1U67A

Crystal structure of arachidonic acid bound to a mutant of prostagladin h synthase-1 that forms predominantly 11-hpete.
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
553
structure length
553
Chain Sequence
PVNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPEIWTWLRTTLRPSPSFIHFLLTHGRWLWDFVNATFIRDTLMRLVLTVRSNLIPSPPTYNIAHDYISWESFSNVSYYTRILPSVPRDCPTPMGTKGKKQLPDAEFLSRRFLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQMLNGEVYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYATIWLREHNRVCDLLKAEHPTWGDEQLFQTARLILIGETIKIVIEEYAQQLSGYFLQLKFDPELLFGAQFQYRNRIAMEFNQLYHFHPLMPDSFRVGPQDYSYEQFLFNTSMLVDYGVEALVDAFSRQPAGRIGGGRNIDHHILHVAVDVIKESRVLRLQPFNEYRKRFGMKPYTSFQELTGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEMGAPFSLKGLLGNPICSPEYWKASTFGGEVGFNLVKTATLKKLVCLNTKTCPYVSFHVPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of arachidonic Acid bound to a mutant of prostaglandin endoperoxide h synthase-1 that forms predominantly 11-hydroperoxyeicosatetraenoic Acid.
pubmed doi rcsb
source organism Ovis aries
molecule tags Oxidoreductase
molecule keywords Prostaglandin G/H synthase 1 precursor
total genus 164
structure length 553
sequence length 553
ec nomenclature ec 1.14.99.1: Prostaglandin-endoperoxide synthase.
pdb deposition date 2004-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF03098 An_peroxidase Animal haem peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.640.10 Mainly Alpha Orthogonal Bundle Myeloperoxidase, subunit C Haem peroxidase domain superfamily, animal type 1u67A02
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1u67A01
1U67A 1CVWL 3SXVA 4HHRA 2K2TA 4RRWA 1D7WC 3SOVA 1IJQA 1EMNA 4ZAEB 1FFMA 1AUTL 2EI8B 1NFUB 1EQGA 1L5GB 1Z6EL 1UZKA 4X8UL 3ZS1C 1B9WA 2WPLE 3LTGD 2YGPA 2WYJB 1KLOA 5E8DA 1IQFL 3N8WA 2VH0B 3V65B 4AQTA 1L3YA 3MDLA 2F9BL 3R4XA 4Y79B 1XKAL 2M74A 2EHAA 4C16A 4OTJA 2P16L 2GJMA 5GLSA 1W7XL 4ZXYL 5CKMA 4Y71B 4BDWA 1ADXA 1HCGB 2MGRA 2G00L 2PHBB 6COXA 2D1JB 4Y55A 1IQLL 3HO3A 4BXWA 4GN6A 3GCWE 1YUFA 5L2ZL 3OLTA 1XKBA 3HPTA 2OJVA 1DDXA 3LN1A 1IVOC 3BT2A 1G1QA 4MMZB 1F0RB 2XC5L 1SZBA 2XBVL 2J34B 3KRKA 2PUMA 3V6QA 4XL1A 4NGAL 3BT1A 3HS5A 2PR3B 3QH0A 4ZHAB 1FAXL 3NIUA 1HREA 3KQDL 2BQ7A 1EPJA 2VJ3A 3BPSE 2W2OE 1PXXA 2Z5ZA 2UWLB 5B72A 5JBAE 2J38B 4PNXA 4KSZA 2PUQL 5CISA 3QCWA 3UBAA 3ERIA 3C9AC 1CXPC 4KVKA 2FLGA 4BTTA 1UZPA 1HAEA 1LPKA 2Y7ZB 4JYVL 5JVZA 2BZ6L 3ELAL 1WHFA 2CJIB 1YGCL 1PTHA 3GCLA 3Q7DA 2J2UB 4CUEA 1IOXA 1DX5I 3TZIA 5GH0A 3S4FA 2RNLA 2KV4A 1LPZA 5I46L 4RRXA 3DEMA 4CUDA 5CKNA 3HO5A 2Y38A 1KLIL 4JZFL 5JW1A 3IITB 1M1XB 3CA7A 2XC4L 2VWOL 1HRFA 3OGWA 1N7DA 1W8BL 2WYGB 4O1ZA 2BMGA 1X7AL 2Y5HL 3R5OA 2BOKL 5F1AA 5IKRA 2B7DL 1EQHA 2Y7XB 4M10A 1NFYB 4GM7A 2J4IB 5FDQA 5FIWC 5CKQA 1IQNL 3NTBA 2YGOA 4BDXA 4KVJA 3Q9KA 1KSNB 2EI7B 1G2MB 1NT0A 3IJEB 3KRQA 3ENSA 2VWLL 3PGHA 3TH3L 2UWPB 1D5LC 3MQEA 4CUFA 2MGPA 3TGYA 5KIRA 2WPME 4Z0KB 2W3IB 1PRHA 1URKA 2VH6B 4Y76B 2XBXL 4A7IA 2NQXA 1N1IA 2XC0L 1ATBA 3M36L 2KL7A 4O02B 2BQWA 1HAFA 3FNLA 2QRBA 1JBUL 1NPEB 5EGMB 1CQEA 4BTUA 4XLWA 2JKHL 3N8ZA 5F19A 1ZAQA 1FSBA 3V64C 4COXA 4N7AA 2VVUL 1NFWB 1UZJA 3GCKA 4NT3A 3LTFB 2FZZL 3NTGA 2Y80B 1G1RA 2R5LA 4JZEL 2GD4A 1BF9A 1Z6CA 3I6NA 5IKVA 3FCSB 3KQBL 1G1TA 1IQEL 1F7EA 2W2NE 1PGEA 1APOA 2BQ6A 1IQGL 4E1GA 1EPIA 4LMFA 2Y82B 1NQLB 3SOBB 1HZ8A 1DIYA 3GCXE 5JBCE 3TBDA 4C1MC 1QFKL 2WFXB 1WU1B 4G1MB 3NJPC 1LQDA 2UWOB 2KB9A 3BXIA 2WPKE 1EPHA 1HX2A 5IKQA 1ATAA 2I9AA 4YZUB 1IOEL 2NPRA 2MHPA 4YT7L 3N8FA 2P3FN 3SW2A 1MYPC 3ZS0C 1DNWC 1K37A 1K36A 