1U6AH

Crystal structure of the broadly neutralizing anti-hiv fab f105
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
222
structure length
222
Chain Sequence
VQLQESGPGLVKPSETLSLTCTVSGGSISSHYWSWIRQSPGKGLQWIGYIYYSGSTNYSPSLKSRVTISVETAKNQFSLKLTSMTAADTAVYYCARGPVPAVFYGDYRLDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Fab fragment of F105, a broadly reactive anti-human immunodeficiency virus (HIV) antibody that recognizes the CD4 binding site of HIV type 1 gp120.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords F105 LIGHT CHAIN
total genus 39
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2004-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u6aH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u6aH01
4UAOB 2MOVA 2PTTB 3CDGA 1T21A 5MENA 3VMNA 3HB3D 3RTQD 3QBTB 1F6AA 2QLVB 4M03A 4L4TA 3C60C 3RHWF 2HN7A 5T5NG 2BRRL 4WUUD 3BGFB 5D1XB 2P8LB 2WK2A 2H3NA 3RBSA 4HDIA 5ALCH 3Q5TA 4DK3A 2GY7B 3KPRE 2Q7NA 4XGZB 1MCEA 4ZUSB 1Q9WB 5CEXB 4OGXL 4U7SA 1QVOA 4WW1B 3K8KA 1V7NL 3HPLA 1K2DA 1ZLVH 2YMXH 4DW2H 1WFTA 4UBDD 1JK8A 1U95B 4HGMA 1Q94A 2MKLC 4IS6A 3LS4L 4ZO7A 5HGBB 4KKAC 5DEFB 3QJHA 4PJ5E 2P4AB 4KK9C 1T6WA 5I1LB 4P5KB 1I8IB 3TO4B 4ISVA 1KPVB 2DF3A 2DQIL 3KLAA 4E41E 1BFOB 4DZBA 2CK2A 3VFNA 3VXNB 2JJWA 5HGAB 4Q74A 1J1PL 4YHKH 2V2XA 2P5WE 4QXGL 2HKHH 3KPOA 1D5MA 1I1AD 3JUYA 2WBJD 2OQJA 1JPFA 4MA3B 4D0CB 2C3XA 3AS1A 3B3IB 4QHLB 1T21B 1NGXA 2BFVH 3LVEA 4PREB 2YD3A 3RUGB 4RZCA 4EDWH 3HR6A 1B90A 2E8YA 5L2KE 3NCJL 1H8NA 4AEIL 1A6ZB 3HI6L 5H8DA 1RK0B 3BD5A 1BHGA 3AAZB 4MD4B 2V2XB 2LAGB 3FCTA 4P57B 2XI9A 4X98A 5C70A 4MJ5A 3TBSA 5I30H 4XXCA 3P2TA 4UB0L 1RIVH 5A40E 5F7WC 1MCOL 3O3UN 3NABH 4WFHE 1IEBA 4WFHD 4JO3L 1CR9L 2XWTB 4L3EB 2C4XA 4P0DA 1WC7A 2N56A 5DHVB 5HI4D 2NZ9D 4JO1L 3QDMA 1OAZH 4TQEH 5DQ9A 1GGUA 3HAEG 3BZEA 3FQTA 5F89B 1KPUB 3QJHB 3GSNL 1CE1H 5DGRA 2X4QA 5F7KC 4CW1B 2H6PA 3CPLA 5HHQB 1FC1A 1T03H 5FECA 2J8UE 1O5DT 5C92A 3TJEH 4P5MA 4Y5XC 3N50A 3NZHH 5FFLA 1RAMA 2AEQL 3UCRA 3G5VB 1U8KB 1NCAL 1UC6A 3IKKA 4KK5C 4OCSL 1WFNA 2Q8BL 3QULB 2XG4A 4P2RB 5KG9B 1S7UA 3O6FA 4H25A 2BP3A 4MJIA 3G6DH 