1U60A

Mcsg apc5046 probable glutaminase ybas
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
309
structure length
309
Chain Sequence
b'LDANKLQQAVDQAYTQFHSLNGGQNADYIPFLANVPGQLAAVAIVTCDGNVYSAGDSDYRFALESISKVCTLALALEDVGPQAVQDKIGADPTGLPFNSVIALELHGGKPLSPLVNAGAIATTSLINAENVEQRWQRILHIQQQLAGEQVALSDEVNQSEQTTNFHNRAIAWLLYSAGYLYCDAMEACDVYTRQCSTLLNTIELATLGATLAAGGVNPLTHKRVLQADNVPYILAEMMMEGLYGRSGDWAYRVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDEDGNSVRGQKMVASVAKQLGYNVFKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable glutaminase ybaS
publication title Functional and structural characterization of four glutaminases from Escherichia coli and Bacillus subtilis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 111
structure length 309
sequence length 309
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.2: Glutaminase.
pdb deposition date 2004-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04960 Glutaminase Glutaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1u60A00
1K4FA 4Y0TA 3JYIA 4S2OA 4CPKA 4DE0A 2G2WA 2XLNA 4QY5A 5EOEA 1W79A 2FFFB 3G34A 3TSGA 5GLDA 1K55C 1SCWA 4MEZA 4S2NA 1IYQA 4QY6A 4FCFA 4R0QA 4BL2A 4OPRA 2HP5A 1LLBA 2EX6A 3MKFA 3PBOA 2P9VA 3BFDA 1DJCA 2P9VB 1BLSA 3FZCA 3ISGA 4EBNA 4OPZA 1I2SA 4X68A 4YINA 4LV1A 5HAQA 5DTSA 2Y2LA 3HREA 2WGIA 5EVIC 1BT5A 4BENA 1RCJA 5A92A 3PBSA 4ZBEA 1EWZA 1W8YA 2WKHA 1GA0A 1MY8A 1XA7A 4E3IA 1K6RA 5FQIA 3ZG8B 3A3IA 4OOYA 3W4OA 5M19A 1YLTA 2H10A 4S2LA 4DXCA 1XXMA 1IKIA 3HLEA 4N9KA 2WK0A 1K25A 4OPQA 2DRWA 1PI4A 4ID4A 1IYPA 2J9OA 1CEFA 3N8RA 1W7FA 1BSGA 2DNSA 1XKZA 1EROA 3OPRA 4E3KA 1ES4A 2A3UA 3UE1A 2Y2NA 4GD8A 4KG2A 4R23A 2EX9A 2H0YA 3M2KA 3VSLA 5KSHA 4HBUA 4JXGA 5CEDA 4K0WA 1MBLA 4DDYA 3ZG0A 3NDEA 2RCXA 3N4IA 3HLCA 1H8ZA 1K4EA 5EPHA 3W4QA 4Q8IA 1LI0A 1XGIA 1BUEA 1NRFA 2FFYA 4JKTA 5CHMA 3V50A 4EV4A 3NI9A 4MLLA 3DWKA 3SH9A 3OPPA 4KG6A 3OC2A 3ZVWA 3ZHHA 2CC1A 2XD1A 5AQ9A 3O88A 3AGDA 3IXBA 1E25A 5FAOA 3V39A 4F94A 3ITAA 3G4PA 2ZM2A 3IQAA 3MBZA 4JLFA 5HFOA 3O86A 2PU2A 3QNCA 3MZFA 4FSFA 4PM8A 5FASA 4QHCA 2EXAA 4EWFA 1BZAA 3E2LA 3BM6A 1ESUA 1VQQA 3IHBA 3VOZA 2V20A 4OQIA 1LL5A 4WMCA 5D3OA 5A91A 1S6RA 4GOGA 4DE1A 2XDMA 4LV2A 3SS5A 3O87A 4K91A 1HD8A 4JPMA 5EOOA 3OPLA 5FATA 3CJMA 4JXWA 5CTNA 1PZOA 3PBNA 4UA6A 5CHJA 4JXVA 4ZJ3A 4DE3A 2ZLYA 1NXYA 2E8IA 4OOLA 3A3DA 3ZDJA 4ZJ2A 4U0XA 4HBTA 2XF3A 3E2KA 4R4RA 4RX2A 5DVAA 5EVIA 3UE0A 3ZG5A 4EBLA 5EVIB 1QMFA 1BLPA 4RVAA 3AGEA 4OOMA 3VP1A 1KGGA 1L0GA 4WYYA 3M6HA 3WS0A 3PAGA 4BQMA 5CECA 1C3BA 1ESIA 2ZQ7A 4EBPA 4Z9QA 1MWTA 2VGJA 3GV9A 1TDGA 3SS3A 2ZC7A 1WYCA 4R1GA 5AQ7A 5M1AA 1Q2PA 1YLPA 3C5AA 4U3TA 1K56D 3Q82A 1LL9A 4GDNA 1JTGA 3FV7A 3LCEA 1NJ4A 2Z2MB 4KZ5A 1GHIA 2HDRA 3NCKA 1FR1A 1TDLA 1ONGA 3QHYA 1JWZA 1YLWA 2Q9NA 4MBHA 3FKVA 3FYZA 1IYSA 1N9BA 1NYYA 2JE5A 4WZ5C 1PIOA 5F1GA 3VFFA 3CMZA 2WGVA 4LENA 2R9XA 1I2WA 4XUXA 5FQ9A 3ZG7B 4EQIA 3VMAA 3NY4A 4MBKA 2OSUA 2WKIA 3HLFA 3GR2A 1M40A 4IEDA 2GDNA 2HPBA 4FH4A 4GN2A 1W8QA 5BOHA 2C5WB 3HLDA 4S2MA 4R3JA 1MWRA 3ZVTA 3BLMA 2OV5A 4KZAA 2H0TA 2Y59A 4P6BA 5F83A 3V3RA 3WS1A 3VP2A 5KMWA 2XK1A 3S4XA 5HAPA 3PBQA 2EX8A 3DWZA 1CK3A 3G2YA 4QB8A 5L2FA 1BLHA 3VP3A 5CHUA 5DF8A 4UA7A 4A5RA 3IF5A 1MWSA 4GKUA 3RXWA 1RP5A 3PBRA 4RX3A 1JWPA 4E3LA 5J8XA 4IVIA 3VSKA 3IXDA 2QZ6A 3TG9A 3C7UA 4XXRA 1XPBA 4QD4A 4B4ZA 1PWGA 2J8YA 1IELA 1KE0A 1MPLA 2HDUA 5M18A 2ZM8A 2EFUA 1J9MA 4DE2A 4BD0A 1WE4A 1KGFA 3G32A 3G35A 2JBFA 2VGKA 3HVFA 1KE4A 1SKFA 2ZQDA 4K0XA 4N9LA 3IF6C 4GDBA 3WS2A 3G31A 4BJPA 1NY0A 4X55A 1G68A 4DF6A 1YLJA 1Y54A 3UPPA 4PM5A 4Y0UA 3ZNYA 1JWVA 3P98A 5GLAA 3VOYA 5DF9A 4S2JA 1I5QA 4R3BA 2Y2OA 4Y0OA 5CGXA 3HUNA 3G30A 5EE8A 3BEBA 3V5MA 1L0DA 2ZD8A 4B88A 1E3UD 3GMWA 1MXOA 2ZQ8A 4CJNA 2XFSA 1O07A 2WZZA 5GHYA 4Y7PA 1FQGA 2P74A 2WGWA 1S0WA 2XR0A 2Y91A 3IHAA 3IH8A 2WGWB 3GVBA 3HBRA 3IT9A 1E4DA 5HARA 1IYOA 5TFQA 2WUQA 1ERQA 3SH8A 3G2ZA 2I72A 2DCFA 4PM6A 5HL1A 3S22A 4JF4A 2ZQAA 4LCMA 4X6TA 3HLWA 3Q1FA 4MNRA 2BG1A 1DJBA 3VFHA 5CTMA 5FA7A 5FQKA 5HW3A 2X01A 1GHPA 3RXXA 1LHYA 4JF6A 1K55A 1KGEA 1ERMA 3IXHA 5FAPA 3OZHA 1FCNA 4NETA 1HVBA 4ZAMA 2XEPA 4MBFA 4XUZA 5E2HA 3GQZA 5JYPA 3IWOA 2R9WA 3ITBA 1ES5A 1YQSA 3HUMA 1PYYA 1JVJA 5GLBA 3ZCZA 3OCLA 2RL3A 4P85A 4LV0A 4BD1A 1PWCA 1KDWA 5CERA 4UHUA 2QPNA 1ZKJA 3C4OA 1JTDA 4E3MA 1Q2QA 5GL9A 4KZ6A 3W4PA 1L0EA 1H5XA 2XH9A 3M6BA 3Q7VA 1BLCA 3BFGA 3Q7VB 4D2OA 2A49A 5FQJA 1BULA 2ZQ9A 5EUAA 5FAQA 1O7EA 5GHXA 3VP4A 5CGWA 3UNWA 1IEMA 2X02A 4WM9A 4OONA 5AQBA 2Y4AA 2JCHA 5DTKA 3IF6A 5FQQA 2ZMAA 1HTZA 2V2FF 3IF6B 4P87A 1CI8A 1CI9A 3N8LA 5FQMA 1XP4A 3WWXA 1PW8A 5KZHA 4ZTKA 3UPNA 1YM1A 3OCNA 2C6WB 4PMAA 5F1FA 3MKEA 1FR6A 3NIAA 3I7JA 1Z6FA 5FSRA 1TVFA 1XX2A 2WYXA 3WRZA 2XGNA 1G6AA 1XGJA 4C75A 1FCMA 2ZQCA 4KZ8A 1W5DA 2XD5A 4OLGA 4WZ4A 3N6IA 4GD6A 5G18A 5HX9A 4S2IA 2Y2QA 1K56A 1YMXA 4JF5A 1K6SA 4EUZA 1M6KA 2HDQA 3C4PA 1CEGA 3ZGAB 4FH2A 1K38A 4O7DA 4E6XA 3BFEA 1EI5A 1PZPA 4S2KA 1FCOA 2V1ZA 2WAEA 2B5RA 3GRJA 4KQQA 1MKIA 3NC8A 1ZG6A 3MXRA 3MZEA 3N7WA 4WBGA 3VP0A 4GNUA 4DXBA 5FDHA 5I94A 4WELA 5GLCA 3BECA 2Y2KA 3MZDA 4IVKA 3ZG9B 2Y55A 4OQGA 3ZFZA 4E3OA 5AQAA 4KENB 1RGZA 5E2FA 3SH7A 1GCEA 2Y2HA 4HESA 5DF7A 5A93A 3MFDA 3C7VA 4KZ4A 5IHVA 4L0LA 1WYBA 2PU4A 1QMEA 1XA1A 5JYOA 4C6YA 1FSYA 1ZG4A 3B3XA 5KSCA 3DW0A 2G2UA 3QNBA 3LEZA 4X56A 3Q81A 1ONHA 1PWDA 2HP6A 5GHZA 3PBTA 4DDSA 3PAEA 1SDNA 4PM9A 1ES3A 2EFXA 1YLYA 3BLSA 1ALQA 1K54C 1TEMA 5CRFA 5E43A 3LY4A 5EVLA 2WAFA 3ZNTA 3Q07A 2EX2A 4GB7A 3M2JA 4N1HA 4KQRA 4QU3A 1KVMA 2OLVA 2OLUA 1MWUA 2J7VA 5CXWA 3WS4A 2UWXA 4NK3A 2Z2LB 4RA7A 3UE3A 4E3NA 3HLBA 4JBFA 3HUOA 3V3SA 4PPRA 3FWLA 1AXBA 3UY6A 1GHMA 2J9PA 3LY3A 4HEFA 3UPOA 3O3VA 5FI6A 4DKIA 1PW1A 4WZ5A 1N4OA 1E3UA 4DRTA 1IKGA 2IWDA 4UA9A 4R4SA 3D4FA 4X69A 4UAAA 3IH9A 2HP9A 4IBRA 1K57C 3W8KA 5E2EA 4LCLA 4E3JA 3GTCA 3DTMA 4OKPA 3AGFA 4KQOA 2HDSA 3BYDA 3TOIA 4QJGA 3N8SA 4B4XA 1KE3A 3A3EA 3NBLA 2Y2PA 4KG5A 4P0MA 2ZC4B 2ZC6B 3RJUA 1U60A 2WZXA 5F82A 1NZOA 4OQ0A 1ES2A 4WMCD 5FI2A 4S2NC 2ZC5B 3CZDA 4BLMA 2QMIA 4OPYA 3SS4A 3A3JA 2H5SA 5TR7A 4KZ3A 2XFTA 5FI7A 4N92A 4GZBA 4WEJA 3WRTA 2ZJ9A 4ZDXA 1YT4A 2BLSA 1FOFA 5TGFA 5EVID 3A3FA 2XQZA 4H8RA 3BFFA 3HLGA 4RYEA 1L2SA 3BRMA 3IXGA 5DTTA 1SHVA 4LV3A 1SDEA 1DY6A 2X71A 2Y2MA 3UDFA 3PTEA 2ZC3B 1K54A 2IWCA 3UDXA 1YMSA 3OPHA 3UO9A 1YLZA 1FSWA 5HAIA 5CEBA 4JXSA 3GSGA 3P09A 4OH0A 4ZJ1A 2Y2GA 5CGSA 2PBYA 2WKEA 4PM7A 4KZ7A 3NDGA 4OP8A 1OMEA 4N1XA 4U0TA 3Q7ZA 4IBXA 2JC7A 4BL3A 1NYMA 5EECA 4WEKA 4KZ9A 3S1YA 1H8YA 1DJAA 2Y2IA 3BFCA 4OP5A 2IWBA 3IWQA 1HZOA 4OVDA 4C3QA 3EQUA 3SOIA 1LI9A 3IWIA 5A90A 1KDSA 1PI5A 5U47A 3UDIA 1RGYA 4KZBA 4M3KA 4YFMA 3UN7A 3FKWA 4OLDA 3CG5A 2WADA 1GA9A 4S2PA 3LO7A 1VM1A 1K57A 1KVLA 3WS5A 4FD8A 3EQVA 2Q9MA 2Y2JA 3MXSA 2EXBA 1ZC2A 4X53A 1NZUA 5E2GA 2ZM0A 4E6WA 1L0FA 3HL9A 1BTLA 4OQHA
chains in the Genus database with same CATH superfamily
1K4FA 2J3WA 3S7OA 2FFFB 3TSGA 4FCFA 3MQ0A 3MKFA 2JKTI 1BT5A 2MJ6A 1RCJA 5A92A 4ZBEA 1EWZA 1VEUA 4E3IA 5FQIA 2HJEA 3W4OA 5M19A 2H10A 4R6LA 1IKIA 5L07A 1IYPA 1K0KA 1W7FA 1BSGA 2DNSA 3OPRA 1WA9A 4E3KA 4GD8A 3M2KA 3VSLA 2V0WA 3ZG0A 5EPHA 1K4EA 3KX0X 2FFYA 2WKPA 4EV4A 3V67A 2CC1A 2EA9A 3UB9A 4P6ZM 4H6JA 3QP5A 4WUJA 3G4PA 1N9NA 4BBTA 5HFOA 2PU2A 3MXQA 3K3CA 1BZAA 3BM6A 3VOZA 4WMCA 3MQOA 5D3OA 5C5KA 5A91A 1S6RA 3O87A 4JPMA 4EESA 3KYZA 3PBNA 2YKHA 4ZJ3A 4DE3A 4HJ6A 2PD8A 3ZDJA 5EVIA 4RX2A 1UWNX 4RVAA 3CHWP 1KGGA 1T1BA 5CECA 3R4KA 4BQMA 4CLCD 4I5SA 4EBPA 2VV8A 2ZC7A 1Q2PA 3G6OA 5F68A 3UB8A 2YKFA 4JGPA 3F1OB 2BTFP 1FR1A 1TDLA 1ONGA 2W3HA 4IUHA 2HV1A 2Q9NA 4MBHA 2K31A 1L0GA 3ZG7B 4LENA 4XUXA 3VMAA 3NY4A 1G6OA 4MBKA 4XT2A 3GR2A 1M40A 5BOHA 4FH4A 2VGLS 2PRFA 1MWRA 3IS2A 2OV5A 4KZAA 3W2ZA 2ACGA 3IX3A 2EX8A 5L2FA 4QB8A 3VP3A 1MWSA 4GKUA 4QWOA 2Y79A 3RXWA 1RP5A 3PBRA 4RX3A 5J8XA 4E3LA 3HJKA 1YPRA 3VSKA 3IXDA 2QZ6A 3C7UA 5FEGA 1PWGA 2J8YA 1KE0A 5EV0A 4Q0JA 3HVFA 2ZQDA 4N9LA 3DAVA 1G68A 2V8FA 4WL9A 5HDDA 5HD3A 3NULA 3P98A 5DF9A 4S2JA 4R3BA 3MQQA 4CLCC 1L0DA 2L0WA 3GMWA 4ARZB 3LEQA 2E8JA 4EQ1A 4NKPA 4GDBA 2Y91A 3IHAA 3IH8A 3HBRA 1IYOA 3SH8A 4PM6A 3S22A 4JF4A 4DMZA 1DJBA 3A0SA 2XSSA 3CAXA 5FQKA 2X01A 1GHPA 1FCNA 1HVBA 4HNBA 3HUMA 3ICYA 1PYYA 5GLBA 4GS9B 4LV0A 1KDWA 4UHUA 1ZKJA 4E3MA 1MKMA 3W4PA 2PHYA 2ZQ9A 5EUAA 5CGWA 2W1RA 4WM9A 5AQBA 2ZMAA 1HTZA 4P87A 5FQMA 1CI9A 1XP4A 2KDKA 3UPNA 1Z6FA 1TVFA 1G6AA 4CLCB 4KZ8A 3JVUA 3N6IA 1D06A 2EWWA 3ZQ5A 3BW6A 1PZPA 3GRJA 4R70A 3NC8A 1ZG6A 3MZEA 3N7WA 3P01A 3VP0A 3BECA 1F5MA 3MZDA 4IVKA 4ZRRA 5HZHA 3ZFZA 5AQAA 1RGZA 5E2FA 2ZL1B 4Y13A 1ACFA 1GCEA 5I5LA 2XA7S 1WYBA 1XA1A 4YNRA 1S66L 3B3XA 3DW0A 3LEZA 3Q81A 3L9KA 1PWDA 2HP6A 1S4RA 1V9ZA 2P04A 3MSHA 3T4TA 4DDSA 1SDNA 4ME4A 1ES3A 2HJ9C 1TEMA 3FG8A 5CRFA 5E43A 2EX2A 4LRXC 3DBAA 4N1HA 2OLVA 3PR6A 3T4KA 5CXWA 4O8GA 3S7QA 3HUOA 3V3SA 2W3FA 4Y17A 4YWZA 1AXBA 1S1ZA 4DKIA 1PW1A 4DRTA 4UA9A 1K57C 4II7A 1T18A 3NOPC 4OKPA 3AGFA 3NJAA 4KQOA 3N8SA 4KG5A 1YSPA 2ZC4B 3RJUA 3H82A 3O5YA 3KSIA 4WMCD 4UQIM 3A3JA 5TR7A 4GZBA 1L3LA 3WRTA 5EVID 3BFFA 3HLGA 1L2SA 4B93A 1TS8A 2X71A 3KO6A 2VZWA 3JVVA 2Y2MA 3OPHA 4JXSA 4PAUA 3FPWA 2Y2GA 4PM7A 4N1XA 3LGOA 4KZ9A 3S1YA 2QHKA 2Y2IA 1Y4OA 1HZOA 4CQHA 4OVDA 3IWIA 5TBMB 4YFMA 3UN7A 4OLDA 4X53A 1IFQA 4E6WA 4Y0TA 3JYIA 4DE0A 4LLOB 4QY5A 5EOEA 1K55C 1SCWA 4MEZA 4DJ3A 4S2NA 4QY6A 3D72A 4BL2A 4OPRA 2EX6A 4HI4A 2LB9A 4P6ZS 2B02A 1OJ5A 2FZ0A 5HAQA 2W27A 5DTSA 1F2KA 5EVIC 4GCZA 1S1YA 2VEAA 2WKHA 1VEUB 3ZG8B 3HLEA 2WK0A 4OPQA 5FEFA 4FUWA 3N8RA 3FPVA 1ES4A 2Y2NA 4R23A 1XFQA 2H0YA 2PBDP 4HBUA 4K0WA 3NDEA 3N4IA 3HLCA 1H8ZA 1NRFA 3B33A 4ETXA 4JKTA 2O0YA 3NI9A 1NWZA 3NHQA 4MLLA 3SH9A 4Y5FA 4B9OA 3IXBA 3V39A 4H6JB 3IQAA 3MBZA 5DKKA 3E2LA 1OJGA 1VQQA 1LL5A 4GOGA 4K91A 3CLOA 1BYWA 5G4ZA 3OPLA 2I9VA 4JXWA 3PHYA 4JXVA 2D01A 2ZLYA 2E8IA 4HBTA 4EBLA 5EVIB 3SZTA 4X1LA 2QJ5A 5FDSA 1DP9A 3M6HA 1C3BA 4Z9QA 4R1GA 5HSQA 5AQ7A 3C5AA 4GDNA 3Q82A 1LL9A 1JTGA 2HZ5A 3LCEA 2VV6A 2Z2MB 4KZ5A 5AVEA 2W3DA 3HCYA 3DTIA 1JWZA 3FKVA 3FYZA 1IYSA 1NYYA 3ZNYA 1PIOA 5F1GA 2WGVA 2WKIA 4MDZA 2GDNA 2HPBA 4GN2A 4XT2B 2JKTM 3U4LP 4BMWA 2C5WB 2JKRI 3HLDA 5HWVA 4R3JA 5J3WA 1PFLA 2Y59A 1LL8A 3WS1A 2A24A 2Z6CA 3DWZA 3G2YA 1BLHA 5CHUA 4UA7A 4A5RA 3IF5A 5HPFA 1OTAA 2B95A 4B4ZA 2PYPA 3BQ8A 1CQAA 2HDUA 5M18A 1WE4A 1J3WA 3G32A 2VGKA 1KE4A 4K0XA 3QP1A 4DF6A 1YLJA 3IBJA 4IUKA 4Y0UA 3H7WA 3HUNA 5EE8A 3V5MA 4B88A 4CJNA 2XFSA 2JN7A 5GHYA 1FQGA 5EECA 4IEDA 1E4DA 1ERQA 2ZQAA 4LCMA 5HWTA 3F1PA 3TRCA 3VFHA 5LBRA 1LHYA 1K55A 3IXHA 4NXBA 3CPTA 3OZHA 2XEPA 5E2HA 1PNEA 5JYPA 1YQSA 1XJ2A 4MMNA 3ZCZA 1DRMA 4BD1A 5DFYA 5CERA 2QPNA 2ZOIA 4NXGA 5AVFA 1L0EA 2XH9A 3Q7VA 3BFGA 5FAQA 3UNWA 1IEMA 4EUVA 2X02A 2Y4AA 5DTKA 3K2NA 3IF6A 3UB5P 3N8LA 2C6WB 1MZUA 2J80A 3MKEA 3WRZA 2VLGA 2XGNA 2XD5A 4OLGA 4HY8A 1NLYA 3KSHA 1K56A 1DP6A 2XROA 2HDQA 3C4PA 1CEGA 3ZGAB 4FH2A 1EI5A 1FCOA 4WBGA 3T4LA 1TF1A 4K08A 3SH7A 1GSWA 3LIEA 5DF7A 2JKFA 5A93A 1QMEA 5JYOA 4WLAA 2AVXA 1ZG4A 4LRZE 5KSCA 3QNBA 5IS1A 1ONHA 2JKGA 5GHZA 3PBTA 3IX8A 1S67L 2PDRA 4HP9A 1ZHHB 4NEED 3BLSA 3EEAA 4UQIS 3R7WA 3LY4A 1ZTUA 3T4SA 4GB7A 3P7NA 1H0MA 2OLUA 1MWUA 2PR5A 3WS4A 2Z2LB 4RA7A 5EM1A 4JBFA 3UY6A 1GHMA 2J9PA 4HEFA 2P08A 2QWSA 4R4SA 4I38A 3W8KA 4E3JA 4Y3IA 3NBLA 2W0NA 2Y2PA 3UMDA 4OQ0A 1ES2A 4MCWA 5FI2A 4S2NC 3CZDA 5CX7A 1P97A 2QMIA 3SS4A 4YOFA 2PD7A 1EW0A 4ZDXA 2KX6A 1FOFA 5L8MA 5IT5A 4H8RA 3F1NB 1SHVA 4LV3A 1IOUA 3UDXA 1YMSA 1YLZA 1FSWA 5HAIA 3GSGA 2OWJA 2PBYA 2OWHA 4KZ7A 1OMEA 4IBXA 2JC7A 4BL3A 4EERA 3LI9A 5EFWA 3VE4A 3LYXA 4OP5A 3RH8B 4WN5A 3DTEA 4C3QA 1LI9A 1KDSA 5U47A 3F1OA 2Z6DA 1ODVA 3CG5A 2W3GA 4S2PA 3E98A 4Q0IA 3WS5A 2WKQA 4R3AA 4FD8A 4MN6A 2HGVA 3LI8A 1NZUA 3B42A 4UAAA 4OQHA 1D1JA 4S2OA 2G2WA 3DTKA 3LR5A 1P9WA 5GLDA 4LFUA 2HP5A 3PBOA 4G3VA 2P9VA 3BFDA 1DJCA 1BLSA 4EBNA 1OT6A 4X68A 4YINA 4LV1A 4IJGA 3HREA 4R38A 4BENA 3PBSA 1T19A 3A3IA 4DJ2A 4OOYA 1CJFA 1YLTA 2Y8HA 3OBFA 4S2LA 4DXCA 1X0OA 1K25A 3C38A 2DRWA 1FILA 1PI4A 2J9OA 1VB6A 1XKZA 1EROA 3UE1A 2A3UA 4NG2A 3NECA 2GZAA 4EETB 5KSHA 4JXGA 5CEDA 1MBLA 2PR6A 4DDYA 4HH2A 3W4QA 4Q8IA 1LI0A 1XGIA 1BUEA 5CHMA 3V50A 3DWKA 2R78A 3OPPA 4KG6A 3OC2A 4GW9A 4L9FA 1F98A 3ZHHA 5AQ9A 3O88A 1XJ6A 3AGDA 5FAOA 4F94A 3CUEA 3O86A 2VV7A 3QNCA 4PM8A 4FSFA 5EVEA 5FASA 4QHCA 4EWFA 3UB6A 2V20A 4OQIA 3MFXA 4GS9A 4LV2A 1HD8A 5EOOA 5FATA 5CTNA 1PZOA 4MN5A 5CHJA 3A3DA 4U0XA 3D9YA 3E2KA 3ZG5A 3A0RA 1QMFA 3LUQA 1BLPA 3AGEA 1HLUP 4HQAA 4WYYA 3PAGA 1ESIA 1MWTA 3GV9A 3MMHA 2M7VA 1WYCA 2B18A 4HOIA 5M1AA 1YLPA 4U3TA 1K56D 1JNUA 2HDRA 4ESPA 3QHYA 2VJWA 1N9BA 4DE1A 4GLQA 4EQIA 2R9XA 1I2WA 4JGOA 2OSUA 3HLFA 1W8QA 4LGWA 4BBVA 4S2MA 2BASA 4G3WA 4D60A 3BLMA 2H0TA 4P6BA 5F83A 2PYRA 5KMWA 2XK1A 5HAPA 3PBQA 2A24B 3MJQA 3T12B 2ZL1A 1KOUA 3EGDC 5HL6A 4IVIA 3HJIA 4XXRA 4QD4A 1IELA 3T1SA 4DE2A 2HF6A 3E4PA 3L7HA 3IF6C 3WS2A 3G31A 1LSVA 1NY0A 5TJJA 2PAVP 5J4EA 1Y54A 4PM5A 1OTDA 5GLAA 2Y2OA 3H7WB 4Y0OA 2ZD8A 3TE8A 2QKPA 1MXOA 5FL3A 1O07A 2WZZA 4Y7PA 2WGWA 2XR0A 3IT9A 2I72A 4IHQA 3QP4A 4HHDA 4MNRA 5HPIA 4EEPA 4JGQA 1VETA 3VE3A 3RXXA 1N9LA 4JF6A 1KGEA 1NLZA 4NETA 3CPTB 3IWOA 2K7SA 3ITBA 2J3TD 3OCLA 2RL3A 4F3LA 4E04A 3C2WA 1XJ4A 3C4OA 1JTDA 5GL9A 3M6BA 3S7PA 2XRNA 1BLCA 3Q7VB 4UEYA 4D2OA 1S4SA 1LSWA 5FQJA 2H28A 1BULA 5F5YA 5GHXA 4OONA 3OOVA 5FQQA 4BBUA 3IF6B 1SKOA 2JHEA 1CI8A 2Q0OA 4PKYA 2JKRM 5HWWA 5K5BA 1YM1A 3OCNA 5A8BA 4PMAA 5F1FA 1FR6A 3NIAA 3I7JA 3S7NA 1XX2A 2WYXA 2ZQCA 1W5DA 4GD6A 5G18A 1UWPX 2P7JA 3A0VA 4S2IA 1YMXA 3T4JA 1K38A 4LRYC 4S2KA 3ZYTA 2V1ZA 2WAEA 2B5RA 5TBMA 1TD5A 3IS2B 3T4QA 5I94A 4WELA 2W1TA 4E3OA 4OQGA 3BQAA 4KENB 3GECA 2O9AA 2WKRA 3MFDA 3C7VA 4L0LA 2PU4A 2J3TC 4C6YA 4X56A 3PAEA 4GHIA 2V9AA 1W63Q 4PM9A 2CMNA 2M7UA 2EFXA 1ALQA 4AFIA 5AJGA 5EVLA 2WAFA 3R7WB 3Q07A 4QU3A 4WF0A 1DP8A 2VK3A 2UWXA 4NK3A 4E3NA 3QP2A 3HLBA 1YKDA 1LSXA 1FIKA 3UPOA 3EEHA 3LR3A 1N4OA 4LPZA 4HIAA 