1A3PA 5IKTA 3SOQA 1RFNB 1OB1C 4PH9A 1IP0A 1TOZA 1D2VC 3H5CB 4FM5A 2QQTA 2J95B 1YUKB 3M37L 4CSYA 1HT5A 2OYEP 1Q4GA 2P94L 1ATEA 2O86A 1JV2B 1FF7A 1HT8A 2P3FL 3CENL 1PFXL 3POYA 4RUTA 1FAKL 1HJ7A 2P3TA 1IQML 1EPGA 4Y7AB 3R55A 1COUA 1NFXB 3CFWA 2WG4B 3ZYJB 4RS0A 2AYLA 1XFEA 3LIWB 3FAQA 1KIGL 2FLBL 1YO8A 2WPJE 1LPGA 4OTYA 2IKCA 2E9EA 2W86A 1EAIC 1EMOA 1IGZA 4M11A 2VVCK 3N8YB 5FF1A 2BO2A 2QPKA 4Y6DB 3HS6A 3F1SB 2VWMK 3KQEL 1P0SL 4OEKA 4X8SL 2P3UA 1WHEA 1ATDA 4Z0LA 2ADXA 2Y5FL 2FLRL 4RRYA 1IQIL 1CCFA 3QMOA 3GCJA 4LORA 4KVLA 3ZYIB 3ERHA 3EGFA 3U73A 1CEJA 1MQ6L 2XBYL 4HHSA 2BOHA 5JB8E 3ASIA 1V3XB 2EI6B 2J94B 4XBMA 5JB9E 3N8XA 1MHLC 1G2LB 4MMYB 2WPIE 2P26A 3FBYA 4D90A 3GC1A 1IGXA 1LMJA 1F0SB 3N8YA 5HPWA 4JZDL 4BTIA 2WPHE 2Y81B 4NA9L 1DQBA 1O5DL 1TPGA 3KL6B 1DVAL 4Y7BB 4ISHL 3QF1A 2P28B 3F6UL 3KCGL 3KQCL 3TK6B 3N8WB 2IPSA 2FD6A 1IQKL 4D0EA 5COXA 3LN0A 2I9BA 5JBBE 3R5QA 2OYUP 2RA0L 2BOXA 3FFGL 2Q1JB 3RR3A 2Y5GL 3LC3B 4X8TL 3N8VA 3OLUA 4DL1C 1EZQB 1MQ5L 1DNUC 4QJQA 1XDTR 1APQA 1GK5A 2TGFA 1KLJL 2BOUA 2WFTA 2XBWL 3LC5B 4QYQA 4LJJA 2RHPA 4IG5A 2W26B 1IQHL 3R05A 2P95L 4MMXB 4NG9L 3NT1A 3NYHA 1U8CB 3HS7A 5JVYA 3LAQA 4ISIL 5K0HB 4NJBA 3CS7L 2VWNL 1YUGA 2W2PE 1NZIA 2W3KB 2K2SB 2DDUA 2WG3C 1EGFA 4BXSA 3Q3KB 4Z6AL 4X8VL 5KN5C 1CCVA 1J9CL 2EFBA 3GISX 3K9XA 4RRZA 5L30L 1EBVA 1FE2A 3ZYGA 1G1SA 2H9EL 3F9PC 5L2YL 1MOXC 4ZXXL 3TGFA 4ZH8B 3U7UG 3RKEA 1TLEA 3P5BL 3HO4A 4MSFA 1JL9A 3QL6A 2PT3A 1CX2A 1C5MF 1FJSL 1CVUA 1I0UA 4YT6L 1IQJL 2P93L 2VVVL 1F7MA 3TK5B 2W2ME 3NAKA 4D0FA 1P9JA 4JYUL 3PY4A 4TGFA 2W2QE 3KK6A 1UZQA
chains in the Genus database with same CATH superfamily
1U67A 1CVWL 3SXVA 4HHRA 2K2TA 4RRWA 1D7WC 3SOVA 1IJQA 1EMNA 4ZAEB 1FFMA 1KKEA 1AUTL 2EI8B 1NFUB 1EQGA 1L5GB 1Z6EL 1UZKA 4X8UL 3ZS1C 1B9WA 2WPLE 3LTGD 2YGPA 2WYJB 1KLOA 5E8DA 1IQFL 3N8WA 2VH0B 3V65B 4AQTA 1L3YA 3MDLA 2F9BL 3R4XA 4Y79B 1XKAL 2M74A 2EHAA 4C16A 4OTJA 2P16L 2GJMA 5GLSA 1W7XL 2BSFA 4ZXYL 5CKMA 4Y71B 4BDWA 1ADXA 1HCGB 2MGRA 2G00L 2PHBB 6COXA 2D1JB 4Y55A 1IQLL 3HO3A 2BT7A 4BXWA 4GN6A 3GCWE 1YUFA 5L2ZL 3OLTA 1XKBA 3HPTA 2OJVA 1DDXA 3LN1A 1IVOC 3BT2A 1G1QA 4MMZB 1F0RB 2XC5L 1SZBA 2XBVL 2J34B 3KRKA 2PUMA 3V6QA 4XL1A 4NGAL 3BT1A 3HS5A 2PR3B 3QH0A 4ZHAB 1FAXL 3NIUA 1HREA 3KQDL 2BQ7A 1EPJA 2VJ3A 3BPSE 2W2OE 1PXXA 2Z5ZA 2UWLB 5B72A 5JBAE 2J38B 4PNXA 4KSZA 2PUQL 5CISA 3QCWA 4GU3A 3UBAA 3ERIA 3C9AC 1CXPC 4KVKA 2FLGA 4BTTA 1UZPA 1HAEA 1LPKA 2Y7ZB 4JYVL 5JVZA 2BZ6L 3ELAL 1WHFA 2CJIB 1YGCL 1V1IA 1PTHA 3GCLA 3Q7DA 2J2UB 4CUEA 1IOXA 1DX5I 3TZIA 5GH0A 3S4FA 2RNLA 1QIUA 2KV4A 1LPZA 5I46L 4RRXA 3DEMA 4CUDA 5CKNA 3HO5A 2Y38A 1KLIL 4JZFL 5JW1A 3IITB 1M1XB 2VRSA 3CA7A 2XC4L 2VWOL 1HRFA 3OGWA 1N7DA 1W8BL 2WYGB 4O1ZA 3S6XA 2JJLA 2BMGA 1X7AL 2Y5HL 3R5OA 2BOKL 5F1AA 5IKRA 2B7DL 1EQHA 2Y7XB 4M10A 1NFYB 4GM7A 2J4IB 5FDQA 5FIWC 5CKQA 1IQNL 3NTBA 2YGOA 4BDXA 4KVJA 2EI7B 3Q9KA 1KSNB 2BT8A 1G2MB 1NT0A 3IJEB 3KRQA 3ENSA 2VWLL 3PGHA 3TH3L 2UWPB 1D5LC 3MQEA 4CUFA 2MGPA 3TGYA 5KIRA 2WPME 4Z0KB 2W3IB 1PRHA 1URKA 2VH6B 4Y76B 2XBXL 4A7IA 2NQXA 2HORA 1N1IA 2XC0L 1ATBA 3M36L 2KL7A 2H9EC 1LMMA 4O02B 2BQWA 1HAFA 3FNLA 2QRBA 1JBUL 1NPEB 5EGMB 1CQEA 4BTUA 4XLWA 2JKHL 3N8ZA 5F19A 1ZAQA 1FSBA 3V64C 4COXA 4N7AA 2VVUL 1NFWB 1UZJA 3GCKA 4NT3A 3LTFB 2FZZL 3NTGA 2Y80B 1G1RA 2R5LA 4JZEL 2GD4A 1BF9A 1Z6CA 3I6NA 5IKVA 3FCSB 3KQBL 1G1TA 1IQEL 1F7EA 2W2NE 1PGEA 1APOA 2BQ6A 1IQGL 4E1GA 1EPIA 2YGQA 4LMFA 2Y82B 1NQLB 3SOBB 2KNIA 1HZ8A 1DIYA 3GCXE 5JBCE 3TBDA 4C1MC 1QFKL 2WFXB 1WU1B 4G1MB 3NJPC 1LQDA 2UWOB 2KB9A 3BXIA 2WPKE 1EPHA 1HX2A 5IKQA 1ATAA 2I9AA 4YZUB 1IOEL 