IYPA 2HP5A 3A3IA 4GKUA 2JE5A 1K55A 3TG9A 3MKFA 1JWPA 1KVLA 3HUMA 3MFDA 3BFGA 5GL9A 5FDHA 4GNUA 1JWVA 4IVKA 1WE4A 3PBNA 2X71A 3AGEA 5EPHA 3C4PA 4R4RA 1YLWA 3ZNTA 4OLGA 3HUNA 4PM8A 1IYSA 3VP3A 3ITBA 3NI9A 3IF6C 5HX9A 2UWXA 4DXBA 5FQKA 3IXDA 1BLHA 1YLJA 2RCXA 3G35A 5FQJA 3ZNYA 3OC2A 4WYYA 3MZDA 5F1GA 2PU4A 1FR6A 2VGKA 4S2IA 5E2EA 3C5AA 5EVIA 1XP4A 3LY3A 3IF5A 1YLZA 3Q1FA 5FSRA 5GHXA 3IH9A 2ZC6B 4WM9A 4LV1A 2P74A 5AQAA 1XPBA 4E3OA 3V5MA 2DCFA 4X56A 2WKIA 1SCWA 1W5DA 1MXOA 3A3DA 2Y59A 1IKIA 4X55A 5HARA 4RX2A 1E3UD 2ZM0A 5HAPA 4R3BA 1VQQA 4KG2A 3HLEA 3LEZA 2ZJ9A 4EQIA 2EX2A 4ZAMA 3ZHHA 3MZFA 3ZVTA 1Q2PA 3BM6A 4R0QA 3B3XA 3FKVA 1YMSA 5E2FA 4GZBA 2Y55A 3HL9A 4EBLA 1ZG6A 5CGXA 4FH4A 3WWXA 3C4OA 2ZC7A 1WYCA 4OQIA 5FI7A 4R3JA 4P85A 2X02A 4S2MA 3HLWA 5J8XA 5EVIB 2XFSA 3QHYA 5D3OA 3Q7VA 4OPYA 3BLSA 2WGWB 5F1FA 2J9OA 3DWKA 4KZ3A 3VOZA 3NBLA 5F83A 3Q82A 2RL3A 3ZGAB 5TR7A 3S1YA 5CGSA 1WYBA 1LHYA 4DF6A 4BLMA 3E2LA 1L0FA 1KGEA 1XGIA 3TOIA 1S6RA 3G30A 1TVFA 2JC7A 4JXVA 4H8RA 3V50A 3SH7A 4PM9A 4C75A 1SHVA 1PYYA 1K56A 2ZC3B 4OLDA 2H0YA 5EVID 3S22A 3WS1A 4RA7A 3IF6B 2Q9MA 1ZKJA 4KQRA 4N1HA 4OH0A 3G31A 1DY6A 4WELA 2ZM8A 1I5QA 3OZHA 3BFCA 1YLYA 1H5XA 2OV5A 1SDNA 3BEBA 2A49A 3V3RA 4KZ6A 1RGZA 1E4DA 2BLSA 3CZDA 3SS5A 1Q2QA 3HBRA 1GCEA 4Z9QA 4FD8A 2ZC4B 1JVJA 3IT9A 3Q07A 3RJUA 4FCFA 5A90A 4B88A 3UDXA 3AGDA 3IXGA 4OPQA 1GHMA 3NDEA 3OPLA 3IHBA 1PI5A 4EUZA 2WYXA 1JTGA 4PMAA 3M2KA 2Y2KA 5CHUA 3LY4A 1BT5A 1W8YA 4QB8A 3QNCA 1XGJA 3MBZA 3SS4A 4UHUA 4EBNA 1GA0A 4U3TA 2X01A 4BL2A 3I7JA 5DF9A 3HLCA 1ERMA 3VOYA 3EQUA 4FSFA 2Y2OA 3BFFA 1QMEA 4MBFA 5IHVA 4E3IA 1EI5A 2Y2HA 4KZAA 5FASA 3UN7A 1MBLA 1BLPA 4OOLA 5GLBA 2WZZA 3PBQA 4OONA 1C3BA 4JKTA 1KGFA 1H8YA 3GSGA 1NRFA 4S2PA 5KZHA 1BSGA 3DW0A 4HBTA 4PM7A 4NETA 5HAIA 4KZ4A 2Y91A 3A3FA 3M6BA 3PTEA 4IBRA 4N9KA 4P87A 4D2OA 3UO9A 1CEGA 3PBOA 1BLSA 4Y0TA 1PI4A 5E2GA 2E8IA 5GHZA 2R9WA 1BLCA 3ZG8B 1L0GA 3GTCA 1MKIA 3ISGA 4ZJ1A 1PW1A 3WS0A 4DDYA 4LV0A 1SDEA 4K0WA 4KQOA 1KDSA 1N9BA 3C7UA 3HLDA 2JBFA 1HVBA 4LCMA 2C5WB 4WMCA 5A91A 4GDBA 5CGWA 1MY8A 2XR0A 4Q8IA 3JYIA 4KZBA 5CHJA 5GHYA 5DTKA 4GDNA 2P9VA 4OVDA 1DJCA 2HDUA 3OPHA 3ZFZA 1XA1A 4KQQA 2DNSA 2C6WB 2J9PA 3C7VA 2Y2JA 3G2YA 5DF8A 4IEDA 4JXGA 5HW3A 4IVIA 5M1AA 3UDIA 1FOFA 1GHPA 1XKZA 5GLDA 1LL9A 3AGFA 1BZAA 4E6WA 1ZC2A 3UNWA 4K0XA 1S0WA 2ZQ9A 5FAQA 1U60A 2FFFB 2G2UA 2WZXA 4E3LA 4WBGA 1E25A 2WAEA 3LO7A 5FAPA 2XEPA 4DE3A 3BLMA 1EWZA 4CPKA 3GR2A 1ES3A 3VSLA 3N6IA 1CI8A 2R9XA 1PW8A 2HPBA 4OQGA 1PWGA 3CJMA 2WGIA 3N8LA 3P09A 4U0XA 4BD1A 4IBXA 2P9VB 1N4OA 1YLPA 1KGGA 4PPRA 5L2FA 3FKWA 1ES5A 2B5RA 4C3QA 2XQZA 4X68A 1W8QA 5E43A 2J7VA 1KE0A 3GMWA 1M40A 3HLGA 3W4OA 5KSHA 4OOMA 4XUXA 4HESA 3SS3A 1KVMA 1K4EA 2Y2GA 2ZC5B 5CTNA 4DXCA 4N9LA 5FQIA 2EX8A 1EROA 4R1GA 1G6AA 3E2KA 3MXSA 4Y7PA 4EWFA 5GLCA 3ZVWA 2XDMA 1KE4A 1YT4A 3GQZA 2OLUA 2ZD8A 3PBSA 5U47A 3UE3A 1NZOA 1MPLA 1HTZA 4L0LA 1MWRA 1HD8A 1VM1A 3P98A 3NIAA 4DKIA 3VSKA 4E3NA 4GN2A 4OKPA 3RXXA 3BYDA 1ES4A 4QY5A 3IH8A 3W4PA 4DRTA 1K6SA 5CHMA 5M19A 1ONGA 4BD0A 2XGNA 1IELA 5FQMA 4JF5A 5DTTA 4BJPA 3GV9A 2HDSA 2WADA 3Q7VB 4KG5A 4LENA 3NY4A 1PZOA 3SH9A 3W8KA 5JYPA 1XXMA 5CTMA 1IEMA 1IKGA 1TEMA 3HVFA 3QNBA 4NK3A 4E3KA 3NC8A 3UE0A 2HDRA 5FI2A 3WRTA 5CXWA 1O07A 2GDNA 4YFMA 5AQ7A 3PBRA 4WEJA 5E2HA 4A5RA 4E6XA 4B4ZA 3LCEA 4UA7A 1M6KA 3HLBA 3UPNA 3UE1A 2QMIA 1IYOA 2V1ZA 3O88A 2IWCA 1FCMA 1JWZA 4RYEA 1ES2A 2Y2PA 4B4XA 1MWUA 2XD1A 2Z2LB 3MKEA 3ZG9B 1HZOA 3HUOA 2EFXA 1NY0A 2Q9NA 4YINA 3G2ZA 4JF4A 5KMWA 4WZ4A 4JXSA 4ZJ3A 2CC1A 3BFDA 3CMZA 2DRWA 3PBTA 4GD6A 4ZJ2A 5DF7A 3EQVA 3BFEA 2ZQAA 1FCOA 3IWQA 3RXWA 4OOYA 3HREA 2V2FF 1CI9A 1YQSA 3NDGA 4KENB 2A3UA 2BG1A 4X69A 4QY6A 4N92A 4WEKA 4LV2A 1JTDA 1K56D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N1X A;  1PWC A;  4OP5 A;  4BEN A;  2WKH A;  3WS4 A;  3BEC A;  4RVA A;  1FSY A;  1H8Z A;  3G32 A;  3WS5 A;  4OPR A;  4QJG A;  3UPO A;  2XK1 A;  3D4F A;  5GLA A;  2PBY A;  4UAA A;  1DJB A;  4MNR A;  2Z2M B;  5TFQ A;  3SOI A;  3UPP A;  1IYQ A;  1BUE A;  4JBF A;  1MWT A;  2H10 A;  3VP2 A;  4E3J A;  3V3S A;  4PM6 A;  1BTL A;  2ZM2 A;  1W7F A;  5JYO A;  1RGY A;  4MBH A;  3M2J A;  3N4I A;  4QD4 A;  3FYZ A;  5TGF A;  1QMF A;  1GHI A;  4JXW A;  2EXA A;  2HDQ A;  3PAE A;  3ZCZ A;  4X6T A;  3FWL A;  4U0T A;  4P0M A;  4QU3 A;  2Y2I A;  1K38 A;  1NYY A;  2WAF A;  3IXB A;  1Y54 A;  3VP0 A;  1ERQ A;  4HBU A;  1K54 A;  1AXB A;  3A3E A;  2J8Y A;  1ALQ A;  3M6H A;  1LLB A;  1YM1 A;  2Y2Q A;  4MBK A;  2EX6 A;  1PIO A;  