1U60A

Mcsg apc5046 probable glutaminase ybas
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
309
structure length
309
Chain Sequence
LDANKLQQAVDQAYTQFHSLNGGQNADYIPFLANVPGQLAAVAIVTCDGNVYSAGDSDYRFALESISKVCTLALALEDVGPQAVQDKIGADPTGLPFNSVIALELHGGKPLSPLVNAGAIATTSLINAENVEQRWQRILHIQQQLAGEQVALSDEVNQSEQTTNFHNRAIAWLLYSAGYLYCDAMEACDVYTRQCSTLLNTIELATLGATLAAGGVNPLTHKRVLQADNVPYILAEMMMEGLYGRSGDWAYRVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDEDGNSVRGQKMVASVAKQLGYNVFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional and structural characterization of four glutaminases from Escherichia coli and Bacillus subtilis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Probable glutaminase ybaS
total genus 111
structure length 309
sequence length 309
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.2: Glutaminase.
pdb deposition date 2004-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04960 Glutaminase Glutaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1u60A00
5HX9A 5KMWA 1FCMA 5U47A 3WRTA 5CTMA 4U3TA 3IXHA 1XPBA 5GHZA 3C4OA 3VOYA 4DF6A 3NBLA 3DWKA 1O7EA 3WS4A 4FCFA 3ZHHA 2HDQA 4NK3A 4JXWA 5FQKA 3HLEA 4WBGA 5E2GA 2ZC7A 3LEZA 4N92A 1GCEA 4KZBA 5DTSA 1DJBA 4Y0OA 4PPRA 5KSCA 4KZ9A 4KENB 5FA7A 1IEMA 3A3JA 2EXAA 2ZM8A 4N9LA 4UAAA 3TSGA 1PIOA 4WZ5C 5M19A 4O7DA 4E3NA 5F82A 2GDNA 2P74A 4BD1A 3IWQA 4MBKA 5CXWA 3MXSA 4GDBA 3BYDA 1J9MA 3IXGA 4BQMA 5FAQA 5E43A 5CHMA 2IWBA 1YMSA 1KDSA 4QD4A 2C5WB 4BL2A 2WYXA 3V5MA 1GA9A 2VGKA 4U0XA 2QZ6A 1I2WA 4OQHA 5EPHA 4KZ3A 4DXBA 1BT5A 1WE4A 2WGIA 3PTEA 4UA9A 3ZFZA 2C6WB 3UE0A 1TEMA 1SHVA 3OPRA 1PI4A 3P98A 3NC8A 1K54A 3ZCZA 2XQZA 5GHYA 2X71A 1YLTA 3RJUA 3Q7VA 4CJNA 4WELA 4DE3A 3FWLA 3HUOA 1BSGA 4LV1A 5FDHA 3UPNA 1YM1A 4S2KA 4OKPA 4UA7A 4Y0TA 3IF6C 1PW1A 4OLGA 5CRFA 2BLSA 3VP1A 1XP4A 2ZQDA 3UPOA 2DNSA 1RGZA 2QPNA 2HDUA 3I7JA 2EFXA 2HDSA 3B3XA 4HESA 1BUEA 4M3KA 4MLLA 3W4PA 4EQIA 2UWXA 1YT4A 1W7FA 3CMZA 3PBRA 1WYCA 2Y2HA 4H8RA 3S4XA 5EUAA 3WS0A 3OCNA 5EECA 5HAQA 1K56A 1PZPA 5FI6A 3IWOA 1E25A 4P0MA 4HEFA 5FAOA 5GLBA 4C6YA 3WS5A 4E3KA 2ZQ7A 5HARA 4DRTA 1L0DA 1BLPA 5CGWA 3SOIA 4PM9A 3SH7A 4KQQA 2HP9A 4WMCA 4BL3A 5CHJA 2WKHA 3QNCA 3N7WA 4WMCD 3FZCA 3PBQA 5JYOA 3IH8A 4ZJ2A 1H5XA 1JWPA 4GNUA 1PZOA 3MZDA 3RXWA 3M2JA 4BENA 4EBLA 3W4QA 4S2NA 2I72A 2X02A 1K55A 1LHYA 2HP5A 1PWCA 3V39A 1ES4A 4JPMA 1FCNA 4Z9QA 2Y2LA 4N1XA 3UDXA 1SKFA 2H10A 3N8SA 3G31A 3BM6A 1N9BA 3IHAA 1NYYA 2CC1A 3M6BA 4YINA 1Y54A 1G68A 3O86A 2H0YA 5CEDA 2ZQAA 2XF3A 4KZ4A 4OH0A 4S2LA 5GHXA 4IBXA 1NJ4A 3FKVA 1IYPA 3HLWA 4P6BA 1IYOA 3G34A 2BG1A 5TGFA 3UY6A 4JF4A 4KZ7A 1K38A 5EOOA 4ZDXA 5M1AA 3WS1A 5CEBA 1L0EA 3Q82A 5E2HA 5A90A 4OOMA 3VSKA 1ZC2A 3HLFA 3UN7A 2WADA 3RXXA 1NRFA 2OLVA 2Y91A 2ZC6B 4B4ZA 5EVIB 3ZNTA 3SS4A 2Y55A 4B88A 2J7VA 2IWCA 1YLZA 4JF6A 4L0LA 5TR7A 4A5RA 2R9XA 4K0WA 4OP8A 5DF8A 1KGGA 4PM8A 2Y2NA 2B5RA 5AQBA 3HUNA 3OPHA 4QJGA 1PI5A 1QMFA 1KDWA 3NIAA 3Q1FA 4KZ5A 4E3MA 2A3UA 1JTDA 2IWDA 2RCXA 4Y0UA 1RGYA 2V1ZA 3OC2A 1L0FA 4LV0A 1KVLA 1ZKJA 3MKFA 3VSLA 4E3JA 3HBRA 3HLGA 5EVIA 2HP6A 3HLCA 1K25A 3IT9A 5GLDA 2Y2MA 5EVID 1JTGA 2H0TA 2JE5A 1Q2QA 3G4PA 4JKTA 4N9KA 4S2NC 4E3OA 2PU2A 3DWZA 5TFQA 4WEKA 4GOGA 3C7UA 3GV9A 4Q8IA 3ZG0A 1CEFA 3ZVWA 3Q81A 3G35A 2JBFA 5FQMA 4R4SA 1IYQA 1GHIA 4ZJ1A 4MBHA 5HW3A 1EROA 3O87A 3ZVTA 3UDFA 3BFCA 3MZEA 1PWDA 1S0WA 5DTTA 2ZQCA 3UNWA 4GKUA 2JCHA 3N8LA 3WWXA 1LI0A 1LLBA 4UA6A 4FH2A 5HL1A 4S2IA 2ZC4B 3SS3A 4GD6A 1XA1A 4DXCA 5F83A 2RL3A 3ZGAB 1Z6FA 2HDRA 4WYYA 3PBSA 4EWFA 3QHYA 3CJMA 1EWZA 2Y2PA 1DY6A 1LI9A 1M40A 5HFOA 3M6HA 3UO9A 4LCMA 4OPZA 2WAFA 1MWTA 3ITBA 2XLNA 4R0QA 4U0TA 1MBLA 1K4FA 1K57C 3AGEA 3IWIA 5GLCA 2FFFB 1W79A 2WGWA 1YLYA 4EV4A 5G18A 4RX2A 1CK3A 2E8IA 3LY4A 1PWGA 1XGIA 3S22A 2ZLYA 3PBNA 1E4DA 1IYSA 5J8XA 1BLHA 1BLSA 4RA7A 3HVFA 2ZJ9A 3BEBA 3OPPA 4WEJA 2VGJA 2EX6A 1FQGA 4JXGA 1JWZA 5AQAA 4MEZA 2EFUA 4R1GA 1ES2A 2Y2OA 2WGWB 4JF5A 1O07A 3LO7A 3HL9A 5BOHA 4GB7A 3UDIA 4DE0A 4DE2A 3ZG9B 5HAPA 3IXDA 4GZBA 4EUZA 3S1YA 4R4RA 4DE1A 1VQQA 4S2OA 4KG6A 4KZ6A 2QMIA 5D3OA 3MBZA 3VP3A 4ZTKA 4E3LA 1S6RA 3IXBA 1BZAA 3GMWA 3TOIA 4FD8A 2XD5A 4GN2A 1PW8A 1ESUA 4JXVA 3Q07A 4KG2A 1LL5A 2P9VA 2FFYA 2ZQ8A 3GQZA 3JYIA 1GHMA 4OQGA 1H8ZA 4KQRA 4WZ5A 1MWUA 5E2FA 4BLMA 1PYYA 3AGFA 2J8YA 2OLUA 3G2YA 2XH9A 1YQSA 2WZZA 3PBOA 3UE3A 1ALQA 1EI5A 1SCWA 2Z2LB 3W8KA 4N1HA 1W8QA 4EBPA 4XXRA 1U60A 2WAEA 2G2WA 3IF6B 5FQIA 4LV2A 4DDYA 1TDLA 5EVIC 3QNBA 3C5AA 3ZG8B 5I94A 3GR2A 1FR1A 1YLJA 1HZOA 4KZAA 5L2FA 3DTMA 3A3DA 2ZD8A 1KE3A 3NI9A 4JLFA 4X53A 5F1GA 4RYEA 3FYZA 3WRZA 1DJAA 1K54C 1IKIA 4MNRA 4XUZA 4E3IA 4HBTA 4X69A 3BFGA 5CERA 5FQ9A 4OPQA 5CGXA 4K0XA 4R3JA 5DF7A 4DDSA 4IBRA 2XEPA 3HLBA 4C75A 4ZBEA 4F94A 1E3UA 3IF6A 4P87A 4LENA 2WGVA 1K56D 1ONHA 2Y2QA 5FQQA 5AQ9A 4OVDA 4XUXA 3M2KA 1K6RA 3O88A 4LCLA 3TG9A 1CI9A 3VMAA 1OMEA 4C3QA 4NETA 5FAPA 2XFSA 3N8RA 1FSYA 3PAEA 3VP2A 4B4XA 2Y2GA 5FASA 4R3BA 3UPPA 1TVFA 2R9WA 2J9OA 1W5DA 3BRMA 3GRJA 5FATA 1BTLA 1NZOA 1JWVA 3HREA 3A3FA 3BFDA 3UE1A 1M6KA 5A92A 1ESIA 2V2FF 3DW0A 1KE4A 4QU3A 3MXRA 5A91A 2Y2IA 4X68A 3V3SA 1K4EA 3N4IA 5M18A 2PBYA 1IKGA 1XX2A 1K55C 3IH9A 3NDGA 4OPYA 4E6XA 3EQVA 3Q7ZA 3VOZA 3G32A 1WYBA 3E2KA 3P09A 4WM9A 2G2UA 1MWSA 2Y59A 4FSFA 3EQUA 4PM7A 3ZNYA 4PMAA 1XXMA 4DKIA 2Y4AA 5HAIA 4OPRA 4R23A 1YLWA 3PBTA 4BJPA 1KGFA 1KGEA 5DF9A 3LY3A 5GLAA 2XDMA 2DCFA 5FI7A 4CPKA 2V20A 3HLDA 1G6AA 3O3VA 4PM5A 4QY5A 4P85A 4K91A 1ONGA 2P9VB 3ISGA 3ITAA 4OQIA 3V50A 1LL9A 1NY0A 4X56A 4OOLA 2HPBA 1BULA 2ZMAA 2WZXA 1RCJA 4X6TA 3VP0A 1H8YA 3BFEA 1IELA 1SDEA 1Q2PA 1HVBA 3BFFA 3D4FA 2ZM0A 3BLMA 2PU4A 1AXBA 3IHBA 3G30A 1W8YA 4GDNA 2XR0A 3SH8A 2Y2KA 2ZC3B 4S2PA 5FQJA 2A49A 2JC7A 5FI2A 2ZM2A 4LV3A 5EOEA 3VFHA 3FKWA 4QB8A 5DVAA 1C3BA 1MWRA 4OOYA 3IF5A 1FR6A 3VFFA 1ES3A 2DRWA 3BLSA 2X01A 5JYPA 3ZDJA 2Q9NA 3MZFA 3MKEA 3OCLA 4OQ0A 4MBFA 4QHCA 1CEGA 3AGDA 4ZAMA 1KE0A 1I2SA 4S2MA 5CHUA 3SS5A 1CI8A 4UHUA 1XKZA 4BD0A 4PM6A 3NY4A 1MXOA 1SDNA 1XA7A 3WS2A 3A3EA 2EX2A 4GD8A 4Y7PA 1HTZA 1VM1A 1ZG4A 3NCKA 5CECA 1ERMA 3ZG5A 2XD1A 1MY8A 5CGSA 2EXBA 2J9PA 1NZUA 5FSRA 2XFTA 4FH4A 1FSWA 1MPLA 2WK0A 4X55A 4OLDA 3GVBA 3GSGA 4IEDA 3C4PA 2XK1A 4JBFA 5A93A 3OZHA 1FCOA 1GHPA 3A3IA 2WUQA 4IVIA 4EBNA 3C7VA 4ZJ3A 2Z2MB 4WZ4A 5CTNA 3GTCA 2OV5A 5F1FA 4KZ8A 1GA0A 2EX8A 3PAGA 5E2EA 1ES5A 4KQOA 3Q7VB 4KG5A 5KSHA 1MKIA 4JXSA 1ZG6A 1RP5A 1K57A 1ERQA 2ZC5B 2WKIA 4IVKA 1YLPA 4OONA 3W4OA 3N6IA 1I5QA 1NYMA 1JVJA 1NXYA 2XGNA 4HBUA 2Y2JA 4RVAA 4E6WA 1L0GA 4YFMA 4RX3A 1BLCA 3FV7A 1HD8A 1N4OA 3SH9A 1E3UD 2EX9A 1DJCA 3BECA 1XGJA 4OP5A 5EVLA 3HUMA 3MFDA 5DTKA 1K6SA 5EE8A 3E2LA 4D2OA 4ID4A 3ZG7B 3CZDA 5AQ7A 2H5SA 3G2ZA 5GL9A 1QMEA 2ZQ9A 5IHVA 3IQAA 3OPLA 2Q9MA 4QY6A 3VP4A 1L2SA 1KVMA 1YMXA 1FOFA 2OSUA 2WKEA 3CG5A 3LCEA 4S2JA 3V3RA 5KZHA 1TDGA 3NDEA
chains in the Genus database with same CATH superfamily