2NPRA 2MHPA 4YT7L 3N8FA 2P3FN 3SW2A 1MYPC 3ZS0C 1DNWC 1K37A 1K36A 1A3PA 5IKTA 3SOQA 1RFNB 1OB1C 4PH9A 1IP0A 1TOZA 1D2VC 3H5CB 4FM5A 2QQTA 2J95B 1YUKB 3M37L 4CSYA 1HT5A 2OYEP 1Q4GA 2P94L 1ATEA 2O86A 1JV2B 1FF7A 1HT8A 2P3FL 3CENL 1PFXL 3POYA 4RUTA 1FAKL 1HJ7A 2P3TA 1IQML 1EPGA 4Y7AB 3R55A 1COUA 1NFXB 3CFWA 2WG4B 4GU4A 3ZYJB 4RS0A 2AYLA 1XFEA 3LIWB 3FAQA 1KIGL 2FLBL 1YO8A 2WPJE 1LPGA 4OTYA 2IKCA 2E9EA 2W86A 1EAIC 1EMOA 1IGZA 4M11A 2VVCK 3N8YB 5FF1A 2BO2A 2QPKA 4Y6DB 3HS6A 3F1SB 2VWMK 3KQEL 1P0SL 4OEKA 4X8SL 2P3UA 1WHEA 1ATDA 4Z0LA 2ADXA 2Y5FL 2FLRL 4RRYA 1IQIL 1CCFA 3QMOA 3GCJA 4LORA 4KVLA 3ZYIB 3ERHA 3EGFA 3U73A 1CEJA 1MQ6L 2XBYL 4HHSA 2BOHA 5JB8E 3ASIA 1V3XB 2EI6B 2J94B 4XBMA 5JB9E 3N8XA 1MHLC 1G2LB 4MMYB 2WPIE 2P26A 3FBYA 4D90A 3GC1A 1IGXA 1LMJA 1F0SB 3N8YA 5HPWA 4JZDL 2WZPP 4BTIA 1LK9A 2WPHE 2Y81B 4NA9L 1DQBA 1O5DL 1TPGA 3KL6B 1DVAL 4Y7BB 4ISHL 3QF1A 2P28B 3F6UL 3KCGL 3KQCL 3TK6B 3N8WB 2IPSA 2FD6A 1IQKL 4D0EA 5COXA 3LN0A 2I9BA 5JBBE 3R5QA 2OYUP 2RA0L 2BOXA 3FFGL 2Q1JB 3RR3A 2Y5GL 3LC3B 4X8TL 3N8VA 3OLUA 4DL1C 1EZQB 1MQ5L 1DNUC 4QJQA 1XDTR 1APQA 1GK5A 2TGFA 1KLJL 1V1HA 2BOUA 2WFTA 2XBWL 3LC5B 4QYQA 4LJJA 2RHPA 4IG5A 2W26B 1IQHL 3R05A 2P95L 4MMXB 4NG9L 3NT1A 3NYHA 1U8CB 3HS7A 5JVYA 3LAQA 4ISIL 5K0HB 4NJBA 2HOXA 3CS7L 2VWNL 1YUGA 2W2PE 1NZIA 2W3KB 2K2SB 2DDUA 2WG3C 1EGFA 4BXSA 3Q3KB 4Z6AL 4X8VL 5KN5C 1CCVA 1J9CL 2EFBA 3GISX 4A94C 3K9XA 4RRZA 5L30L 1EBVA 1FE2A 3ZYGA 1G1SA 2H9EL 3F9PC 5L2YL 1MOXC 4ZXXL 3TGFA 4ZH8B 3U7UG 3RKEA 1TLEA 3P5BL 3HO4A 4MSFA 1JL9A 3QL6A 2PT3A 1CX2A 1C5MF 1FJSL 1CVUA 1I0UA 4YT6L 1IQJL 2P93L 2VVVL 1F7MA 3TK5B 2W2ME 3NAKA 4D0FA 1P9JA 4JYUL 3PY4A 4TGFA 2W2QE 3KK6A 1UZQA
chains in the Genus database with same CATH topology
1U67A 1CVWL 3SXVA 4HHRA 2K2TA 4RRWA 1D7WC 3SOVA 1IJQA 1EMNA 4ZAEB 1FFMA 1AUTL 2EI8B 1NFUB 1EQGA 1L5GB 1Z6EL 1UZKA 4X8UL 3ZS1C 1B9WA 2WPLE 3LTGD 2YGPA 2WYJB 1KLOA 5E8DA 1IQFL 3N8WA 2VH0B 3V65B 4AQTA 1L3YA 3MDLA 2F9BL 3R4XA 4Y79B 1XKAL 2M74A 2EHAA 4C16A 4OTJA 2P16L 2GJMA 5GLSA 1W7XL 4ZXYL 5CKMA 4Y71B 4BDWA 1ADXA 1HCGB 2MGRA 2G00L 2PHBB 6COXA 2D1JB 4Y55A 1IQLL 3HO3A 4BXWA 4GN6A 3GCWE 1YUFA 5L2ZL 3OLTA 1XKBA 3HPTA 2OJVA 1DDXA 3LN1A 1IVOC 3BT2A 1G1QA 4MMZB 1F0RB 2XC5L 1SZBA 2XBVL 2J34B 3KRKA 2PUMA 3V6QA 4XL1A 4NGAL 3BT1A 3HS5A 2PR3B 3QH0A 4ZHAB 1FAXL 3NIUA 1HREA 3KQDL 2BQ7A 1EPJA 2VJ3A 3BPSE 2W2OE 1PXXA 2Z5ZA 2UWLB 5B72A 5JBAE 2J38B 4PNXA 4KSZA 2PUQL 5CISA 3QCWA 3UBAA 3ERIA 3C9AC 1CXPC 4KVKA 2FLGA 4BTTA 1UZPA 1HAEA 1LPKA 2Y7ZB 4JYVL 5JVZA 2BZ6L 3ELAL 1WHFA 2CJIB 1YGCL 1PTHA 3GCLA 3Q7DA 2J2UB 4CUEA 1IOXA 1DX5I 3TZIA 5GH0A 3S4FA 2RNLA 2KV4A 1LPZA 5I46L 4RRXA 3DEMA 4CUDA 5CKNA 3HO5A 2Y38A 1KLIL 4JZFL 5JW1A 3IITB 1M1XB 3CA7A 2XC4L 2VWOL 1HRFA 3OGWA 1N7DA 1W8BL 2WYGB 4O1ZA 3S6XA 2BMGA 1X7AL 2Y5HL 3R5OA 2BOKL 5F1AA 5IKRA 2B7DL 1EQHA 2Y7XB 4M10A 1NFYB 4GM7A 2J4IB 5FDQA 5FIWC 5CKQA 1IQNL 3NTBA 2YGOA 4BDXA 4KVJA 3Q9KA 1KSNB 2EI7B 1G2MB 1NT0A 3IJEB 3KRQA 3ENSA 2VWLL 3PGHA 3TH3L 2UWPB 1D5LC 3MQEA 4CUFA 2MGPA 3TGYA 5KIRA 2WPME 4Z0KB 2W3IB 1PRHA 1URKA 2VH6B 4Y76B 2XBXL 4A7IA 2NQXA 1N1IA 2XC0L 1ATBA 3M36L 2KL7A 2H9EC 1LMMA 4O02B 2BQWA 1HAFA 3FNLA 2QRBA 1JBUL 1NPEB 5EGMB 1CQEA 4BTUA 4XLWA 2JKHL 3N8ZA 5F19A 1ZAQA 1FSBA 3V64C 4COXA 4N7AA 2VVUL 1NFWB 1UZJA 3GCKA 4NT3A 3LTFB 2FZZL 3NTGA 2Y80B 1G1RA 2R5LA 4JZEL 2GD4A 1BF9A 1Z6CA 3I6NA 5IKVA 3FCSB 3KQBL 1G1TA 1IQEL 1F7EA 2W2NE 1PGEA 1APOA 2BQ6A 1IQGL 4E1GA 1EPIA 2YGQA 4LMFA 2Y82B 1NQLB 3SOBB 2KNIA 1HZ8A 1DIYA 3GCXE 5JBCE 3TBDA 4C1MC 1QFKL 2WFXB 1WU1B 4G1MB 3NJPC 1LQDA 2UWOB 2KB9A 3BXIA 2WPKE 1EPHA 1HX2A 