4KZ7 A;  5FAT A;  1PZP A;  1ZG4 A;  2V20 A;  2Y4A A;  3O3V A;  4S2O A;  5CEB A;  2QZ6 A;  5FA7 A;  4F94 A;  2I72 A;  3BRM A;  3G34 A;  4E3M A;  5CED A;  2WGW A;  5DVA A;  2EFU A;  1L0D A;  4R4S A;  1L0E A;  4UA9 A;  1J9M A;  3UDF A;  1ESI A;  1SKF A;  4KG6 A;  2H0T A;  5G18 A;  1TDG A;  4P6B A;  5EUA A;  2Y2N A;  3O86 A;  5CEC A;  1ESU A;  1NXY A;  3PAG A;  4R23 A;  4CJN A;  5HAQ A;  3IWI A;  2H5S A;  2G2W A;  1FCN A;  5M18 A;  3NCK A;  5CRF A;  3W4Q A;  4DE1 A;  4BQM A;  4QHC A;  1LL5 A;  4X53 A;  2XFT A;  4PM5 A;  4ZTK A;  1OME A;  2WK0 A;  2ZQ8 A;  4M3K A;  2OLV A;  1KE3 A;  4JPM A;  2XD5 A;  3OPR A;  1PWD A;  3OCL A;  3VFH A;  3IF6 A;  4JF6 A;  4HEF A;  3IWO A;  5EOO A;  3CG5 A;  1I2W A;  4WMC D;  4XXR A;  5AQ9 A;  2XLN A;  4XUZ A;  4C6Y A;  2EXB A;  2Y2M A;  3MXR A;  3OCN A;  5FQ9 A;  4FH2 A;  4Y0O A;  3OPP A;  1TDL A;  3G4P A;  2ZMA A;  2ZLY A;  3Q81 A;  4GD8 A;  1BUL A;  2WKE A;  4RX3 A;  5F82 A;  3VMA A;  4O7D A;  5A92 A;  1YLT A;  4KZ9 A;  4DE2 A;  4S2L A;  4EBP A;  4LCL A;  1L2S A;  1NJ4 A;  1NYM A;  2XF3 A;  3IHA A;  4OQ0 A;  5A93 A;  5HL1 A;  2PU2 A;  3IXH A;  3ZG7 B;  4UA6 A;  1FR1 A;  2VGJ A;  3N7W A;  2EX9 A;  4Y0U A;  4KZ5 A;  4S2N C;  1KDW A;  2OSU A;  3GVB A;  5EE8 A;  1CEF A;  4WZ5 C;  2HP9 A;  2WGV A;  1I2S A;  1YMX A;  4JLF A;  3FZC A;  5CER A;  3VFF A;  3ZDJ A;  4OQH A;  3N8R A;  1FQG A;  4BL3 A;  5AQB A;  3V39 A;  4S2K A;  5KSC A;  2IWB A;  4ZBE A;  2WUQ A;  2JCH A;  1K57 C;  3ZG0 A;  1G68 A;  1ONH A;  5FQQ A;  2Y2L A;  4K91 A;  5FAO A;  5BOH A;  1K55 C;  1MWS A;  1XA7 A;  2ZQ7 A;  2FFY A;  5DTS A;  5I94 A;  1NZU A;  2ZQD A;  4ID4 A;  3UY6 A;  4DDS A;  4OPZ A;  4EV4 A;  1XX2 A;  1W79 A;  2IWD A;  3DTM A;  3HLF A;  4GB7 A;  4S2N A;  1K25 A;  3O87 A;  3Q7Z A;  3S4X A;  3IQA A;  3ITA A;  4GOG A;  1E3U A;  3A3J A;  1K54 C;  4WZ5 A;  5EOE A;  1RCJ A;  3DWZ A;  3VP4 A;  2QPN A;  3GRJ A;  3ZG5 A;  2ZQC A;  1O7E A;  4OP8 A;  1RP5 A;  4LV3 A;  1Z6F A;  1FSW A;  1LI0 A;  1LI9 A;  3FV7 A;  5FI6 A;  4MLL A;  5EVI C;  3VP1 A;  4ZDX A;  4S2J A;  1GA9 A;  1K4F A;  4MEZ A;  5EVL A;  5HFO A;  3WRZ A;  4KZ8 A;  5EEC A;  3SH8 A;  3N8S A;  3TSG A;  2XH9 A;  3MZE A;  4DE0 A;  1CK3 A;  2HP6 A;  1K6R A;  1DJA A;  1K57 A;  3WS2 A;  1IYP A;  2HP5 A;  3A3I A;  4GKU A;  2JE5 A;  1K55 A;  3TG9 A;  3MKF A;  1JWP A;  1KVL A;  3HUM A;  3MFD A;  3BFG A;  5GL9 A;  5FDH A;  4GNU A;  1JWV A;  4IVK A;  1WE4 A;  3PBN A;  2X71 A;  3AGE A;  5EPH A;  3C4P A;  4R4R A;  1YLW A;  3ZNT A;  4OLG A;  3HUN A;  4PM8 A;  1IYS A;  3VP3 A;  3ITB A;  3NI9 A;  3IF6 C;  5HX9 A;  2UWX A;  4DXB A;  5FQK A;  3IXD A;  1BLH A;  1YLJ A;  2RCX A;  3G35 A;  5FQJ A;  3ZNY A;  3OC2 A;  4WYY A;  3MZD A;  5F1G A;  2PU4 A;  1FR6 A;  2VGK A;  4S2I A;  5E2E A;  3C5A A;  5EVI A;  1XP4 A;  3LY3 A;  3IF5 A;  1YLZ A;  3Q1F A;  5FSR A;  5GHX A;  3IH9 A;  2ZC6 B;  4WM9 A;  4LV1 A;  2P74 A;  5AQA A;  1XPB A;  4E3O A;  3V5M A;  2DCF A;  4X56 A;  2WKI A;  1SCW A;  1W5D A;  1MXO A;  3A3D A;  2Y59 A;  1IKI A;  4X55 A;  5HAR A;  4RX2 A;  1E3U D;  2ZM0 A;  5HAP A;  4R3B A;  1VQQ A;  4KG2 A;  3HLE A;  3LEZ A;  2ZJ9 A;  4EQI A;  2EX2 A;  4ZAM A;  3ZHH A;  3MZF A;  3ZVT A;  1Q2P A;  3BM6 A;  4R0Q A;  3B3X A;  3FKV A;  1YMS A;  5E2F A;  4GZB A;  2Y55 A;  3HL9 A;  4EBL A;  1ZG6 A;  5CGX A;  4FH4 A;  3WWX A;  3C4O A;  2ZC7 A;  1WYC A;  4OQI A;  5FI7 A;  4R3J A;  4P85 A;  2X02 A;  4S2M A;  3HLW A;  5J8X A;  5EVI B;  2XFS A;  3QHY A;  5D3O A;  3Q7V A;  4OPY A;  3BLS A;  2WGW B;  5F1F A;  2J9O A;  3DWK A;  4KZ3 A;  3VOZ A;  3NBL A;  5F83 A;  3Q82 A;  2RL3 A;  3ZGA B;  5TR7 A;  3S1Y A;  5CGS A;  1WYB A;  1LHY A;  4DF6 A;  4BLM A;  3E2L A;  1L0F A;  1KGE A;  1XGI A;  3TOI A;  1S6R A;  3G30 A;  1TVF A;  2JC7 A;  4JXV A;  4H8R A;  3V50 A;  3SH7 A;  4PM9 A;  4C75 A;  1SHV A;  1PYY A;  1K56 A;  2ZC3 B;  4OLD A;  2H0Y A;  5EVI D;  3S22 A;  3WS1 A;  4RA7 A;  3IF6 B;  2Q9M A;  1ZKJ A;  4KQR A;  4N1H A;  4OH0 A;  3G31 A;  1DY6 A;  4WEL A;  2ZM8 A;  1I5Q A;  3OZH A;  3BFC A;  1YLY A;  1H5X A;  2OV5 A;  1SDN A;  3BEB A;  2A49 A;  3V3R A;  4KZ6 A;  1RGZ A;  1E4D A;  2BLS A;  3CZD A;  3SS5 A;  1Q2Q A;  3HBR A;  1GCE A;  4Z9Q A;  4FD8 A;  2ZC4 B;  1JVJ A;  3IT9 A;  3Q07 A;  3RJU A;  4FCF A;  5A90 A;  4B88 A;  3UDX A;  3AGD A;  3IXG A;  4OPQ A;  1GHM A;  3NDE A;  3OPL A;  3IHB A;  1PI5 A;  4EUZ A;  2WYX A;  1JTG A;  4PMA A;  3M2K A;  2Y2K A;  5CHU A;  3LY4 A;  1BT5 A;  1W8Y A;  4QB8 A;  3QNC A;  1XGJ A;  3MBZ A;  3SS4 A;  4UHU A;  4EBN A;  1GA0 A;  4U3T A;  2X01 A;  4BL2 A;  3I7J A;  5DF9 A;  3HLC A;  1ERM A;  3VOY A;  3EQU A;  4FSF A;  2Y2O A;  3BFF A;  1QME A;  4MBF A;  5IHV A;  4E3I A;  1EI5 A;  2Y2H A;  4KZA A;  5FAS A;  3UN7 A;  1MBL A;  1BLP A;  4OOL A;  5GLB A;  2WZZ A;  3PBQ A;  4OON A;  1C3B A;  4JKT A;  1KGF A;  1H8Y A;  3GSG A;  1NRF A;  4S2P A;  5KZH A;  1BSG A;  3DW0 A;  4HBT A;  4PM7 A;  4NET A;  5HAI A;  4KZ4 A;  2Y91 A;  3A3F A;  3M6B A;  3PTE A;  4IBR A;  4N9K A;  4P87 A;  4D2O A;  3UO9 A;  1CEG A;  3PBO A;  1BLS A;  4Y0T A;  1PI4 A;  5E2G A;  2E8I A;  5GHZ A;  2R9W A;  1BLC A;  3ZG8 B;  1L0G A;  3GTC A;  1MKI A;  3ISG A;  4ZJ1 A;  1PW1 A;  3WS0 A;  4DDY A;  4LV0 A;  1SDE A;  4K0W A;  4KQO A;  1KDS A;  1N9B A;  3C7U A;  3HLD A;  2JBF A;  1HVB A;  4LCM A;  2C5W B;  4WMC A;  5A91 A;  4GDB A;  5CGW A;  1MY8 A;  2XR0 A;  4Q8I A;  3JYI A;  4KZB A;  5CHJ A;  5GHY A;  5DTK A;  4GDN A;  2P9V A;  4OVD A;  1DJC A;  2HDU A;  3OPH A;  3ZFZ A;  1XA1 A;  4KQQ A;  2DNS A;  2C6W B;  2J9P A;  3C7V A;  2Y2J A;  3G2Y A;  5DF8 A;  4IED A;  4JXG A;  5HW3 A;  4IVI A;  5M1A A;  3UDI A;  1FOF A;  1GHP A;  1XKZ A;  5GLD A;  1LL9 A;  3AGF A;  1BZA A;  4E6W A;  1ZC2 A;  3UNW A;  4K0X A;  1S0W A;  2ZQ9 A;  5FAQ A;  1U60 A;  2FFF B;  2G2U A;  2WZX A;  4E3L A;  4WBG A;  1E25 A;  2WAE A;  3LO7 A;  5FAP A;  2XEP A;  4DE3 A;  3BLM A;  1EWZ A;  4CPK A;  3GR2 A;  1ES3 A;  3VSL A;  3N6I A;  1CI8 A;  2R9X A;  1PW8 A;  2HPB A;  4OQG A;  1PWG A;  3CJM A;  2WGI A;  3N8L A;  3P09 A;  4U0X A;  4BD1 A;  4IBX A;  2P9V B;  1N4O A;  1YLP A;  1KGG A;  4PPR A;  5L2F A;  3FKW A;  1ES5 A;  2B5R A;  4C3Q A;  2XQZ A;  4X68 A;  1W8Q A;  5E43 A;  2J7V A;  1KE0 A;  3GMW A;  1M40 A;  3HLG A;  3W4O A;  5KSH A;  4OOM A;  4XUX A;  4HES A;  3SS3 A;  1KVM A;  1K4E A;  2Y2G A;  2ZC5 B;  5CTN A;  4DXC A;  4N9L A;  5FQI A;  2EX8 A;  1ERO A;  4R1G A;  1G6A A;  3E2K A;  3MXS A;  4Y7P A;  4EWF A;  5GLC A;  3ZVW A;  2XDM A;  1KE4 A;  1YT4 A;  3GQZ A;  2OLU A;  2ZD8 A;  3PBS A;  5U47 A;  3UE3 A;  1NZO A;  1MPL A;  1HTZ A;  4L0L A;  1MWR A;  1HD8 A;  1VM1 A;  3P98 A;  3NIA A;  4DKI A;  3VSK A;  4E3N A;  4GN2 A;  4OKP A;  3RXX A;  3BYD A;  1ES4 A;  4QY5 A;  3IH8 A;  3W4P A;  4DRT A;  1K6S A;  5CHM A;  5M19 A;  1ONG A;  4BD0 A;  2XGN A;  1IEL A;  5FQM A;  4JF5 A;  5DTT A;  4BJP A;  3GV9 A;  2HDS A;  2WAD A;  3Q7V B;  4KG5 A;  4LEN A;  3NY4 A;  1PZO A;  3SH9 A;  3W8K A;  5JYP A;  1XXM A;  5CTM A;  1IEM A;  1IKG A;  1TEM A;  3HVF A;  3QNB A;  4NK3 A;  4E3K A;  3NC8 A;  3UE0 A;  2HDR A;  5FI2 A;  3WRT A;  5CXW A;  1O07 A;  2GDN A;  4YFM A;  5AQ7 A;  3PBR A;  4WEJ A;  5E2H A;  4A5R A;  4E6X A;  4B4Z A;  3LCE A;  4UA7 A;  1M6K A;  3HLB A;  3UPN A;  3UE1 A;  2QMI A;  1IYO A;  2V1Z A;  3O88 A;  2IWC A;  1FCM A;  1JWZ A;  4RYE A;  1ES2 A;  2Y2P A;  4B4X A;  1MWU A;  2XD1 A;  2Z2L B;  3MKE A;  3ZG9 B;  1HZO A;  3HUO A;  2EFX A;  1NY0 A;  2Q9N A;  4YIN A;  3G2Z A;  4JF4 A;  5KMW A;  4WZ4 A;  4JXS A;  4ZJ3 A;  2CC1 A;  3BFD A;  3CMZ A;  2DRW A;  3PBT A;  4GD6 A;  4ZJ2 A;  5DF7 A;  3EQV A;  3BFE A;  2ZQA A;  1FCO A;  3IWQ A;  3RXW A;  4OOY A;  3HRE A;  2V2F F;  1CI9 A;  1YQS A;  3NDG A;  4KEN B;  2A3U A;  2BG1 A;  4X69 A;  4QY6 A;  4N92 A;  4WEK A;  4LV2 A;  1JTD A;  1K56 D; 
#chains in the Genus database with same CATH topology
 3WS4 A;  1FSY A;  2XK1 A;  4R38 A;  2PBY A;  1DJB A;  2VEA A;  1VET B;  2V8F A;  1IYQ A;  1BUE A;  2GZA A;  2ZM2 A;  4RQ9 A;  3QP1 A;  3ICY A;  3PAE A;  4X6T A;  3IX4 A;  2Y2I A;  4MN5 A;  1Y54 A;  1ALQ A;  1LLB A;  4QPR A;  1EW0 A;  1T1C A;  1PZP A;  2V20 A;  3O3V A;  3LR3 A;  4P6Z M;  4EW7 A;  4E3M A;  5CED A;  2W1R A;  1L0E A;  1SKF A;  4HP9 A;  2H0T A;  3F1P A;  2Y2N A;  3PHY A;  1ESU A;  4R23 A;  1SKO B;  2XFT A;  3NUL A;  4PM5 A;  2WKQ A;  1OME A;  2PAV P;  3RTY A;  1XJ4 A;  2VGL M;  3OCL A;  3VFH A;  3IF6 A;  1TS7 A;  4NXB A;  4HEF A;  3IWO A;  5EOO A;  3CG5 A;  4WMC D;  4ETX A;  1STZ A;  2Y2M A;  3UB5 P;  3T1S A;  4GJ4 A;  4Y0O A;  1TDL A;  3Q81 A;  5CX7 A;  4RX3 A;  3VMA A;  4FOF A;  2L1M A;  4DE2 A;  4LCL A;  4GCZ A;  3IHA A;  5HL1 A;  3ZQ5 A;  1L3L A;  1W63 Q;  4ARZ B;  4EEU A;  3HJI A;  5F6A A;  3UMD A;  2WGV A;  5J4E A;  3VFF A;  4OQH A;  4S2K A;  4CQH A;  2EWV A;  2Y2L A;  1K55 C;  1XA7 A;  2FFY A;  3C8C A;  4EV4 A;  1W79 A;  3DTM A;  2W3E A;  5EOE A;  1RCJ A;  3DWZ A;  3VP4 A;  2QPN A;  2ZQC A;  4WL9 A;  1RP5 A;  4EQ1 A;  3NEC A;  1LI9 A;  