4DN4L 3KPRD 2PTTA 1S7TB 3QIWC 4XBGB 1CICB 2EDNA 3ARGC 1VB9A 1IL1B 2IFFH 1F90H 1QP1A 4CRPA 3OXRA 3ULVF 3ARDB 4LARL 2JB5H 4HCRL 1A3RL 1N8ZB 4NOFA 2VC2H 3C6LD 2XZQH 3WJJA 2GTWB 3MOAH 5INCA 3KPPB 5DT1L 4BZ2H 1FVEA 1CWVA 5CHNA 4GKSB 1PZ5A 4FOMA 1CLZH 2R2CA 4DGVH 4TULH 3ZHDA 3G08B 2CUMA 4PRHB 1N26A 3BXNA 4N0UA 4YGVB 4PRIE 2AJXH 3GJEA 1MCFA 2AK4D 3DVNB 4KFZC 4KV5F 1VESA 2BDNH 4XTRD 3MV01 5IWLC 1BOGA 4OM1H 3M45A 2YD9A 3NFSL 2LU3A 1JGUL 2DMKA 1NBVH 1LO3L 2HRPH 3SKOB 5LAXB 4GKOA 5TE7H 4X4YB 4OCYL 1HI6B 5FUCC 3GO1L 3FOLB 3VU2A 1A7PH 1UCBH 1HSBA 5BXFA 3V4VH 5KVGH 4H8WH 4ODWB 2DM3A 3VWKB 5I1AA 2YPVL 2PXYA 4UILH 3U1SL 5J3HC 3VFUA 4DKEH 2B8OT 3IDXH 4MXQC 2F54E 5BS0D 3HNTH 4WUUE 4JY4A 5CEZE 5KVFL 4PY8J 3D18B 5MEND 3L3IB 5DRNB 1LEIA 1NBVL 1KIPB 4C4KO 4I9WE 1TXKA 4KROB 3UTQB 4HIIA 3WE6A 4CJ0A 4NNPH 2H9GB 1MCDA 2O5ZH 1NSNL 3OR7A 3TZVD 3V5DB 5DJAB 3L95B 3TN0A 2EC8A 5CSBA 5B8CC 4X6EA 1FNHA 3IDXL 2EICA 4WFED 2VITB 5CGYC 3TBYB 5L9DH 3S34H 3WD5L 1JFQH 5I1JH 4PD4K 3PUCA 2B0SL 4QRRB 3TV3L 2VKXA 3MLVH 3O3DB 1IAIH 5E70A 5JDJA 3T65B 1NCUA 1Q38A 4NT6A 2I07B 1FZKB 4GBXC 3UP1A 1FNGB 1U8PB 4MGXA 1K8DA 2P24A 3Q6FA 2DB8A 4NO0B 4LNRA 1Y18A 1H3PH 1KLUB 3MLRH 1UKSA 3CMGA 1NMBL 3OKYA 2V5RA 1JFQL 1P2CA 5BOZG 3QG6B 4Z7VA 3C60D 1NGPH 4N0UE 3T65A 3QFJE 1DBKL 2G9HB 1PX4A 3MCLH 4IRSD 2Y5TB 5E4EB 4GS7B 1QLRA 3H0TB 4JLRA 5ISZE 3QZWB 3RY6C 4ZNCD 5J0BA 3F5WA 2C1PB 3S35X 3CH8A 2LTQB 1VADB 5AZ2H 2VC2L 3P4OA 2GFBA 1EJOL 1R3HB 1S8DB 3JTSB 2QTEA 3C08L 3B9VA 5KTEL 5IHZB 1TJIH 3LH2H 1EBAA 4Q6IC 2PETA 4PJAA 1F3RB 4LFHG 4JCLA 4KI5F 1RPQA 1UB6B 2DQUL 1FE8H 1KIQB 2DLHA 2IBZX 1LO2H 4JDVA 2UY6A 4XWGL 3VGAC 7CGTA 5JW4M 3QNYB 1TPXC 2KBGA 4ZDHA 1Q0YL 1S5HA 4NZUH 5GXBB 1XIWB 4NQSA 3SDDC 4HIJA 2YRZA 1RUPL 2WNGA 2FL5A 3NGBC 5EFIB 3QO0A 1UH2A 1A0QH 1EGJL 2PR4H 5CKGA 5C0IA 5IB2B 4NHUB 2HG5B 4I0PA 4KRNA 3H9SB 1S7SA 1AE6H 2QR0A 1H3VA 1OHQA 4L3EA 1MH5B 3HMWL 3CD4A 4IRSC 1R5IA 3VMOA 3QFJD 3GSOB 3K1DA 2R2BA 4PJIE 3TPUB 3RPIA 3QO0B 4HFUL 5GGTA 3WN5A 4FXGA 1HK6A 5HXMA 2IH3B 3MUGA 5ALCL 4CU6A 1X5HA 4HBQA 2MTPA 3UTQA 1AQDB 1G9NL 1N8ZA 4LLQB 1YJDC 5HYSB 4L3ED 4CU8A 1P5UA 