5IKQA 1ATAA 2I9AA 4YZUB 1IOEL 2NPRA 2MHPA 4YT7L 3N8FA 2P3FN 3SW2A 1MYPC 3ZS0C 1DNWC 1K37A 1K36A 1A3PA 5IKTA 3SOQA 1RFNB 1OB1C 4PH9A 1IP0A 1TOZA 1D2VC 3H5CB 4FM5A 2QQTA 2J95B 1YUKB 3M37L 4CSYA 1HT5A 2OYEP 1Q4GA 2P94L 1ATEA 2O86A 1JV2B 1FF7A 1HT8A 2P3FL 3CENL 1PFXL 3POYA 4RUTA 1FAKL 1HJ7A 2P3TA 1IQML 1EPGA 4Y7AB 3R55A 1COUA 1NFXB 3CFWA 2WG4B 3ZYJB 4RS0A 2AYLA 1XFEA 3LIWB 3FAQA 1KIGL 2FLBL 1YO8A 2WPJE 1LPGA 4OTYA 2IKCA 2E9EA 2W86A 1EAIC 1EMOA 1IGZA 4M11A 2VVCK 3N8YB 5FF1A 2BO2A 2QPKA 4Y6DB 3HS6A 3F1SB 2VWMK 3KQEL 1P0SL 4OEKA 4X8SL 2P3UA 1WHEA 1ATDA 4Z0LA 2ADXA 2Y5FL 2FLRL 4RRYA 1IQIL 1CCFA 3QMOA 3GCJA 4LORA 4KVLA 3ZYIB 3ERHA 3EGFA 3U73A 1CEJA 1MQ6L 2XBYL 4HHSA 2BOHA 5JB8E 3ASIA 1V3XB 2EI6B 2J94B 4XBMA 5JB9E 3N8XA 1MHLC 1G2LB 4MMYB 2WPIE 2P26A 3FBYA 4D90A 3GC1A 1IGXA 1LMJA 1F0SB 3N8YA 5HPWA 4JZDL 2WZPP 4BTIA 2WPHE 2Y81B 4NA9L 1DQBA 1O5DL 1TPGA 3KL6B 1DVAL 4Y7BB 4ISHL 3QF1A 2P28B 3F6UL 3KCGL 3KQCL 3TK6B 3N8WB 2IPSA 2FD6A 1IQKL 4D0EA 5COXA 3LN0A 2I9BA 5JBBE 3R5QA 2OYUP 2RA0L 2BOXA 3FFGL 2Q1JB 3RR3A 2Y5GL 3LC3B 4X8TL 3N8VA 3OLUA 4DL1C 1EZQB 1MQ5L 1DNUC 4QJQA 1XDTR 1APQA 1GK5A 2TGFA 1KLJL 2BOUA 2WFTA 2XBWL 3LC5B 4QYQA 4LJJA 2RHPA 4IG5A 2W26B 1IQHL 3R05A 2P95L 4MMXB 4NG9L 3NT1A 3NYHA 1U8CB 3HS7A 5JVYA 3LAQA 4ISIL 5K0HB 4NJBA 3CS7L 2VWNL 1YUGA 2W2PE 1NZIA 2W3KB 2K2SB 2DDUA 2WG3C 1EGFA 4BXSA 3Q3KB 4Z6AL 4X8VL 5KN5C 1CCVA 1J9CL 2EFBA 3GISX 4A94C 3K9XA 4RRZA 5L30L 1EBVA 1FE2A 3ZYGA 1G1SA 2H9EL 3F9PC 5L2YL 1MOXC 4ZXXL 3TGFA 4ZH8B 3U7UG 3RKEA 1TLEA 3P5BL 3HO4A 4MSFA 1JL9A 3QL6A 2PT3A 1CX2A 1C5MF 1FJSL 1CVUA 1I0UA 4YT6L 1IQJL 2P93L 2VVVL 1F7MA 3TK5B 2W2ME 3NAKA 4D0FA 1P9JA 4JYUL 3PY4A 4TGFA 2W2QE 3KK6A 1UZQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U67 A;  1CVW L;  3SXV A;  4HHR A;  2K2T A;  4RRW A;  1D7W C;  3SOV A;  1IJQ A;  1EMN A;  4ZAE B;  1FFM A;  1AUT L;  2EI8 B;  1NFU B;  1EQG A;  1L5G B;  1Z6E L;  1UZK A;  4X8U L;  3ZS1 C;  1B9W A;  2WPL E;  3LTG D;  2YGP A;  2WYJ B;  1KLO A;  5E8D A;  1IQF L;  3N8W A;  2VH0 B;  3V65 B;  4AQT A;  1L3Y A;  3MDL A;  2F9B L;  3R4X A;  4Y79 B;  1XKA L;  2M74 A;  2EHA A;  4C16 A;  4OTJ A;  2P16 L;  2GJM A;  5GLS A;  1W7X L;  4ZXY L;  5CKM A;  4Y71 B;  4BDW A;  1ADX A;  1HCG B;  2MGR A;  2G00 L;  2PHB B;  6COX A;  2D1J B;  4Y55 A;  1IQL L;  3HO3 A;  4BXW A;  4GN6 A;  3GCW E;  1YUF A;  5L2Z L;  3OLT A;  1XKB A;  3HPT A;  2OJV A;  1DDX A;  3LN1 A;  1IVO C;  3BT2 A;  1G1Q A;  4MMZ B;  1F0R B;  2XC5 L;  1SZB A;  2XBV L;  2J34 B;  3KRK A;  2PUM A;  3V6Q A;  4XL1 A;  4NGA L;  3BT1 A;  3HS5 A;  2PR3 B;  3QH0 A;  4ZHA B;  1FAX L;  3NIU A;  1HRE A;  3KQD L;  2BQ7 A;  1EPJ A;  2VJ3 A;  3BPS E;  2W2O E;  1PXX A;  2Z5Z A;  2UWL B;  5B72 A;  5JBA E;  2J38 B;  4PNX A;  4KSZ A;  2PUQ L;  5CIS A;  3QCW A;  3UBA A;  3ERI A;  3C9A C;  1CXP C;  4KVK A;  2FLG A;  4BTT A;  1UZP A;  1HAE A;  1LPK A;  2Y7Z B;  4JYV L;  5JVZ A;  2BZ6 L;  3ELA L;  1WHF A;  2CJI B;  1YGC L;  1PTH A;  3GCL A;  3Q7D A;  2J2U B;  4CUE A;  1IOX A;  1DX5 I;  3TZI A;  5GH0 A;  3S4F A;  2RNL A;  2KV4 A;  1LPZ A;  5I46 L;  4RRX A;  3DEM A;  4CUD A;  5CKN A;  3HO5 A;  2Y38 A;  1KLI L;  4JZF L;  5JW1 A;  3IIT B;  1M1X B;  3CA7 A;  2XC4 L;  2VWO L;  1HRF A;  3OGW A;  1N7D A;  1W8B L;  2WYG B;  4O1Z A;  2BMG A;  1X7A L;  2Y5H L;  3R5O A;  2BOK L;  5F1A A;  5IKR A;  2B7D L;  1EQH A;  2Y7X B;  4M10 A;  1NFY B;  4GM7 A;  2J4I B;  5FDQ A;  5FIW C;  5CKQ A;  1IQN L;  3NTB A;  2YGO A;  4BDX A;  4KVJ A;  3Q9K A;  1KSN B;  2EI7 B;  1G2M B;  1NT0 A;  3IJE B;  3KRQ A;  3ENS A;  2VWL L;  