5EVI C;  3VP1 A;  4ZDX A;  4MEZ A;  4KZ8 A;  3TSG A;  3MZE A;  4DE0 A;  2HP6 A;  1K6R A;  4Y2F A;  1DJA A;  3LR5 A;  3BQA A;  3WS2 A;  2HP5 A;  3R4K A;  2JE5 A;  3BFG A;  3A0R A;  4NXF A;  2J80 A;  3PBN A;  2X71 A;  4LRY C;  3AGE A;  5EPH A;  4R4R A;  1YLW A;  2Q0O A;  4OLG A;  2XRN A;  3IF6 C;  4DXB A;  2PD7 A;  3IXD A;  1BLH A;  1NLZ A;  1YLJ A;  2GJ3 A;  3MZD A;  1KOU A;  2PU4 A;  3LY3 A;  5GHX A;  4WM9 A;  4IUK A;  2P74 A;  2ZMV A;  3E98 A;  1SCW A;  1MXO A;  2ZM0 A;  1W63 M;  4R3B A;  1YAX A;  5DKK A;  4EUV A;  2EX2 A;  4DJ3 A;  4R0Q A;  4EBL A;  1ZG6 A;  2VKS A;  4FH4 A;  4OQI A;  2ZC7 A;  3B47 A;  4R3J A;  2HJ9 C;  3SW1 A;  3FPW A;  2XFS A;  2WGW B;  2J9O A;  3LGO A;  4KZ3 A;  4XT2 B;  3S1Y A;  2B02 A;  3CAX A;  4KUO A;  4Y15 A;  3T1R A;  1PRQ A;  3G30 A;  3LEQ A;  1T1B A;  1TVF A;  3CHW P;  3V50 A;  4PM9 A;  1SHV A;  1PYY A;  2ZC3 B;  2H0Y A;  3H82 A;  5EVI D;  3S22 A;  3WS1 A;  1LT0 A;  2A24 A;  4HOI A;  2ZOH A;  4MN7 A;  4KQR A;  1H5X A;  3KO6 A;  2OV5 A;  3V3R A;  1E4D A;  2BLS A;  3LUQ A;  3LIE A;  3HBR A;  3Q07 A;  3RJU A;  2ACG A;  3DTK A;  1GHM A;  3OPL A;  4UEY A;  3M2K A;  2Y2K A;  3BY8 A;  3LY4 A;  3B42 A;  1BT5 A;  3MBZ A;  1MKM A;  3PXP A;  4U3T A;  3KYZ A;  3EQU A;  4FSF A;  3BFF A;  1QME A;  3UB9 A;  4MBF A;  1EI5 A;  4OOL A;  3IS2 A;  2WZZ A;  4OON A;  5LBR A;  4CLC E;  5TBM B;  3NOT C;  1A0K A;  4NET A;  2Y91 A;  3A3F A;  4N9K A;  4P87 A;  4I39 A;  3MS6 A;  1CEG A;  4H6J A;  4NG2 A;  3CPT A;  1BLS A;  3VE3 A;  5E2G A;  1S1Z A;  4Y5F A;  3ZG8 B;  1L0G A;  3GTC A;  4ZJ1 A;  1SDE A;  2UV0 E;  3C7U A;  3HLD A;  5FEF A;  5A91 A;  4GDB A;  1MY8 A;  4Q8I A;  2QJ7 A;  1NWZ A;  3GEC A;  2P9V A;  3FPV A;  2HDU A;  1XA1 A;  2DNS A;  2J9P A;  4K08 A;  3G2Y A;  5DF8 A;  4JXG A;  4IVI A;  4E6W A;  1N9N A;  2WZX A;  4DE3 A;  1E25 A;  2EWW A;  3LO7 A;  1T18 A;  4X1L A;  4I3A A;  4CPK A;  1ES3 A;  3VSL A;  5HPF A;  1CI8 A;  1BYW A;  4OQG A;  4BD1 A;  2I9V A;  1YLP A;  1N4O A;  2FH5 A;  4PPR A;  5L2F A;  3FKW A;  2B5R A;  5EM0 A;  4C3Q A;  2XQZ A;  1W8Q A;  2E8J A;  4NXG A;  4OOM A;  3SS3 A;  4CLC C;  2Y2G A;  5CTN A;  1S66 L;  5EV0 A;  4X25 A;  1G6A A;  2XDM A;  3A0S A;  3CLO A;  3PBS A;  5U47 A;  3UE3 A;  1NZO A;  4L0L A;  1VM1 A;  3NIA A;  4OKP A;  3BYD A;  3KYQ A;  5M19 A;  1K6S A;  1H3Q A;  4BD0 A;  1IEL A;  2QWS A;  5DTT A;  4Q0I A;  2VA0 A;  2WAD A;  3GV9 A;  4KG5 A;  2KDK A;  1PZO A;  3W8K A;  1YSP A;  3DAV A;  3NC8 A;  4IUH A;  3WRT A;  1DP8 A;  1O07 A;  5AQ7 A;  4D60 A;  3EGD C;  4A5R A;  4UA7 A;  3HLB A;  3UE1 A;  2V0W A;  2QMI A;  3EWK A;  5HDS A;  2IWC A;  2Y2P A;  1MWU A;  5DJT A;  3ZG9 B;  3P01 A;  3G2Z A;  4WZ4 A;  2PR5 A;  3BFD A;  4IHQ A;  2DRW A;  4F3L B;  2JN7 A;  5AVF A;  3EQV A;  4HY8 A;  2V2F F;  2NUT C;  1YQS A;  4KEN B;  4EER A;  2OWJ A;  4X69 A;  4QY6 A;  4LV2 A;  1JTD A;  1PWC A;  3MQQ A;  1PFL A;  2WKH A;  4UQI M;  1OT9 A;  3WS5 A;  3K3C A;  1T19 A;  1T1A A;  3A0V A;  4YNR A;  2M7U A;  4UAA A;  5TFQ A;  3SOI A;  2J3T D;  3VP2 A;  1MWT A;  1BTL A;  3PR6 A;  4CLC D;  2J3W A;  4JXW A;  2EXA A;  1TF1 A;  3FWL A;  3IX3 A;  3VP0 A;  1ERQ A;  1AXB A;  2J8Y A;  1VEU B;  3M6H A;  2EX6 A;  5I5L A;  5FAT A;  1ZG4 A;  5FA7 A;  3BRM A;  3KSH A;  4DJ2 A;  2WGW A;  5AVE A;  4XT2 A;  2K31 A;  4KG6 A;  5G18 A;  4HQA A;  3PAG A;  3FC7 A;  4NKP A;  4DE1 A;  3CWF A;  4BQM A;  1LL5 A;  3LIB A;  2WK0 A;  2ZQ8 A;  2OLV A;  3E4Q A;  1D06 A;  2V8C A;  4JF6 A;  4XXR A;  3V67 A;  5L8M A;  5AQ9 A;  4GLQ A;  3T12 B;  4C6Y A;  5FQ9 A;  4JGO A;  1MC0 A;  2Z6C A;  3LYX A;  3OPP A;  2ZLY A;  5F82 A;  5A92 A;  4KZ9 A;  1L2S A;  1NJ4 A;  1NYM A;  2XF3 A;  5A93 A;  2PU2 A;  3IXH A;  3ZG7 B;  4UA6 A;  4BBT A;  1V9Z A;  2EX9 A;  4Y0U A;  4S2N C;  4YOF A;  1KDW A;  3GVB A;  4KUK A;  5EE8 A;  4WZ5 C;  4GS9 B;  1XJ2 A;  4FUW A;  1UWP X;  1I2S A;  1YMX A;  5AQB A;  3L9K A;  4II7 A;  5TBM A;  2JCH A;  1K57 C;  2EA9 A;  2YKH A;  2ZQ7 A;  1FIK A;  2JKR M;  5DTS A;  1NZU A;  3D9Y A;  4ME4 A;  4DDS A;  4OPZ A;  1XX2 A;  2QYB A;  1K25 A;  3IQA A;  4GOG A;  3LIA A;  1O7E A;  4OP8 A;  1Z6F A;  4MLL A;  4S2J A;  1GA9 A;  1K4F A;  2XH9 A;  2GX5 A;  1JNU A;  5FL3 A;  4N92 A;  2D01 A;  1IYP A;  4GKU A;  4I38 A;  3NHQ A;  1K55 A;  3TG9 A;  3MKF A;  1JWP A;  4IVK A;  1ZHH B;  3OBF A;  4EU0 A;  2FZ0 A;  3C4P A;  4Y3I A;  3ZNT A;  3HUN A;  3CI6 A;  1IYS A;  3S7P A;  4Y13 A;  3T4S A;  2UWX A;  5FQK A;  4KQD A;  3G35 A;  4WYY A;  5HD3 A;  