2GTWA 3MJ7B 4OSUH 3OXRB 3KXFB 1MVFA 3O9WC 4NQCB 3QEUA 1AHWA 5CKAA 1SEQH 1TIUA 3ABZA 4QTHB 5F7MC 1F6LL 3LS4H 4OBSA 2C3VB 2AXGB 4I2XA 4W4OA 2IAMB 5I1CL 3V6ZA 2XQYK 2BZDA 1CQKA 4N0FB 2E9IA 2VH5H 4KMTL 5H2BA 3I6KB 4OCRH 5GRVK 1K5NA 1TQBB 4D9LL 1U6AL 2ERJB 1VADA 2BSSA 1T0NB 4F3FB 1VFUA 4L8BB 4UDUB 1J8HA 3Q48A 1S5IL 2HRLA 4IS6B 4R4BA 4HAFA 3OBAA 1MY7A 5IFJB 3O9WD 2JK5A 3U6RB 2DQJL 1FG2A 2DRUA 2FBJL 2V2WA 3FB7B 3IJHB 1YY8A 1BJ1H 2NXYB 3B83A 1P2CB 3VXSA 4JHZA 1RIUL 1UYWH 2GCYB 3EFDL 3QYCA 3BOVA 2GQHA 3PHQB 1T0PB 2DLTA 3UJJL 1M05A 2DYPD 4FS0A 1MFBH 3QUXB 4LOUD 3O2DA 3WIHA 4JFYB 4X0KB 4K9EC 4XT1C 3G6AB 1T5XB 4G9FD 4W6YB 4ZSOB 5KJRL 5FGSA 3BEWA 1ZMYA 1E0OB 3KR3L 4LCIH 4MAYA 2IANA 3L9RB 1JVKA 2ADFL 1QKZH 4WUUB 3PWPB 2AK1H 4LCWB 4PB0H 4AIXA 4O00A 5DEZA 4ONHA 3MRFA 1TTUA 2AEQH 3TN0D 1OARL 1HQ4A 4TN9A 2OM5A 3GIVB 3P9WB 4YAQA 1QQDA 5IWLA 4F7CB 1SY6A 4ODBD 3C5JB 1HDMB 3TEUA 5JDSA 5EIQA 4UV4H 3O0RH 4KTYA 5DK0B 2EKJA 1IGJA 5LJYH 3DVFA 4UT9H 4F7MB 4OGAC 4LSPH 4MMZC 5ELIA 3IT8D 4PTTA 3FT4A 3RU8L 1I8IA 5JOFB 4OI9A 1G9MC 5FECB 5BVJA 5MI0B 5D1XD 2CKBA 2XV6B 1CTNA 2A77L 3U36B 1FL6A 2VQUA 5IB1B 4G8GD 3CSBA 1T7ZA 3HRZA 1TZHB 3UJTL 4YPGA 4AIZA 3QPXL 4HEPG 3DLQR 4KKLD 3U4BL 3EHBD 3LPFA 1WZKA 4H88L 1U8IA 4OCMC 3QDJB 5CZKA 4ALAL 1DL7L 3D3VA 4CVWA 3MBEC 3WIHL 3FT2B 3BP4B 1P1ZA 1TVHB 5D1XA 2AVGA 1HHIA 2F74A 2QQLH 4L9LB 5E1HB 5C09B 4K23H 1YY9D 3SE9L 2CK0L 5DR5H 2WWMD 3RWJB 1BWWA 1EBPA 3LDBB 1S3KL 3KS0H 3B6SA 1HQ4B 4PJFF 2A83A 3MNVA 3D2UB 5TDNA 1YEJL 2B2XH 2FSEB 4Z7NF 4P4KA 3HN3A 4QRUA 3MJ9H 1J0YA 4YHMH 2RCSL 3WUZA 2NXZC 4U1HA 1ZWIB 1OAXH 5L6YH 1CFNB 3P0YL 4PJ8A 4J8RA 5IHUL 4WO4C 1KLGA 1LWRA 2A38A 4XMPH 3RGHA 5IB3A 1FFNA 3E6FB 4HKBA 2CLRA 5LWYH 4I4WB 1OTTD 5E1AB 3NPZB 1UACH 1A6TB 2FECI 4JPKL 4HJ0D 1R3LA 2GKIA 4LGPB 2ZG3A 3CXHJ 1TZGL 1BVLB 4OTXH 2OR9H 4Q58C 5J6GA 5HYJB 5EZOH 4H20L 4LPCA 1KLGB 2Y23A 1U8LA 4K94H 2JJTA 5T3XH 3RNQB 4RGNE 3MNWB 1Q72H 1F4XL 1NBYA 2F19L 4L4VB 4XNYH 2WQ8A 1N59B 1MJ7H 4UQ2A 5KOMC 5I73B 1HKFA 5C3TA 3HC3H 1TQCC 4RDQG 5EPMB 2HJLA 3QEQD 3UTSA 4D8PA 4PRAA 4TUOB 4KROD 1OB1A 1WWAX 1MCNA 4F7TA 5F8QC 4L3CA 4ONGH 2AV7A 