2V8FA 3IXHA 4D60A 1XPBA 4I3AA 1F2KA 2HDQA 3HLEA 1DJBA 4Y0OA 4KZ9A 4I39A 1LSWA 4KENB 1CF0A 3A3JA 2ZM8A 3TSGA 5M19A 1T1AA 4UQIM 5F82A 4BD1A 1STZA 5CXWA 4GDBA 1J9MA 5FAQA 4G3VA 2C5WB 4BL2A 2ZL1B 5FEFA 1GA9A 3CLOA 1I2WA 1BT5A 2WGIA 3NULA 4UA9A 4HJ4A 3B33A 4HJ6A 1SHVA 3A0RA 3P98A 2XQZA 5GHYA 4CJNA 4DE3A 1X0OA 3H82B 3JVUA 4Y0TA 3HJKA 2PYPA 2QPNA 4HESA 4M3KA 2EWVA 3LEQA 1W7FA 3B47A 5EUAA 5HAQA 4P0MA 1BLPA 4NXFA 3LR4A 4KQQA 5FL3A 4WN5A 4WMCD 3FZCA 5JYOA 3DAVA 3MZDA 3RXWA 2I9VA 1XFNA 2X02A 4Q0HA 1K55A 1OTDA 4Z9QA 1F98A 3UDXA 3G31A 2CC1A 4YINA 1Y54A 3O86A 4KZ4A 3PHYA 4S2LA 1NJ4A 1P9WA 1IYPA 4P6BA 1IYOA 1K38A 2BTFP 5CEBA 5E2HA 3UB8A 2YKFA 1DP6A 3RXXA 1OPXA 4R38A 3T4OA 3ZNTA 2Y55A 3BW6A 4OP8A 1SKOB 2OAQ1 1D1JA 3PR6A 5DFYA 1QMFA 3MQQA 4QPRA 1KDWA 3Q1FA 3LI9A 3QP1A 2IWDA 2RCXA 4GW9A 1RGYA 2V1ZA 3OC2A 1L0FA 1V9YA 3VSLA 3SW1A 4X1MA 4NKPA 3HLCA 1K25A 5EVID 1JTGA 5TFQA 3C7UA 4B9OA 4Q8IA 3Q81A 4R4SA 1GHIA 4ZJ1A 4MBHA 5HW3A 3RH8B 1ACFA 1IOUA 1PWDA 2O9BA 3F1OB 2GZAA 1LLBA 4S2IA 2HF6A 2RL3A 1HLUP 2WKRA 4I3JA 3EOIA 1DY6A 3M6HA 4H6JB 4Y5FA 1W79A 2WGWA 1YLYA 4EV4A 4RX2A 1S67L 2ZLYA 2K31A 3HVFA 5HDSA 1FQGA 3U4LP 2Z6CA 1JWZA 3KSHA 1P0ZA 2W27A 1VEUA 4GB7A 4R70A 4DE2A 5AVFA 1LSVA 3S1YA 1VQQA 4KG6A 5D3OA 2Y8HA 3BJNA 3TOIA 2FZ0A 4WF0A 4GN2A 1ESUA 3QP8A 2K7SA 3GQZA 3JYIA 1H8ZA 4KQRA 1PYYA 3AGFA 2J8YA 3ICYA 2XH9A 2WZZA 3UE3A 1ALQA 1EI5A 4EBPA 4N1HA 1OJGA 3IF6B 4LV2A 5EVIC 2HZ5A 3C5AA 3GR2A 1HZOA 2ZD8A 4O01A 4DJ2A 4JLFA 4X25A 3MR0A 1DJAA 1K54C 3C2WA 4LLOB 4OPQA 4NXEA 5CGXA 4DDSA 2P04A 3HLBA 3T4TA 3IF6A 2QKPA 3M2KA 1DRMA 3QP5A 4C3QA 5HWWA 1Z09A 2XFSA 3VP2A 2Y2GA 3K2NA 2J9OA 1W5DA 3GRJA 1M6KA 2HJ9C 3MXRA 4HP4A 5F5YA 4X68A 2O0YA 1IKGA 2PBYA 1H3QA 3G32A 4MN7A 1OJ5A 5EVEA 1CQAA 4PM7A 2J80A 1XXMA 3EWKA 5EV0A 4NXBA 4R23A 1YLWA 1F5MA 3GDIA 1KGFA 2V20A 1OTIA 1G6AA 3O3VA 4PM5A 2ACGA 2R78A 1LL9A 1NY0A 4MMNA 5G4YA 4EEPA 3DTKA 1RCJA 3VP0A 1H8YA 4MN5A 1IELA 2LB5A 1HVBA 3D4FA 4RQ9A 3LICA 3BLMA 2PU4A 1AXBA 3IHBA 2FH5A 3UB7A 3SH8A 2Y2KA 3LI8A 4GLQA 2M7UA 4LV3A 2X01A 2DRWA 2VEAA 3MKEA 1CEGA 4ZAMA 2A2LA 3MFXA 3SS5A 1XKZA 1MXOA 3WS2A 1T18A 1VM1A 3NCKA 5HZHA 5DJTA 2VZWA 5AVEA 3ZG5A 1MY8A 3E4QA 5J4EA 5FSRA 2V8CA 4FH4A 1FSWA 2JKRM 3GSGA 4IEDA 2XK1A 4JBFA 3OZHA 4UQIS 4I38A 3C7VA 1K0KA 4KZ8A 4HH3A 3NJAA 1ES5A 1RP5A 4GHIB 1YLPA 2QJ5A 3W4OA 1JVJA 2XGNA 4RVAA 3E98A 1HD8A 1E3UD 4Y17A 1DJCA 3BECA 3MQOA 5MC7A 5EE8A 4D2OA 4ID4A 4Z1WA 5GL9A 2JKGA 4GHIA 5AQ7A 5HD3A 3K3CA 5IHVA 3OPLA 1YSPA 3FG8A 3D72A 1YMXA 3L9KA 4S2JA 2ZMVA 1TDGA 1FCMA 3WRTA 5CTMA 4U3TA 2W1RA 1L3LA 3F1NB 3VOYA 4DF6A 3KSIA 1O7EA 3WS4A 4BBTA 2W0NA 3ZHHA 2P7JA 4NK3A 4JXWA 5FQKA 3NOPC 4KZBA 5DTSA 3FPWA 4PPRA 4KQDA 5FA7A 1IEMA 4UAAA 2ZBBA 4WZ5C 4O7DA 3F1PA 4PKYA 2GDNA 3F1NA 5CHMA 2IWBA 1KDSA 1FIKA 2WYXA 3QP6A 3TE8A 4OQHA 5EPHA 4DXBA 1WE4A 3ZFZA 3NC8A 1K54A 3ZCZA 2X71A 3RJUA 4M4XA 3UPNA 1YM1A 4S2KA 4OKPA 4UA7A 3JPUA 2BLSA 2INWA 1RGZA 2HDSA 3B3XA 1BUEA 1OT6A 3CPTB 2Y2HA 4F3LA 1K56A 1PZPA 5FI6A 3IWOA 1E25A 4EQ1A 4HEFA 4DRTA 3SOIA 3SH7A 2M1CA 2V0UA 4BL3A 1LSXA 4WMCA 5CHJA 2QJ7A 3QNCA 3N7WA 3TRCA 2CMNA 1JWPA 3D9YA 3M2JA 4BENA 4S2NA 1LHYA 2HP5A 3V39A 1ES4A 1ZHHB 4ESPA 2Y2LA 4G3WA 2GJ3A 3N8SA 3BM6A 4H6JA 3IHAA 2DMWA 4OH0A 3FKVA 2PT7A 1TS6A 5M1AA 3WS1A 3Q82A 3NOUC 2M7VA 3NECA 5FEGA 1N9OA 1ZC2A 3HLFA 2WADA 2ZL1A 5EVIB 2IWCA 4A5RA 5HDCA 1VEUB 4HQAA 4K0WA 2VX8A 1KGGA 2Y2NA 1XJ6A 3OPHA 4KZ5A 1JTDA 4LV0A 1ZKJA 4E3JA 5EVIA 2HP6A 4P6ZM 5GLDA 2JE5A 4S2NC 4N9KA 4WEKA 3ZG0A 1CEFA 5FQMA 1EROA 3UDFA 1G6OA 3BFCA 3MZEA 2JCHA 3N8LA 3WWXA 4UA6A 4YWZA 4IUKA 4FTXA 4HY8A 2ZC4B 3SS3A 4DXCA 5F83A 1Z6FA 2HDRA 2EA9A 4LRXC 3UB6A 2OWHA 1LI9A 1M40A 4IUHA 4LCMA 3AGEA 3VE3A 2D02A 5G18A 2E8IA 4EERA 1PWGA 1XGIA 4PAUA 3S22A 1E4DA 5J8XA 2JKFA 4WEJA 2EX6A 4JXGA 4R1GA 1ES2A 2VV7A 1O07A 3LO7A 4MN6A 3S7OA 3ZG9B 4ETXA 3H9WA 4GZBA 1NLYA 3S7QA 4R4RA 1YPRA 4DE1A 4K08A 2YKHA 4ZTKA 5J3WA 2KDKA 2IA2A 1BZAA 3GMWA 2P08A 4FD8A 5CX7A 4WUJA 4JXVA 4LGWA 1LL5A 2FFYA 3VE4A 1GHMA 3G2YA 4XXRA 2WAEA 2PR5A 3QNBA 3ZG8B 1JNUA 5L2FA 2XA7S 3DTMA 1W63M 5F1GA 2V1AA 4E3IA 4AFIA 4X69A 2MJ6A 3BFGA 4R3JA 4YOFA 3OLOA 4C75A 4ZBEA 4F94A 1E3UA 4P87A 3CUEA 1ONHA 2W1TA 4XUXA 1K6RA 2JN7A 4JGRA 2E8JA 3VMAA 1OMEA 4NETA 3CI6A 5FASA 4R3BA 4X1LA 2QYBA 1NZOA 2O99A 3A3FA 3BFDA 1N9LA 1ESIA 3DW0A 1KE4A 2VGLS 5A91A 3V3SA 3N4IA 5M18A 1VETA 4E6XA 3Q7ZA 3P09A 4WM9A 4DN0A 2NUTC 1MWSA 2Y59A 2G7UA 2Y4AA 2JHEA 2O9CA 2PD8A 4OPRA 4NEED 5DF9A 4EETB 5FI7A 3HLDA 1Y4OA 4P85A 2QWSA 5F6AA 1BULA 4HHDA 4X6TA 2KOIA 1Q2PA 3BFFA 4CLCC 3KSFA 5DFXA 1W8YA 5F69A 3IS2B 2JKTM 3LGOA 2A49A 2JC7A 1NWZA 5FI2A 5EOEA 1PFLA 4QB8A 1C3BA 1MKMA 3IF5A 1UWNX 4LRZE 3MQ0A 3T50A 4MBFA 4QHCA 3AGDA 3PXPA 1P97A 4BD0A 1SDNA 3A3EA 2EX2A 1HTZA 3T4KA 1WA9A 1ZG4A 5CECA 4CLCE 2XD1A 3F1PB 5CGSA 2J9PA 2V1BA 4UEYA 3TJZC 2XFTA 4ARZA 4OLDA 3C4PA 2VJWA 5A93A 5L09A 2WUQA 2VK3A 1YSQA 3GTCA 3GECA 2HJEA 2W3DA 3Q7VB 4KG5A 4JXSA 5A8BA 5L10A 1K57A 2ZC5B 2WKIA 1CJFA 3N6IA 3CPTA 1NYMA 4HIAA 1NXYA 2Y2JA 4YFMA 4RX3A 1N4OA 4OP5A 5EVLA 3E2LA 3ZG7B 3CZDA 3LFVA 1QMEA 4R6LA 4QY6A 2Q9MA 3VP4A 4EEUA 1L2SA 1OTBA 2OSUA 4CLCA 5JYPA 3NDEA 1Y28A 5HX9A 1XJ2A 5KMWA 5HSQA 2A24B 5GHZA 3A0SA 3NBLA 3ULFA 4GS9B 4YNRA 5E2GA 4HNBA 4N9LA 3QP4A 3LUQA 2B95A 1PIOA 4MCWA 3EGDC 3MXSA 3BYDA 3IXGA 4BQMA 5E43A 2PR6A 4QD4A 4GJ4A 4U0XA 2VGKA 2QZ6A 2ZOIA 4KZ3A 3RFBA 2C6WB 3LIDA 3OPRA 1PI4A 4EUVA 4WELA 3FWLA 3HUOA 1BSGA 4LV1A 5FDHA 1S1ZA 3IF6C 3EEAA 1PW1A 4OLGA 3CUEC 2PHYA 2J3TD 2ZQDA 3UPOA 2DNSA 2HDUA 3I7JA 4BBUA 4MLLA 4EQIA 2UWXA 1XJ3A 1YT4A 3CMZA 3S4XA 4H8RA 1PRQA 3OCNA 5EECA 4B93A 3EGXC 1G5UA 5EFWA 3P7NA 5GLBA 5FAOA 4C6YA 4E3KA 2ZQ7A 4I5SA 3H82A 4JGQA 4PM9A 2WKHA 3FPVA 3PBQA 5K5BA 1H5XA 4EBLA 3W4QA 2L4RA 1PWCA 4JPMA 3T4LA 3R4KA 4N1XA 1SKFA 2H10A 2WKPA 1N9BA 1NYYA 1G68A 3T1SA 5CEDA 2XF3A 5GHXA 4IBXA 3KO6A 3G34A 5TGFA 4JF4A 4KZ7A 5EOOA 4ZDXA 2VV8A 5DKLA 2K2NA 5A90A 4OOMA 3VSKA 3S7NA 3UN7A 4QWOA 3C30A 1NRFA 4B4ZA 4B88A 2J7VA 4JF6A 1YLZA 4DMZA 3UB9A 1W63Q 5HL6A 2R9XA 4EU0A 2L1MA 3HUNA 4E3MA 2A3UA 4Y0UA 1ZTUA 1KVLA 3MKFA 3HBRA 1T19A 3IT9A 3FC7A 2Y2MA 1Q2QA 3G4PA 4E3OA 2PU2A 3DWZA 2D01A 4GOGA 1XFQA 4F3LB 3ZVWA 3CWFA 2JBFA 5AJGA 1IFQA 3T4SA 3ZVTA 4Y2FA 2ZQCA 3UNWA 1LI0A 4ETZA 2PAVP 1XA1A 2W3EA 3C8CA 3ZGAB 2H28A 4WYYA 4EWFA 1TD5A 3QHYA 1EWZA 2Y2PA 1DP9A 1D7EA 3UO9A 2WAFA 1MWTA 3ITBA 2XLNA 4U0TA 1MBLA 5GLCA 1K4FA 3CAXA 3IWIA 3MF0A 2PYRA 4G3KA 2HGVA 3PBNA 1BLHA 1BLSA 2UV0E 3E4OA 4RA7A 4O8GA 2VGJA 1T1CA 5KIZA 5AQAA 2EFUA 3A0VA 2WGWB 2Y2OA 4NG2A 3UDIA 5HAPA 3IXDA 1YAXA 2GX5A 5TBMB 1S4RA 4KZ6A 3VP3A 3MBZA 4E3LA 3IXBA 3ZQ5A 4WLAA 1NRJA 2XD5A 1PW8A 3U2AA 3Q07A 4KG2A 4PHTA 3UY6A 2JKRI 5E2FA 2OLUA 4DJ3A 1SCWA 2Z2LB 3W8KA 1W8QA 3DBAA 1BYWA 3H7WA 2XSSA 2G2WA 5TBMA 2OOLA 4I3IA 3MSHA 4DDYA 4LFUA 1YLJA 3MS6A 4KZAA 1KE3A 3NI9A 4X53A 3C38A 3WRZA 5FQ9A 4IBRA 5IT5A 3T12B 2WGVA 5AQ9A 4LCLA 3TG9A 1N9NA 3LIAA 3BWLA 3N8RA 3W2ZA 3PAEA 4B4XA 1V9ZA 4HI4A 1G28A 4FUWA 1MZUA 1P9RA 3S7PA 