5F1G A;  5E2E A;  1FR6 A;  2VGK A;  4S2I A;  5EVI A;  1LSV A;  3BJN A;  5HD5 A;  2ZC6 B;  4LV1 A;  5AQA A;  1XPB A;  4YWZ A;  2DCF A;  4LGW A;  4X56 A;  2W1T A;  2WKI A;  1W5D A;  1IKI A;  2PHY A;  1E3U D;  1VQQ A;  4KG2 A;  1OTE A;  2H28 A;  3ZHH A;  2MJ6 A;  3BM6 A;  3FKV A;  1YMS A;  3HL9 A;  3WWX A;  3DBA A;  4WLA A;  1XFQ A;  4LPZ A;  2X02 A;  3HLW A;  5D3O A;  4OPY A;  3DWK A;  3VOZ A;  3Q82 A;  1UGU A;  1WYB A;  3UE6 A;  4BLM A;  4PKY A;  3E2L A;  1L0F A;  1KGE A;  3TOI A;  1F2K A;  3F1O B;  4H8R A;  1MZU A;  3SH7 A;  4HH2 A;  4OLD A;  4RA7 A;  1ZKJ A;  4OH0 A;  3G31 A;  5HWW A;  1DY6 A;  5F69 A;  2ZM8 A;  1I5Q A;  3OZH A;  1YLY A;  3BEB A;  4KZ6 A;  5KIZ A;  2PDR A;  4F3L A;  3S7Q A;  1GCE A;  1CJF A;  4FD8 A;  3IT9 A;  3T4O A;  5A90 A;  4FCF A;  4X1M A;  4B88 A;  3NDE A;  4PMA A;  1W8Y A;  1OTD A;  2QJ5 A;  1G28 A;  3F1N B;  2VV6 A;  3T4K A;  1ERM A;  3RFB A;  4LFU A;  1YSQ A;  4MN6 A;  1BLP A;  3PBQ A;  1C3B A;  3GSG A;  4WF0 A;  1NRF A;  1IFQ A;  4DN0 A;  3DW0 A;  2PYP A;  3M6B A;  4D2O A;  3UO9 A;  4JGQ A;  1LSW A;  1VEU A;  2P04 A;  4Y0T A;  5GHZ A;  1BLC A;  1XJ6 A;  1OT6 A;  3ISG A;  3WS0 A;  5AJG A;  4NEE D;  1KDS A;  4B93 A;  1HVB A;  2C5W B;  1TS6 A;  4GHI B;  3JYI A;  5GHY A;  5FEG A;  2PR6 A;  1DJC A;  4KQQ A;  4IED A;  2O9A A;  1FOF A;  1GHP A;  1GSW A;  1LL9 A;  3AGF A;  3QP4 A;  4K0X A;  2ZL1 B;  5FAQ A;  2O0Y A;  1U60 A;  4O0P A;  3BW6 A;  4HI4 A;  4HNB A;  4WN5 A;  4PHT A;  3MXQ A;  2R9X A;  1PWG A;  2WGI A;  3P09 A;  1KGG A;  3TRC A;  1P9W A;  4ETZ A;  1KE0 A;  1M40 A;  1DRM A;  3T4L A;  5FQI A;  3U2A A;  2EX8 A;  3E2K A;  3ZVW A;  1YT4 A;  2OLU A;  2M1C A;  1MPL A;  4GN2 A;  3W4P A;  1S67 L;  1ONG A;  4BWI A;  5FQM A;  4BJP A;  2A2L A;  5CTM A;  3EGX C;  3MQ0 A;  3QNB A;  2LB9 A;  4E3K A;  1XJ3 A;  4WEJ A;  4E6X A;  4B4Z A;  3H7W B;  4CLC A;  1P0Z A;  3UPN A;  5L07 A;  1GSX A;  3O88 A;  1FCM A;  4RYE A;  2R78 A;  2Z2L B;  2IA2 A;  1VET A;  4IJG A;  3R7W B;  4ZJ3 A;  5EFW A;  2XA7 M;  4GD6 A;  4ZJ2 A;  1TS0 A;  3BFE A;  4BBU A;  3HRE A;  3VE4 A;  2W3F A;  2VZW A;  5HWT A;  4WEK A;  1P9R A;  2K2N A;  1CF0 A;  4BEN A;  3BEC A;  1X0O A;  1H8Z A;  3DTI A;  3SZT A;  3UPO A;  4QJG A;  5GLA A;  4MNR A;  2Z2M B;  3UPP A;  3MR0 A;  2H10 A;  4E3J A;  3V3S A;  4PM6 A;  1Y28 A;  2G7U A;  5JYO A;  3M2J A;  3N4I A;  4QD4 A;  4EXO A;  3FYZ A;  2INW A;  3ZCZ A;  2HDQ A;  3KYE A;  4UQI S;  1SKO A;  4U0T A;  4P0M A;  2JKR I;  4QU3 A;  2WAF A;  1NYY A;  3IXB A;  2W3D A;  2P7J A;  4HBU A;  3MSH A;  1G5U A;  1YM1 A;  2KX6 A;  4MBK A;  4S2O A;  1OJG A;  4F94 A;  2OAP 1;  1AWI A;  5DVA A;  2EFU A;  1L0D A;  4R4S A;  4LLO B;  1TDG A;  4P6B A;  3LI9 A;  5HSQ A;  4CJN A;  3IWI A;  2H5S A;  3DTE A;  5M18 A;  3NCK A;  3W4Q A;  2J3T C;  4QHC A;  4ARZ A;  4X53 A;  3JVU A;  3OPR A;  1PWD A;  2XRO A;  2VJW A;  3ZYT A;  1I2W A;  5L09 A;  4FH2 A;  3K3D A;  3G4P A;  3UME A;  4O7D A;  4OQ0 A;  3EOI A;  1FR1 A;  3N7W A;  1YKD A;  5HL6 A;  2D02 A;  3OOV A;  1VB6 A;  2HP9 A;  5HPI A;  5IT5 A;  3C38 A;  3FZC A;  1FQG A;  4BL3 A;  3V39 A;  2B18 A;  2IWB A;  4ZBE A;  3ZG0 A;  1G68 A;  5FQQ A;  4K91 A;  1MWS A;  2ZQD A;  4ID4 A;  3UY6 A;  3C2W A;  2IWD A;  4S2N A;  3Q7Z A;  1E3U A;  4L9F A;  4WZ5 A;  3GRJ A;  3ZG5 A;  1FSW A;  5HFO A;  5EVL A;  2O99 A;  3IX8 A;  1K57 A;  2M7V A;  1J3W A;  3ULF A;  3MFD A;  1WE4 A;  3NOP C;  2GNX A;  1F5M A;  2K7S A;  4PKY G;  4PM8 A;  3ITB A;  3NI9 A;  3GDI A;  2RCX A;  3T1Q B;  3D3O A;  3ZNY A;  3OC2 A;  1ACF A;  3C5A A;  5HDD A;  5FSR A;  3UB8 A;  3IH9 A;  3HJK A;  4E3O A;  3V5M A;  3A3D A;  2Z6D A;  4X55 A;  5TJJ A;  4RX2 A;  3T50 A;  3HLE A;  2ZJ9 A;  5MC7 A;  4EQI A;  1OJ5 A;  4ZAM A;  3VOL A;  3ZVT A;  5E2F A;  4GZB A;  2Y55 A;  4P6Z S;  1F9I A;  3S7N A;  5CGX A;  1LSX A;  5FI7 A;  1WYC A;  2PD8 A;  4P85 A;  5J8X A;  2YKF A;  3QP2 A;  2WKP A;  2VV8 A;  3NBL A;  2RL3 A;  2BAS A;  3HCY A;  4HIA A;  4I5S A;  1LHY A;  4DF6 A;  4JGP A;  2VGL S;  1XGI A;  2WKR A;  5FDS A;  4JXV A;  4C75 A;  1K56 A;  4N1H A;  2QKP A;  4WEL A;  3BFC A;  3QP5 A;  3CZD A;  2PT7 A;  1Q2Q A;  4Z9Q A;  2ZC4 B;  4Q0J A;  4OPQ A;  5DKL A;  3IHB A;  1PI5 A;  5CHU A;  4QB8 A;  4EES A;  3QNC A;  1XGJ A;  3SS4 A;  4Y17 A;  4UHU A;  2JKG A;  3H82 B;  2A24 B;  3I7J A;  5DF9 A;  3HLC A;  3VOY A;  4LRX C;  2Y2O A;  5IHV A;  4E3I A;  2Y2H A;  4KZA A;  5FAS A;  3UN7 A;  1MBL A;  4EET B;  3LIF A;  1CQA A;  1G6O A;  1KGF A;  1ODV A;  4S2P