1E3UA 2ZMVA 3E0YA 2IWDA 3UMEA 4X69A 2HP9A 4GJ4A 2KOIA 4LCLA 3T1RA 1STZA 2HDSA 3BYDA 3TOIA 4QJGA 3A3EA 2ZBBA 2ZC6B 4O01A 2WZXA 5F82A 5DJTA 2ZC5B 3KYQA 3B47A 2V0UA 4Z1WA 2ZOHA 4KZ3A 2XFTA 4WEJA 2ZJ9A 2EWVA 2BLSA 1YAXA 2XQZA 3RTYA 5DTTA 3IXGA 1XFNA 2QYBA 3UDFA 4EXOA 2ZC3B 1K54A 2IWCA 3LIAA 2K2NA 3P09A 4ZJ1A 1TS6A 2WKEA 1GSXA 4CLCE 1Y28A 4I3IA 4WEKA 1MC0A 1DJAA 3BFCA 2IWBA 3TJZC 3IWQA 2OAP1 3LIFA 3EQUA 3BJNA 3T4OA 3UDIA 1RGYA 4KZBA 1H3QA 4M3KA 5EM0A 3FKWA 3T1XA 3LO7A 1VM1A 1YSQA 2PT7A 2Q9MA 2Y2JA 3MXSA 4NXFA 2EXBA 5E2GA 2ZM0A 3CUEC 5HARA 1BTLA 4CPKA 2XLNA 1W79A 3G34A 1IYQA 2A2LA 4Y2FA 4R0QA 1LLBA 1XJ3A 1VHMA 2P9VB 3FZCA 3ISGA 4OPZA 1I2SA 1A0KA 2LB5A 2Y2LA 3T50A 2WGIA 2L4RA 1D7EA 5HDSA 1W8YA 1GA0A 1MY8A 1XA7A 1K6RA 4DN0A 1SZVA 1XXMA 1AWIA 1W63M 4N9KA 5DKLA 2VKSA 1OTBA 5L10A 4ID4A 3QP8A 4I3AA 1CEFA 4L9GA 4I3JA 4KG2A 2EX9A 2RCXA 2M1CA 2UV0E 3ZVWA 4BWIA 2XD1A 3LIBA 3H82B 2QJ7A 1E25A 3ITAA 2ZM2A 1G28A 3PYPA 1T1CA 4JLFA 3MZFA 2EXAA 3EGXC 1ESUA 3UE6A 3IHBA 3ULFA 2XDMA 1TS7A 3SS5A 3CJMA 4HH3A 4Y15A 4UA6A 4HJ3A 1NXYA 4OOLA 2GJ3A 1H8MA 4ZJ2A 4Q0HA 2XF3A 4R4RA 5DVAA 3TW8A 3UE0A 3VP1A 4OOMA 1P9RA 3OLOA 3WS0A 2ZQ7A 2VGJA 1TDGA 3SS3A 3JPUA 2D02A 3VV4A 3FV7A 3QP6A 1NJ4A 3LIDA 4RQ9A 1GHIA 3NCKA 3K3DA 1YLWA 4WZ5C 3VFFA 2JE5A 4C75A 2GX5A 3CMZA 5FQ9A 1F9IA 1G5UA 1TS0A 1OT9A 4HP4A 3ZVTA 3V3RA 1NRJA 3VP2A 3S4XA 1UGUA 1CK3A 4O0PA 5DF8A 5MC7A 3U2AA 3SW1A 3BY8A 1JWPA 3VOLA 3TG9A 1XPBA 1MPLA 2ZM8A 4I39A 2EFUA 1J9MA 4BD0A 3IX4A 1KGFA 5G4YA 3G35A 2JBFA 2V1AA 1SKFA 4X25A 2ZMFA 3EWKA 4BJPA 3LICA 1N9OA 4X55A 2KLIA 4L9EA 3UPPA 1JWVA 3VOYA 1I5QA 5CGXA 3G30A 3BEBA 3E4OA 4ARZA 1E3UD 2VGLM 2ZQ8A 2P74A 1S0WA 5IU1A 2WGWB 3GVBA 5TFQA 2WUQA 3G2ZA 2DCFA 2V8CA 1OTEA 5HL1A 4X6TA 3HLWA 3Q1FA 2BG1A 5CTMA 1VETB 5FA7A 5HW3A 3KSFA 1ERMA 5FAPA 4ZAMA 4MBFA 4XUZA 2O99A 3GQZA 2R9WA 1ES5A 1JVJA 1OPXA 4P85A 5HDCA 4F3LB 1PWCA 4EU0A 1Q2QA 4KZ6A 1H5XA 3C8CA 2A49A 3NOTC 1O7EA 3VP4A 5F69A 2JCHA 3F1NA 4HJ4A 2V1BA 2NUTC 3GDIA 2V2FF 3WWXA 1SKOB 1PW8A 5KZHA 4ZTKA 3IBRA 5FSRA 4CLCA 1XGJA 1FCMA 4NXEA 2VX8A 4WZ4A 5HX9A 4PKYG 2NUPC 5F6AA 2O9BA 1OTIA 2Y2QA 4JF5A 1K6SA 4EUZA 1M6KA 4O7DA 4E6XA 2G7UA 3BFEA 4M4XA 2OOLA 2W3EA 4KQQA 1MKIA 4JGRA 3MXRA 4GNUA 4DXBA 5FDHA 5GLCA 3BY9A 3LFVA 2W1TB 2Y2KA 4FOFA 3ZG9B 2Y55A 4X1MA 3PXPA 4G3KA 2Y2HA 4HESA 2O9CA 3C30A 4KZ4A 5IHVA 1FSYA 2G2UA 5HD5A 3EOIA 5DFXA 4GHIB 3MR0A 1YLYA 1K54C 4KUOA 3ZNTA 3NOUC 3UB7A 2INWA 3M2JA 4ETZA 3MS6A 4KQRA 1KVMA 2J7VA 3T1QB 2GNXA 1GSVA 4QPRA 3UE3A 3E4QA 2IA2A 3MF0A 3FWLA 4PPRA 3LY3A 3O3VA 5FI6A 4WZ5A 3FC7A 5KIZA 1IKGA 4KQDA 3CI6A 3D4FA 3F1PB 3IH9A 3CITA 4IBRA 2XA7M 1LT0A 5E2EA 3GTCA 3DTMA 4B4XA 1KE3A 2L1MA 3CWFA 3D3OA 4P0MA 1P0ZA 1U60A 1NZOA 4PHTA 4BLMA 3RFBA 4OPYA 4EEUA 2H5SA 5FI7A 4N92A 4FTXA 1YT4A 3LR0A 5TGFA 5L09A 1Z09A 2OAQ1 3A3FA 3KYEA 4RYEA 3BRMA 1SDEA 1DY6A 3LR4A 1CF0A 3PTEA 4EW7A 3UO9A 5CEBA 2FH5A 5DJUA 4OH0A 5CGSA 3BWLA 1V9YA 3KSGA 3NDGA 4OP8A 2VA0A 4U0TA 3Q7ZA 1NYMA 2DMWA 4KUKA 1H8YA 1T1AA 3SOIA 5A90A 1PI5A 2WADA 1GA9A 1K57A 1KVLA 1PRQA 3EQVA 5J7EA 4MN7A 1ZC2A 3H9WA 1L0FA 3HL9A
chains in the Genus database with same CATH topology
1K4FA 4Y0TA 3JYIA 4S2OA 4CPKA 4DE0A 2G2WA 2XLNA 4QY5A 5EOEA 1W79A 2FFFB 3G34A 3TSGA 5GLDA 1K55C 1SCWA 4MEZA 4S2NA 1IYQA 4QY6A 4FCFA 4R0QA 4BL2A 4OPRA 2HP5A 1LLBA 2EX6A 3MKFA 3PBOA 2P9VA 3BFDA 1DJCA 2P9VB 1BLSA 3FZCA 3ISGA 4EBNA 4OPZA 1I2SA 4X68A 4YINA 4LV1A 5HAQA 5DTSA 2Y2LA 3HREA 2WGIA 5EVIC 1BT5A 4BENA 1RCJA 5A92A 3PBSA 4ZBEA 1EWZA 1W8YA 2WKHA 1GA0A 1MY8A 1XA7A 4E3IA 1K6RA 5FQIA 3ZG8B 3A3IA 4OOYA 3W4OA 5M19A 1YLTA 2H10A 4S2LA 4DXCA 1XXMA 1IKIA 3HLEA 4N9KA 2WK0A 1K25A 4OPQA 2DRWA 1PI4A 4ID4A 1IYPA 2J9OA 1CEFA 3N8RA 1W7FA 1BSGA 2DNSA 1XKZA 1EROA 3OPRA 4E3KA 1ES4A 2A3UA 3UE1A 2Y2NA 4GD8A 4KG2A 4R23A 2EX9A 2H0YA 3M2KA 3VSLA 5KSHA 4HBUA 4JXGA 5CEDA 4K0WA 1MBLA 4DDYA 3ZG0A 3NDEA 2RCXA 3N4IA 3HLCA 1H8ZA 1K4EA 5EPHA 3W4QA 4Q8IA 1LI0A 1XGIA 1BUEA 1NRFA 2FFYA 4JKTA 5CHMA 3V50A 4EV4A 3NI9A 4MLLA 3DWKA 3SH9A 3OPPA 4KG6A 3OC2A 3ZVWA 3ZHHA 2CC1A 2XD1A 5AQ9A 3O88A 3AGDA 3IXBA 1E25A 5FAOA 3V39A 4F94A 3ITAA 3G4PA 2ZM2A 3IQAA 3MBZA 4JLFA 5HFOA 3O86A 2PU2A 3QNCA 3MZFA 4FSFA 4PM8A 5FASA 4QHCA 2EXAA 4EWFA 1BZAA 3E2LA 3BM6A 1ESUA 1VQQA 3IHBA 3VOZA 2V20A 4OQIA 1LL5A 4WMCA 5D3OA 5A91A 1S6RA 4GOGA 4DE1A 2XDMA 4LV2A 3SS5A 3O87A 4K91A 1HD8A 4JPMA 5EOOA 3OPLA 5FATA 3CJMA 4JXWA 5CTNA 1PZOA 3PBNA 4UA6A 5CHJA 4JXVA 4ZJ3A 4DE3A 2ZLYA 1NXYA 2E8IA 4OOLA 3A3DA 3ZDJA 4ZJ2A 4U0XA 4HBTA 2XF3A 3E2KA 4R4RA 4RX2A 5DVAA 5EVIA 3UE0A 3ZG5A 4EBLA 5EVIB 1QMFA 1BLPA 4RVAA 3AGEA 4OOMA 3VP1A 1KGGA 1L0GA 4WYYA 3M6HA 3WS0A 3PAGA 4BQMA 5CECA 1C3BA 1ESIA 2ZQ7A 4EBPA 4Z9QA 1MWTA 2VGJA 3GV9A 1TDGA 3SS3A 2ZC7A 1WYCA 4R1GA 5AQ7A 5M1AA 1Q2PA 1YLPA 3C5AA 4U3TA 1K56D 3Q82A 1LL9A 4GDNA 1JTGA 3FV7A 3LCEA 1NJ4A 2Z2MB 4KZ5A 1GHIA 2HDRA 3NCKA 1FR1A 1TDLA 1ONGA 3QHYA 1JWZA 1YLWA 2Q9NA 4MBHA 3FKVA 3FYZA 1IYSA 1N9BA 1NYYA 2JE5A 4WZ5C 1PIOA 5F1GA 3VFFA 3CMZA 2WGVA 4LENA 2R9XA 1I2WA 4XUXA 5FQ9A 3ZG7B 4EQIA 3VMAA 3NY4A 4MBKA 2OSUA 2WKIA 3HLFA 3GR2A 1M40A 4IEDA 2GDNA 2HPBA 4FH4A 4GN2A 1W8QA 5BOHA 2C5WB 3HLDA 4S2MA 4R3JA 1MWRA 3ZVTA 3BLMA 2OV5A 4KZAA 2H0TA 2Y59A 4P6BA 5F83A 3V3RA 3WS1A 3VP2A 5KMWA 2XK1A 3S4XA 5HAPA 3PBQA 2EX8A 3DWZA 1CK3A 3G2YA 4QB8A 5L2FA 1BLHA 3VP3A 5CHUA 5DF8A 4UA7A 4A5RA 3IF5A 1MWSA 4GKUA 3RXWA 1RP5A 3PBRA 4RX3A 1JWPA 4E3LA 5J8XA 4IVIA 3VSKA 3IXDA 2QZ6A 3TG9A 3C7UA 4XXRA 1XPBA 4QD4A 4B4ZA 1PWGA 2J8YA 1IELA 1KE0A 1MPLA 2HDUA 5M18A 2ZM8A 2EFUA 1J9MA 4DE2A 4BD0A 1WE4A 1KGFA 3G32A 3G35A 2JBFA 2VGKA 3HVFA 1KE4A 1SKFA 2ZQDA 4K0XA 4N9LA 3IF6C 4GDBA 3WS2A 3G31A 4BJPA 1NY0A 4X55A 1G68A 4DF6A 1YLJA 1Y54A 3UPPA 4PM5A 4Y0UA 3ZNYA 1JWVA 3P98A 5GLAA 3VOYA 5DF9A 4S2JA 1I5QA 4R3BA 2Y2OA 4Y0OA 5CGXA 3HUNA 3G30A 5EE8A 3BEBA 3V5MA 1L0DA 2ZD8A 4B88A 1E3UD 3GMWA 1MXOA 2ZQ8A 4CJNA 2XFSA 1O07A 2WZZA 5GHYA 4Y7PA 1FQGA 2P74A 2WGWA 1S0WA 2XR0A 2Y91A 3IHAA 3IH8A 2WGWB 3GVBA 3HBRA 3IT9A 1E4DA 5HARA 1IYOA 5TFQA 2WUQA 1ERQA 3SH8A 3G2ZA 2I72A 2DCFA 4PM6A 5HL1A 3S22A 4JF4A 2ZQAA 4LCMA 4X6TA 3HLWA 3Q1FA 4MNRA 2BG1A 1DJBA 3VFHA 5CTMA 5FA7A 5FQKA 5HW3A 2X01A 1GHPA 3RXXA 1LHYA 4JF6A 1K55A 1KGEA 1ERMA 3IXHA 5FAPA 3OZHA 1FCNA 4NETA 1HVBA 4ZAMA 2XEPA 4MBFA 4XUZA 5E2HA 3GQZA 5JYPA 3IWOA 2R9WA 3ITBA 1ES5A 1YQSA 3HUMA 1PYYA 1JVJA 5GLBA 3ZCZA 3OCLA 2RL3A 4P85A 4LV0A 4BD1A 1PWCA 1KDWA 5CERA 4UHUA 2QPNA 1ZKJA 3C4OA 1JTDA 4E3MA 1Q2QA 5GL9A 4KZ6A 3W4PA 1L0EA 1H5XA 2XH9A 3M6BA 3Q7VA 1BLCA 3BFGA 3Q7VB 4D2OA 2A49A 5FQJA 1BULA 2ZQ9A 5EUAA 5FAQA 1O7EA 5GHXA 3VP4A 5CGWA 3UNWA 1IEMA 2X02A 4WM9A 4OONA 5AQBA 2Y4AA 2JCHA 5DTKA 3IF6A 5FQQA 2ZMAA 1HTZA 2V2FF 3IF6B 4P87A 1CI8A 1CI9A 3N8LA 5FQMA 1XP4A 3WWXA 1PW8A 5KZHA 4ZTKA 3UPNA 1YM1A 3OCNA 2C6WB 4PMAA 5F1FA 3MKEA 1FR6A 3NIAA 3I7JA 1Z6FA 5FSRA 1TVFA 1XX2A 2WYXA 3WRZA 2XGNA 1G6AA 1XGJA 4C75A 1FCMA 2ZQCA 4KZ8A 1W5DA 2XD5A 4OLGA 4WZ4A 3N6IA 4GD6A 5G18A 