3BRMA 3LR0A 1BTLA 1JWVA 3UE1A 5A92A 4QU3A 2Y2IA 3DTEA 1VHMA 1K4EA 1TS7A 1XX2A 4OPYA 3EQVA 3VOZA 4FSFA 3EQUA 4XT2A 3UB5P 3PBTA 1KGEA 3LY3A 5GLAA 2XDMA 2GNXA 3OBFA 5TJJA 4QY5A 4K91A 2P9VB 4OQIA 3V50A 4FOFA 5HWTA 4X56A 4OOLA 2HPBA 2VA0A 1XJ4A 1SDEA 2PDRA 4XT2B 2W3HA 2ZC3B 1MC0A 1LL8A 3LYXA 2ZM2A 3VFHA 3FKWA 5DVAA 1MWRA 4OOYA 1FR6A 3VFFA 5IS1A 3BLSA 2ZMFA 3MZFA 2W1TB 4NXGA 1KE0A 2XA7M 4GS9A 4S2MA 4EESA 4UHUA 3T1QB 3NY4A 1XA7A 4GD8A 4Y13A 3MJQA 2EXBA 4HOIA 1NZUA 2Z6DA 2WK0A 3GVBA 3IX4A 1FCOA 1GHPA 3BQAA 4IVIA 4ZJ3A 2Z2MB 5HPFA 1VETB 4WZ4A 5CTNA 5F1FA 3K3DA 3PAGA 4KQOA 1ZG6A 2ZOHA 1ERQA 4EXOA 1EW0A 1A0KA 4IVKA 4OONA 5HDDA 4JGPA 3T1RA 3T4QA 3LR5A 1BLCA 2EX9A 1XGJA 1GSVA 3HUMA 5I5LA 2AVXA 3G2ZA 2BASA 3IQAA 2WKEA 3E0YA 1FOFA 3UMDA 5KZHA 5U47A 2KX6A 3C4OA 3DWKA 4FCFA 4WBGA 2ZC7A 3LEZA 4N92A 1GCEA 5KSCA 1TS0A 3KSGA 2EXAA 2NUPC 4E3NA 2P74A 3IWQA 4MBKA 2W3GA 2WKQA 1YMSA 3V5MA 5G4ZA 3QP2A 4L9GA 3PTEA 2B18A 5HPIA 3UE0A 1TEMA 4KUKA 2W3FA 1YLTA 3Q7VA 5CRFA 3VP1A 1XP4A 5F68A 2Y79A 2EFXA 3R7WB 3BQ8A 3W4PA 2XRNA 4HJ3A 3PBRA 1WYCA 4MDZA 3WS0A 2LB9A 4Q0JA 3WS5A 5HARA 1L0DA 5CGWA 3VV4A 2HP9A 2XROA 3F1OA 3IX3A 3L7HA 3IH8A 4ZJ2A 4GNUA 1PZOA 4CLCB 4Y3IA 1T1BA 2I72A 5C5KA 5EM1A 2OWJA 2A24A 1FCNA 1F9IA 1ODVA 2V0WA 1S66L 3KX0X 3M6BA 3NHQA 2H0YA 2ZQAA 3BY8A 3HLWA 2KLIA 2BG1A 4L9FA 2VGLM 3T4JA 1L0EA 1AWIA 4LPZA 2OLVA 2ZC6B 2Y91A 3SS4A 4L0LA 4WL9A 5TR7A 2VV6A 5DF8A 4PM8A 5DJUA 2B5RA 5AQBA 2J3TC 4QJGA 1PI5A 4E04A 3NIAA 3D3OA 4ZRRA 3HLGA 2H0TA 4JKTA 4LRYC 4KUOA 3HJIA 5HWVA 3GV9A 3BY9A 3DTIA 3G35A 1IYQA 3O87A 2JKTI 3B42A 1S0WA 2PRFA 1PNEA 5DTTA 4BBVA 4GKUA 4FH2A 5HL1A 4GD6A 4L9EA 3PBSA 2O9AA 3CJMA 5HFOA 4OPZA 4R0QA 2Q0OA 1K57C 2VKSA 2FFFB 4R3AA 5HD5A 4PKYG 1CK3A 3P01A 3LY4A 2J3WA 3TW8A 1IYSA 4GCZA 2ZJ9A 1VB6A 3BEBA 3OPPA 4MEZA 5DKKA 4BMWA 3MMHA 3E4PA 4JF5A 5BOHA 3HL9A 4DE0A 1TF1A 4EUZA 1SKOA 3G6OA 3T1XA 4S2OA 4II7A 1OTEA 2QMIA 1S6RA 1OTAA 2L0WA 3UE6A 2P9VA 2ZQ8A 4OQGA 4WZ5A 5FATA 3RTYA 4BLMA 5LBRA 1MWUA 1YQSA 3PBOA 1LT0A 1U60A 2VLGA 4CQHA 1J3WA 5FQIA 3PYPA 1TDLA 5I94A 1FR1A 4O0PA 3A3DA 2PBDP 5J7EA 4RYEA 4HH2A 3FYZA 5IU1A 4MNRA 1IKIA 4XUZA 4HBTA 5CERA 3LIBA 4K0XA 5DF7A 4P6ZS 1FILA 2EWWA 2XEPA 4Q0IA 4LENA 1K56D 2Y2QA 5FQQA 4OVDA 1UGUA 1NLZA 3O88A 1CI9A 3CITA 3JVVA 5FAPA 1FSYA 5L8MA 3UPPA 4JGOA 1TVFA 4Y15A 2R9WA 4BWIA 3HCYA 3HREA 3LIFA 2V2FF 3KYQA 5EM0A 2QHKA 1K55C 3IH9A 3NDGA 1WYBA 3E2KA 3SZTA 2G2UA 5L07A 3ZNYA 4PMAA 4DKIA 5HAIA 4HP9A 4BJPA 1S4SA 3OOVA 2DCFA 4CPKA 3IS2A 1ONGA 3ISGA 3ITAA 3IBJA 1OT9A 1GSXA 2ZMAA 3O5YA 2WZXA 3H7WB 4ME4A 3BFEA 2ZM0A 2OAP1 1H8MA 3KYEA 2B02A 4IHQA 3G30A 4GDNA 3LIEA 2XR0A 4S2PA 3IBRA 5FQJA 1GSWA 1ES3A 3ZDJA 2Q9NA 3OCLA 4OQ0A 1KOUA 1YKDA 1I2SA 5CHUA 1CI8A 4CLCD 4PM6A 4Y7PA 2PD7A 1ERMA 1D06A 1UWPX 3V67A 5FDSA 1MPLA 4X55A 3A3IA 3VOLA 4EBNA 3MXQA 3LR3A 2OV5A 1GA0A 2EX8A 5E2EA 5KSHA 1MKIA 3IX8A 2V9AA 4ARZB 3UMEA 4IJGA 3CHWP 1SZVA 3R7WA 1S1YA 3ZYTA 4EW7A 1I5QA 3EEHA 4HBUA 4E6WA 1L0GA 2HV1A 1H0MA 3FV7A 3SH9A 1TS8A 3MFDA 5DTKA 1K6SA 2H5SA 3KYZA 2ZQ9A 1KVMA 3CG5A 3LCEA 3NOTC 3V3RA 1DP8A
chains in the Genus database with same CATH topology
5HX9A 5KMWA 1FCMA 5U47A 3WRTA 5CTMA 4U3TA 3IXHA 1XPBA 5GHZA 3C4OA 3VOYA 4DF6A 3NBLA 3DWKA 1O7EA 3WS4A 4FCFA 3ZHHA 2HDQA 4NK3A 4JXWA 5FQKA 3HLEA 4WBGA 5E2GA 2ZC7A 3LEZA 4N92A 1GCEA 4KZBA 5DTSA 1DJBA 4Y0OA 4PPRA 5KSCA 4KZ9A 4KENB 5FA7A 1IEMA 3A3JA 2EXAA 2ZM8A 4N9LA 4UAAA 3TSGA 1PIOA 4WZ5C 5M19A 4O7DA 4E3NA 5F82A 2GDNA 2P74A 4BD1A 3IWQA 4MBKA 5CXWA 3MXSA 4GDBA 3BYDA 1J9MA 3IXGA 4BQMA 5FAQA 5E43A 5CHMA 2IWBA 1YMSA 1KDSA 4QD4A 2C5WB 4BL2A 2WYXA 3V5MA 1GA9A 2VGKA 4U0XA 2QZ6A 1I2WA 4OQHA 5EPHA 4KZ3A 4DXBA 1BT5A 1WE4A 2WGIA 3PTEA 4UA9A 3ZFZA 2C6WB 3UE0A 1TEMA 1SHVA 3OPRA 1PI4A 3P98A 3NC8A 1K54A 3ZCZA 2XQZA 5GHYA 2X71A 1YLTA 3RJUA 3Q7VA 4CJNA 4WELA 4DE3A 3FWLA 3HUOA 1BSGA 4LV1A 5FDHA 3UPNA 1YM1A 4S2KA 4OKPA 4UA7A 4Y0TA 3IF6C 1PW1A 4OLGA 5CRFA 2BLSA 3VP1A 1XP4A 2ZQDA 3UPOA 2DNSA 1RGZA 2QPNA 2HDUA 3I7JA 2EFXA 2HDSA 3B3XA 4HESA 1BUEA 4M3KA 4MLLA 3W4PA 4EQIA 2UWXA 1YT4A 1W7FA 3CMZA 3PBRA 1WYCA 2Y2HA 4H8RA 3S4XA 5EUAA 3WS0A 3OCNA 5EECA 5HAQA 1K56A 1PZPA 5FI6A 3IWOA 1E25A 4P0MA 4HEFA 5FAOA 5GLBA 4C6YA 3WS5A 4E3KA 2ZQ7A 5HARA 4DRTA 1L0DA 1BLPA 5CGWA 3SOIA 4PM9A 3SH7A 4KQQA 2HP9A 4WMCA 4BL3A 5CHJA 2WKHA 3QNCA 3N7WA 4WMCD 3FZCA 3PBQA 5JYOA 3IH8A 4ZJ2A 1H5XA 1JWPA 4GNUA 1PZOA 3MZDA 3RXWA 3M2JA 4BENA 4EBLA 3W4QA 4S2NA 2I72A 2X02A 1K55A 1LHYA 2HP5A 1PWCA 3V39A 1ES4A 4JPMA 1FCNA 4Z9QA 2Y2LA 4N1XA 3UDXA 1SKFA 2H10A 3N8SA 3G31A 3BM6A 1N9BA 3IHAA 1NYYA 2CC1A 3M6BA 4YINA 1Y54A 1G68A 3O86A 2H0YA 5CEDA 2ZQAA 2XF3A 4KZ4A 4OH0A 4S2LA 5GHXA 4IBXA 1NJ4A 3FKVA 1IYPA 3HLWA 4P6BA 1IYOA 3G34A 2BG1A 5TGFA 3UY6A 4JF4A 4KZ7A 1K38A 5EOOA 4ZDXA 5M1AA 3WS1A 5CEBA 1L0EA 3Q82A 5E2HA 5A90A 4OOMA 3VSKA 1ZC2A 3HLFA 3UN7A 2WADA 3RXXA 1NRFA 2OLVA 2Y91A 2ZC6B 4B4ZA 5EVIB 3ZNTA 3SS4A 2Y55A 4B88A 2J7VA 2IWCA 1YLZA 4JF6A 4L0LA 5TR7A 4A5RA 2R9XA 4K0WA 4OP8A 5DF8A 1KGGA 4PM8A 2Y2NA 2B5RA 5AQBA 3HUNA 3OPHA 4QJGA 1PI5A 1QMFA 1KDWA 3NIAA 3Q1FA 4KZ5A 4E3MA 2A3UA 1JTDA 2IWDA 2RCXA 4Y0UA 1RGYA 2V1ZA 3OC2A 1L0FA 4LV0A 1KVLA 1ZKJA 3MKFA 3VSLA 4E3JA 3HBRA 3HLGA 5EVIA 2HP6A 3HLCA 1K25A 3IT9A 5GLDA 2Y2MA 5EVID 1JTGA 2H0TA 2JE5A 1Q2QA 3G4PA 4JKTA 4N9KA 4S2NC 4E3OA 2PU2A 3DWZA 5TFQA 4WEKA 4GOGA 3C7UA 3GV9A 4Q8IA 3ZG0A 1CEFA 3ZVWA 3Q81A 3G35A 2JBFA 5FQMA 4R4SA 1IYQA 1GHIA 4ZJ1A 4MBHA 5HW3A 1EROA 3O87A 3ZVTA 3UDFA 3BFCA 3MZEA 1PWDA 1S0WA 5DTTA 2ZQCA 3UNWA 4GKUA 2JCHA 3N8LA 3WWXA 1LI0A 1LLBA 4UA6A 4FH2A 5HL1A 4S2IA 2ZC4B 3SS3A 4GD6A 1XA1A 4DXCA 5F83A 2RL3A 3ZGAB 1Z6FA 2HDRA 4WYYA 3PBSA 4EWFA 3QHYA 3CJMA 1EWZA 2Y2PA 1DY6A 1LI9A 1M40A 5HFOA 3M6HA 3UO9A 4LCMA 4OPZA 2WAFA 1MWTA 3ITBA 2XLNA 4R0QA 4U0TA 1MBLA 1K4FA 1K57C 3AGEA 3IWIA 5GLCA 2FFFB 1W79A 2WGWA 1YLYA 4EV4A 5G18A 4RX2A 1CK3A 2E8IA 3LY4A 1PWGA 1XGIA 3S22A 2ZLYA 3PBNA 1E4DA 1IYSA 5J8XA 1BLHA 1BLSA 4RA7A 3HVFA 2ZJ9A 3BEBA 3OPPA 4WEJA 2VGJA 2EX6A 1FQGA 4JXGA 1JWZA 5AQAA 4MEZA 2EFUA 4R1GA 1ES2A 2Y2OA 2WGWB 4JF5A 1O07A 3LO7A 3HL9A 5BOHA 4GB7A 3UDIA 4DE0A 4DE2A 3ZG9B 5HAPA 3IXDA 4GZBA 4EUZA 3S1YA 4R4RA 4DE1A 1VQQA 4S2OA 4KG6A 4KZ6A 2QMIA 5D3OA 3MBZA 3VP3A 4ZTKA 4E3LA 1S6RA 3IXBA 1BZAA 3GMWA 3TOIA 4FD8A 2XD5A 4GN2A 1PW8A 1ESUA 4JXVA 3Q07A 4KG2A 1LL5A 2P9VA 2FFYA 2ZQ8A 3GQZA 3JYIA 1GHMA 4OQGA 1H8ZA 4KQRA 4WZ5A 1MWUA 5E2FA 4BLMA 1PYYA 3AGFA 2J8YA 2OLUA 3G2YA 2XH9A 1YQSA 2WZZA 3PBOA 3UE3A 1ALQA 1EI5A 1SCWA 2Z2LB 3W8KA 4N1HA 1W8QA 4EBPA 4XXRA 1U60A 2WAEA 2G2WA 3IF6B 5FQIA 4LV2A 4DDYA 1TDLA 5EVIC 3QNBA 3C5AA 3ZG8B 5I94A 3GR2A 1FR1A 1YLJA 1HZOA 4KZAA 5L2FA 3DTMA 3A3DA 2ZD8A 1KE3A 3NI9A 4JLFA 4X53A 5F1GA 4RYEA 3FYZA 3WRZA 1DJAA 1K54C 1IKIA 4MNRA 4XUZA 4E3IA 4HBTA 4X69A 3BFGA 5CERA 5FQ9A 4OPQA 5CGXA 4K0XA 4R3JA 5DF7A 4DDSA 4IBRA 2XEPA 3HLBA 4C75A 4ZBEA 4F94A 1E3UA 3IF6A 4P87A 4LENA 2WGVA 1K56D 1ONHA 2Y2QA 5FQQA 5AQ9A 4OVDA 4XUXA 3M2KA 