A;  5KZH A;  4HBT A;  5HAI A;  3E0Y A;  4IBR A;  3PBO A;  1PI4 A;  2R9W A;  1S1Y A;  1MKI A;  1PW1 A;  4DDY A;  4LV0 A;  2LB5 A;  3LR4 A;  4G3V A;  2JBF A;  4LCM A;  3RH8 B;  5CHJ A;  3NJA A;  3OPH A;  3IS2 B;  4R3A A;  2HV1 A;  4I3I A;  4HJ6 A;  2Y2J A;  4DMZ A;  5GLD A;  1XKZ A;  2P08 A;  3T4Q A;  2PYR A;  1BZA A;  4H6J B;  3CPT B;  1S0W A;  2ZQ9 A;  4E3L A;  2BTF P;  5DFX A;  3BLM A;  1EWZ A;  3GR2 A;  1OTA A;  3N6I A;  1PW8 A;  4U0X A;  4IBX A;  2P9V B;  1V9Y A;  1D1J A;  5EM1 A;  1ES5 A;  5E43 A;  1H8M A;  4X68 A;  3GMW A;  3NOU C;  5HZH A;  4XUX A;  1ZTU A;  1K4E A;  2ZC5 B;  3EEA A;  4DXC A;  4EWF A;  1ERO A;  4R1G A;  4Y7P A;  3JVV A;  1KE4 A;  1UWN X;  3GQZ A;  2ZD8 A;  1D7E A;  2OWH A;  1WA9 A;  1MWR A;  2JKT M;  3P98 A;  3VSK A;  4E3N A;  1ES4 A;  4QY5 A;  5CHM A;  2V1A A;  2XGN A;  4JF5 A;  3Q7V B;  4LEN A;  3NY4 A;  1XXM A;  1IEM A;  1IKG A;  1TEM A;  3UE0 A;  5CXW A;  1TD5 A;  3EEH A;  2HGV A;  3C30 A;  4YFM A;  5E2H A;  5IS1 A;  2V1Z A;  1JWZ A;  2XSS A;  4B4X A;  3MKE A;  1HZO A;  3PYP A;  2EFX A;  2Q9N A;  1Y4O A;  4JF4 A;  4JXS A;  2KLI A;  3MJQ A;  2ZQA A;  3RXW A;  5DFY A;  3L7H A;  1CI9 A;  2BG1 A;  4QWO A;  1K56 D;  5CEB A;  4N1X A;  4OP5 A;  1H0M A;  4MMN A;  4RVA A;  2L4R A;  3G32 A;  4OPR A;  3D4F A;  2XA7 S;  3FG8 A;  3D72 A;  4BBV A;  4JBF A;  5F68 A;  1N9L A;  4HJ4 A;  1W7F A;  1RGY A;  4MBH A;  2HF6 A;  4O8G A;  5TGF A;  1SZV A;  1QMF A;  1GHI A;  1K38 A;  1K54 A;  4I3J A;  3A3E A;  2Y2Q A;  1FIL A;  4R70 A;  1PIO A;  4KZ7 A;  2Y4A A;  3K2N A;  2QZ6 A;  5F5Y A;  3QP8 A;  2I72 A;  3G34 A;  4UA9 A;  3BWL A;  2O9B A;  1J9M A;  2V0U A;  3CIT A;  1ESI A;  3KSF A;  4L9G A;  3UDF A;  4MDZ A;  1N9O A;  5EUA A;  3O86 A;  5CEC A;  1NXY A;  5HAQ A;  2PBD P;  2G2W A;  1FCN A;  5CRF A;  4ZTK A;  1VHM A;  3UB6 A;  4M3K A;  1DP6 A;  1KE3 A;  4JPM A;  2XD5 A;  4GS9 A;  3P7N A;  3E4P A;  4Z1W A;  2XLN A;  4XUZ A;  2EXB A;  3MXR A;  3OCN A;  1LL8 A;  2ZMA A;  4GD8 A;  1BUL A;  2WKE A;  4R6L A;  1NRJ A;  1YLT A;  1F98 A;  3U4L P;  4EEP A;  4S2L A;  4EBP A;  2OOL A;  2VGJ A;  2W0N A;  4KZ5 A;  5J7E A;  2OSU A;  1CEF A;  3B33 A;  4HHD A;  4Q0H A;  2B95 A;  3LID A;  4AFI A;  4JLF A;  5CER A;  3ZDJ A;  3N8R A;  2KOI A;  5IU1 A;  2VV7 A;  5G4Z A;  1HLU P;  5KSC A;  2WUQ A;  2L0W A;  1DP9 A;  4FTX A;  3UB7 A;  1ONH A;  5FAO A;  5BOH A;  3LR0 A;  5A8B A;  4G3W A;  5I94 A;  3HLF A;  2ZMF A;  4GB7 A;  3O87 A;  3S4X A;  3ITA A;  3A3J A;  1IOU A;  1K54 C;  3CUE A;  3LIC A;  4LV3 A;  1LI0 A;  3FV7 A;  1Z09 A;  5FI6 A;  3WRZ A;  4PAU A;  1OPX A;  5EEC A;  3SH8 A;  3N8S A;  5G4Y A;  1YPR A;  1CK3 A;  3MQO A;  3A3I A;  1KVL A;  3HUM A;  2DMW A;  1S4R A;  5GL9 A;  5FDH A;  4GNU A;  1JWV A;  3BY9 A;  3S7O A;  3OLO A;  1GSV A;  3TW8 A;  1NLY A;  3VP3 A;  2ZOI A;  5HX9 A;  5FQJ A;  5K5B A;  1XP4 A;  3IF5 A;  1YLZ A;  3Q1F A;  3VV4 A;  5L10 A;  4NXE A;  2VK3 A;  5HAR A;  2Y59 A;  2V9A A;  2ZBB A;  5HAP A;  3LEZ A;  3KSI A;  3MZF A;  1Q2P A;  3B3X A;  3F1O A;  4BMW A;  5EVE A;  3C4O A;  3T4T A;  3LFV A;  1K0K A;  4S2M A;  4ESP A;  5EVI B;  2Y79 A;  3QHY A;  3Q7V A;  3BLS A;  5F1F A;  3KX0 X;  5F83 A;  3ZGA B;  5TR7 A;  3T1X A;  4HH3 A;  5CGS A;  2W1T B;  3F1P B;  2PRF A;  1PNE A;  4HP4 A;  1S6R A;  2JC7 A;  3F1N A;  3CUE C;  3IF6 B;  2Q9M A;  3IBR A;  1SDN A;  2A49 A;  1RGZ A;  3SS5 A;  4JGR A;  1JVJ A;  2Y8H A;  3UDX A;  3AGD A;  3IXG A;  3E4O A;  4G3K A;  4EUZ A;  2WYX A;  1JTG A;  4EBN A;  1GA0 A;  2X01 A;  4BL2 A;  1S4S A;  3KSG A;  2VX8 A;  4GHI A;  2JKT I;  3LI8 A;  5GLB A;  3TE8 A;  4L9E A;  4JKT A;  1H8Y A;  1BSG A;  4PM7 A;  4KZ4 A;  4GW9 A;  3PTE A;  5HWV A;  2ZL1 A;  2HZ5 A;  2E8I A;  3W2Z A;  4K0W A;  4KQO A;  1N9B A;  4WMC A;  2W3H A;  5CGW A;  2HJE A;  2XR0 A;  4KZB A;  5J3W A;  4GDN A;  4OVD A;  3ZFZ A;  2OAQ 1;  4E04 A;  2C6W B;  3C7V A;  5HW3 A;  5M1A A;  3UDI A;  3JPU A;  1ZC2 A;  3UNW A;  2G2U A;  2FFF B;  2QHK A;  2WAE A;  4WBG A;  5FAP A;  2XEP A;  2W3G A;  2HPB A;  3IBJ A;  3CJM A;  3N8L A;  3MMH A;  4M4X A;  2JKF A;  5DJU A;  2V1B A;  2J7V A;  4B9O A;  3G6O A;  3HLG A;  3W4O A;  5KSH A;  2JHE A;  4ZRR A;  1TS8 A;  4HES A;  1KVM A;  3H7W A;  4N9L A;  3MXS A;  5GLC A;  1HTZ A;  3T4J A;  1HD8 A;  1P97 A;  4DKI A;  3RXX A;  3MF0 A;  3IH8 A;  4DRT A;  3BQ8 A;  2AVX A;  3R7W A;  2NUP C;  2HDS A;  3O5Y A;  3SH9 A;  3H9W A;  5JYP A;  1OTB A;  4NK3 A;  3HVF A;  4MCW A;  4HJ3 A;  2HDR A;  5FI2 A;  2GDN A;  1OTI A;  3PBR A;  2CMN A;  2W27 A;  3LCE A;  1M6K A;  3MFX A;  1IYO A;  5C5K A;  5HDC A;  1XFN A;  4WUJ A;  1ES2 A;  2XD1 A;  2VLG A;  3HUO A;  1NY0 A;  4YIN A;  5KMW A;  3TJZ C;  2CC1 A;  3CMZ A;  4O01 A;  3PBT A;  2O9C A;  3QP6 A;  5DF7 A;  4LRZ E;  3IWQ A;  1FCO A;  4OOY A;  3NDG A;  2A3U A;  5DTK A;  4CLC B; 