5HX9A 4S2IA 2Y2QA 1K56A 1YMXA 4JF5A 1K6SA 4EUZA 1M6KA 2HDQA 3C4PA 1CEGA 3ZGAB 4FH2A 1K38A 4O7DA 4E6XA 3BFEA 1EI5A 1PZPA 4S2KA 1FCOA 2V1ZA 2WAEA 2B5RA 3GRJA 4KQQA 1MKIA 3NC8A 1ZG6A 3MXRA 3MZEA 3N7WA 4WBGA 3VP0A 4GNUA 4DXBA 5FDHA 5I94A 4WELA 5GLCA 3BECA 2Y2KA 3MZDA 4IVKA 3ZG9B 2Y55A 4OQGA 3ZFZA 4E3OA 5AQAA 4KENB 1RGZA 5E2FA 3SH7A 1GCEA 2Y2HA 4HESA 5DF7A 5A93A 3MFDA 3C7VA 4KZ4A 5IHVA 4L0LA 1WYBA 2PU4A 1QMEA 1XA1A 5JYOA 4C6YA 1FSYA 1ZG4A 3B3XA 5KSCA 3DW0A 2G2UA 3QNBA 3LEZA 4X56A 3Q81A 1ONHA 1PWDA 2HP6A 5GHZA 3PBTA 4DDSA 3PAEA 1SDNA 4PM9A 1ES3A 2EFXA 1YLYA 3BLSA 1ALQA 1K54C 1TEMA 5CRFA 5E43A 3LY4A 5EVLA 2WAFA 3ZNTA 3Q07A 2EX2A 4GB7A 3M2JA 4N1HA 4KQRA 4QU3A 1KVMA 2OLVA 2OLUA 1MWUA 2J7VA 5CXWA 3WS4A 2UWXA 4NK3A 2Z2LB 4RA7A 3UE3A 4E3NA 3HLBA 4JBFA 3HUOA 3V3SA 4PPRA 3FWLA 1AXBA 3UY6A 1GHMA 2J9PA 3LY3A 4HEFA 3UPOA 3O3VA 5FI6A 4DKIA 1PW1A 4WZ5A 1N4OA 1E3UA 4DRTA 1IKGA 2IWDA 4UA9A 4R4SA 3D4FA 4X69A 4UAAA 3IH9A 2HP9A 4IBRA 1K57C 3W8KA 5E2EA 4LCLA 4E3JA 3GTCA 3DTMA 4OKPA 3AGFA 4KQOA 2HDSA 3BYDA 3TOIA 4QJGA 3N8SA 4B4XA 1KE3A 3A3EA 3NBLA 2Y2PA 4KG5A 4P0MA 2ZC4B 2ZC6B 3RJUA 1U60A 2WZXA 5F82A 1NZOA 4OQ0A 1ES2A 4WMCD 5FI2A 4S2NC 2ZC5B 3CZDA 4BLMA 2QMIA 4OPYA 3SS4A 3A3JA 2H5SA 5TR7A 4KZ3A 2XFTA 5FI7A 4N92A 4GZBA 4WEJA 3WRTA 2ZJ9A 4ZDXA 1YT4A 2BLSA 1FOFA 5TGFA 5EVID 3A3FA 2XQZA 4H8RA 3BFFA 3HLGA 4RYEA 1L2SA 3BRMA 3IXGA 5DTTA 1SHVA 4LV3A 1SDEA 1DY6A 2X71A 2Y2MA 3UDFA 3PTEA 2ZC3B 1K54A 2IWCA 3UDXA 1YMSA 3OPHA 3UO9A 1YLZA 1FSWA 5HAIA 5CEBA 4JXSA 3GSGA 3P09A 4OH0A 4ZJ1A 2Y2GA 5CGSA 2PBYA 2WKEA 4PM7A 4KZ7A 3NDGA 4OP8A 1OMEA 4N1XA 4U0TA 3Q7ZA 4IBXA 2JC7A 4BL3A 1NYMA 5EECA 4WEKA 4KZ9A 3S1YA 1H8YA 1DJAA 2Y2IA 3BFCA 4OP5A 2IWBA 3IWQA 1HZOA 4OVDA 4C3QA 3EQUA 3SOIA 1LI9A 3IWIA 5A90A 1KDSA 1PI5A 5U47A 3UDIA 1RGYA 4KZBA 4M3KA 4YFMA 3UN7A 3FKWA 4OLDA 3CG5A 2WADA 1GA9A 4S2PA 3LO7A 1VM1A 1K57A 1KVLA 3WS5A 4FD8A 3EQVA 2Q9MA 2Y2JA 3MXSA 2EXBA 1ZC2A 4X53A 1NZUA 5E2GA 2ZM0A 4E6WA 1L0FA 3HL9A 1BTLA 4OQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K4F A;  4Y0T A;  3JYI A;  4S2O A;  4CPK A;  4DE0 A;  2G2W A;  2XLN A;  4QY5 A;  5EOE A;  1W79 A;  2FFF B;  3G34 A;  3TSG A;  5GLD A;  1K55 C;  1SCW A;  4MEZ A;  4S2N A;  1IYQ A;  4QY6 A;  4FCF A;  4R0Q A;  4BL2 A;  4OPR A;  2HP5 A;  1LLB A;  2EX6 A;  3MKF A;  3PBO A;  2P9V A;  3BFD A;  1DJC A;  2P9V B;  1BLS A;  3FZC A;  3ISG A;  4EBN A;  4OPZ A;  1I2S A;  4X68 A;  4YIN A;  4LV1 A;  5HAQ A;  5DTS A;  2Y2L A;  3HRE A;  2WGI A;  5EVI C;  1BT5 A;  4BEN A;  1RCJ A;  5A92 A;  3PBS A;  4ZBE A;  1EWZ A;  1W8Y A;  2WKH A;  1GA0 A;  1MY8 A;  1XA7 A;  4E3I A;  1K6R A;  5FQI A;  3ZG8 B;  3A3I A;  4OOY A;  3W4O A;  5M19 A;  1YLT A;  2H10 A;  4S2L A;  4DXC A;  1XXM A;  1IKI A;  3HLE A;  4N9K A;  2WK0 A;  1K25 A;  4OPQ A;  2DRW A;  1PI4 A;  4ID4 A;  1IYP A;  2J9O A;  1CEF A;  3N8R A;  1W7F A;  1BSG A;  2DNS A;  1XKZ A;  1ERO A;  3OPR A;  4E3K A;  1ES4 A;  2A3U A;  3UE1 A;  2Y2N A;  4GD8 A;  4KG2 A;  4R23 A;  2EX9 A;  2H0Y A;  3M2K A;  3VSL A;  5KSH A;  4HBU A;  4JXG A;  5CED A;  4K0W A;  1MBL A;  4DDY A;  3ZG0 A;  3NDE A;  2RCX A;  3N4I A;  3HLC A;  1H8Z A;  1K4E A;  5EPH A;  3W4Q A;  4Q8I A;  1LI0 A;  1XGI A;  1BUE A;  1NRF A;  2FFY A;  4JKT A;  5CHM A;  3V50 A;  4EV4 A;  3NI9 A;  4MLL A;  3DWK A;  3SH9 A;  3OPP A;  4KG6 A;  3OC2 A;  3ZVW A;  3ZHH A;  2CC1 A;  2XD1 A;  5AQ9 A;  3O88 A;  3AGD A;  3IXB A;  1E25 A;  5FAO A;  3V39 A;  4F94 A;  3ITA A;  3G4P A;  2ZM2 A;  3IQA A;  3MBZ A;  4JLF A;  5HFO A;  3O86 A;  2PU2 A;  3QNC A;  3MZF A;  4FSF A;  4PM8 A;  5FAS A;  4QHC A;  2EXA A;  4EWF A;  1BZA A;  3E2L A;  3BM6 A;  1ESU A;  1VQQ A;  3IHB A;  3VOZ A;  2V20 A;  4OQI A;  1LL5 A;  4WMC A;  5D3O A;  5A91 A;  1S6R A;  4GOG A;  4DE1 A;  2XDM A;  4LV2 A;  3SS5 A;  3O87 A;  4K91 A;  1HD8 A;  4JPM A;  5EOO A;  3OPL A;  5FAT A;  3CJM A;  4JXW A;  5CTN A;  1PZO A;  3PBN A;  4UA6 A;  5CHJ A;  4JXV A;  4ZJ3 A;  4DE3 A;  2ZLY A;  1NXY A;  2E8I A;  4OOL A;  3A3D A;  3ZDJ A;  4ZJ2 A;  4U0X A;  4HBT A;  2XF3 A;  3E2K A;  4R4R A;  4RX2 A;  5DVA A;  5EVI A;  3UE0 A;  3ZG5 A;  4EBL A;  5EVI B;  1QMF A;  1BLP A;  4RVA A;  3AGE A;  4OOM A;  3VP1 A;  1KGG A;  1L0G A;  4WYY A;  3M6H A;  3WS0 A;  3PAG A;  4BQM A;  5CEC A;  1C3B A;  1ESI A;  2ZQ7 A;  4EBP A;  4Z9Q A;  1MWT A;  2VGJ A;  3GV9 A;  1TDG A;  3SS3 A;  2ZC7 A;  1WYC A;  4R1G A;  5AQ7 A;  5M1A A;  1Q2P A;  1YLP A;  3C5A A;  4U3T A;  1K56 D;  3Q82 A;  1LL9 A;  4GDN A;  1JTG A;  3FV7 A;  3LCE A;  1NJ4 A;  2Z2M B;  4KZ5 A;  1GHI A;  2HDR A;  3NCK A;  1FR1 A;  1TDL A;  1ONG A;  3QHY A;  1JWZ A;  1YLW A;  2Q9N A;  4MBH A;  3FKV A;  3FYZ A;  1IYS A;  1N9B A;  1NYY A;  2JE5 A;  4WZ5 C;  1PIO A;  5F1G A;  3VFF A;  3CMZ A;  2WGV A;  4LEN A;  2R9X A;  1I2W A;  4XUX A;  5FQ9 A;  3ZG7 B;  4EQI A;  3VMA A;  3NY4 A;  4MBK A;  2OSU A;  2WKI A;  3HLF A;  3GR2 A;  1M40 A;  4IED A;  2GDN A;  2HPB A;  4FH4 A;  4GN2 A;  1W8Q A;  5BOH A;  2C5W B;  3HLD A;  4S2M A;  4R3J A;  1MWR A;  3ZVT A;  3BLM A;  2OV5 A;  4KZA A;  2H0T A;  2Y59 A;  4P6B A;  5F83 A;  3V3R A;  3WS1 A;  3VP2 A;  5KMW A;  2XK1 A;  3S4X A;  5HAP A;  3PBQ A;  2EX8 A;  3DWZ A;  1CK3 A;  3G2Y A;  4QB8 A;  5L2F A;  1BLH A;  3VP3 A;  5CHU A;  5DF8 A;  4UA7 A;  4A5R A;  3IF5 A;  1MWS A;  4GKU A;  3RXW A;  1RP5 A;  3PBR A;  4RX3 A;  1JWP A;  4E3L A;  5J8X A;  4IVI A;  3VSK A;  3IXD A;  2QZ6 A;  3TG9 A;  3C7U A;  4XXR A;  1XPB A;  4QD4 A;  4B4Z A;  1PWG A;  2J8Y A;  1IEL A;  1KE0 A;  1MPL A;  2HDU A;  5M18 A;  2ZM8 A;  2EFU A;  1J9M A;  4DE2 A;  4BD0 A;  1WE4 A;  1KGF A;  3G32 A;  3G35 A;  2JBF A;  2VGK A;  3HVF A;  1KE4 A;  1SKF A;  2ZQD A;  4K0X A;  4N9L A;  3IF6 C;  4GDB A;  3WS2 A;  3G31 A;  4BJP A;  1NY0 A;  4X55 A;  1G68 A;  4DF6 A;  1YLJ A;  1Y54 A;  3UPP A;  4PM5 A;  4Y0U A;  3ZNY A;  1JWV A;  3P98 A;  5GLA A;  3VOY A;  5DF9 A;  4S2J A;  1I5Q A;  4R3B A;  2Y2O A;  4Y0O A;  5CGX A;  3HUN A;  3G30 A;  5EE8 A;  3BEB A;  3V5M A;  1L0D A;  2ZD8 A;  4B88 A;  1E3U D;  3GMW A;  1MXO A;  2ZQ8 A;  4CJN A;  2XFS A;  1O07 A;  2WZZ A;  5GHY A;  4Y7P A;  1FQG A;  2P74 A;  2WGW A;  1S0W A;  2XR0 A;  2Y91 A;  3IHA A;  3IH8 A;  2WGW B;  3GVB A;  3HBR A;  3IT9 A;  1E4D A;  5HAR A;  1IYO A;  5TFQ A;  2WUQ A;  1ERQ A;  3SH8 A;  3G2Z A;  2I72 A;  2DCF A;  4PM6 A;  5HL1 A;  3S22 A;  4JF4 A;  2ZQA A;  4LCM A;  4X6T A;  3HLW A;  3Q1F A;  4MNR A;  2BG1 A;  1DJB A;  3VFH A;  5CTM A;  5FA7 A;  5FQK A;  5HW3 A;  2X01 A;  1GHP A;  3RXX A;  1LHY A;  4JF6 A;  1K55 A;  1KGE A;  1ERM A;  3IXH A;  5FAP A;  3OZH A;  1FCN A;  4NET A;  1HVB A;  4ZAM A;  2XEP A;  4MBF A;  4XUZ A;  5E2H A;  3GQZ A;  5JYP A;  3IWO A;  2R9W A;  3ITB A;  1ES5 A;  1YQS A;  3HUM A;  1PYY A;  1JVJ A;  5GLB A;  3ZCZ A;  3OCL A;  2RL3 A;  4P85 A;  4LV0 A;  4BD1 A;  1PWC A;  1KDW A;  5CER A;  4UHU A;  2QPN A;  1ZKJ A;  3C4O A;  1JTD A;  4E3M A;  1Q2Q A;  5GL9 A;  4KZ6 A;  3W4P A;  1L0E A;  1H5X A;  2XH9 A;  3M6B A;  3Q7V A;  1BLC A;  3BFG A;  3Q7V B;  4D2O A;  2A49 A;  5FQJ A;  1BUL A;  2ZQ9 A;  5EUA A;  5FAQ A;  1O7E A;  5GHX A;  3VP4 A;  5CGW A;  3UNW A;  1IEM A;  2X02 A;  4WM9 A;  4OON A;  5AQB A;  2Y4A A;  2JCH A;  5DTK A;  3IF6 A;  5FQQ A;  2ZMA A;  1HTZ A;  2V2F F;  3IF6 B;  4P87 A;  1CI8 A;  1CI9 A;  3N8L A;  5FQM A;  1XP4 A;  3WWX A;  1PW8 A;  5KZH A;  4ZTK A;  3UPN A;  1YM1 A;  3OCN A;  2C6W B;  4PMA A;  5F1F A;  3MKE A;  1FR6 A;  3NIA A;  3I7J A;  1Z6F A;  5FSR A;  1TVF A;  1XX2 A;  2WYX A;  3WRZ A;  2XGN A;  1G6A A;  1XGJ A;  4C75 A;  1FCM A;  2ZQC A;  4KZ8 A;  1W5D A;  2XD5 A;  4OLG A;  4WZ4 A;  3N6I A;  4GD6 A;  5G18 A;  5HX9 A;  4S2I A;  2Y2Q A;  1K56 A;  1YMX A;  4JF5 A;  1K6S A;  4EUZ A;  1M6K A;  2HDQ A;  3C4P A;  1CEG A;  3ZGA B;  4FH2 A;  1K38 A;  4O7D A;  4E6X A;  3BFE A;  1EI5 A;  1PZP A;  4S2K A;  1FCO A;  2V1Z A;  2WAE A;  2B5R A;  3GRJ A;  4KQQ A;  1MKI A;  3NC8 A;  1ZG6 A;  3MXR A;  3MZE A;  3N7W A;  4WBG A;  3VP0 A;  4GNU A;  4DXB A;  5FDH A;  5I94 A;  4WEL A;  5GLC A;  3BEC A;  2Y2K A;  3MZD A;  4IVK A;  3ZG9 B;  2Y55 A;  4OQG A;  3ZFZ A;  4E3O A;  5AQA A;  4KEN B;  1RGZ A;  5E2F A;  3SH7 A;  1GCE A;  2Y2H A;  4HES A;  5DF7 A;  5A93 A;  3MFD A;  3C7V A;  4KZ4 A;  5IHV A;  4L0L A;  1WYB A;  2PU4 A;  1QME A;  1XA1 A;  5JYO A;  4C6Y A;  1FSY A;  1ZG4 A;  3B3X A;  5KSC A;  3DW0 A;  2G2U A;  3QNB A;  3LEZ A;  4X56 A;  3Q81 A;  1ONH A;  1PWD A;  2HP6 A;  5GHZ A;  3PBT A;  4DDS A;  3PAE A;  1SDN A;  4PM9 A;  1ES3 A;  2EFX A;  1YLY A;  3BLS A;  1ALQ A;  1K54 C;  1TEM A;  5CRF A;  5E43 A;  3LY4 A;  5EVL A;  2WAF A;  3ZNT A;  3Q07 A;  2EX2 A;  4GB7 A;  3M2J A;  4N1H A;  4KQR A;  4QU3 A;  1KVM A;  2OLV A;  2OLU A;  1MWU A;  2J7V A;  5CXW A;  3WS4 A;  2UWX A;  4NK3 A;  2Z2L B;  4RA7 A;  3UE3 A;  4E3N A;  3HLB A;  4JBF A;  3HUO A;  3V3S A;  4PPR A;  3FWL A;  1AXB A;  3UY6 A;  1GHM A;  2J9P A;  3LY3 A;  4HEF A;  3UPO A;  3O3V A;  5FI6 A;  4DKI A;  1PW1 A;  4WZ5 A;  1N4O A;  1E3U A;  4DRT A;  1IKG A;  2IWD A;  4UA9 A;  4R4S A;  3D4F A;  4X69 A;  4UAA A;  3IH9 A;  2HP9 A;  4IBR A;  1K57 C;  3W8K A;  5E2E A;  4LCL A;  4E3J A;  3GTC A;  3DTM A;  4OKP A;  3AGF A;  4KQO A;  2HDS A;  3BYD A;  3TOI A;  4QJG A;  3N8S A;  4B4X A;  1KE3 A;  3A3E A;  3NBL A;  2Y2P A;  4KG5 A;  4P0M A;  2ZC4 B;  2ZC6 B;  3RJU A;  1U60 A;  2WZX A;  5F82 A;  1NZO A;  4OQ0 A;  1ES2 A;  4WMC D;  5FI2 A;  4S2N C;  2ZC5 B;  3CZD A;  4BLM A;  2QMI A;  4OPY A;  3SS4 A;  3A3J A;  2H5S A;  5TR7 A;  4KZ3 A;  2XFT A;  5FI7 A;  4N92 A;  4GZB A;  4WEJ A;  3WRT A;  2ZJ9 A;  4ZDX A;  1YT4 A;  2BLS A;  1FOF A;  5TGF A;  5EVI D;  3A3F A;  2XQZ A;  4H8R A;  3BFF A;  3HLG A;  4RYE A;  1L2S A;  3BRM A;  3IXG A;  5DTT A;  1SHV A;  4LV3 A;  1SDE A;  1DY6 A;  2X71 A;  2Y2M A;  3UDF A;  3PTE A;  2ZC3 B;  1K54 A;  2IWC A;  3UDX A;  1YMS A;  3OPH A;  3UO9 A;  1YLZ A;  1FSW A;  5HAI A;  5CEB A;  4JXS A;  3GSG A;  3P09 A;  4OH0 A;  4ZJ1 A;  2Y2G A;  5CGS A;  2PBY A;  2WKE A;  4PM7 A;  4KZ7 A;  3NDG A;  4OP8 A;  1OME A;  4N1X A;  4U0T A;  3Q7Z A;  4IBX A;  2JC7 A;  4BL3 A;  1NYM A;  5EEC A;  4WEK A;  4KZ9 A;  3S1Y A;  1H8Y A;  1DJA A;  2Y2I A;  3BFC A;  4OP5 A;  2IWB A;  3IWQ A;  1HZO A;  4OVD A;  4C3Q A;  3EQU A;  3SOI A;  1LI9 A;  3IWI A;  5A90 A;  1KDS A;  1PI5 A;  5U47 A;  3UDI A;  1RGY A;  4KZB A;  4M3K A;  4YFM A;  3UN7 A;  3FKW A;  4OLD A;  3CG5 A;  2WAD A;  1GA9 A;  4S2P A;  3LO7 A;  1VM1 A;  1K57 A;  1KVL A;  3WS5 A;  4FD8 A;  3EQV A;  2Q9M A;  2Y2J A;  3MXS A;  2EXB A;  1ZC2 A;  4X53 A;  1NZU A;  5E2G A;  2ZM0 A;  4E6W A;  1L0F A;  3HL9 A;  1BTL A;  4OQH A; 
#chains in the Genus database with same CATH topology
 1K4F A;  2J3W A;  3S7O A;  2FFF B;  3TSG A;  4FCF A;  3MQ0 A;  3MKF A;  2JKT I;  1BT5 A;  2MJ6 A;  1RCJ A;  5A92 A;  4ZBE A;  1EWZ A;  1VEU A;  4E3I A;  5FQI A;  2HJE A;  3W4O A;  5M19 A;  2H10 A;  4R6L A;  1IKI A;  5L07 A;  1IYP A;  1K0K A;  1W7F A;  1BSG A;  2DNS A;  3OPR A;  1WA9 A;  4E3K A;  4GD8 A;  3M2K A;  3VSL A;  2V0W A;  3ZG0 A;  5EPH A;  1K4E A;  3KX0 X;  2FFY A;  2WKP A;  4EV4 A;  3V67 A;  2CC1 A;  2EA9 A;  3UB9 A;  4P6Z M;  4H6J A;  3QP5 A;  4WUJ A;  3G4P A;  1N9N A;  4BBT A;  5HFO A;  2PU2 A;  3MXQ A;  3K3C A;  1BZA A;  3BM6 A;  3VOZ A;  4WMC A;  3MQO A;  5D3O A;  5C5K A;  5A91 A;  1S6R A;  3O87 A;  4JPM A;  4EES A;  3KYZ A;  3PBN A;  2YKH A;  4ZJ3 A;  4DE3 A;  4HJ6 A;  2PD8 A;  3ZDJ A;  5EVI A;  4RX2 A;  1UWN X;  4RVA A;  3CHW P;  1KGG A;  1T1B A;  5CEC A;  3R4K A;  4BQM A;  4CLC D;  4I5S A;  4EBP A;  2VV8 A;  2ZC7 A;  1Q2P A;  3G6O A;  5F68 A;  3UB8 A;  2YKF A;  4JGP A;  3F1O B;  2BTF P;  1FR1 A;  1TDL A;  1ONG A;  2W3H A;  4IUH A;  2HV1 A;  2Q9N A;  4MBH A;  2K31 A;  1L0G A;  3ZG7 B;  4LEN A;  4XUX A;  3VMA A;  3NY4 A;  1G6O A;  4MBK A;  4XT2 A;  3GR2 A;  1M40 A;  5BOH A;  4FH4 A;  2VGL S;  2PRF A;  1MWR A;  3IS2 A;  2OV5 A;  4KZA A;  3W2Z A;  2ACG A;  3IX3 A;  2EX8 A;  5L2F A;  4QB8 A;  3VP3 A;  1MWS A;  4GKU A;  4QWO A;  2Y79 A;  3RXW A;  1RP5 A;  3PBR A;  4RX3 A;  5J8X A;  4E3L A;  3HJK A;  1YPR A;  3VSK A;  3IXD A;  2QZ6 A;  3C7U A;  5FEG A;  1PWG A;  2J8Y A;  1KE0 A;  5EV0 A;  4Q0J A;  3HVF A;  2ZQD A;  4N9L A;  3DAV A;  1G68 A;  2V8F A;  4WL9 A;  5HDD A;  5HD3 A;  3NUL A;  3P98 A;  5DF9 A;  4S2J A;  4R3B A;  3MQQ A;  4CLC C;  1L0D A;  2L0W A;  3GMW A;  4ARZ B;  3LEQ A;  2E8J A;  4EQ1 A;  4NKP A;  4GDB A;  2Y91 A;  3IHA A;  3IH8 A;  3HBR A;  1IYO A;  3SH8 A;  4PM6 A;  3S22 A;  4JF4 A;  4DMZ A;  1DJB A;  3A0S A;  2XSS A;  3CAX A;  5FQK A;  2X01 A;  1GHP A;  1FCN A;  1HVB A;  4HNB A;  3HUM A;  3ICY A;  1PYY A;  5GLB A;  4GS9 B;  4LV0 A;  1KDW A;  4UHU A;  1ZKJ A;  4E3M A;  1MKM A;  3W4P A;  2PHY A;  2ZQ9 A;  5EUA A;  5CGW A;  2W1R A;  4WM9 A;  5AQB A;  2ZMA A;  1HTZ A;  4P87 A;  5FQM A;  1CI9 A;  1XP4 A;  2KDK A;  3UPN A;  1Z6F A;  1TVF A;  1G6A A;  4CLC B;  4KZ8 A;  3JVU A;  3N6I A;  1D06 A;  2EWW A;  3ZQ5 A;  3BW6 A;  1PZP A;  3GRJ A;  4R70 A;  3NC8 A;  1ZG6 A;  3MZE A;  3N7W A;  3P01 A;  3VP0 A;  3BEC A;  1F5M A;  3MZD A;  4IVK A;  4ZRR A;  5HZH A;  3ZFZ A;  5AQA A;  1RGZ A;  5E2F A;  2ZL1 B;  4Y13 A;  1ACF A;  1GCE A;  5I5L A;  2XA7 S;  1WYB A;  1XA1 A;  4YNR A;  1S66 L;  3B3X A;  3DW0 A;  3LEZ A;  3Q81 A;  3L9K A;  1PWD A;  2HP6 A;  1S4R A;  1V9Z A;  2P04 A;  3MSH A;  3T4T A;  4DDS A;  1SDN A;  4ME4 A;  1ES3 A;  2HJ9 C;  1TEM A;  3FG8 A;  5CRF A;  5E43 A;  2EX2 A;  4LRX C;  3DBA A;  4N1H A;  2OLV A;  3PR6 A;  3T4K A;  5CXW A;  4O8G A;  3S7Q A;  3HUO A;  3V3S A;  2W3F A;  4Y17 A;  4YWZ A;  1AXB A;  1S1Z A;  4DKI A;  1PW1 A;  4DRT A;  4UA9 A;  1K57 C;  4II7 A;  1T18 A;  3NOP C;  4OKP A;  3AGF A;  3NJA A;  4KQO A;  3N8S A;  4KG5 A;  1YSP