1K6RA 3O88A 4LCLA 3TG9A 1CI9A 3VMAA 1OMEA 4C3QA 4NETA 5FAPA 2XFSA 3N8RA 1FSYA 3PAEA 3VP2A 4B4XA 2Y2GA 5FASA 4R3BA 3UPPA 1TVFA 2R9WA 2J9OA 1W5DA 3BRMA 3GRJA 5FATA 1BTLA 1NZOA 1JWVA 3HREA 3A3FA 3BFDA 3UE1A 1M6KA 5A92A 1ESIA 2V2FF 3DW0A 1KE4A 4QU3A 3MXRA 5A91A 2Y2IA 4X68A 3V3SA 1K4EA 3N4IA 5M18A 2PBYA 1IKGA 1XX2A 1K55C 3IH9A 3NDGA 4OPYA 4E6XA 3EQVA 3Q7ZA 3VOZA 3G32A 1WYBA 3E2KA 3P09A 4WM9A 2G2UA 1MWSA 2Y59A 4FSFA 3EQUA 4PM7A 3ZNYA 4PMAA 1XXMA 4DKIA 2Y4AA 5HAIA 4OPRA 4R23A 1YLWA 3PBTA 4BJPA 1KGFA 1KGEA 5DF9A 3LY3A 5GLAA 2XDMA 2DCFA 5FI7A 4CPKA 2V20A 3HLDA 1G6AA 3O3VA 4PM5A 4QY5A 4P85A 4K91A 1ONGA 2P9VB 3ISGA 3ITAA 4OQIA 3V50A 1LL9A 1NY0A 4X56A 4OOLA 2HPBA 1BULA 2ZMAA 2WZXA 1RCJA 4X6TA 3VP0A 1H8YA 3BFEA 1IELA 1SDEA 1Q2PA 1HVBA 3BFFA 3D4FA 2ZM0A 3BLMA 2PU4A 1AXBA 3IHBA 3G30A 1W8YA 4GDNA 2XR0A 3SH8A 2Y2KA 2ZC3B 4S2PA 5FQJA 2A49A 2JC7A 5FI2A 2ZM2A 4LV3A 5EOEA 3VFHA 3FKWA 4QB8A 5DVAA 1C3BA 1MWRA 4OOYA 3IF5A 1FR6A 3VFFA 1ES3A 2DRWA 3BLSA 2X01A 5JYPA 3ZDJA 2Q9NA 3MZFA 3MKEA 3OCLA 4OQ0A 4MBFA 4QHCA 1CEGA 3AGDA 4ZAMA 1KE0A 1I2SA 4S2MA 5CHUA 3SS5A 1CI8A 4UHUA 1XKZA 4BD0A 4PM6A 3NY4A 1MXOA 1SDNA 1XA7A 3WS2A 3A3EA 2EX2A 4GD8A 4Y7PA 1HTZA 1VM1A 1ZG4A 3NCKA 5CECA 1ERMA 3ZG5A 2XD1A 1MY8A 5CGSA 2EXBA 2J9PA 1NZUA 5FSRA 2XFTA 4FH4A 1FSWA 1MPLA 2WK0A 4X55A 4OLDA 3GVBA 3GSGA 4IEDA 3C4PA 2XK1A 4JBFA 5A93A 3OZHA 1FCOA 1GHPA 3A3IA 2WUQA 4IVIA 4EBNA 3C7VA 4ZJ3A 2Z2MB 4WZ4A 5CTNA 3GTCA 2OV5A 5F1FA 4KZ8A 1GA0A 2EX8A 3PAGA 5E2EA 1ES5A 4KQOA 3Q7VB 4KG5A 5KSHA 1MKIA 4JXSA 1ZG6A 1RP5A 1K57A 1ERQA 2ZC5B 2WKIA 4IVKA 1YLPA 4OONA 3W4OA 3N6IA 1I5QA 1NYMA 1JVJA 1NXYA 2XGNA 4HBUA 2Y2JA 4RVAA 4E6WA 1L0GA 4YFMA 4RX3A 1BLCA 3FV7A 1HD8A 1N4OA 3SH9A 1E3UD 2EX9A 1DJCA 3BECA 1XGJA 4OP5A 5EVLA 3HUMA 3MFDA 5DTKA 1K6SA 5EE8A 3E2LA 4D2OA 4ID4A 3ZG7B 3CZDA 5AQ7A 2H5SA 3G2ZA 5GL9A 1QMEA 2ZQ9A 5IHVA 3IQAA 3OPLA 2Q9MA 4QY6A 3VP4A 1L2SA 1KVMA 1YMXA 1FOFA 2OSUA 2WKEA 3CG5A 3LCEA 4S2JA 3V3RA 5KZHA 1TDGA 3NDEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HX9 A;  5KMW A;  1FCM A;  5U47 A;  3WRT A;  5CTM A;  4U3T A;  3IXH A;  1XPB A;  5GHZ A;  3C4O A;  3VOY A;  4DF6 A;  3NBL A;  3DWK A;  1O7E A;  3WS4 A;  4FCF A;  3ZHH A;  2HDQ A;  4NK3 A;  4JXW A;  5FQK A;  3HLE A;  4WBG A;  5E2G A;  2ZC7 A;  3LEZ A;  4N92 A;  1GCE A;  4KZB A;  5DTS A;  1DJB A;  4Y0O A;  4PPR A;  5KSC A;  4KZ9 A;  4KEN B;  5FA7 A;  1IEM A;  3A3J A;  2EXA A;  2ZM8 A;  4N9L A;  4UAA A;  3TSG A;  1PIO A;  4WZ5 C;  5M19 A;  4O7D A;  4E3N A;  5F82 A;  2GDN A;  2P74 A;  4BD1 A;  3IWQ A;  4MBK A;  5CXW A;  3MXS A;  4GDB A;  3BYD A;  1J9M A;  3IXG A;  4BQM A;  5FAQ A;  5E43 A;  5CHM A;  2IWB A;  1YMS A;  1KDS A;  4QD4 A;  2C5W B;  4BL2 A;  2WYX A;  3V5M A;  1GA9 A;  2VGK A;  4U0X A;  2QZ6 A;  1I2W A;  4OQH A;  5EPH A;  4KZ3 A;  4DXB A;  1BT5 A;  1WE4 A;  2WGI A;  3PTE A;  4UA9 A;  3ZFZ A;  2C6W B;  3UE0 A;  1TEM A;  1SHV A;  3OPR A;  1PI4 A;  3P98 A;  3NC8 A;  1K54 A;  3ZCZ A;  2XQZ A;  5GHY A;  2X71 A;  1YLT A;  3RJU A;  3Q7V A;  4CJN A;  4WEL A;  4DE3 A;  3FWL A;  3HUO A;  1BSG A;  4LV1 A;  5FDH A;  3UPN A;  1YM1 A;  4S2K A;  4OKP A;  4UA7 A;  4Y0T A;  3IF6 C;  1PW1 A;  4OLG A;  5CRF A;  2BLS A;  3VP1 A;  1XP4 A;  2ZQD A;  3UPO A;  2DNS A;  1RGZ A;  2QPN A;  2HDU A;  3I7J A;  2EFX A;  2HDS A;  3B3X A;  4HES A;  1BUE A;  4M3K A;  4MLL A;  3W4P A;  4EQI A;  2UWX A;  1YT4 A;  1W7F A;  3CMZ A;  3PBR A;  1WYC A;  2Y2H A;  4H8R A;  3S4X A;  5EUA A;  3WS0 A;  3OCN A;  5EEC A;  5HAQ A;  1K56 A;  1PZP A;  5FI6 A;  3IWO A;  1E25 A;  4P0M A;  4HEF A;  5FAO A;  5GLB A;  4C6Y A;  3WS5 A;  4E3K A;  2ZQ7 A;  5HAR A;  4DRT A;  1L0D A;  1BLP A;  5CGW A;  3SOI A;  4PM9 A;  3SH7 A;  4KQQ A;  2HP9 A;  4WMC A;  4BL3 A;  5CHJ A;  2WKH A;  3QNC A;  3N7W A;  4WMC D;  3FZC A;  3PBQ A;  5JYO A;  3IH8 A;  4ZJ2 A;  1H5X A;  1JWP A;  4GNU A;  1PZO A;  3MZD A;  3RXW A;  3M2J A;  4BEN A;  4EBL A;  3W4Q A;  4S2N A;  2I72 A;  2X02 A;  1K55 A;  1LHY A;  2HP5 A;  1PWC A;  3V39 A;  1ES4 A;  4JPM A;  1FCN A;  4Z9Q A;  2Y2L A;  4N1X A;  3UDX A;  1SKF A;  2H10 A;  3N8S A;  3G31 A;  3BM6 A;  1N9B A;  3IHA A;  1NYY A;  2CC1 A;  3M6B A;  4YIN A;  1Y54 A;  1G68 A;  3O86 A;  2H0Y A;  5CED A;  2ZQA A;  2XF3 A;  4KZ4 A;  4OH0 A;  4S2L A;  5GHX A;  4IBX A;  1NJ4 A;  3FKV A;  1IYP A;  3HLW A;  4P6B A;  1IYO A;  3G34 A;  2BG1 A;  5TGF A;  3UY6 A;  4JF4 A;  4KZ7 A;  1K38 A;  5EOO A;  4ZDX A;  5M1A A;  3WS1 A;  5CEB A;  1L0E A;  3Q82 A;  5E2H A;  5A90 A;  4OOM A;  3VSK A;  1ZC2 A;  3HLF A;  3UN7 A;  2WAD A;  3RXX A;  1NRF A;  2OLV A;  2Y91 A;  2ZC6 B;  4B4Z A;  5EVI B;  3ZNT A;  3SS4 A;  2Y55 A;  4B88 A;  2J7V A;  2IWC A;  1YLZ A;  4JF6 A;  4L0L A;  5TR7 A;  4A5R A;  2R9X A;  4K0W A;  4OP8 A;  5DF8 A;  1KGG A;  4PM8 A;  2Y2N A;  2B5R A;  5AQB A;  3HUN A;  3OPH A;  4QJG A;  1PI5 A;  1QMF A;  1KDW A;  3NIA A;  3Q1F A;  4KZ5 A;  4E3M A;  2A3U A;  1JTD A;  2IWD A;  2RCX A;  4Y0U A;  1RGY A;  2V1Z A;  3OC2 A;  1L0F A;  4LV0 A;  1KVL A;  1ZKJ A;  3MKF A;  3VSL A;  4E3J A;  3HBR A;  3HLG A;  5EVI A;  2HP6 A;  3HLC A;  1K25 A;  3IT9 A;  5GLD A;  2Y2M A;  5EVI D;  1JTG A;  2H0T A;  2JE5 A;  1Q2Q A;  3G4P A;  4JKT A;  4N9K A;  4S2N C;  4E3O A;  2PU2 A;  3DWZ A;  5TFQ A;  4WEK A;  4GOG A;  3C7U A;  3GV9 A;  4Q8I A;  3ZG0 A;  1CEF A;  3ZVW A;  3Q81 A;  3G35 A;  2JBF A;  5FQM A;  4R4S A;  1IYQ A;  1GHI A;  4ZJ1 A;  4MBH A;  5HW3 A;  1ERO A;  3O87 A;  3ZVT A;  3UDF A;  3BFC A;  3MZE A;  1PWD A;  1S0W A;  5DTT A;  2ZQC A;  3UNW A;  4GKU A;  2JCH A;  3N8L A;  3WWX A;  1LI0 A;  1LLB A;  4UA6 A;  4FH2 A;  5HL1 A;  4S2I A;  2ZC4 B;  3SS3 A;  4GD6 A;  1XA1 A;  4DXC A;  5F83 A;  2RL3 A;  3ZGA B;  1Z6F A;  2HDR A;  4WYY A;  3PBS A;  4EWF A;  3QHY A;  3CJM A;  1EWZ A;  2Y2P A;  1DY6 A;  1LI9 A;  1M40 A;  5HFO A;  3M6H A;  3UO9 A;  4LCM A;  4OPZ A;  2WAF A;  1MWT A;  3ITB A;  2XLN A;  4R0Q A;  4U0T A;  1MBL A;  1K4F A;  1K57 C;  3AGE A;  3IWI A;  5GLC A;  2FFF B;  1W79 A;  2WGW A;  1YLY A;  4EV4 A;  5G18 A;  4RX2 A;  1CK3 A;  2E8I A;  3LY4 A;  1PWG A;  1XGI A;  3S22 A;  2ZLY A;  3PBN A;  1E4D A;  1IYS A;  5J8X A;  1BLH A;  1BLS A;  4RA7 A;  3HVF A;  2ZJ9 A;  3BEB A;  3OPP A;  4WEJ A;  2VGJ A;  2EX6 A;  1FQG A;  4JXG A;  1JWZ A;  5AQA A;  4MEZ A;  2EFU A;  4R1G A;  1ES2 A;  2Y2O A;  2WGW B;  4JF5 A;  1O07 A;  3LO7 A;  3HL9 A;  5BOH A;  4GB7 A;  3UDI A;  4DE0 A;  4DE2 A;  3ZG9 B;  5HAP A;  3IXD A;  4GZB A;  4EUZ A;  3S1Y A;  4R4R A;  4DE1 A;  1VQQ A;  4S2O A;  4KG6 A;  4KZ6 A;  2QMI A;  5D3O A;  3MBZ A;  3VP3 A;  4ZTK A;  4E3L A;  1S6R A;  3IXB A;  1BZA A;  3GMW A;  3TOI A;  4FD8 A;  2XD5 A;  4GN2 A;  1PW8 A;  1ESU A;  4JXV A;  3Q07 A;  4KG2 A;  1LL5 A;  2P9V A;  2FFY A;  2ZQ8 A;  3GQZ A;  3JYI A;  1GHM A;  4OQG A;  1H8Z A;  4KQR A;  4WZ5 A;  1MWU A;  5E2F A;  4BLM A;  1PYY A;  3AGF A;  