#chains in the Genus database with same CATH homology
 4N1X A;  1PWC A;  4OP5 A;  4BEN A;  2WKH A;  3WS4 A;  3BEC A;  4RVA A;  1FSY A;  1H8Z A;  3G32 A;  3WS5 A;  4OPR A;  4QJG A;  3UPO A;  2XK1 A;  3D4F A;  5GLA A;  2PBY A;  4UAA A;  1DJB A;  4MNR A;  2Z2M B;  5TFQ A;  3SOI A;  3UPP A;  1IYQ A;  1BUE A;  4JBF A;  1MWT A;  2H10 A;  3VP2 A;  4E3J A;  3V3S A;  4PM6 A;  1BTL A;  2ZM2 A;  1W7F A;  5JYO A;  1RGY A;  4MBH A;  3M2J A;  3N4I A;  4QD4 A;  3FYZ A;  5TGF A;  1QMF A;  1GHI A;  4JXW A;  2EXA A;  2HDQ A;  3PAE A;  3ZCZ A;  4X6T A;  3FWL A;  4U0T A;  4P0M A;  4QU3 A;  2Y2I A;  1K38 A;  1NYY A;  2WAF A;  3IXB A;  1Y54 A;  3VP0 A;  1ERQ A;  4HBU A;  1K54 A;  1AXB A;  3A3E A;  2J8Y A;  1ALQ A;  3M6H A;  1LLB A;  1YM1 A;  2Y2Q A;  4MBK A;  2EX6 A;  1PIO A;  4KZ7 A;  5FAT A;  1PZP A;  1ZG4 A;  2V20 A;  2Y4A A;  3O3V A;  4S2O A;  5CEB A;  2QZ6 A;  5FA7 A;  4F94 A;  2I72 A;  3BRM A;  3G34 A;  4E3M A;  5CED A;  2WGW A;  5DVA A;  2EFU A;  1L0D A;  4R4S A;  1L0E A;  4UA9 A;  1J9M A;  3UDF A;  1ESI A;  1SKF A;  4KG6 A;  2H0T A;  5G18 A;  1TDG A;  4P6B A;  5EUA A;  2Y2N A;  3O86 A;  5CEC A;  1ESU A;  1NXY A;  3PAG A;  4R23 A;  4CJN A;  5HAQ A;  3IWI A;  2H5S A;  2G2W A;  1FCN A;  5M18 A;  3NCK A;  5CRF A;  3W4Q A;  4DE1 A;  4BQM A;  4QHC A;  1LL5 A;  4X53 A;  2XFT A;  4PM5 A;  4ZTK A;  1OME A;  2WK0 A;  2ZQ8 A;  4M3K A;  2OLV A;  1KE3 A;  4JPM A;  2XD5 A;  3OPR A;  1PWD A;  3OCL A;  3VFH A;  3IF6 A;  4JF6 A;  4HEF A;  3IWO A;  5EOO A;  3CG5 A;  1I2W A;  4WMC D;  4XXR A;  5AQ9 A;  2XLN A;  4XUZ A;  4C6Y A;  2EXB A;  2Y2M A;  3MXR A;  3OCN A;  5FQ9 A;  4FH2 A;  4Y0O A;  3OPP A;  1TDL A;  3G4P A;  2ZMA A;  2ZLY A;  3Q81 A;  4GD8 A;  1BUL A;  2WKE A;  4RX3 A;  5F82 A;  3VMA A;  4O7D A;  5A92 A;  1YLT A;  4KZ9 A;  4DE2 A;  4S2L A;  4EBP A;  4LCL A;  1L2S A;  1NJ4 A;  1NYM A;  2XF3 A;  3IHA A;  4OQ0 A;  5A93 A;  5HL1 A;  2PU2 A;  3IXH A;  3ZG7 B;  4UA6 A;  1FR1 A;  2VGJ A;  3N7W A;  2EX9 A;  4Y0U A;  4KZ5 A;  4S2N C;  1KDW A;  2OSU A;  3GVB A;  5EE8 A;  1CEF A;  4WZ5 C;  2HP9 A;  2WGV A;  1I2S A;  1YMX A;  4JLF A;  3FZC A;  5CER A;  3VFF A;  3ZDJ A;  4OQH A;  3N8R A;  1FQG A;  4BL3 A;  5AQB A;  3V39 A;  4S2K A;  5KSC A;  2IWB A;  4ZBE A;  2WUQ A;  2JCH A;  1K57 C;  3ZG0 A;  1G68 A;  1ONH A;  5FQQ A;  2Y2L A;  4K91 A;  5FAO A;  5BOH A;  1K55 C;  1MWS A;  1XA7 A;  2ZQ7 A;  2FFY A;  5DTS A;  5I94 A;  1NZU A;  2ZQD A;  4ID4 A;  3UY6 A;  4DDS A;  4OPZ A;  4EV4 A;  1XX2 A;  1W79 A;  2IWD A;  3DTM A;  3HLF A;  4GB7 A;  4S2N A;  1K25 A;  3O87 A;  3Q7Z A;  3S4X A;  3IQA A;  3ITA A;  4GOG A;  1E3U A;  3A3J A;  1K54 C;  4WZ5 A;  5EOE A;  1RCJ A;  3DWZ A;  3VP4 A;  2QPN A;  3GRJ A;  3ZG5 A;  2ZQC A;  1O7E A;  4OP8 A;  1RP5 A;  4LV3 A;  1Z6F A;  1FSW A;  1LI0 A;  1LI9 A;  3FV7 A;  5FI6 A;  4MLL A;  5EVI C;  3VP1 A;  4ZDX A;  4S2J A;  1GA9 A;  1K4F A;  4MEZ A;  5EVL A;  5HFO A;  3WRZ A;  4KZ8 A;  5EEC A;  3SH8 A;  3N8S A;  3TSG A;  2XH9 A;  3MZE A;  4DE0 A;  1CK3 A;  2HP6 A;  1K6R A;  1DJA A;  1K57 A;  3WS2 A;  1IYP A;  2HP5 A;  3A3I A;  4GKU A;  2JE5 A;  1K55 A;  3TG9 A;  3MKF A;  1JWP A;  1KVL A;  3HUM A;  3MFD A;  3BFG A;  5GL9 A;  5FDH A;  4GNU A;  1JWV A;  4IVK A;  1WE4 A;  3PBN A;  2X71 A;  3AGE A;  5EPH A;  3C4P A;  4R4R A;  1YLW A;  3ZNT A;  4OLG A;  3HUN A;  4PM8 A;  1IYS A;  3VP3 A;  3ITB A;  3NI9 A;  3IF6 C;  5HX9 A;  2UWX A;  4DXB A;  5FQK A;  3IXD A;  1BLH A;  1YLJ A;  2RCX A;  3G35 A;  5FQJ A;  3ZNY A;  3OC2 A;  4WYY A;  3MZD A;  5F1G A;  2PU4 A;  1FR6 A;  2VGK A;  4S2I A;  5E2E A;  3C5A A;  5EVI A;  1XP4 A;  3LY3 A;  3IF5 A;  1YLZ A;  3Q1F A;  5FSR A;  5GHX A;  3IH9 A;  2ZC6 B;  4WM9 A;  4LV1 A;  2P74 A;  5AQA A;  1XPB A;  4E3O A;  3V5M A;  2DCF A;  4X56 A;  2WKI A;  1SCW A;  1W5D A;  1MXO A;  3A3D A;  2Y59 A;  1IKI A;  4X55 A;  5HAR A;  4RX2 A;  1E3U D;  2ZM0 A;  5HAP A;  4R3B A;  1VQQ A;  4KG2 A;  3HLE A;  3LEZ A;  2ZJ9 A;  4EQI A;  2EX2 A;  4ZAM A;  3ZHH A;  3MZF A;  3ZVT A;  1Q2P A;  3BM6 A;  4R0Q A;  3B3X A;  3FKV A;  1YMS A;  5E2F A;  4GZB A;  2Y55 A;  3HL9 A;  4EBL A;  1ZG6 A;  5CGX A;  4FH4 A;  3WWX A;  3C4O A;  2ZC7 A;  1WYC A;  4OQI A;  5FI7 A;  4R3J A;  4P85 A;  2X02 A;  4S2M A;  3HLW A;  5J8X A;  5EVI B;  2XFS A;  3QHY A;  5D3O A;  3Q7V A;  4OPY A;  3BLS A;  2WGW B;  5F1F A;  2J9O A;  3DWK A;  4KZ3 A;  3VOZ A;  3NBL A;  5F83 A;  3Q82 A;  2RL3 A;  3ZGA B;  5TR7 A;  3S1Y A;  5CGS A;  1WYB A;  1LHY A;  4DF6 A;  4BLM A;  3E2L A;  1L0F A;  1KGE A;  1XGI A;  3TOI A;  1S6R A;  3G30 A;  1TVF A;  2JC7 A;  4JXV A;  4H8R A;  3V50 A;  3SH7 A;  4PM9 A;  4C75 A;  1SHV A;  1PYY A;  1K56 A;  2ZC3 B;  4OLD A;  2H0Y A;  5EVI D;  3S22 A;  3WS1 A;  4RA7 A;  3IF6 B;  2Q9M A;  1ZKJ A;  4KQR A;  4N1H A;  4OH0 A;  3G31 A;  1DY6 A;  4WEL A;  2ZM8 A;  1I5Q A;  3OZH A;  3BFC A;  1YLY A;  1H5X A;  2OV5 A;  1SDN A;  3BEB A;  2A49 A;  3V3R A;  4KZ6 A;  1RGZ A;  1E4D A;  2BLS A;  3CZD A;  3SS5 A;  1Q2Q A;  3HBR A;  1GCE A;  4Z9Q A;  4FD8 A;  2ZC4 B;  1JVJ A;  3IT9 A;  3Q07 A;  3RJU A;  4FCF A;  5A90 A;  4B88 A;  3UDX A;  3AGD A;  3IXG A;  4OPQ A;  1GHM A;  3NDE A;  3OPL A;  3IHB A;  1PI5 A;  4EUZ A;  2WYX A;  1JTG A;  4PMA A;  3M2K A;  2Y2K A;  5CHU A;  3LY4 A;  1BT5 A;  1W8Y A;  4QB8 A;  3QNC A;  1XGJ A;  3MBZ A;  3SS4 A;  4UHU A;  4EBN A;  1GA0 A;  4U3T A;  2X01 A;  4BL2 A;  3I7J A;  5DF9 A;  3HLC A;  1ERM A;  3VOY A;  3EQU A;  4FSF A;  2Y2O A;  3BFF A;  1QME A;  4MBF A;  5IHV A;  4E3I A;  1EI5 A;  2Y2H A;  4KZA A;  5FAS A;  3UN7 A;  1MBL A;  1BLP A;  4OOL A;  5GLB A;  2WZZ A;  3PBQ A;  4OON A;  1C3B A;  4JKT A;  1KGF A;  1H8Y A;  3GSG A;  1NRF A;  4S2P A;  5KZH A;  1BSG A;  3DW0 A;  4HBT A;  4PM7 A;  4NET A;  5HAI A;  4KZ4 A;  2Y91 A;  3A3F A;  3M6B A;  3PTE A;  4IBR A;  4N9K A;  4P87 A;  4D2O A;  3UO9 A;  1CEG A;  3PBO A;  1BLS A;  4Y0T A;  1PI4 A;  5E2G A;  2E8I A;  5GHZ A;  2R9W A;  1BLC A;  3ZG8 B;  1L0G A;  3GTC A;  1MKI A;  3ISG A;  4ZJ1 A;  1PW1 A;  3WS0 A;  4DDY A;  4LV0 A;  1SDE A;  4K0W A;  4KQO A;  1KDS A;  1N9B A;  3C7U A;  3HLD A;  2JBF A;  1HVB A;  4LCM A;  2C5W B;  4WMC A;  5A91 A;  4GDB A;  5CGW A;  1MY8 A;  2XR0 A;  4Q8I A;  3JYI A;  4KZB A;  5CHJ A;  5GHY A;  5DTK A;  4GDN A;  2P9V A;  4OVD A;  1DJC A;  2HDU A;  3OPH A;  3ZFZ A;  1XA1 A;  4KQQ A;  2DNS A;  2C6W B;  2J9P A;  3C7V A;  2Y2J A;  3G2Y A;  5DF8 A;  4IED A;  4JXG A;  5HW3 A;  4IVI A;  5M1A A;  3UDI A;  1FOF A;  1GHP A;  1XKZ A;  5GLD A;  1LL9 A;  3AGF A;  1BZA A;  4E6W A;  1ZC2 A;  3UNW A;  4K0X A;  1S0W A;  2ZQ9 A;  5FAQ A;  1U60 A;  2FFF B;  2G2U A;  2WZX A;  4E3L A;  4WBG A;  1E25 A;  2WAE A;  3LO7 A;  5FAP A;  2XEP A;  4DE3 A;  3BLM A;  1EWZ A;  4CPK A;  3GR2 A;  1ES3 A;  3VSL A;  3N6I A;  1CI8 A;  2R9X A;  1PW8 A;  2HPB A;  4OQG A;  1PWG A;  3CJM A;  2WGI A;  3N8L A;  3P09 A;  4U0X A;  4BD1 A;  4IBX A;  2P9V B;  1N4O A;  1YLP A;  1KGG A;  4PPR A;  5L2F A;  3FKW A;  1ES5 A;  2B5R A;  4C3Q A;  2XQZ A;  4X68 A;  1W8Q A;  5E43 A;  2J7V A;  1KE0 A;  3GMW A;  1M40 A;  3HLG A;  3W4O A;  5KSH A;  4OOM A;  4XUX A;  4HES A;  3SS3 A;  1KVM A;  1K4E A;  2Y2G A;  2ZC5 B;  5CTN A;  4DXC A;  4N9L A;  5FQI A;  2EX8 A;  1ERO A;  4R1G A;  1G6A A;  3E2K A;  3MXS A;  4Y7P A;  4EWF A;  5GLC A;  3ZVW A;  2XDM A;  1KE4 A;  1YT4 A;  3GQZ A;  2OLU A;  2ZD8 A;  3PBS A;  5U47 A;  3UE3 A;  1NZO A;  1MPL A;  1HTZ A;  4L0L A;  1MWR A;  1HD8 A;  1VM1 A;  3P98 A;  3NIA A;  4DKI A;  3VSK A;  4E3N A;  4GN2 A;  4OKP A;  3RXX A;  3BYD A;  1ES4 A;  4QY5 A;  3IH8 A;  3W4P A;  4DRT A;  1K6S A;  5CHM A;  5M19 A;  1ONG A;  4BD0 A;  2XGN A;  1IEL A;  5FQM A;  4JF5 A;  5DTT A;  4BJP A;  3GV9 A;  2HDS A;  2WAD A;  3Q7V B;  4KG5 A;  4LEN A;  3NY4 A;  1PZO A;  3SH9 A;  3W8K A;  5JYP A;  1XXM A;  5CTM A;  1IEM A;  1IKG A;  1TEM A;  3HVF A;  3QNB A;  4NK3 A;  4E3K A;  3NC8 A;  3UE0 A;  2HDR A;  5FI2 A;  3WRT A;  5CXW A;  1O07 A;  2GDN A;  4YFM A;  5AQ7 A;  3PBR A;  4WEJ A;  5E2H A;  4A5R A;  4E6X A;  4B4Z A;  3LCE A;  4UA7 A;  1M6K A;  3HLB A;  3UPN A;  3UE1 A;  2QMI A;  1IYO A;  2V1Z A;  3O88 A;  2IWC A;  1FCM A;  1JWZ A;  4RYE A;  1ES2 A;  2Y2P A;  4B4X A;  1MWU A;  2XD1 A;  2Z2L B;  3MKE A;  3ZG9 B;  1HZO A;  3HUO A;  2EFX A;  1NY0 A;  2Q9N A;  4YIN A;  3G2Z A;  4JF4 A;  5KMW A;  4WZ4 A;  4JXS A;  4ZJ3 A;  2CC1 A;  3BFD A;  3CMZ A;  2DRW A;  3PBT A;  4GD6 A;  4ZJ2 A;  5DF7 A;  3EQV A;  3BFE A;  2ZQA A;  1FCO A;  3IWQ A;  3RXW A;  4OOY A;  3HRE A;  2V2F F;  1CI9 A;  1YQS A;  3NDG A;  4KEN B;  2A3U A;  2BG1 A;  4X69 A;  4QY6 A;  4N92 A;  4WEK A;  4LV2 A;  1JTD A;  1K56 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...