A;  2ZC4 B;  3RJU A;  3H82 A;  3O5Y A;  3KSI A;  4WMC D;  4UQI M;  3A3J A;  5TR7 A;  4GZB A;  1L3L A;  3WRT A;  5EVI D;  3BFF A;  3HLG A;  1L2S A;  4B93 A;  1TS8 A;  2X71 A;  3KO6 A;  2VZW A;  3JVV A;  2Y2M A;  3OPH A;  4JXS A;  4PAU A;  3FPW A;  2Y2G A;  4PM7 A;  4N1X A;  3LGO A;  4KZ9 A;  3S1Y A;  2QHK A;  2Y2I A;  1Y4O A;  1HZO A;  4CQH A;  4OVD A;  3IWI A;  5TBM B;  4YFM A;  3UN7 A;  4OLD A;  4X53 A;  1IFQ A;  4E6W A;  4Y0T A;  3JYI A;  4DE0 A;  4LLO B;  4QY5 A;  5EOE A;  1K55 C;  1SCW A;  4MEZ A;  4DJ3 A;  4S2N A;  4QY6 A;  3D72 A;  4BL2 A;  4OPR A;  2EX6 A;  4HI4 A;  2LB9 A;  4P6Z S;  2B02 A;  1OJ5 A;  2FZ0 A;  5HAQ A;  2W27 A;  5DTS A;  1F2K A;  5EVI C;  4GCZ A;  1S1Y A;  2VEA A;  2WKH A;  1VEU B;  3ZG8 B;  3HLE A;  2WK0 A;  4OPQ A;  5FEF A;  4FUW A;  3N8R A;  3FPV A;  1ES4 A;  2Y2N A;  4R23 A;  1XFQ A;  2H0Y A;  2PBD P;  4HBU A;  4K0W A;  3NDE A;  3N4I A;  3HLC A;  1H8Z A;  1NRF A;  3B33 A;  4ETX A;  4JKT A;  2O0Y A;  3NI9 A;  1NWZ A;  3NHQ A;  4MLL A;  3SH9 A;  4Y5F A;  4B9O A;  3IXB A;  3V39 A;  4H6J B;  3IQA A;  3MBZ A;  5DKK A;  3E2L A;  1OJG A;  1VQQ A;  1LL5 A;  4GOG A;  4K91 A;  3CLO A;  1BYW A;  5G4Z A;  3OPL A;  2I9V A;  4JXW A;  3PHY A;  4JXV A;  2D01 A;  2ZLY A;  2E8I A;  4HBT A;  4EBL A;  5EVI B;  3SZT A;  4X1L A;  2QJ5 A;  5FDS A;  1DP9 A;  3M6H A;  1C3B A;  4Z9Q A;  4R1G A;  5HSQ A;  5AQ7 A;  3C5A A;  4GDN A;  3Q82 A;  1LL9 A;  1JTG A;  2HZ5 A;  3LCE A;  2VV6 A;  2Z2M B;  4KZ5 A;  5AVE A;  2W3D A;  3HCY A;  3DTI A;  1JWZ A;  3FKV A;  3FYZ A;  1IYS A;  1NYY A;  3ZNY A;  1PIO A;  5F1G A;  2WGV A;  2WKI A;  4MDZ A;  2GDN A;  2HPB A;  4GN2 A;  4XT2 B;  2JKT M;  3U4L P;  4BMW A;  2C5W B;  2JKR I;  3HLD A;  5HWV A;  4R3J A;  5J3W A;  1PFL A;  2Y59 A;  1LL8 A;  3WS1 A;  2A24 A;  2Z6C A;  3DWZ A;  3G2Y A;  1BLH A;  5CHU A;  4UA7 A;  4A5R A;  3IF5 A;  5HPF A;  1OTA A;  2B95 A;  4B4Z A;  2PYP A;  3BQ8 A;  1CQA A;  2HDU A;  5M18 A;  1WE4 A;  1J3W A;  3G32 A;  2VGK A;  1KE4 A;  4K0X A;  3QP1 A;  4DF6 A;  1YLJ A;  3IBJ A;  4IUK A;  4Y0U A;  3H7W A;  3HUN A;  5EE8 A;  3V5M A;  4B88 A;  4CJN A;  2XFS A;  2JN7 A;  5GHY A;  1FQG A;  5EEC A;  4IED A;  1E4D A;  1ERQ A;  2ZQA A;  4LCM A;  5HWT A;  3F1P A;  3TRC A;  3VFH A;  5LBR A;  1LHY A;  1K55 A;  3IXH A;  4NXB A;  3CPT A;  3OZH A;  2XEP A;  5E2H A;  1PNE A;  5JYP A;  1YQS A;  1XJ2 A;  4MMN A;  3ZCZ A;  1DRM A;  4BD1 A;  5DFY A;  5CER A;  2QPN A;  2ZOI A;  4NXG A;  5AVF A;  1L0E A;  2XH9 A;  3Q7V A;  3BFG A;  5FAQ A;  3UNW A;  1IEM A;  4EUV A;  2X02 A;  2Y4A A;  5DTK A;  3K2N A;  3IF6 A;  3UB5 P;  3N8L A;  2C6W B;  1MZU A;  2J80 A;  3MKE A;  3WRZ A;  2VLG A;  2XGN A;  2XD5 A;  4OLG A;  4HY8 A;  1NLY A;  3KSH A;  1K56 A;  1DP6 A;  2XRO A;  2HDQ A;  3C4P A;  1CEG A;  3ZGA B;  4FH2 A;  1EI5 A;  1FCO A;  4WBG A;  3T4L A;  1TF1 A;  4K08 A;  3SH7 A;  1GSW A;  3LIE A;  5DF7 A;  2JKF A;  5A93 A;  1QME A;  5JYO A;  4WLA A;  2AVX A;  1ZG4 A;  4LRZ E;  5KSC A;  3QNB A;  5IS1 A;  1ONH A;  2JKG A;  5GHZ A;  3PBT A;  3IX8 A;  1S67 L;  2PDR A;  4HP9 A;  1ZHH B;  4NEE D;  3BLS A;  3EEA A;  4UQI S;  3R7W A;  3LY4 A;  1ZTU A;  3T4S A;  4GB7 A;  3P7N A;  1H0M A;  2OLU A;  1MWU A;  2PR5 A;  3WS4 A;  2Z2L B;  4RA7 A;  5EM1 A;  4JBF A;  3UY6 A;  1GHM A;  2J9P A;  4HEF A;  2P08 A;  2QWS A;  4R4S A;  4I38 A;  3W8K A;  4E3J A;  4Y3I A;  3NBL A;  2W0N A;  2Y2P A;  3UMD A;  4OQ0 A;  1ES2 A;  4MCW A;  5FI2 A;  4S2N C;  3CZD A;  5CX7 A;  1P97 A;  2QMI A;  3SS4 A;  4YOF A;  2PD7 A;  1EW0 A;  4ZDX A;  2KX6 A;  1FOF A;  5L8M A;  5IT5 A;  4H8R A;  3F1N B;  1SHV A;  4LV3 A;  1IOU A;  3UDX A;  1YMS A;  1YLZ A;  1FSW A;  5HAI A;  3GSG A;  2OWJ A;  2PBY A;  2OWH A;  4KZ7 A;  1OME A;  4IBX A;  2JC7 A;  4BL3 A;  4EER A;  3LI9 A;  5EFW A;  3VE4 A;  3LYX A;  4OP5 A;  3RH8 B;  4WN5 A;  3DTE A;  4C3Q A;  1LI9 A;  1KDS A;  5U47 A;  3F1O A;  2Z6D A;  1ODV A;  3CG5 A;  2W3G A;  4S2P A;  3E98 A;  4Q0I A;  3WS5 A;  2WKQ A;  4R3A A;  4FD8 A;  4MN6 A;  2HGV A;  3LI8 A;  1NZU A;  3B42 A;  4UAA A;  4OQH A;  1D1J A;  4S2O A;  2G2W A;  3DTK A;  3LR5 A;  1P9W A;  5GLD A;  4LFU A;  2HP5 A;  3PBO A;  4G3V A;  2P9V A;  3BFD A;  1DJC A;  1BLS A;  4EBN A;  1OT6 A;  4X68 A;  4YIN A;  4LV1 A;  4IJG A;  3HRE A;  4R38 A;  4BEN A;  3PBS A;  1T19 A;  3A3I A;  4DJ2 A;  4OOY A;  1CJF A;  1YLT A;  2Y8H A;  3OBF A;  4S2L A;  4DXC A;  1X0O A;  1K25 A;  3C38 A;  2DRW A;  1FIL A;  1PI4 A;  2J9O A;  1VB6 A;  1XKZ A;  1ERO A;  3UE1 A;  2A3U A;  4NG2 A;  3NEC A;  2GZA A;  4EET B;  5KSH A;  4JXG A;  5CED A;  1MBL A;  2PR6 A;  4DDY A;  4HH2 A;  3W4Q A;  4Q8I A;  1LI0 A;  1XGI A;  1BUE A;  5CHM A;  3V50 A;  3DWK A;  2R78 A;  3OPP A;  4KG6 A;  3OC2 A;  4GW9 A;  4L9F A;  1F98 A;  3ZHH A;  5AQ9 A;  3O88 A;  1XJ6 A;  3AGD A;  5FAO A;  4F94 A;  3CUE A;  3O86 A;  2VV7 A;  3QNC A;  4PM8 A;  4FSF A;  5EVE A;  5FAS A;  4QHC A;  4EWF A;  3UB6 A;  2V20 A;  4OQI A;  3MFX A;  4GS9 A;  4LV2 A;  1HD8 A;  5EOO A;  5FAT A;  5CTN A;  1PZO A;  4MN5 A;  5CHJ A;  3A3D A;  4U0X A;  3D9Y A;  3E2K A;  3ZG5 A;  3A0R A;  1QMF A;  3LUQ A;  1BLP A;  3AGE A;  1HLU P;  4HQA A;  4WYY A;  3PAG A;  1ESI A;  1MWT A;  3GV9 A;  3MMH A;  2M7V A;  1WYC A;  2B18 A;  4HOI A;  5M1A A;  1YLP A;  4U3T A;  1K56 D;  1JNU A;  2HDR A;  4ESP A;  3QHY A;  2VJW A;  1N9B A;  4DE1 A;  4GLQ A;  4EQI A;  2R9X A;  1I2W A;  4JGO A;  2OSU A;  3HLF A;  1W8Q A;  4LGW A;  4BBV A;  4S2M A;  2BAS A;  4G3W A;  4D60 A;  3BLM A;  2H0T A;  4P6B A;  5F83 A;  2PYR A;  5KMW A;  2XK1 A;  5HAP A;  3PBQ A;  2A24 B;  3MJQ A;  3T12 B;  2ZL1 A;  1KOU A;  3EGD C;  5HL6 A;  4IVI A;  3HJI A;  4XXR A;  4QD4 A;  1IEL A;  3T1S A;  4DE2 A;  2HF6 A;  3E4P A;  3L7H A;  3IF6 C;  3WS2 A;  3G31 A;  1LSV A;  1NY0 A;  5TJJ A;  2PAV P;  5J4E A;  1Y54 A;  4PM5 A;  1OTD A;  5GLA A;  2Y2O A;  3H7W B;  4Y0O A;  2ZD8 A;  3TE8 A;  2QKP A;  1MXO A;  5FL3 A;  1O07 A;  2WZZ A;  4Y7P A;  2WGW A;  2XR0 A;  3IT9 A;  2I72 A;  4IHQ A;  3QP4 A;  4HHD A;  4MNR A;  5HPI A;  4EEP A;  4JGQ A;  1VET A;  3VE3 A;  3RXX A;  1N9L A;  4JF6 A;  1KGE A;  1NLZ A;  4NET A;  3CPT B;  3IWO A;  2K7S A;  3ITB A;  2J3T D;  3OCL A;  2RL3 A;  4F3L A;  4E04 A;  3C2W A;  1XJ4 A;  3C4O A;  1JTD A;  5GL9 A;  3M6B A;  3S7P A;  2XRN A;  1BLC A;  3Q7V B;  4UEY A;  4D2O A;  1S4S A;  1LSW A;  5FQJ A;  2H28 A;  1BUL A;  5F5Y A;  5GHX A;  4OON A;  3OOV A;  5FQQ A;  4BBU A;  3IF6 B;  1SKO A;  2JHE A;  1CI8 A;  2Q0O A;  4PKY A;  2JKR M;  5HWW A;  5K5B A;  1YM1 A;  3OCN A;  5A8B A;  4PMA A;  5F1F A;  1FR6 A;  3NIA A;  3I7J A;  3S7N A;  1XX2 A;  2WYX A;  2ZQC A;  1W5D A;  4GD6 A;  5G18 A;  1UWP X;  2P7J A;  3A0V A;  4S2I A;  1YMX A;  3T4J A;  1K38 A;  4LRY C;  4S2K A;  3ZYT A;  2V1Z A;  2WAE A;  2B5R A;  5TBM A;  1TD5 A;  3IS2 B;  3T4Q A;  5I94 A;  4WEL A;  2W1T A;  4E3O A;  4OQG A;  