2J8Y A;  2OLU A;  3G2Y A;  2XH9 A;  1YQS A;  2WZZ A;  3PBO A;  3UE3 A;  1ALQ A;  1EI5 A;  1SCW A;  2Z2L B;  3W8K A;  4N1H A;  1W8Q A;  4EBP A;  4XXR A;  1U60 A;  2WAE A;  2G2W A;  3IF6 B;  5FQI A;  4LV2 A;  4DDY A;  1TDL A;  5EVI C;  3QNB A;  3C5A A;  3ZG8 B;  5I94 A;  3GR2 A;  1FR1 A;  1YLJ A;  1HZO A;  4KZA A;  5L2F A;  3DTM A;  3A3D A;  2ZD8 A;  1KE3 A;  3NI9 A;  4JLF A;  4X53 A;  5F1G A;  4RYE A;  3FYZ A;  3WRZ A;  1DJA A;  1K54 C;  1IKI A;  4MNR A;  4XUZ A;  4E3I A;  4HBT A;  4X69 A;  3BFG A;  5CER A;  5FQ9 A;  4OPQ A;  5CGX A;  4K0X A;  4R3J A;  5DF7 A;  4DDS A;  4IBR A;  2XEP A;  3HLB A;  4C75 A;  4ZBE A;  4F94 A;  1E3U A;  3IF6 A;  4P87 A;  4LEN A;  2WGV A;  1K56 D;  1ONH A;  2Y2Q A;  5FQQ A;  5AQ9 A;  4OVD A;  4XUX A;  3M2K A;  1K6R A;  3O88 A;  4LCL A;  3TG9 A;  1CI9 A;  3VMA A;  1OME A;  4C3Q A;  4NET A;  5FAP A;  2XFS A;  3N8R A;  1FSY A;  3PAE A;  3VP2 A;  4B4X A;  2Y2G A;  5FAS A;  4R3B A;  3UPP A;  1TVF A;  2R9W A;  2J9O A;  1W5D A;  3BRM A;  3GRJ A;  5FAT A;  1BTL A;  1NZO A;  1JWV A;  3HRE A;  3A3F A;  3BFD A;  3UE1 A;  1M6K A;  5A92 A;  1ESI A;  2V2F F;  3DW0 A;  1KE4 A;  4QU3 A;  3MXR A;  5A91 A;  2Y2I A;  4X68 A;  3V3S A;  1K4E A;  3N4I A;  5M18 A;  2PBY A;  1IKG A;  1XX2 A;  1K55 C;  3IH9 A;  3NDG A;  4OPY A;  4E6X A;  3EQV A;  3Q7Z A;  3VOZ A;  3G32 A;  1WYB A;  3E2K A;  3P09 A;  4WM9 A;  2G2U A;  1MWS A;  2Y59 A;  4FSF A;  3EQU A;  4PM7 A;  3ZNY A;  4PMA A;  1XXM A;  4DKI A;  2Y4A A;  5HAI A;  4OPR A;  4R23 A;  1YLW A;  3PBT A;  4BJP A;  1KGF A;  1KGE A;  5DF9 A;  3LY3 A;  5GLA A;  2XDM A;  2DCF A;  5FI7 A;  4CPK A;  2V20 A;  3HLD A;  1G6A A;  3O3V A;  4PM5 A;  4QY5 A;  4P85 A;  4K91 A;  1ONG A;  2P9V B;  3ISG A;  3ITA A;  4OQI A;  3V50 A;  1LL9 A;  1NY0 A;  4X56 A;  4OOL A;  2HPB A;  1BUL A;  2ZMA A;  2WZX A;  1RCJ A;  4X6T A;  3VP0 A;  1H8Y A;  3BFE A;  1IEL A;  1SDE A;  1Q2P A;  1HVB A;  3BFF A;  3D4F A;  2ZM0 A;  3BLM A;  2PU4 A;  1AXB A;  3IHB A;  3G30 A;  1W8Y A;  4GDN A;  2XR0 A;  3SH8 A;  2Y2K A;  2ZC3 B;  4S2P A;  5FQJ A;  2A49 A;  2JC7 A;  5FI2 A;  2ZM2 A;  4LV3 A;  5EOE A;  3VFH A;  3FKW A;  4QB8 A;  5DVA A;  1C3B A;  1MWR A;  4OOY A;  3IF5 A;  1FR6 A;  3VFF A;  1ES3 A;  2DRW A;  3BLS A;  2X01 A;  5JYP A;  3ZDJ A;  2Q9N A;  3MZF A;  3MKE A;  3OCL A;  4OQ0 A;  4MBF A;  4QHC A;  1CEG A;  3AGD A;  4ZAM A;  1KE0 A;  1I2S A;  4S2M A;  5CHU A;  3SS5 A;  1CI8 A;  4UHU A;  1XKZ A;  4BD0 A;  4PM6 A;  3NY4 A;  1MXO A;  1SDN A;  1XA7 A;  3WS2 A;  3A3E A;  2EX2 A;  4GD8 A;  4Y7P A;  1HTZ A;  1VM1 A;  1ZG4 A;  3NCK A;  5CEC A;  1ERM A;  3ZG5 A;  2XD1 A;  1MY8 A;  5CGS A;  2EXB A;  2J9P A;  1NZU A;  5FSR A;  2XFT A;  4FH4 A;  1FSW A;  1MPL A;  2WK0 A;  4X55 A;  4OLD A;  3GVB A;  3GSG A;  4IED A;  3C4P A;  2XK1 A;  4JBF A;  5A93 A;  3OZH A;  1FCO A;  1GHP A;  3A3I A;  2WUQ A;  4IVI A;  4EBN A;  3C7V A;  4ZJ3 A;  2Z2M B;  4WZ4 A;  5CTN A;  3GTC A;  2OV5 A;  5F1F A;  4KZ8 A;  1GA0 A;  2EX8 A;  3PAG A;  5E2E A;  1ES5 A;  4KQO A;  3Q7V B;  4KG5 A;  5KSH A;  1MKI A;  4JXS A;  1ZG6 A;  1RP5 A;  1K57 A;  1ERQ A;  2ZC5 B;  2WKI A;  4IVK A;  1YLP A;  4OON A;  3W4O A;  3N6I A;  1I5Q A;  1NYM A;  1JVJ A;  1NXY A;  2XGN A;  4HBU A;  2Y2J A;  4RVA A;  4E6W A;  1L0G A;  4YFM A;  4RX3 A;  1BLC A;  3FV7 A;  1HD8 A;  1N4O A;  3SH9 A;  1E3U D;  2EX9 A;  1DJC A;  3BEC A;  1XGJ A;  4OP5 A;  5EVL A;  3HUM A;  3MFD A;  5DTK A;  1K6S A;  5EE8 A;  3E2L A;  4D2O A;  4ID4 A;  3ZG7 B;  3CZD A;  5AQ7 A;  2H5S A;  3G2Z A;  5GL9 A;  1QME A;  2ZQ9 A;  5IHV A;  3IQA A;  3OPL A;  2Q9M A;  4QY6 A;  3VP4 A;  1L2S A;  1KVM A;  1YMX A;  1FOF A;  2OSU A;  2WKE A;  3CG5 A;  3LCE A;  4S2J A;  3V3R A;  5KZH A;  1TDG A;  3NDE A; 
#chains in the Genus database with same CATH topology
 2V8F A;  3IXH A;  4D60 A;  1XPB A;  4I3A A;  1F2K A;  2HDQ A;  3HLE A;  1DJB A;  4Y0O A;  4KZ9 A;  4I39 A;  1LSW A;  4KEN B;  1CF0 A;  3A3J A;  2ZM8 A;  3TSG A;  5M19 A;  1T1A A;  4UQI M;  5F82 A;  4BD1 A;  1STZ A;  5CXW A;  4GDB A;  1J9M A;  5FAQ A;  4G3V A;  2C5W B;  4BL2 A;  2ZL1 B;  5FEF A;  1GA9 A;  3CLO A;  1I2W A;  1BT5 A;  2WGI A;  3NUL A;  4UA9 A;  4HJ4 A;  3B33 A;  4HJ6 A;  1SHV A;  3A0R A;  3P98 A;  2XQZ A;  5GHY A;  4CJN A;  4DE3 A;  1X0O A;  3H82 B;  3JVU A;  4Y0T A;  3HJK A;  2PYP A;  2QPN A;  4HES A;  4M3K A;  2EWV A;  3LEQ A;  1W7F A;  3B47 A;  5EUA A;  5HAQ A;  4P0M A;  1BLP A;  4NXF A;  3LR4 A;  4KQQ A;  5FL3 A;  4WN5 A;  4WMC D;  3FZC A;  5JYO A;  3DAV A;  3MZD A;  3RXW A;  2I9V A;  1XFN A;  2X02 A;  4Q0H A;  1K55 A;  1OTD A;  4Z9Q A;  1F98 A;  3UDX A;  3G31 A;  2CC1 A;  4YIN A;  1Y54 A;  3O86 A;  4KZ4 A;  3PHY A;  4S2L A;  1NJ4 A;  1P9W A;  1IYP A;  4P6B A;  1IYO A;  1K38 A;  2BTF P;  5CEB A;  5E2H A;  3UB8 A;  2YKF A;  1DP6 A;  3RXX A;  1OPX A;  4R38 A;  3T4O A;  3ZNT A;  2Y55 A;  3BW6 A;  4OP8 A;  1SKO B;  2OAQ 1;  1D1J A;  3PR6 A;  5DFY A;  1QMF A;  3MQQ A;  4QPR A;  1KDW A;  3Q1F A;  3LI9 A;  3QP1 A;  2IWD A;  2RCX A;  4GW9 A;  1RGY A;  2V1Z A;  3OC2 A;  1L0F A;  1V9Y A;  3VSL A;  3SW1 A;  4X1M A;  4NKP A;  3HLC A;  1K25 A;  5EVI D;  1JTG A;  5TFQ A;  3C7U A;  4B9O A;  4Q8I A;  3Q81 A;  4R4S A;  1GHI A;  4ZJ1 A;  4MBH A;  5HW3 A;  3RH8 B;  1ACF A;  1IOU A;  1PWD A;  2O9B A;  3F1O B;  2GZA A;  1LLB A;  4S2I A;  2HF6 A;  2RL3 A;  1HLU P;  2WKR A;  4I3J A;  3EOI A;  1DY6 A;  3M6H A;  4H6J B;  4Y5F A;  1W79 A;  2WGW A;  1YLY A;  4EV4 A;  4RX2 A;  1S67 L;  2ZLY A;  2K31 A;  3HVF A;  5HDS A;  1FQG A;  3U4L P;  2Z6C A;  1JWZ A;  3KSH A;  1P0Z A;  2W27 A;  1VEU A;  4GB7 A;  4R70 A;  4DE2 A;  5AVF A;  1LSV A;  3S1Y A;  1VQQ A;  4KG6 A;  5D3O A;  2Y8H A;  3BJN A;  3TOI A;  2FZ0 A;  4WF0 A;  4GN2 A;  1ESU A;  3QP8 A;  2K7S A;  3GQZ A;  3JYI A;  1H8Z A;  4KQR A;  1PYY A;  3AGF A;  2J8Y A;  3ICY A;  2XH9 A;  2WZZ A;  3UE3 A;  1ALQ A;  1EI5 A;  4EBP A;  4N1H A;  1OJG A;  3IF6 B;  4LV2 A;  5EVI C;  2HZ5 A;  3C5A A;  3GR2 A;  1HZO A;  2ZD8 A;  4O01 A;  4DJ2 A;  4JLF A;  4X25 A;  3MR0 A;  1DJA A;  1K54 C;  3C2W A;  4LLO B;  4OPQ A;  4NXE A;  5CGX A;  4DDS A;  2P04 A;  3HLB A;  3T4T A;  3IF6 A;  2QKP A;  3M2K A;  1DRM A;  3QP5 A;  4C3Q A;  5HWW A;  1Z09 A;  2XFS A;  3VP2 A;  2Y2G A;  3K2N A;  2J9O A;  1W5D A;  3GRJ A;  1M6K A;  2HJ9 C;  3MXR A;  4HP4 A;  5F5Y A;  4X68 A;  2O0Y A;  1IKG A;  2PBY A;  1H3Q A;  3G32 A;  4MN7 A;  1OJ5 A;  5EVE A;  1CQA A;  4PM7 A;  2J80 A;  1XXM A;  3EWK A;  5EV0 A;  4NXB A;  4R23 A;  1YLW A;  1F5M A;  3GDI A;  1KGF A;  2V20 A;  1OTI A;  1G6A A;  3O3V A;  4PM5 A;  2ACG A;  2R78 A;  1LL9 A;  1NY0 A;  4MMN A;  5G4Y A;  4EEP A;  3DTK A;  1RCJ A;  3VP0 A;  1H8Y A;  4MN5 A;  1IEL A;  2LB5 A;  1HVB A;  3D4F A;  4RQ9 A;  3LIC A;  3BLM A;  2PU4 A;  1AXB A;  3IHB A;  2FH5 A;  3UB7 A;  3SH8 A;  2Y2K A;  3LI8 A;  4GLQ A;  2M7U A;  4LV3 A;  