3PGH A;  3TH3 L;  2UWP B;  1D5L C;  3MQE A;  4CUF A;  2MGP A;  3TGY A;  5KIR A;  2WPM E;  4Z0K B;  2W3I B;  1PRH A;  1URK A;  2VH6 B;  4Y76 B;  2XBX L;  4A7I A;  2NQX A;  1N1I A;  2XC0 L;  1ATB A;  3M36 L;  2KL7 A;  4O02 B;  2BQW A;  1HAF A;  3FNL A;  2QRB A;  1JBU L;  1NPE B;  5EGM B;  1CQE A;  4BTU A;  4XLW A;  2JKH L;  3N8Z A;  5F19 A;  1ZAQ A;  1FSB A;  3V64 C;  4COX A;  4N7A A;  2VVU L;  1NFW B;  1UZJ A;  3GCK A;  4NT3 A;  3LTF B;  2FZZ L;  3NTG A;  2Y80 B;  1G1R A;  2R5L A;  4JZE L;  2GD4 A;  1BF9 A;  1Z6C A;  3I6N A;  5IKV A;  3FCS B;  3KQB L;  1G1T A;  1IQE L;  1F7E A;  2W2N E;  1PGE A;  1APO A;  2BQ6 A;  1IQG L;  4E1G A;  1EPI A;  4LMF A;  2Y82 B;  1NQL B;  3SOB B;  1HZ8 A;  1DIY A;  3GCX E;  5JBC E;  3TBD A;  4C1M C;  1QFK L;  2WFX B;  1WU1 B;  4G1M B;  3NJP C;  1LQD A;  2UWO B;  2KB9 A;  3BXI A;  2WPK E;  1EPH A;  1HX2 A;  5IKQ A;  1ATA A;  2I9A A;  4YZU B;  1IOE L;  2NPR A;  2MHP A;  4YT7 L;  3N8F A;  2P3F N;  3SW2 A;  1MYP C;  3ZS0 C;  1DNW C;  1K37 A;  1K36 A;  1A3P A;  5IKT A;  3SOQ A;  1RFN B;  1OB1 C;  4PH9 A;  1IP0 A;  1TOZ A;  1D2V C;  3H5C B;  4FM5 A;  2QQT A;  2J95 B;  1YUK B;  3M37 L;  4CSY A;  1HT5 A;  2OYE P;  1Q4G A;  2P94 L;  1ATE A;  2O86 A;  1JV2 B;  1FF7 A;  1HT8 A;  2P3F L;  3CEN L;  1PFX L;  3POY A;  4RUT A;  1FAK L;  1HJ7 A;  2P3T A;  1IQM L;  1EPG A;  4Y7A B;  3R55 A;  1COU A;  1NFX B;  3CFW A;  2WG4 B;  3ZYJ B;  4RS0 A;  2AYL A;  1XFE A;  3LIW B;  3FAQ A;  1KIG L;  2FLB L;  1YO8 A;  2WPJ E;  1LPG A;  4OTY A;  2IKC A;  2E9E A;  2W86 A;  1EAI C;  1EMO A;  1IGZ A;  4M11 A;  2VVC K;  3N8Y B;  5FF1 A;  2BO2 A;  2QPK A;  4Y6D B;  3HS6 A;  3F1S B;  2VWM K;  3KQE L;  1P0S L;  4OEK A;  4X8S L;  2P3U A;  1WHE A;  1ATD A;  4Z0L A;  2ADX A;  2Y5F L;  2FLR L;  4RRY A;  1IQI L;  1CCF A;  3QMO A;  3GCJ A;  4LOR A;  4KVL A;  3ZYI B;  3ERH A;  3EGF A;  3U73 A;  1CEJ A;  1MQ6 L;  2XBY L;  4HHS A;  2BOH A;  5JB8 E;  3ASI A;  1V3X B;  2EI6 B;  2J94 B;  4XBM A;  5JB9 E;  3N8X A;  1MHL C;  1G2L B;  4MMY B;  2WPI E;  2P26 A;  3FBY A;  4D90 A;  3GC1 A;  1IGX A;  1LMJ A;  1F0S B;  3N8Y A;  5HPW A;  4JZD L;  4BTI A;  2WPH E;  2Y81 B;  4NA9 L;  1DQB A;  1O5D L;  1TPG A;  3KL6 B;  1DVA L;  4Y7B B;  4ISH L;  3QF1 A;  2P28 B;  3F6U L;  3KCG L;  3KQC L;  3TK6 B;  3N8W B;  2IPS A;  2FD6 A;  1IQK L;  4D0E A;  5COX A;  3LN0 A;  2I9B A;  5JBB E;  3R5Q A;  2OYU P;  2RA0 L;  2BOX A;  3FFG L;  2Q1J B;  3RR3 A;  2Y5G L;  3LC3 B;  4X8T L;  3N8V A;  3OLU A;  4DL1 C;  1EZQ B;  1MQ5 L;  1DNU C;  4QJQ A;  1XDT R;  1APQ A;  1GK5 A;  2TGF A;  1KLJ L;  2BOU A;  2WFT A;  2XBW L;  3LC5 B;  4QYQ A;  4LJJ A;  2RHP A;  4IG5 A;  2W26 B;  1IQH L;  3R05 A;  2P95 L;  4MMX B;  4NG9 L;  3NT1 A;  3NYH A;  1U8C B;  3HS7 A;  5JVY A;  3LAQ A;  4ISI L;  5K0H B;  4NJB A;  3CS7 L;  2VWN L;  1YUG A;  2W2P E;  1NZI A;  2W3K B;  2K2S B;  2DDU A;  2WG3 C;  1EGF A;  4BXS A;  3Q3K B;  4Z6A L;  4X8V L;  5KN5 C;  1CCV A;  1J9C L;  2EFB A;  3GIS X;  3K9X A;  4RRZ A;  5L30 L;  1EBV A;  1FE2 A;  3ZYG A;  1G1S A;  2H9E L;  3F9P C;  5L2Y L;  1MOX C;  4ZXX L;  3TGF A;  4ZH8 B;  3U7U G;  3RKE A;  1TLE A;  3P5B L;  3HO4 A;  4MSF A;  1JL9 A;  3QL6 A;  2PT3 A;  1CX2 A;  1C5M F;  1FJS L;  1CVU A;  1I0U A;  4YT6 L;  1IQJ L;  2P93 L;  2VVV L;  1F7M A;  3TK5 B;  2W2M E;  3NAK A;  4D0F A;  1P9J A;  4JYU L;  3PY4 A;  4TGF A;  2W2Q E;  3KK6 A;  1UZQ A; 
#chains in the Genus database with same CATH topology