3BQA A;  4KEN B;  3GEC A;  2O9A A;  2WKR A;  3MFD A;  3C7V A;  4L0L A;  2PU4 A;  2J3T C;  4C6Y A;  4X56 A;  3PAE A;  4GHI A;  2V9A A;  1W63 Q;  4PM9 A;  2CMN A;  2M7U A;  2EFX A;  1ALQ A;  4AFI A;  5AJG A;  5EVL A;  2WAF A;  3R7W B;  3Q07 A;  4QU3 A;  4WF0 A;  1DP8 A;  2VK3 A;  2UWX A;  4NK3 A;  4E3N A;  3QP2 A;  3HLB A;  1YKD A;  1LSX A;  1FIK A;  3UPO A;  3EEH A;  3LR3 A;  1N4O A;  4LPZ A;  4HIA A;  1E3U A;  2ZMV A;  3E0Y A;  2IWD A;  3UME A;  4X69 A;  2HP9 A;  4GJ4 A;  2KOI A;  4LCL A;  3T1R A;  1STZ A;  2HDS A;  3BYD A;  3TOI A;  4QJG A;  3A3E A;  2ZBB A;  2ZC6 B;  4O01 A;  2WZX A;  5F82 A;  5DJT A;  2ZC5 B;  3KYQ A;  3B47 A;  2V0U A;  4Z1W A;  2ZOH A;  4KZ3 A;  2XFT A;  4WEJ A;  2ZJ9 A;  2EWV A;  2BLS A;  1YAX A;  2XQZ A;  3RTY A;  5DTT A;  3IXG A;  1XFN A;  2QYB A;  3UDF A;  4EXO A;  2ZC3 B;  1K54 A;  2IWC A;  3LIA A;  2K2N A;  3P09 A;  4ZJ1 A;  1TS6 A;  2WKE A;  1GSX A;  4CLC E;  1Y28 A;  4I3I A;  4WEK A;  1MC0 A;  1DJA A;  3BFC A;  2IWB A;  3TJZ C;  3IWQ A;  2OAP 1;  3LIF A;  3EQU A;  3BJN A;  3T4O A;  3UDI A;  1RGY A;  4KZB A;  1H3Q A;  4M3K A;  5EM0 A;  3FKW A;  3T1X A;  3LO7 A;  1VM1 A;  1YSQ A;  2PT7 A;  2Q9M A;  2Y2J A;  3MXS A;  4NXF A;  2EXB A;  5E2G A;  2ZM0 A;  3CUE C;  5HAR A;  1BTL A;  4CPK A;  2XLN A;  1W79 A;  3G34 A;  1IYQ A;  2A2L A;  4Y2F A;  4R0Q A;  1LLB A;  1XJ3 A;  1VHM A;  2P9V B;  3FZC A;  3ISG A;  4OPZ A;  1I2S A;  1A0K A;  2LB5 A;  2Y2L A;  3T50 A;  2WGI A;  2L4R A;  1D7E A;  5HDS A;  1W8Y A;  1GA0 A;  1MY8 A;  1XA7 A;  1K6R A;  4DN0 A;  1SZV A;  1XXM A;  1AWI A;  1W63 M;  4N9K A;  5DKL A;  2VKS A;  1OTB A;  5L10 A;  4ID4 A;  3QP8 A;  4I3A A;  1CEF A;  4L9G A;  4I3J A;  4KG2 A;  2EX9 A;  2RCX A;  2M1C A;  2UV0 E;  3ZVW A;  4BWI A;  2XD1 A;  3LIB A;  3H82 B;  2QJ7 A;  1E25 A;  3ITA A;  2ZM2 A;  1G28 A;  3PYP A;  1T1C A;  4JLF A;  3MZF A;  2EXA A;  3EGX C;  1ESU A;  3UE6 A;  3IHB A;  3ULF A;  2XDM A;  1TS7 A;  3SS5 A;  3CJM A;  4HH3 A;  4Y15 A;  4UA6 A;  4HJ3 A;  1NXY A;  4OOL A;  2GJ3 A;  1H8M A;  4ZJ2 A;  4Q0H A;  2XF3 A;  4R4R A;  5DVA A;  3TW8 A;  3UE0 A;  3VP1 A;  4OOM A;  1P9R A;  3OLO A;  3WS0 A;  2ZQ7 A;  2VGJ A;  1TDG A;  3SS3 A;  3JPU A;  2D02 A;  3VV4 A;  3FV7 A;  3QP6 A;  1NJ4 A;  3LID A;  4RQ9 A;  1GHI A;  3NCK A;  3K3D A;  1YLW A;  4WZ5 C;  3VFF A;  2JE5 A;  4C75 A;  2GX5 A;  3CMZ A;  5FQ9 A;  1F9I A;  1G5U A;  1TS0 A;  1OT9 A;  4HP4 A;  3ZVT A;  3V3R A;  1NRJ A;  3VP2 A;  3S4X A;  1UGU A;  1CK3 A;  4O0P A;  5DF8 A;  5MC7 A;  3U2A A;  3SW1 A;  3BY8 A;  1JWP A;  3VOL A;  3TG9 A;  1XPB A;  1MPL A;  2ZM8 A;  4I39 A;  2EFU A;  1J9M A;  4BD0 A;  3IX4 A;  1KGF A;  5G4Y A;  3G35 A;  2JBF A;  2V1A A;  1SKF A;  4X25 A;  2ZMF A;  3EWK A;  4BJP A;  3LIC A;  1N9O A;  4X55 A;  2KLI A;  4L9E A;  3UPP A;  1JWV A;  3VOY A;  1I5Q A;  5CGX A;  3G30 A;  3BEB A;  3E4O A;  4ARZ A;  1E3U D;  2VGL M;  2ZQ8 A;  2P74 A;  1S0W A;  5IU1 A;  2WGW B;  3GVB A;  5TFQ A;  2WUQ A;  3G2Z A;  2DCF A;  2V8C A;  1OTE A;  5HL1 A;  4X6T A;  3HLW A;  3Q1F A;  2BG1 A;  5CTM A;  1VET B;  5FA7 A;  5HW3 A;  3KSF A;  1ERM A;  5FAP A;  4ZAM A;  4MBF A;  4XUZ A;  2O99 A;  3GQZ A;  2R9W A;  1ES5 A;  1JVJ A;  1OPX A;  4P85 A;  5HDC A;  4F3L B;  1PWC A;  4EU0 A;  1Q2Q A;  4KZ6 A;  1H5X A;  3C8C A;  2A49 A;  3NOT C;  1O7E A;  3VP4 A;  5F69 A;  2JCH A;  3F1N A;  4HJ4 A;  2V1B A;  2NUT C;  3GDI A;  2V2F F;  3WWX A;  1SKO B;  1PW8 A;  5KZH A;  4ZTK A;  3IBR A;  5FSR A;  4CLC A;  1XGJ A;  1FCM A;  4NXE A;  2VX8 A;  4WZ4 A;  5HX9 A;  4PKY G;  2NUP C;  5F6A A;  2O9B A;  1OTI A;  2Y2Q A;  4JF5 A;  1K6S A;  4EUZ A;  1M6K A;  4O7D A;  4E6X A;  2G7U A;  3BFE A;  4M4X A;  2OOL A;  2W3E A;  4KQQ A;  1MKI A;  4JGR A;  3MXR A;  4GNU A;  4DXB A;  5FDH A;  5GLC A;  3BY9 A;  3LFV A;  2W1T B;  2Y2K A;  4FOF A;  3ZG9 B;  2Y55 A;  4X1M A;  3PXP A;  4G3K A;  2Y2H A;  4HES A;  2O9C A;  3C30 A;  4KZ4 A;  5IHV A;  1FSY A;  2G2U A;  5HD5 A;  3EOI A;  5DFX A;  4GHI B;  3MR0 A;  1YLY A;  1K54 C;  4KUO A;  3ZNT A;  3NOU C;  3UB7 A;  2INW A;  3M2J A;  4ETZ A;  3MS6 A;  4KQR A;  1KVM A;  2J7V A;  3T1Q B;  2GNX A;  1GSV A;  4QPR A;  3UE3 A;  3E4Q A;  2IA2 A;  3MF0 A;  3FWL A;  4PPR A;  3LY3 A;  3O3V A;  5FI6 A;  4WZ5 A;  3FC7 A;  5KIZ A;  1IKG A;  4KQD A;  3CI6 A;  3D4F A;  3F1P B;  3IH9 A;  3CIT A;  4IBR A;  2XA7 M;  1LT0 A;  5E2E A;  3GTC A;  3DTM A;  4B4X A;  1KE3 A;  2L1M A;  3CWF A;  3D3O A;  4P0M A;  1P0Z A;  1U60 A;  1NZO A;  4PHT A;  4BLM A;  3RFB A;  4OPY A;  4EEU A;  2H5S A;  5FI7 A;  4N92 A;  4FTX A;  1YT4 A;  3LR0 A;  5TGF A;  5L09 A;  1Z09 A;  2OAQ 1;  3A3F A;  3KYE A;  4RYE A;  3BRM A;  1SDE A;  1DY6 A;  3LR4 A;  1CF0 A;  3PTE A;  4EW7 A;  3UO9 A;  5CEB A;  2FH5 A;  5DJU A;  4OH0 A;  5CGS A;  3BWL A;  1V9Y A;  3KSG A;  3NDG A;  4OP8 A;  2VA0 A;  4U0T A;  3Q7Z A;  1NYM A;  2DMW A;  4KUK A;  1H8Y A;  1T1A A;  3SOI A;  5A90 A;  1PI5 A;  2WAD A;  1GA9 A;  1K57 A;  1KVL A;  1PRQ A;  3EQV A;  5J7E A;  4MN7 A;  1ZC2 A;  3H9W A;  1L0F A;  3HL9 A; 
#chains in the Genus database with same CATH homology
 1K4F A;  4Y0T A;  3JYI A;  4S2O A;  4CPK A;  4DE0 A;  2G2W A;  2XLN A;  4QY5 A;  5EOE A;  1W79 A;  2FFF B;  3G34 A;  3TSG A;  5GLD A;  1K55 C;  1SCW A;  4MEZ A;  4S2N A;  1IYQ A;  4QY6 A;  4FCF A;  4R0Q A;  4BL2 A;  4OPR A;  2HP5 A;  1LLB A;  2EX6 A;  3MKF A;  3PBO A;  2P9V A;  3BFD A;  1DJC A;  2P9V B;  1BLS A;  3FZC A;  3ISG A;  4EBN A;  4OPZ A;  1I2S A;  4X68 A;  4YIN A;  4LV1 A;  5HAQ A;  5DTS A;  2Y2L A;  3HRE A;  2WGI A;  5EVI C;  1BT5 A;  4BEN A;  1RCJ A;  5A92 A;  3PBS A;  4ZBE A;  1EWZ A;  1W8Y A;  2WKH A;  1GA0 A;  1MY8 A;  1XA7 A;  4E3I A;  1K6R A;  5FQI A;  3ZG8 B;  3A3I A;  4OOY A;  3W4O A;  5M19 A;  1YLT A;  2H10 A;  4S2L A;  4DXC A;  1XXM A;  1IKI A;  3HLE A;  4N9K A;  2WK0 A;  1K25 A;  4OPQ A;  2DRW A;  1PI4 A;  4ID4 A;  1IYP A;  2J9O A;  1CEF A;  3N8R A;  1W7F A;  1BSG A;  2DNS A;  1XKZ A;  1ERO A;  3OPR A;  4E3K A;  1ES4 A;  2A3U A;  3UE1 A;  2Y2N A;  4GD8 A;  4KG2 A;  4R23 A;  2EX9 A;  2H0Y A;  3M2K A;  3VSL A;  5KSH A;  4HBU A;  4JXG A;  5CED A;  4K0W A;  1MBL A;  4DDY A;  3ZG0 A;  3NDE A;  2RCX A;  3N4I A;  3HLC A;  1H8Z A;  1K4E A;  5EPH A;  3W4Q A;  4Q8I A;  1LI0 A;  1XGI A;  1BUE A;  1NRF A;  2FFY A;  4JKT A;  5CHM A;  3V50 A;  4EV4 A;  3NI9 A;  4MLL A;  3DWK A;  3SH9 A;  3OPP A;  4KG6 A;  3OC2 A;  3ZVW A;  3ZHH A;  2CC1 A;  2XD1 A;  5AQ9 A;  3O88 A;  3AGD A;  3IXB A;  1E25 A;  5FAO A;  3V39 A;  4F94 A;  3ITA A;  3G4P A;  2ZM2 A;  3IQA A;  3MBZ A;  4JLF A;  5HFO A;  3O86 A;  2PU2 A;  3QNC A;  3MZF A;  4FSF A;  4PM8 A;  5FAS A;  4QHC A;  2EXA A;  4EWF A;  1BZA A;  3E2L A;  3BM6 A;  1ESU A;  1VQQ A;  3IHB A;  3VOZ A;  2V20 A;  4OQI A;  1LL5 A;  4WMC A;  5D3O A;  5A91 A;  1S6R A;  4GOG A;  4DE1 A;  2XDM A;  4LV2 A;  3SS5 A;  3O87 A;  