2X01 A;  2DRW A;  2VEA A;  3MKE A;  1CEG A;  4ZAM A;  2A2L A;  3MFX A;  3SS5 A;  1XKZ A;  1MXO A;  3WS2 A;  1T18 A;  1VM1 A;  3NCK A;  5HZH A;  5DJT A;  2VZW A;  5AVE A;  3ZG5 A;  1MY8 A;  3E4Q A;  5J4E A;  5FSR A;  2V8C A;  4FH4 A;  1FSW A;  2JKR M;  3GSG A;  4IED A;  2XK1 A;  4JBF A;  3OZH A;  4UQI S;  4I38 A;  3C7V A;  1K0K A;  4KZ8 A;  4HH3 A;  3NJA A;  1ES5 A;  1RP5 A;  4GHI B;  1YLP A;  2QJ5 A;  3W4O A;  1JVJ A;  2XGN A;  4RVA A;  3E98 A;  1HD8 A;  1E3U D;  4Y17 A;  1DJC A;  3BEC A;  3MQO A;  5MC7 A;  5EE8 A;  4D2O A;  4ID4 A;  4Z1W A;  5GL9 A;  2JKG A;  4GHI A;  5AQ7 A;  5HD3 A;  3K3C A;  5IHV A;  3OPL A;  1YSP A;  3FG8 A;  3D72 A;  1YMX A;  3L9K A;  4S2J A;  2ZMV A;  1TDG A;  1FCM A;  3WRT A;  5CTM A;  4U3T A;  2W1R A;  1L3L A;  3F1N B;  3VOY A;  4DF6 A;  3KSI A;  1O7E A;  3WS4 A;  4BBT A;  2W0N A;  3ZHH A;  2P7J A;  4NK3 A;  4JXW A;  5FQK A;  3NOP C;  4KZB A;  5DTS A;  3FPW A;  4PPR A;  4KQD A;  5FA7 A;  1IEM A;  4UAA A;  2ZBB A;  4WZ5 C;  4O7D A;  3F1P A;  4PKY A;  2GDN A;  3F1N A;  5CHM A;  2IWB A;  1KDS A;  1FIK A;  2WYX A;  3QP6 A;  3TE8 A;  4OQH A;  5EPH A;  4DXB A;  1WE4 A;  3ZFZ A;  3NC8 A;  1K54 A;  3ZCZ A;  2X71 A;  3RJU A;  4M4X A;  3UPN A;  1YM1 A;  4S2K A;  4OKP A;  4UA7 A;  3JPU A;  2BLS A;  2INW A;  1RGZ A;  2HDS A;  3B3X A;  1BUE A;  1OT6 A;  3CPT B;  2Y2H A;  4F3L A;  1K56 A;  1PZP A;  5FI6 A;  3IWO A;  1E25 A;  4EQ1 A;  4HEF A;  4DRT A;  3SOI A;  3SH7 A;  2M1C A;  2V0U A;  4BL3 A;  1LSX A;  4WMC A;  5CHJ A;  2QJ7 A;  3QNC A;  3N7W A;  3TRC A;  2CMN A;  1JWP A;  3D9Y A;  3M2J A;  4BEN A;  4S2N A;  1LHY A;  2HP5 A;  3V39 A;  1ES4 A;  1ZHH B;  4ESP A;  2Y2L A;  4G3W A;  2GJ3 A;  3N8S A;  3BM6 A;  4H6J A;  3IHA A;  2DMW A;  4OH0 A;  3FKV A;  2PT7 A;  1TS6 A;  5M1A A;  3WS1 A;  3Q82 A;  3NOU C;  2M7V A;  3NEC A;  5FEG A;  1N9O A;  1ZC2 A;  3HLF A;  2WAD A;  2ZL1 A;  5EVI B;  2IWC A;  4A5R A;  5HDC A;  1VEU B;  4HQA A;  4K0W A;  2VX8 A;  1KGG A;  2Y2N A;  1XJ6 A;  3OPH A;  4KZ5 A;  1JTD A;  4LV0 A;  1ZKJ A;  4E3J A;  5EVI A;  2HP6 A;  4P6Z M;  5GLD A;  2JE5 A;  4S2N C;  4N9K A;  4WEK A;  3ZG0 A;  1CEF A;  5FQM A;  1ERO A;  3UDF A;  1G6O A;  3BFC A;  3MZE A;  2JCH A;  3N8L A;  3WWX A;  4UA6 A;  4YWZ A;  4IUK A;  4FTX A;  4HY8 A;  2ZC4 B;  3SS3 A;  4DXC A;  5F83 A;  1Z6F A;  2HDR A;  2EA9 A;  4LRX C;  3UB6 A;  2OWH A;  1LI9 A;  1M40 A;  4IUH A;  4LCM A;  3AGE A;  3VE3 A;  2D02 A;  5G18 A;  2E8I A;  4EER A;  1PWG A;  1XGI A;  4PAU A;  3S22 A;  1E4D A;  5J8X A;  2JKF A;  4WEJ A;  2EX6 A;  4JXG A;  4R1G A;  1ES2 A;  2VV7 A;  1O07 A;  3LO7 A;  4MN6 A;  3S7O A;  3ZG9 B;  4ETX A;  3H9W A;  4GZB A;  1NLY A;  3S7Q A;  4R4R A;  1YPR A;  4DE1 A;  4K08 A;  2YKH A;  4ZTK A;  5J3W A;  2KDK A;  2IA2 A;  1BZA A;  3GMW A;  2P08 A;  4FD8 A;  5CX7 A;  4WUJ A;  4JXV A;  4LGW A;  1LL5 A;  2FFY A;  3VE4 A;  1GHM A;  3G2Y A;  4XXR A;  2WAE A;  2PR5 A;  3QNB A;  3ZG8 B;  1JNU A;  5L2F A;  2XA7 S;  3DTM A;  1W63 M;  5F1G A;  2V1A A;  4E3I A;  4AFI A;  4X69 A;  2MJ6 A;  3BFG A;  4R3J A;  4YOF A;  3OLO A;  4C75 A;  4ZBE A;  4F94 A;  1E3U A;  4P87 A;  3CUE A;  1ONH A;  2W1T A;  4XUX A;  1K6R A;  2JN7 A;  4JGR A;  2E8J A;  3VMA A;  1OME A;  4NET A;  3CI6 A;  5FAS A;  4R3B A;  4X1L A;  2QYB A;  1NZO A;  2O99 A;  3A3F A;  3BFD A;  1N9L A;  1ESI A;  3DW0 A;  1KE4 A;  2VGL S;  5A91 A;  3V3S A;  3N4I A;  5M18 A;  1VET A;  4E6X A;  3Q7Z A;  3P09 A;  4WM9 A;  4DN0 A;  2NUT C;  1MWS A;  2Y59 A;  2G7U A;  2Y4A A;  2JHE A;  2O9C A;  2PD8 A;  4OPR A;  4NEE D;  5DF9 A;  4EET B;  5FI7 A;  3HLD A;  1Y4O A;  4P85 A;  2QWS A;  5F6A A;  1BUL A;  4HHD A;  4X6T A;  2KOI A;  1Q2P A;  3BFF A;  4CLC C;  3KSF A;  5DFX A;  1W8Y A;  5F69 A;  3IS2 B;  2JKT M;  3LGO A;  2A49 A;  2JC7 A;  1NWZ A;  5FI2 A;  5EOE A;  1PFL A;  4QB8 A;  1C3B A;  1MKM A;  3IF5 A;  1UWN X;  4LRZ E;  3MQ0 A;  3T50 A;  4MBF A;  4QHC A;  3AGD A;  3PXP A;  1P97 A;  4BD0 A;  1SDN A;  3A3E A;  2EX2 A;  1HTZ A;  3T4K A;  1WA9 A;  1ZG4 A;  5CEC A;  4CLC E;  2XD1 A;  3F1P B;  5CGS A;  2J9P A;  2V1B A;  4UEY A;  3TJZ C;  2XFT A;  4ARZ A;  4OLD A;  3C4P A;  2VJW A;  5A93 A;  5L09 A;  2WUQ A;  2VK3 A;  1YSQ A;  3GTC A;  3GEC A;  2HJE A;  2W3D A;  3Q7V B;  4KG5 A;  4JXS A;  5A8B A;  5L10 A;  1K57 A;  2ZC5 B;  2WKI A;  1CJF A;  3N6I A;  3CPT A;  1NYM A;  4HIA A;  1NXY A;  2Y2J A;  4YFM A;  4RX3 A;  1N4O A;  4OP5 A;  5EVL A;  3E2L A;  3ZG7 B;  3CZD A;  3LFV A;  1QME A;  4R6L A;  4QY6 A;  2Q9M A;  3VP4 A;  4EEU A;  1L2S A;  1OTB A;  2OSU A;  4CLC A;  5JYP A;  3NDE A;  1Y28 A;  5HX9 A;  1XJ2 A;  5KMW A;  5HSQ A;  2A24 B;  5GHZ A;  3A0S A;  3NBL A;  3ULF A;  4GS9 B;  4YNR A;  5E2G A;  4HNB A;  4N9L A;  3QP4 A;  3LUQ A;  2B95 A;  1PIO A;  4MCW A;  3EGD C;  3MXS A;  3BYD A;  3IXG A;  4BQM A;  5E43 A;  2PR6 A;  4QD4 A;  4GJ4 A;  4U0X A;  2VGK A;  2QZ6 A;  2ZOI A;  4KZ3 A;  3RFB A;  2C6W B;  3LID A;  3OPR A;  1PI4 A;  4EUV A;  4WEL A;  3FWL A;  3HUO A;  1BSG A;  4LV1 A;  5FDH A;  1S1Z A;  3IF6 C;  3EEA A;  1PW1 A;  4OLG A;  3CUE C;  2PHY A;  2J3T D;  2ZQD A;  3UPO A;  2DNS A;  2HDU A;  3I7J A;  4BBU A;  4MLL A;  4EQI A;  2UWX A;  1XJ3 A;  1YT4 A;  3CMZ A;  3S4X A;  4H8R A;  1PRQ A;  3OCN A;  5EEC A;  4B93 A;  3EGX C;  1G5U A;  5EFW A;  3P7N A;  5GLB A;  5FAO A;  4C6Y A;  4E3K A;  2ZQ7 A;  4I5S A;  3H82 A;  4JGQ A;  4PM9 A;  2WKH A;  3FPV A;  3PBQ A;  5K5B A;  1H5X A;  4EBL A;  3W4Q A;  2L4R A;  1PWC A;  4JPM A;  3T4L A;  3R4K A;  4N1X A;  1SKF A;  2H10 A;  2WKP A;  1N9B A;  1NYY A;  1G68 A;  3T1S A;  5CED A;  2XF3 A;  5GHX A;  4IBX A;  3KO6 A;  3G34 A;  5TGF A;  4JF4 A;  4KZ7 A;  5EOO A;  4ZDX A;  2VV8 A;  5DKL A;  2K2N A;  5A90 A;  4OOM A;  3VSK A;  3S7N A;  3UN7 A;  4QWO A;  3C30 A;  1NRF A;  4B4Z A;  4B88 A;  2J7V A;  4JF6 A;  1YLZ A;  4DMZ A;  3UB9 A;  1W63 Q;  5HL6 A;  2R9X A;  4EU0 A;  2L1M A;  3HUN A;  4E3M A;  2A3U A;  4Y0U A;  1ZTU A;  1KVL A;  3MKF A;  3HBR A;  1T19 A;  3IT9 A;  3FC7 A;  2Y2M A;  1Q2Q A;  3G4P A;  4E3O A;  2PU2 A;  3DWZ A;  2D01 A;  4GOG A;  1XFQ A;  4F3L B;  3ZVW A;  3CWF A;  2JBF A;  5AJG A;  1IFQ A;  3T4S A;  3ZVT A;  4Y2F A;  2ZQC A;  3UNW A;  1LI0 A;  4ETZ A;  2PAV P;  1XA1 A;  2W3E A;  3C8C A;  3ZGA B;  2H28 A;  4WYY A;  4EWF A;  1TD5 A;  3QHY A;  1EWZ A;  2Y2P A;  1DP9 A;  1D7E A;  3UO9 A;  2WAF A;  1MWT A;  3ITB A;  2XLN A;  4U0T A;  1MBL A;  5GLC A;  1K4F A;  3CAX A;  3IWI A;  3MF0 A;  2PYR A;  4G3K A;  2HGV A;  3PBN A;  1BLH A;  1BLS A;  2UV0 E;  3E4O A;  4RA7 A;  4O8G A;  2VGJ A;  1T1C A;  5KIZ A;  5AQA A;  2EFU A;  3A0V A;  2WGW B;  2Y2O A;  4NG2 A;  3UDI A;  5HAP A;  3IXD A;  1YAX A;  2GX5 A;  5TBM B;  1S4R A;  4KZ6 A;  3VP3 A;  3MBZ A;  4E3L A;  3IXB A;  3ZQ5 A;  4WLA A;  1NRJ A;  2XD5 A;  1PW8 A;  3U2A A;  3Q07 A;  4KG2 A;  4PHT A;  3UY6 A;  2JKR I;  5E2F A;  2OLU