 1U67 A;  1CVW L;  3SXV A;  4HHR A;  2K2T A;  4RRW A;  1D7W C;  3SOV A;  1IJQ A;  1EMN A;  4ZAE B;  1FFM A;  1KKE A;  1AUT L;  2EI8 B;  1NFU B;  1EQG A;  1L5G B;  1Z6E L;  1UZK A;  4X8U L;  3ZS1 C;  1B9W A;  2WPL E;  3LTG D;  2YGP A;  2WYJ B;  1KLO A;  5E8D A;  1IQF L;  3N8W A;  2VH0 B;  3V65 B;  4AQT A;  1L3Y A;  3MDL A;  2F9B L;  3R4X A;  4Y79 B;  1XKA L;  2M74 A;  2EHA A;  4C16 A;  4OTJ A;  2P16 L;  2GJM A;  5GLS A;  1W7X L;  2BSF A;  4ZXY L;  5CKM A;  4Y71 B;  4BDW A;  1ADX A;  1HCG B;  2MGR A;  2G00 L;  2PHB B;  6COX A;  2D1J B;  4Y55 A;  1IQL L;  3HO3 A;  2BT7 A;  4BXW A;  4GN6 A;  3GCW E;  1YUF A;  5L2Z L;  3OLT A;  1XKB A;  3HPT A;  2OJV A;  1DDX A;  3LN1 A;  1IVO C;  3BT2 A;  1G1Q A;  4MMZ B;  1F0R B;  2XC5 L;  1SZB A;  2XBV L;  2J34 B;  3KRK A;  2PUM A;  3V6Q A;  4XL1 A;  4NGA L;  3BT1 A;  3HS5 A;  2PR3 B;  3QH0 A;  4ZHA B;  1FAX L;  3NIU A;  1HRE A;  3KQD L;  2BQ7 A;  1EPJ A;  2VJ3 A;  3BPS E;  2W2O E;  1PXX A;  2Z5Z A;  2UWL B;  5B72 A;  5JBA E;  2J38 B;  4PNX A;  4KSZ A;  2PUQ L;  5CIS A;  3QCW A;  4GU3 A;  3UBA A;  3ERI A;  3C9A C;  1CXP C;  4KVK A;  2FLG A;  4BTT A;  1UZP A;  1HAE A;  1LPK A;  2Y7Z B;  4JYV L;  5JVZ A;  2BZ6 L;  3ELA L;  1WHF A;  2CJI B;  1YGC L;  1V1I A;  1PTH A;  3GCL A;  3Q7D A;  2J2U B;  4CUE A;  1IOX A;  1DX5 I;  3TZI A;  5GH0 A;  3S4F A;  2RNL A;  1QIU A;  2KV4 A;  1LPZ A;  5I46 L;  4RRX A;  3DEM A;  4CUD A;  5CKN A;  3HO5 A;  2Y38 A;  1KLI L;  4JZF L;  5JW1 A;  3IIT B;  1M1X B;  2VRS A;  3CA7 A;  2XC4 L;  2VWO L;  1HRF A;  3OGW A;  1N7D A;  1W8B L;  2WYG B;  4O1Z A;  3S6X A;  2JJL A;  2BMG A;  1X7A L;  2Y5H L;  3R5O A;  2BOK L;  5F1A A;  5IKR A;  2B7D L;  1EQH A;  2Y7X B;  4M10 A;  1NFY B;  4GM7 A;  2J4I B;  5FDQ A;  5FIW C;  5CKQ A;  1IQN L;  3NTB A;  2YGO A;  4BDX A;  4KVJ A;  2EI7 B;  3Q9K A;  1KSN B;  2BT8 A;  1G2M B;  1NT0 A;  3IJE B;  3KRQ A;  3ENS A;  2VWL L;  3PGH A;  3TH3 L;  2UWP B;  1D5L C;  3MQE A;  4CUF A;  2MGP A;  3TGY A;  5KIR A;  2WPM E;  4Z0K B;  2W3I B;  1PRH A;  1URK A;  2VH6 B;  4Y76 B;  2XBX L;  4A7I A;  2NQX A;  2HOR A;  1N1I A;  2XC0 L;  1ATB A;  3M36 L;  2KL7 A;  2H9E C;  1LMM A;  4O02 B;  2BQW A;  1HAF A;  3FNL A;  2QRB A;  1JBU L;  1NPE B;  5EGM B;  1CQE A;  4BTU A;  4XLW A;  2JKH L;  3N8Z A;  5F19 A;  1ZAQ A;  1FSB A;  3V64 C;  4COX A;  4N7A A;  2VVU L;  1NFW B;  1UZJ A;  3GCK A;  4NT3 A;  3LTF B;  2FZZ L;  3NTG A;  2Y80 B;  1G1R A;  2R5L A;  4JZE L;  2GD4 A;  1BF9 A;  1Z6C A;  3I6N A;  5IKV A;  3FCS B;  3KQB L;  1G1T A;  1IQE L;  1F7E A;  2W2N E;  1PGE A;  1APO A;  2BQ6 A;  1IQG L;  4E1G A;  1EPI A;  2YGQ A;  4LMF A;  2Y82 B;  1NQL B;  3SOB B;  2KNI A;  1HZ8 A;  1DIY A;  3GCX E;  5JBC E;  3TBD A;  4C1M C;  1QFK L;  2WFX B;  1WU1 B;  4G1M B;  3NJP C;  1LQD A;  2UWO B;  2KB9 A;  3BXI A;  2WPK E;  1EPH A;  1HX2 A;  5IKQ A;  1ATA A;  2I9A A;  4YZU B;  1IOE L;  2NPR A;  2MHP A;  4YT7 L;  3N8F A;  2P3F N;  3SW2 A;  1MYP C;  3ZS0 C;  1DNW C;  1K37 A;  1K36 A;  1A3P A;  5IKT A;  3SOQ A;  1RFN B;  1OB1 C;  4PH9 A;  1IP0 A;  1TOZ A;  1D2V C;  3H5C B;  4FM5 A;  2QQT A;  2J95 B;  1YUK B;  3M37 L;  4CSY A;  1HT5 A;  2OYE P;  1Q4G A;  2P94 L;  1ATE A;  2O86 A;  1JV2 B;  1FF7 A;  1HT8 A;  2P3F L;  3CEN L;  1PFX L;  3POY A;  4RUT A;  1FAK L;  1HJ7 A;  2P3T A;  1IQM L;  1EPG A;  4Y7A B;  3R55 A;  1COU A;  1NFX B;  3CFW A;  2WG4 B;  4GU4 A;  3ZYJ B;  4RS0 A;  2AYL A;  1XFE A;  3LIW B;  3FAQ A;  1KIG L;  2FLB L;  1YO8 A;  2WPJ E;  1LPG A;  4OTY A;  2IKC A;  2E9E A;  2W86 A;  1EAI C;  1EMO A;  1IGZ A;  4M11 A;  2VVC K;  3N8Y B;  5FF1 A;  2BO2 A;  2QPK A;  4Y6D B;  3HS6 A;  3F1S B;  2VWM K;  3KQE L;  1P0S L;  4OEK A;  