4K91 A;  1HD8 A;  4JPM A;  5EOO A;  3OPL A;  5FAT A;  3CJM A;  4JXW A;  5CTN A;  1PZO A;  3PBN A;  4UA6 A;  5CHJ A;  4JXV A;  4ZJ3 A;  4DE3 A;  2ZLY A;  1NXY A;  2E8I A;  4OOL A;  3A3D A;  3ZDJ A;  4ZJ2 A;  4U0X A;  4HBT A;  2XF3 A;  3E2K A;  4R4R A;  4RX2 A;  5DVA A;  5EVI A;  3UE0 A;  3ZG5 A;  4EBL A;  5EVI B;  1QMF A;  1BLP A;  4RVA A;  3AGE A;  4OOM A;  3VP1 A;  1KGG A;  1L0G A;  4WYY A;  3M6H A;  3WS0 A;  3PAG A;  4BQM A;  5CEC A;  1C3B A;  1ESI A;  2ZQ7 A;  4EBP A;  4Z9Q A;  1MWT A;  2VGJ A;  3GV9 A;  1TDG A;  3SS3 A;  2ZC7 A;  1WYC A;  4R1G A;  5AQ7 A;  5M1A A;  1Q2P A;  1YLP A;  3C5A A;  4U3T A;  1K56 D;  3Q82 A;  1LL9 A;  4GDN A;  1JTG A;  3FV7 A;  3LCE A;  1NJ4 A;  2Z2M B;  4KZ5 A;  1GHI A;  2HDR A;  3NCK A;  1FR1 A;  1TDL A;  1ONG A;  3QHY A;  1JWZ A;  1YLW A;  2Q9N A;  4MBH A;  3FKV A;  3FYZ A;  1IYS A;  1N9B A;  1NYY A;  2JE5 A;  4WZ5 C;  1PIO A;  5F1G A;  3VFF A;  3CMZ A;  2WGV A;  4LEN A;  2R9X A;  1I2W A;  4XUX A;  5FQ9 A;  3ZG7 B;  4EQI A;  3VMA A;  3NY4 A;  4MBK A;  2OSU A;  2WKI A;  3HLF A;  3GR2 A;  1M40 A;  4IED A;  2GDN A;  2HPB A;  4FH4 A;  4GN2 A;  1W8Q A;  5BOH A;  2C5W B;  3HLD A;  4S2M A;  4R3J A;  1MWR A;  3ZVT A;  3BLM A;  2OV5 A;  4KZA A;  2H0T A;  2Y59 A;  4P6B A;  5F83 A;  3V3R A;  3WS1 A;  3VP2 A;  5KMW A;  2XK1 A;  3S4X A;  5HAP A;  3PBQ A;  2EX8 A;  3DWZ A;  1CK3 A;  3G2Y A;  4QB8 A;  5L2F A;  1BLH A;  3VP3 A;  5CHU A;  5DF8 A;  4UA7 A;  4A5R A;  3IF5 A;  1MWS A;  4GKU A;  3RXW A;  1RP5 A;  3PBR A;  4RX3 A;  1JWP A;  4E3L A;  5J8X A;  4IVI A;  3VSK A;  3IXD A;  2QZ6 A;  3TG9 A;  3C7U A;  4XXR A;  1XPB A;  4QD4 A;  4B4Z A;  1PWG A;  2J8Y A;  1IEL A;  1KE0 A;  1MPL A;  2HDU A;  5M18 A;  2ZM8 A;  2EFU A;  1J9M A;  4DE2 A;  4BD0 A;  1WE4 A;  1KGF A;  3G32 A;  3G35 A;  2JBF A;  2VGK A;  3HVF A;  1KE4 A;  1SKF A;  2ZQD A;  4K0X A;  4N9L A;  3IF6 C;  4GDB A;  3WS2 A;  3G31 A;  4BJP A;  1NY0 A;  4X55 A;  1G68 A;  4DF6 A;  1YLJ A;  1Y54 A;  3UPP A;  4PM5 A;  4Y0U A;  3ZNY A;  1JWV A;  3P98 A;  5GLA A;  3VOY A;  5DF9 A;  4S2J A;  1I5Q A;  4R3B A;  2Y2O A;  4Y0O A;  5CGX A;  3HUN A;  3G30 A;  5EE8 A;  3BEB A;  3V5M A;  1L0D A;  2ZD8 A;  4B88 A;  1E3U D;  3GMW A;  1MXO A;  2ZQ8 A;  4CJN A;  2XFS A;  1O07 A;  2WZZ A;  5GHY A;  4Y7P A;  1FQG A;  2P74 A;  2WGW A;  1S0W A;  2XR0 A;  2Y91 A;  3IHA A;  3IH8 A;  2WGW B;  3GVB A;  3HBR A;  3IT9 A;  1E4D A;  5HAR A;  1IYO A;  5TFQ A;  2WUQ A;  1ERQ A;  3SH8 A;  3G2Z A;  2I72 A;  2DCF A;  4PM6 A;  5HL1 A;  3S22 A;  4JF4 A;  2ZQA A;  4LCM A;  4X6T A;  3HLW A;  3Q1F A;  4MNR A;  2BG1 A;  1DJB A;  3VFH A;  5CTM A;  5FA7 A;  5FQK A;  5HW3 A;  2X01 A;  1GHP A;  3RXX A;  1LHY A;  4JF6 A;  1K55 A;  1KGE A;  1ERM A;  3IXH A;  5FAP A;  3OZH A;  1FCN A;  4NET A;  1HVB A;  4ZAM A;  2XEP A;  4MBF A;  4XUZ A;  5E2H A;  3GQZ A;  5JYP A;  3IWO A;  2R9W A;  3ITB A;  1ES5 A;  1YQS A;  3HUM A;  1PYY A;  1JVJ A;  5GLB A;  3ZCZ A;  3OCL A;  2RL3 A;  4P85 A;  4LV0 A;  4BD1 A;  1PWC A;  1KDW A;  5CER A;  4UHU A;  2QPN A;  1ZKJ A;  3C4O A;  1JTD A;  4E3M A;  1Q2Q A;  5GL9 A;  4KZ6 A;  3W4P A;  1L0E A;  1H5X A;  2XH9 A;  3M6B A;  3Q7V A;  1BLC A;  3BFG A;  3Q7V B;  4D2O A;  2A49 A;  5FQJ A;  1BUL A;  2ZQ9 A;  5EUA A;  5FAQ A;  1O7E A;  5GHX A;  3VP4 A;  5CGW A;  3UNW A;  1IEM A;  2X02 A;  4WM9 A;  4OON A;  5AQB A;  2Y4A A;  2JCH A;  5DTK A;  3IF6 A;  5FQQ A;  2ZMA A;  1HTZ A;  2V2F F;  3IF6 B;  4P87 A;  1CI8 A;  1CI9 A;  3N8L A;  5FQM A;  1XP4 A;  3WWX A;  1PW8 A;  5KZH A;  4ZTK A;  3UPN A;  1YM1 A;  3OCN A;  2C6W B;  4PMA A;  5F1F A;  3MKE A;  1FR6 A;  3NIA A;  3I7J A;  1Z6F A;  5FSR A;  1TVF A;  1XX2 A;  2WYX A;  3WRZ A;  2XGN A;  1G6A A;  1XGJ A;  4C75 A;  1FCM A;  2ZQC A;  4KZ8 A;  1W5D A;  2XD5 A;  4OLG A;  4WZ4 A;  3N6I A;  4GD6 A;  5G18 A;  5HX9 A;  4S2I A;  2Y2Q A;  1K56 A;  1YMX A;  4JF5 A;  1K6S A;  4EUZ A;  1M6K A;  2HDQ A;  3C4P A;  1CEG A;  3ZGA B;  4FH2 A;  1K38 A;  4O7D A;  4E6X A;  3BFE A;  1EI5 A;  1PZP A;  4S2K A;  1FCO A;  2V1Z A;  2WAE A;  2B5R A;  3GRJ A;  4KQQ A;  1MKI A;  3NC8 A;  1ZG6 A;  3MXR A;  3MZE A;  3N7W A;  4WBG A;  3VP0 A;  4GNU A;  4DXB A;  5FDH A;  5I94 A;  4WEL A;  5GLC A;  3BEC A;  2Y2K A;  3MZD A;  4IVK A;  3ZG9 B;  2Y55 A;  4OQG A;  3ZFZ A;  4E3O A;  5AQA A;  4KEN B;  1RGZ A;  5E2F A;  3SH7 A;  1GCE A;  2Y2H A;  4HES A;  5DF7 A;  5A93 A;  3MFD A;  3C7V A;  4KZ4 A;  5IHV A;  4L0L A;  1WYB A;  2PU4 A;  1QME A;  1XA1 A;  5JYO A;  4C6Y A;  1FSY A;  1ZG4 A;  3B3X A;  5KSC A;  3DW0 A;  2G2U A;  3QNB A;  3LEZ A;  4X56 A;  3Q81 A;  1ONH A;  1PWD A;  2HP6 A;  5GHZ A;  3PBT A;  4DDS A;  3PAE A;  1SDN A;  4PM9 A;  1ES3 A;  2EFX A;  1YLY A;  3BLS A;  1ALQ A;  1K54 C;  1TEM A;  5CRF A;  5E43 A;  3LY4 A;  5EVL A;  2WAF A;  3ZNT A;  3Q07 A;  2EX2 A;  4GB7 A;  3M2J A;  4N1H A;  4KQR A;  4QU3 A;  1KVM A;  2OLV A;  2OLU A;  1MWU A;  2J7V A;  5CXW A;  3WS4 A;  2UWX A;  4NK3 A;  2Z2L B;  4RA7 A;  3UE3 A;  4E3N A;  3HLB A;  4JBF A;  3HUO A;  3V3S A;  4PPR A;  3FWL A;  1AXB A;  3UY6 A;  1GHM A;  2J9P A;  3LY3 A;  4HEF A;  3UPO A;  3O3V A;  5FI6 A;  4DKI A;  1PW1 A;  4WZ5 A;  1N4O A;  1E3U A;  4DRT A;  1IKG A;  2IWD A;  4UA9 A;  4R4S A;  3D4F A;  4X69 A;  4UAA A;  3IH9 A;  2HP9 A;  4IBR A;  1K57 C;  3W8K A;  5E2E A;  4LCL A;  4E3J A;  3GTC A;  3DTM A;  4OKP A;  3AGF A;  4KQO A;  2HDS A;  3BYD A;  3TOI A;  4QJG A;  3N8S A;  4B4X A;  1KE3 A;  3A3E A;  3NBL A;  2Y2P A;  4KG5 A;  4P0M A;  2ZC4 B;  2ZC6 B;  3RJU A;  1U60 A;  2WZX A;  5F82 A;  1NZO A;  4OQ0 A;  1ES2 A;  4WMC D;  5FI2 A;  4S2N C;  2ZC5 B;  3CZD A;  4BLM A;  2QMI A;  4OPY A;  3SS4 A;  3A3J A;  2H5S A;  5TR7 A;  4KZ3 A;  2XFT A;  5FI7 A;  4N92 A;  4GZB A;  4WEJ A;  3WRT A;  2ZJ9 A;  4ZDX A;  1YT4 A;  2BLS A;  1FOF A;  5TGF A;  5EVI D;  3A3F A;  2XQZ A;  4H8R A;  3BFF A;  3HLG A;  4RYE A;  1L2S A;  3BRM A;  3IXG A;  5DTT A;  1SHV A;  4LV3 A;  1SDE A;  1DY6 A;  2X71 A;  2Y2M A;  3UDF A;  3PTE A;  2ZC3 B;  1K54 A;  2IWC A;  3UDX A;  1YMS A;  3OPH A;  3UO9 A;  1YLZ A;  1FSW A;  5HAI A;  5CEB A;  4JXS A;  3GSG A;  3P09 A;  4OH0 A;  4ZJ1 A;  2Y2G A;  5CGS A;  2PBY A;  2WKE A;  4PM7 A;  4KZ7 A;  3NDG A;  4OP8 A;  1OME A;  4N1X A;  4U0T A;  3Q7Z A;  4IBX A;  2JC7 A;  4BL3 A;  1NYM A;  5EEC A;  4WEK A;  4KZ9 A;  3S1Y A;  1H8Y A;  1DJA A;  2Y2I A;  3BFC A;  4OP5 A;  2IWB A;  3IWQ A;  1HZO A;  4OVD A;  4C3Q A;  3EQU A;  3SOI A;  1LI9 A;  3IWI A;  5A90 A;  1KDS A;  1PI5 A;  5U47 A;  3UDI A;  1RGY A;  4KZB A;  4M3K A;  4YFM A;  3UN7 A;  3FKW A;  4OLD A;  3CG5 A;  2WAD A;  1GA9 A;  4S2P A;  3LO7 A;  1VM1 A;  1K57 A;  1KVL A;  3WS5 A;  4FD8 A;  3EQV A;  2Q9M A;  2Y2J A;  3MXS A;  2EXB A;  1ZC2 A;  4X53 A;  1NZU A;  5E2G A;  2ZM0 A;  4E6W A;  1L0F A;  3HL9 A;  1BTL A;  4OQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...