A;  4DJ3 A;  1SCW A;  2Z2L B;  3W8K A;  1W8Q A;  3DBA A;  1BYW A;  3H7W A;  2XSS A;  2G2W A;  5TBM A;  2OOL A;  4I3I A;  3MSH A;  4DDY A;  4LFU A;  1YLJ A;  3MS6 A;  4KZA A;  1KE3 A;  3NI9 A;  4X53 A;  3C38 A;  3WRZ A;  5FQ9 A;  4IBR A;  5IT5 A;  3T12 B;  2WGV A;  5AQ9 A;  4LCL A;  3TG9 A;  1N9N A;  3LIA A;  3BWL A;  3N8R A;  3W2Z A;  3PAE A;  4B4X A;  1V9Z A;  4HI4 A;  1G28 A;  4FUW A;  1MZU A;  1P9R A;  3S7P A;  3BRM A;  3LR0 A;  1BTL A;  1JWV A;  3UE1 A;  5A92 A;  4QU3 A;  2Y2I A;  3DTE A;  1VHM A;  1K4E A;  1TS7 A;  1XX2 A;  4OPY A;  3EQV A;  3VOZ A;  4FSF A;  3EQU A;  4XT2 A;  3UB5 P;  3PBT A;  1KGE A;  3LY3 A;  5GLA A;  2XDM A;  2GNX A;  3OBF A;  5TJJ A;  4QY5 A;  4K91 A;  2P9V B;  4OQI A;  3V50 A;  4FOF A;  5HWT A;  4X56 A;  4OOL A;  2HPB A;  2VA0 A;  1XJ4 A;  1SDE A;  2PDR A;  4XT2 B;  2W3H A;  2ZC3 B;  1MC0 A;  1LL8 A;  3LYX A;  2ZM2 A;  3VFH A;  3FKW A;  5DVA A;  1MWR A;  4OOY A;  1FR6 A;  3VFF A;  5IS1 A;  3BLS A;  2ZMF A;  3MZF A;  2W1T B;  4NXG A;  1KE0 A;  2XA7 M;  4GS9 A;  4S2M A;  4EES A;  4UHU A;  3T1Q B;  3NY4 A;  1XA7 A;  4GD8 A;  4Y13 A;  3MJQ A;  2EXB A;  4HOI A;  1NZU A;  2Z6D A;  2WK0 A;  3GVB A;  3IX4 A;  1FCO A;  1GHP A;  3BQA A;  4IVI A;  4ZJ3 A;  2Z2M B;  5HPF A;  1VET B;  4WZ4 A;  5CTN A;  5F1F A;  3K3D A;  3PAG A;  4KQO A;  1ZG6 A;  2ZOH A;  1ERQ A;  4EXO A;  1EW0 A;  1A0K A;  4IVK A;  4OON A;  5HDD A;  4JGP A;  3T1R A;  3T4Q A;  3LR5 A;  1BLC A;  2EX9 A;  1XGJ A;  1GSV A;  3HUM A;  5I5L A;  2AVX A;  3G2Z A;  2BAS A;  3IQA A;  2WKE A;  3E0Y A;  1FOF A;  3UMD A;  5KZH A;  5U47 A;  2KX6 A;  3C4O A;  3DWK A;  4FCF A;  4WBG A;  2ZC7 A;  3LEZ A;  4N92 A;  1GCE A;  5KSC A;  1TS0 A;  3KSG A;  2EXA A;  2NUP C;  4E3N A;  2P74 A;  3IWQ A;  4MBK A;  2W3G A;  2WKQ A;  1YMS A;  3V5M A;  5G4Z A;  3QP2 A;  4L9G A;  3PTE A;  2B18 A;  5HPI A;  3UE0 A;  1TEM A;  4KUK A;  2W3F A;  1YLT A;  3Q7V A;  5CRF A;  3VP1 A;  1XP4 A;  5F68 A;  2Y79 A;  2EFX A;  3R7W B;  3BQ8 A;  3W4P A;  2XRN A;  4HJ3 A;  3PBR A;  1WYC A;  4MDZ A;  3WS0 A;  2LB9 A;  4Q0J A;  3WS5 A;  5HAR A;  1L0D A;  5CGW A;  3VV4 A;  2HP9 A;  2XRO A;  3F1O A;  3IX3 A;  3L7H A;  3IH8 A;  4ZJ2 A;  4GNU A;  1PZO A;  4CLC B;  4Y3I A;  1T1B A;  2I72 A;  5C5K A;  5EM1 A;  2OWJ A;  2A24 A;  1FCN A;  1F9I A;  1ODV A;  2V0W A;  1S66 L;  3KX0 X;  3M6B A;  3NHQ A;  2H0Y A;  2ZQA A;  3BY8 A;  3HLW A;  2KLI A;  2BG1 A;  4L9F A;  2VGL M;  3T4J A;  1L0E A;  1AWI A;  4LPZ A;  2OLV A;  2ZC6 B;  2Y91 A;  3SS4 A;  4L0L A;  4WL9 A;  5TR7 A;  2VV6 A;  5DF8 A;  4PM8 A;  5DJU A;  2B5R A;  5AQB A;  2J3T C;  4QJG A;  1PI5 A;  4E04 A;  3NIA A;  3D3O A;  4ZRR A;  3HLG A;  2H0T A;  4JKT A;  4LRY C;  4KUO A;  3HJI A;  5HWV A;  3GV9 A;  3BY9 A;  3DTI A;  3G35 A;  1IYQ A;  3O87 A;  2JKT I;  3B42 A;  1S0W A;  2PRF A;  1PNE A;  5DTT A;  4BBV A;  4GKU A;  4FH2 A;  5HL1 A;  4GD6 A;  4L9E A;  3PBS A;  2O9A A;  3CJM A;  5HFO A;  4OPZ A;  4R0Q A;  2Q0O A;  1K57 C;  2VKS A;  2FFF B;  4R3A A;  5HD5 A;  4PKY G;  1CK3 A;  3P01 A;  3LY4 A;  2J3W A;  3TW8 A;  1IYS A;  4GCZ A;  2ZJ9 A;  1VB6 A;  3BEB A;  3OPP A;  4MEZ A;  5DKK A;  4BMW A;  3MMH A;  3E4P A;  4JF5 A;  5BOH A;  3HL9 A;  4DE0 A;  1TF1 A;  4EUZ A;  1SKO A;  3G6O A;  3T1X A;  4S2O A;  4II7 A;  1OTE A;  2QMI A;  1S6R A;  1OTA A;  2L0W A;  3UE6 A;  2P9V A;  2ZQ8 A;  4OQG A;  4WZ5 A;  5FAT A;  3RTY A;  4BLM A;  5LBR A;  1MWU A;  1YQS A;  3PBO A;  1LT0 A;  1U60 A;  2VLG A;  4CQH A;  1J3W A;  5FQI A;  3PYP A;  1TDL A;  5I94 A;  1FR1 A;  4O0P A;  3A3D A;  2PBD P;  5J7E A;  4RYE A;  4HH2 A;  3FYZ A;  5IU1 A;  4MNR A;  1IKI A;  4XUZ A;  4HBT A;  5CER A;  3LIB A;  4K0X A;  5DF7 A;  4P6Z S;  1FIL A;  2EWW A;  2XEP A;  4Q0I A;  4LEN A;  1K56 D;  2Y2Q A;  5FQQ A;  4OVD A;  1UGU A;  1NLZ A;  3O88 A;  1CI9 A;  3CIT A;  3JVV A;  5FAP A;  1FSY A;  5L8M A;  3UPP A;  4JGO A;  1TVF A;  4Y15 A;  2R9W A;  4BWI A;  3HCY A;  3HRE A;  3LIF A;  2V2F F;  3KYQ A;  5EM0 A;  2QHK A;  1K55 C;  3IH9 A;  3NDG A;  1WYB A;  3E2K A;  3SZT A;  2G2U A;  5L07 A;  3ZNY A;  4PMA A;  4DKI A;  5HAI A;  4HP9 A;  4BJP A;  1S4S A;  3OOV A;  2DCF A;  4CPK A;  3IS2 A;  1ONG A;  3ISG A;  3ITA A;  3IBJ A;  1OT9 A;  1GSX A;  2ZMA A;  3O5Y A;  2WZX A;  3H7W B;  4ME4 A;  3BFE A;  2ZM0 A;  2OAP 1;  1H8M A;  3KYE A;  2B02 A;  4IHQ A;  3G30 A;  4GDN A;  3LIE A;  2XR0 A;  4S2P A;  3IBR A;  5FQJ A;  1GSW A;  1ES3 A;  3ZDJ A;  2Q9N A;  3OCL A;  4OQ0 A;  1KOU A;  1YKD A;  1I2S A;  5CHU A;  1CI8 A;  4CLC D;  4PM6 A;  4Y7P A;  2PD7 A;  1ERM A;  1D06 A;  1UWP X;  3V67 A;  5FDS A;  1MPL A;  4X55 A;  3A3I A;  3VOL A;  4EBN A;  3MXQ A;  3LR3 A;  2OV5 A;  1GA0 A;  2EX8 A;  5E2E A;  5KSH A;  1MKI A;  3IX8 A;  2V9A A;  4ARZ B;  3UME A;  4IJG A;  3CHW P;  1SZV A;  3R7W A;  1S1Y A;  3ZYT A;  4EW7 A;  1I5Q A;  3EEH A;  4HBU A;  4E6W A;  1L0G A;  2HV1 A;  1H0M A;  3FV7 A;  3SH9 A;  1TS8 A;  3MFD A;  5DTK A;  1K6S A;  2H5S A;  3KYZ A;  2ZQ9 A;  1KVM A;  3CG5 A;  3LCE A;  3NOT C;  3V3R A;  1DP8 A; 
#chains in the Genus database with same CATH homology
 5HX9 A;  5KMW A;  1FCM A;  5U47 A;  3WRT A;  5CTM A;  4U3T A;  3IXH A;  1XPB A;  5GHZ A;  3C4O A;  3VOY A;  4DF6 A;  3NBL A;  3DWK A;  1O7E A;  3WS4 A;  4FCF A;  3ZHH A;  2HDQ A;  4NK3 A;  4JXW A;  5FQK A;  3HLE A;  4WBG A;  5E2G A;  2ZC7 A;  3LEZ A;  4N92 A;  1GCE A;  4KZB A;  5DTS A;  1DJB A;  4Y0O A;  4PPR A;  5KSC A;  4KZ9 A;  4KEN B;  5FA7 A;  1IEM A;  3A3J A;  2EXA A;  2ZM8 A;  4N9L A;  4UAA A;  3TSG A;  1PIO A;  4WZ5 C;  5M19 A;  4O7D A;  4E3N A;  5F82 A;  2GDN A;  2P74 A;  4BD1 A;  3IWQ A;  4MBK A;  5CXW A;  3MXS A;  4GDB A;  3BYD A;  1J9M A;  3IXG A;  4BQM A;  5FAQ A;  5E43 A;  5CHM A;  2IWB A;  1YMS A;  1KDS A;  4QD4 A;  2C5W B;  4BL2 A;  2WYX A;  3V5M A;  1GA9 A;  2VGK A;  4U0X A;  2QZ6 A;  1I2W A;  4OQH A;  5EPH A;  4KZ3 A;  4DXB A;  1BT5 A;  1WE4 A;  2WGI A;  3PTE A;  4UA9 A;  3ZFZ A;  2C6W B;  3UE0 A;  1TEM A;  1SHV A;  3OPR A;  1PI4 A;  3P98 A;  3NC8 A;  1K54 A;  3ZCZ A;  2XQZ A;  5GHY A;  2X71 A;  1YLT A;  3RJU A;  3Q7V A;  4CJN A;  4WEL A;  4DE3 A;  3FWL A;  3HUO A;  1BSG A;  4LV1 A;  5FDH A;  3UPN A;  1YM1 A;  4S2K A;  4OKP A;  4UA7 A;  4Y0T A;  3IF6 C;  1PW1 A;  4OLG A;  5CRF A;  2BLS A;  3VP1 A;  1XP4 A;  2ZQD A;  3UPO A;  2DNS A;  1RGZ A;  2QPN A;  2HDU A;  3I7J A;  2EFX A;  2HDS A;  3B3X A;  4HES A;  1BUE A;  4M3K A;  4MLL A;  3W4P A;  4EQI A;  2UWX A;  1YT4 A;  1W7F A;  3CMZ A;  3PBR A;  1WYC A;  2Y2H A;  4H8R A;  3S4X A;  5EUA A;  3WS0 A;  3OCN A;  5EEC A;  5HAQ A;  1K56 A;  1PZP A;  5FI6 A;  3IWO A;  1E25 A;  4P0M A;  4HEF A;  5FAO A;  5GLB A;  4C6Y A;  3WS5 A;  4E3K A;  2ZQ7 A;  5HAR A;  4DRT A;  1L0D A;  1BLP A;  5CGW A;  3SOI A;  4PM9 A;  3SH7 A;  4KQQ A;  2HP9 A;  4WMC A;  4BL3 A;  5CHJ A;  2WKH A;  3QNC A;  3N7W A;  4WMC D;  3FZC