4X8S L;  2P3U A;  1WHE A;  1ATD A;  4Z0L A;  2ADX A;  2Y5F L;  2FLR L;  4RRY A;  1IQI L;  1CCF A;  3QMO A;  3GCJ A;  4LOR A;  4KVL A;  3ZYI B;  3ERH A;  3EGF A;  3U73 A;  1CEJ A;  1MQ6 L;  2XBY L;  4HHS A;  2BOH A;  5JB8 E;  3ASI A;  1V3X B;  2EI6 B;  2J94 B;  4XBM A;  5JB9 E;  3N8X A;  1MHL C;  1G2L B;  4MMY B;  2WPI E;  2P26 A;  3FBY A;  4D90 A;  3GC1 A;  1IGX A;  1LMJ A;  1F0S B;  3N8Y A;  5HPW A;  4JZD L;  2WZP P;  4BTI A;  1LK9 A;  2WPH E;  2Y81 B;  4NA9 L;  1DQB A;  1O5D L;  1TPG A;  3KL6 B;  1DVA L;  4Y7B B;  4ISH L;  3QF1 A;  2P28 B;  3F6U L;  3KCG L;  3KQC L;  3TK6 B;  3N8W B;  2IPS A;  2FD6 A;  1IQK L;  4D0E A;  5COX A;  3LN0 A;  2I9B A;  5JBB E;  3R5Q A;  2OYU P;  2RA0 L;  2BOX A;  3FFG L;  2Q1J B;  3RR3 A;  2Y5G L;  3LC3 B;  4X8T L;  3N8V A;  3OLU A;  4DL1 C;  1EZQ B;  1MQ5 L;  1DNU C;  4QJQ A;  1XDT R;  1APQ A;  1GK5 A;  2TGF A;  1KLJ L;  1V1H A;  2BOU A;  2WFT A;  2XBW L;  3LC5 B;  4QYQ A;  4LJJ A;  2RHP A;  4IG5 A;  2W26 B;  1IQH L;  3R05 A;  2P95 L;  4MMX B;  4NG9 L;  3NT1 A;  3NYH A;  1U8C B;  3HS7 A;  5JVY A;  3LAQ A;  4ISI L;  5K0H B;  4NJB A;  2HOX A;  3CS7 L;  2VWN L;  1YUG A;  2W2P E;  1NZI A;  2W3K B;  2K2S B;  2DDU A;  2WG3 C;  1EGF A;  4BXS A;  3Q3K B;  4Z6A L;  4X8V L;  5KN5 C;  1CCV A;  1J9C L;  2EFB A;  3GIS X;  4A94 C;  3K9X A;  4RRZ A;  5L30 L;  1EBV A;  1FE2 A;  3ZYG A;  1G1S A;  2H9E L;  3F9P C;  5L2Y L;  1MOX C;  4ZXX L;  3TGF A;  4ZH8 B;  3U7U G;  3RKE A;  1TLE A;  3P5B L;  3HO4 A;  4MSF A;  1JL9 A;  3QL6 A;  2PT3 A;  1CX2 A;  1C5M F;  1FJS L;  1CVU A;  1I0U A;  4YT6 L;  1IQJ L;  2P93 L;  2VVV L;  1F7M A;  3TK5 B;  2W2M E;  3NAK A;  4D0F A;  1P9J A;  4JYU L;  3PY4 A;  4TGF A;  2W2Q E;  3KK6 A;  1UZQ A; 
#chains in the Genus database with same CATH homology
 1U67 A;  1CVW L;  3SXV A;  4HHR A;  2K2T A;  4RRW A;  1D7W C;  3SOV A;  1IJQ A;  1EMN A;  4ZAE B;  1FFM A;  1AUT L;  2EI8 B;  1NFU B;  1EQG A;  1L5G B;  1Z6E L;  1UZK A;  4X8U L;  3ZS1 C;  1B9W A;  2WPL E;  3LTG D;  2YGP A;  2WYJ B;  1KLO A;  5E8D A;  1IQF L;  3N8W A;  2VH0 B;  3V65 B;  4AQT A;  1L3Y A;  3MDL A;  2F9B L;  3R4X A;  4Y79 B;  1XKA L;  2M74 A;  2EHA A;  4C16 A;  4OTJ A;  2P16 L;  2GJM A;  5GLS A;  1W7X L;  4ZXY L;  5CKM A;  4Y71 B;  4BDW A;  1ADX A;  1HCG B;  2MGR A;  2G00 L;  2PHB B;  6COX A;  2D1J B;  4Y55 A;  1IQL L;  3HO3 A;  4BXW A;  4GN6 A;  3GCW E;  1YUF A;  5L2Z L;  3OLT A;  1XKB A;  3HPT A;  2OJV A;  1DDX A;  3LN1 A;  1IVO C;  3BT2 A;  1G1Q A;  4MMZ B;  1F0R B;  2XC5 L;  1SZB A;  2XBV L;  2J34 B;  3KRK A;  2PUM A;  3V6Q A;  4XL1 A;  4NGA L;  3BT1 A;  3HS5 A;  2PR3 B;  3QH0 A;  4ZHA B;  1FAX L;  3NIU A;  1HRE A;  3KQD L;  2BQ7 A;  1EPJ A;  2VJ3 A;  3BPS E;  2W2O E;  1PXX A;  2Z5Z A;  2UWL B;  5B72 A;  5JBA E;  2J38 B;  4PNX A;  4KSZ A;  2PUQ L;  5CIS A;  3QCW A;  3UBA A;  3ERI A;  3C9A C;  1CXP C;  4KVK A;  2FLG A;  4BTT A;  1UZP A;  1HAE A;  1LPK A;  2Y7Z B;  4JYV L;  5JVZ A;  2BZ6 L;  3ELA L;  1WHF A;  2CJI B;  1YGC L;  1PTH A;  3GCL A;  3Q7D A;  2J2U B;  4CUE A;  1IOX A;  1DX5 I;  3TZI A;  5GH0 A;  3S4F A;  2RNL A;  2KV4 A;  1LPZ A;  5I46 L;  4RRX A;  3DEM A;  4CUD A;  5CKN A;  3HO5 A;  2Y38 A;  1KLI L;  4JZF L;  5JW1 A;  3IIT B;  1M1X B;  3CA7 A;  2XC4 L;  2VWO L;  1HRF A;  3OGW A;  1N7D A;  1W8B L;  2WYG B;  4O1Z A;  3S6X A;  2BMG A;  1X7A L;  2Y5H L;  3R5O A;  2BOK L;  5F1A A;  5IKR A;  2B7D L;  1EQH A;  2Y7X B;  4M10 A;  1NFY B;  4GM7 A;  2J4I B;  5FDQ A;  5FIW C;  5CKQ A;  1IQN L;  3NTB A;  2YGO A;  4BDX A;  4KVJ A;  3Q9K A;  1KSN B;  2EI7 B;  1G2M B;  1NT0 A;  3IJE B;  3KRQ A;  3ENS A;  2VWL L;  3PGH A;  3TH3 L;  2UWP B;  1D5L C;  3MQE A;  4CUF A;  2MGP A;  3TGY A;  5KIR A;  2WPM E;  4Z0K B;  2W3I B;  1PRH A;  1URK A;  2VH6 B;  4Y76 B;  2XBX L;  4A7I A;  2NQX A;  1N1I A;  2XC0 L;  1ATB A;  3M36 L;  2KL7 A;  2H9E C;  1LMM A;  4O02 B;  2BQW A;  1HAF A;  3FNL A;  2QRB A;  1JBU L;  1NPE B;  5EGM B;  1CQE A;  4BTU A;  4XLW A;  2JKH L;  3N8Z A;  5F19 A;  1ZAQ A;  1FSB A;  3V64 C;  4COX A;  4N7A A;  2VVU L;  1NFW B;  1UZJ A;  3GCK A;  4NT3 A;  3LTF B;  2FZZ L;  3NTG A;  2Y80 B;  1G1R A;  2R5L A;  4JZE L;  2GD4 A;  1BF9 A;  1Z6C A;  3I6N A;  5IKV A;  3FCS B;  3KQB L;  1G1T A;  1IQE L;  1F7E A;  2W2N E;  1PGE A;  1APO A;  2BQ6 A;  1IQG L;  4E1G A;  1EPI A;  2YGQ A;  4LMF A;  2Y82 B;  1NQL B;  3SOB B;  2KNI A;  1HZ8 A;  1DIY A;  3GCX E;  5JBC E;  3TBD A;  4C1M C;  1QFK L;  2WFX B;  1WU1 B;  4G1M B;  3NJP C;  1LQD A;  2UWO B;  2KB9 A;  3BXI A;  2WPK E;  1EPH A;  1HX2 A;  5IKQ A;  1ATA A;  2I9A A;  4YZU B;  1IOE L;  2NPR A;  2MHP A;  4YT7 L;  3N8F A;  2P3F N;  3SW2 A;  1MYP C;  3ZS0 C;  1DNW C;  1K37 A;  1K36 A;  1A3P A;  5IKT A;  3SOQ A;  1RFN B;  1OB1 C;  4PH9 A;  1IP0 A;  1TOZ A;  1D2V C;  3H5C B;  4FM5 A;  2QQT A;  2J95 B;  1YUK B;  3M37 L;  4CSY A;  1HT5 A;  2OYE P;  1Q4G A;  2P94 L;  1ATE A;  2O86 A;  1JV2 B;  1FF7 A;  1HT8 A;  2P3F L;  3CEN L;  1PFX L;  3POY A;  4RUT A;  1FAK L;  1HJ7 A;  2P3T A;  1IQM L;  1EPG A;  4Y7A B;  3R55 A;  1COU A;  1NFX B;  3CFW A;  2WG4 B;  3ZYJ B;  4RS0 A;  2AYL A;  1XFE A;  3LIW B;  3FAQ A;  1KIG L;  2FLB L;  1YO8 A;  2WPJ E;  1LPG A;  4OTY A;  2IKC A;  2E9E A;  2W86 A;  1EAI C;  1EMO A;  1IGZ A;  4M11 A;  2VVC K;  3N8Y B;  5FF1 A;  2BO2 A;  2QPK A;  4Y6D B;  3HS6 A;  3F1S B;  2VWM K;  3KQE L;  1P0S L;  4OEK A;  4X8S L;  2P3U A;  1WHE A;  1ATD A;  4Z0L A;  2ADX A;  2Y5F L;  2FLR L;  4RRY A;  1IQI L;  1CCF A;  3QMO A;  3GCJ A;  4LOR A;  4KVL A;  3ZYI B;  3ERH A;  3EGF A;  3U73 A;  1CEJ A;  1MQ6 L;  2XBY L;  4HHS A;  2BOH A;  5JB8 E;  3ASI A;  1V3X B;  2EI6 B;  2J94 B;  4XBM A;  5JB9 E;  3N8X A;  1MHL C;  1G2L B;  4MMY B;  2WPI E;  2P26 A;  3FBY A;  4D90 A;  3GC1 A;  1IGX A;  1LMJ A;  1F0S B;  3N8Y A;  5HPW A;  4JZD L;  2WZP P;  4BTI A;  2WPH E;  2Y81 B;  4NA9 L;  1DQB A;  1O5D L;  1TPG A;  3KL6 B;  1DVA L;  4Y7B B;  4ISH L;  3QF1 A;  2P28 B;  3F6U L;  3KCG L;  3KQC L;  3TK6 B;  3N8W B;  2IPS A;  2FD6 A;  1IQK L;  4D0E A;  5COX A;  3LN0 A;  2I9B A;  5JBB E;  3R5Q A;  2OYU P;  2RA0 L;  2BOX A;  3FFG L;  2Q1J B;  3RR3 A;  2Y5G L;  3LC3 B;  4X8T L;  3N8V A;  3OLU A;  4DL1 C;  1EZQ B;  1MQ5 L;  1DNU C;  4QJQ A;  1XDT R;  1APQ A;  1GK5 A;  2TGF A;  1KLJ L;  2BOU A;  2WFT A;  2XBW L;  3LC5 B;  4QYQ A;  4LJJ A;  2RHP A;  4IG5 A;  2W26 B;  1IQH L;  3R05 A;  2P95 L;  4MMX B;  4NG9 L;  3NT1 A;  3NYH A;  1U8C B;  3HS7 A;  5JVY A;  3LAQ A;  4ISI L;  5K0H B;  4NJB A;  3CS7 L;  2VWN L;  1YUG A;  2W2P E;  1NZI A;  2W3K B;  2K2S B;  2DDU A;  2WG3 C;  1EGF A;  4BXS A;  3Q3K B;  4Z6A L;  4X8V L;  5KN5 C;  1CCV A;  1J9C L;  2EFB A;  3GIS X;  4A94 C;  3K9X A;  4RRZ A;  5L30 L;  1EBV A;  1FE2 A;  3ZYG A;  1G1S A;  2H9E L;  3F9P C;  5L2Y L;  1MOX C;  4ZXX L;  3TGF A;  4ZH8 B;  3U7U G;  3RKE A;  1TLE A;  3P5B L;  3HO4 A;  4MSF A;  1JL9 A;  3QL6 A;  2PT3 A;  1CX2 A;  1C5M F;  1FJS L;  1CVU A;  1I0U A;  4YT6 L;  1IQJ L;  2P93 L;  2VVV L;  1F7M A;  3TK5 B;  2W2M E;  3NAK A;  4D0F A;  1P9J A;  4JYU L;  3PY4 A;  4TGF A;  2W2Q E;  3KK6 A;  1UZQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...