A;  3PBQ A;  5JYO A;  3IH8 A;  4ZJ2 A;  1H5X A;  1JWP A;  4GNU A;  1PZO A;  3MZD A;  3RXW A;  3M2J A;  4BEN A;  4EBL A;  3W4Q A;  4S2N A;  2I72 A;  2X02 A;  1K55 A;  1LHY A;  2HP5 A;  1PWC A;  3V39 A;  1ES4 A;  4JPM A;  1FCN A;  4Z9Q A;  2Y2L A;  4N1X A;  3UDX A;  1SKF A;  2H10 A;  3N8S A;  3G31 A;  3BM6 A;  1N9B A;  3IHA A;  1NYY A;  2CC1 A;  3M6B A;  4YIN A;  1Y54 A;  1G68 A;  3O86 A;  2H0Y A;  5CED A;  2ZQA A;  2XF3 A;  4KZ4 A;  4OH0 A;  4S2L A;  5GHX A;  4IBX A;  1NJ4 A;  3FKV A;  1IYP A;  3HLW A;  4P6B A;  1IYO A;  3G34 A;  2BG1 A;  5TGF A;  3UY6 A;  4JF4 A;  4KZ7 A;  1K38 A;  5EOO A;  4ZDX A;  5M1A A;  3WS1 A;  5CEB A;  1L0E A;  3Q82 A;  5E2H A;  5A90 A;  4OOM A;  3VSK A;  1ZC2 A;  3HLF A;  3UN7 A;  2WAD A;  3RXX A;  1NRF A;  2OLV A;  2Y91 A;  2ZC6 B;  4B4Z A;  5EVI B;  3ZNT A;  3SS4 A;  2Y55 A;  4B88 A;  2J7V A;  2IWC A;  1YLZ A;  4JF6 A;  4L0L A;  5TR7 A;  4A5R A;  2R9X A;  4K0W A;  4OP8 A;  5DF8 A;  1KGG A;  4PM8 A;  2Y2N A;  2B5R A;  5AQB A;  3HUN A;  3OPH A;  4QJG A;  1PI5 A;  1QMF A;  1KDW A;  3NIA A;  3Q1F A;  4KZ5 A;  4E3M A;  2A3U A;  1JTD A;  2IWD A;  2RCX A;  4Y0U A;  1RGY A;  2V1Z A;  3OC2 A;  1L0F A;  4LV0 A;  1KVL A;  1ZKJ A;  3MKF A;  3VSL A;  4E3J A;  3HBR A;  3HLG A;  5EVI A;  2HP6 A;  3HLC A;  1K25 A;  3IT9 A;  5GLD A;  2Y2M A;  5EVI D;  1JTG A;  2H0T A;  2JE5 A;  1Q2Q A;  3G4P A;  4JKT A;  4N9K A;  4S2N C;  4E3O A;  2PU2 A;  3DWZ A;  5TFQ A;  4WEK A;  4GOG A;  3C7U A;  3GV9 A;  4Q8I A;  3ZG0 A;  1CEF A;  3ZVW A;  3Q81 A;  3G35 A;  2JBF A;  5FQM A;  4R4S A;  1IYQ A;  1GHI A;  4ZJ1 A;  4MBH A;  5HW3 A;  1ERO A;  3O87 A;  3ZVT A;  3UDF A;  3BFC A;  3MZE A;  1PWD A;  1S0W A;  5DTT A;  2ZQC A;  3UNW A;  4GKU A;  2JCH A;  3N8L A;  3WWX A;  1LI0 A;  1LLB A;  4UA6 A;  4FH2 A;  5HL1 A;  4S2I A;  2ZC4 B;  3SS3 A;  4GD6 A;  1XA1 A;  4DXC A;  5F83 A;  2RL3 A;  3ZGA B;  1Z6F A;  2HDR A;  4WYY A;  3PBS A;  4EWF A;  3QHY A;  3CJM A;  1EWZ A;  2Y2P A;  1DY6 A;  1LI9 A;  1M40 A;  5HFO A;  3M6H A;  3UO9 A;  4LCM A;  4OPZ A;  2WAF A;  1MWT A;  3ITB A;  2XLN A;  4R0Q A;  4U0T A;  1MBL A;  1K4F A;  1K57 C;  3AGE A;  3IWI A;  5GLC A;  2FFF B;  1W79 A;  2WGW A;  1YLY A;  4EV4 A;  5G18 A;  4RX2 A;  1CK3 A;  2E8I A;  3LY4 A;  1PWG A;  1XGI A;  3S22 A;  2ZLY A;  3PBN A;  1E4D A;  1IYS A;  5J8X A;  1BLH A;  1BLS A;  4RA7 A;  3HVF A;  2ZJ9 A;  3BEB A;  3OPP A;  4WEJ A;  2VGJ A;  2EX6 A;  1FQG A;  4JXG A;  1JWZ A;  5AQA A;  4MEZ A;  2EFU A;  4R1G A;  1ES2 A;  2Y2O A;  2WGW B;  4JF5 A;  1O07 A;  3LO7 A;  3HL9 A;  5BOH A;  4GB7 A;  3UDI A;  4DE0 A;  4DE2 A;  3ZG9 B;  5HAP A;  3IXD A;  4GZB A;  4EUZ A;  3S1Y A;  4R4R A;  4DE1 A;  1VQQ A;  4S2O A;  4KG6 A;  4KZ6 A;  2QMI A;  5D3O A;  3MBZ A;  3VP3 A;  4ZTK A;  4E3L A;  1S6R A;  3IXB A;  1BZA A;  3GMW A;  3TOI A;  4FD8 A;  2XD5 A;  4GN2 A;  1PW8 A;  1ESU A;  4JXV A;  3Q07 A;  4KG2 A;  1LL5 A;  2P9V A;  2FFY A;  2ZQ8 A;  3GQZ A;  3JYI A;  1GHM A;  4OQG A;  1H8Z A;  4KQR A;  4WZ5 A;  1MWU A;  5E2F A;  4BLM A;  1PYY A;  3AGF A;  2J8Y A;  2OLU A;  3G2Y A;  2XH9 A;  1YQS A;  2WZZ A;  3PBO A;  3UE3 A;  1ALQ A;  1EI5 A;  1SCW A;  2Z2L B;  3W8K A;  4N1H A;  1W8Q A;  4EBP A;  4XXR A;  1U60 A;  2WAE A;  2G2W A;  3IF6 B;  5FQI A;  4LV2 A;  4DDY A;  1TDL A;  5EVI C;  3QNB A;  3C5A A;  3ZG8 B;  5I94 A;  3GR2 A;  1FR1 A;  1YLJ A;  1HZO A;  4KZA A;  5L2F A;  3DTM A;  3A3D A;  2ZD8 A;  1KE3 A;  3NI9 A;  4JLF A;  4X53 A;  5F1G A;  4RYE A;  3FYZ A;  3WRZ A;  1DJA A;  1K54 C;  1IKI A;  4MNR A;  4XUZ A;  4E3I A;  4HBT A;  4X69 A;  3BFG A;  5CER A;  5FQ9 A;  4OPQ A;  5CGX A;  4K0X A;  4R3J A;  5DF7 A;  4DDS A;  4IBR A;  2XEP A;  3HLB A;  4C75 A;  4ZBE A;  4F94 A;  1E3U A;  3IF6 A;  4P87 A;  4LEN A;  2WGV A;  1K56 D;  1ONH A;  2Y2Q A;  5FQQ A;  5AQ9 A;  4OVD A;  4XUX A;  3M2K A;  1K6R A;  3O88 A;  4LCL A;  3TG9 A;  1CI9 A;  3VMA A;  1OME A;  4C3Q A;  4NET A;  5FAP A;  2XFS A;  3N8R A;  1FSY A;  3PAE A;  3VP2 A;  4B4X A;  2Y2G A;  5FAS A;  4R3B A;  3UPP A;  1TVF A;  2R9W A;  2J9O A;  1W5D A;  3BRM A;  3GRJ A;  5FAT A;  1BTL A;  1NZO A;  1JWV A;  3HRE A;  3A3F A;  3BFD A;  3UE1 A;  1M6K A;  5A92 A;  1ESI A;  2V2F F;  3DW0 A;  1KE4 A;  4QU3 A;  3MXR A;  5A91 A;  2Y2I A;  4X68 A;  3V3S A;  1K4E A;  3N4I A;  5M18 A;  2PBY A;  1IKG A;  1XX2 A;  1K55 C;  3IH9 A;  3NDG A;  4OPY A;  4E6X A;  3EQV A;  3Q7Z A;  3VOZ A;  3G32 A;  1WYB A;  3E2K A;  3P09 A;  4WM9 A;  2G2U A;  1MWS A;  2Y59 A;  4FSF A;  3EQU A;  4PM7 A;  3ZNY A;  4PMA A;  1XXM A;  4DKI A;  2Y4A A;  5HAI A;  4OPR A;  4R23 A;  1YLW A;  3PBT A;  4BJP A;  1KGF A;  1KGE A;  5DF9 A;  3LY3 A;  5GLA A;  2XDM A;  2DCF A;  5FI7 A;  4CPK A;  2V20 A;  3HLD A;  1G6A A;  3O3V A;  4PM5 A;  4QY5 A;  4P85 A;  4K91 A;  1ONG A;  2P9V B;  3ISG A;  3ITA A;  4OQI A;  3V50 A;  1LL9 A;  1NY0 A;  4X56 A;  4OOL A;  2HPB A;  1BUL A;  2ZMA A;  2WZX A;  1RCJ A;  4X6T A;  3VP0 A;  1H8Y A;  3BFE A;  1IEL A;  1SDE A;  1Q2P A;  1HVB A;  3BFF A;  3D4F A;  2ZM0 A;  3BLM A;  2PU4 A;  1AXB A;  3IHB A;  3G30 A;  1W8Y A;  4GDN A;  2XR0 A;  3SH8 A;  2Y2K A;  2ZC3 B;  4S2P A;  5FQJ A;  2A49 A;  2JC7 A;  5FI2 A;  2ZM2 A;  4LV3 A;  5EOE A;  3VFH A;  3FKW A;  4QB8 A;  5DVA A;  1C3B A;  1MWR A;  4OOY A;  3IF5 A;  1FR6 A;  3VFF A;  1ES3 A;  2DRW A;  3BLS A;  2X01 A;  5JYP A;  3ZDJ A;  2Q9N A;  3MZF A;  3MKE A;  3OCL A;  4OQ0 A;  4MBF A;  4QHC A;  1CEG A;  3AGD A;  4ZAM A;  1KE0 A;  1I2S A;  4S2M A;  5CHU A;  3SS5 A;  1CI8 A;  4UHU A;  1XKZ A;  4BD0 A;  4PM6 A;  3NY4 A;  1MXO A;  1SDN A;  1XA7 A;  3WS2 A;  3A3E A;  2EX2 A;  4GD8 A;  4Y7P A;  1HTZ A;  1VM1 A;  1ZG4 A;  3NCK A;  5CEC A;  1ERM A;  3ZG5 A;  2XD1 A;  1MY8 A;  5CGS A;  2EXB A;  2J9P A;  1NZU A;  5FSR A;  2XFT A;  4FH4 A;  1FSW A;  1MPL A;  2WK0 A;  4X55 A;  4OLD A;  3GVB A;  3GSG A;  4IED A;  3C4P A;  2XK1 A;  4JBF A;  5A93 A;  3OZH A;  1FCO A;  1GHP A;  3A3I A;  2WUQ A;  4IVI A;  4EBN A;  3C7V A;  4ZJ3 A;  2Z2M B;  4WZ4 A;  5CTN A;  3GTC A;  2OV5 A;  5F1F A;  4KZ8 A;  1GA0 A;  2EX8 A;  3PAG A;  5E2E A;  1ES5 A;  4KQO A;  3Q7V B;  4KG5 A;  5KSH A;  1MKI A;  4JXS A;  1ZG6 A;  1RP5 A;  1K57 A;  1ERQ A;  2ZC5 B;  2WKI A;  4IVK A;  1YLP A;  4OON A;  3W4O A;  3N6I A;  1I5Q A;  1NYM A;  1JVJ A;  1NXY A;  2XGN A;  4HBU A;  2Y2J A;  4RVA A;  4E6W A;  1L0G A;  4YFM A;  4RX3 A;  1BLC A;  3FV7 A;  1HD8 A;  1N4O A;  3SH9 A;  1E3U D;  2EX9 A;  1DJC A;  3BEC A;  1XGJ A;  4OP5 A;  5EVL A;  3HUM A;  3MFD A;  5DTK A;  1K6S A;  5EE8 A;  3E2L A;  4D2O A;  4ID4 A;  3ZG7 B;  3CZD A;  5AQ7 A;  2H5S A;  3G2Z A;  5GL9 A;  1QME A;  2ZQ9 A;  5IHV A;  3IQA A;  3OPL A;  2Q9M A;  4QY6 A;  3VP4 A;  1L2S A;  1KVM A;  1YMX A;  1FOF A;  2OSU A;  2WKE A;  3CG5 A;  3LCE A;  4S2J A;  3V3R A;  5KZH A;  1TDG A;  3NDE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...