1HNGA 12E8L 1YQVH 3TCLA 1YN6A 2LU4A 2NY6C 4OLUH 1OF2A 1HILB 3D0LA 3F7QA 1IGMH 4TPRL 3S96B 4NBZB 1MCQA 1AGEB 3PQYA 3O6LH 2X4PB 3WFZA 5JO5A 4QHKI 4B5EA 4X98B 2VDQL 3FFCB 4KJWC 4DCQB 3H7LA 5DJCA 4KGLA 3MO1B 2R1YA 5GS1C 3JSSA 4XMKH 2AV1B 1A4KA 2Y9RT 3OKEB 4KK8D 3CFKB 2HFGH 2JIXD 3BGMA 1F97A 1AGCB 3DUUA 4WHCA 3WO3B 2YC1B 1KTKE 3BT2H 5CWSA 3BRFA 2D03L 5ITFB 5F97E 1I7UB 3DGGB 4LCWE 4I77L 3WS6A 1B4JL 3GBNL 1S7SB 4Y2DB 4XNQB 2W65B 3KPSA 2JELH 1QSVA 3I75A 2YPLA 2J6EH 4HZLB 3CLFL 3N1QC 2AKRB 3W11D 4FQXA 2R4RL 2BMKB 4V1DA 4JR9H 3L3OB 1C12A 4YEFA 1E6JL 4QNPE 1T22B 2A6DA 4NCC2 5ENWA 1QA9A 4ZUSA 2R56H 4U1JB 3BEWB 3EYVA 4OM0L 1KOAA 2D7QA 2P1YA 3MODH 2XA8L 1YPZF 1FPTH 4C56D 3EYSH 2EE6A 4FABH 1DVFA 2R0LH 3U0PB 4B0MM 1IC7H 4ZNEE 1GZPB 1UM5H 2YUWA 3DVGB 4DFIA 5JQ6L 4H1LB 1XR8A 1D6EA 4J3XA 5HJ3B 4U6VL 1IGYB 2Q7YA 1M7IA 2DKUA 4C59B 3HMWH 5CJQL 1ZE3C 4PJ5B 4J3VA 3N85H 1NDMB 3DYOA 3ULSA 2VLMD 3DX7A 1X4ZA 4PJ7F 3H9ZA 4O4YH 3MRIA 4XVTH 4U4BA 4XVJH 3WNPA 4IM8A 4LQFL 1DUZB 2B4CC 1O7SA 2A9NH 4HUWA 3JV6B 4MJID 4IHOA 3QRGH 1MCJA 2NY5C 2AXFB 4PJGB 3QEGH 4Y4FB 3RFZC 5FUOH 3GMRA 5FO7B 3AUVA 1MWAB 4M48H 3IU3A 2HH0L 4XPTH 2ZPKH 1A6UH 1D7FA 1LDPH 3FONA 4Z7WF 2FECL 3UTSE 2QKIA 1YMMB 1I8MA 5TF0A 3LQZB 2BJML 2M1KA 3E2HC 1LK2B 3C6LA 2KKQA 1EJ6A 2V9TA 4QGTA 3QWOA 4WW2F 2QQNH 3B2UD 3T2PA 2WWKO 3MJ7A 3QDJE 3ARVA 4KWUA 3T4YA 2VR4A 2ZWLT 5HHPB 3TIEA 1NMCB 2I24N 4MS8C 1MAJA 1UH3A 4ZPVA 1OAUH 43C9A 2LABA 5JOPD 1H5BA 1CFTA 1M6OB 5CJXA 2VDRL 3KNBB 3A67L 3E6HA 4FQ1H 4F9LA 1HH9B 1UYWL 2HMID 1LO3H 2YWYA 4LSPL 5FOBB 4IRJA 3QXAA 2ILLA 4DVBA 5IBTH 3C9NB 4IOFC 4KRPC 1N7MH 4L8SC 1XGTA 4PJGE 2HT2C 4KXZH 4DTGH 1MRFH 5D70H 3WL9B 2C1OA 4UILL 1RUPH 1KJ3H 1II4E 3BRGC 3SY0B 2X4RA 2UZIL 4YDIL 4QHUA 5GSRB 4XVUC 1A6AA 4F7EB 2H8PB 1MVUB 1YEGL 1U93B 1KCLA 4ZAKC 4U3XA 1GRWA 4HUVB 4TSCL 3ZO0A 4EI5A 3GI9H 1XGTB 1A14H 5FB8A 1DANT 3ARED 1CFTB 1M6OA 2VRAA 3TC9A 2JB6A 2HTKC 3KNBA 1D6VL 3FCTB 4NM4H 1CG9A 4YHIA 1ED3A 5FUZL 3MLSH 1UA6H 1GZPA 5FO9B 3BN9C 2EE3A 5ITBL 3MJ9L 2FJHB 4EI5D 3O6KL 1KBGL 1GC1L 1QTYT 4L1DA 4YHKL 1QBBA 1O0VA 2E9JA 1CLOL 2F5BH 3B3IA 3C60B 4NQDB 2HKFH 5DD3H 2G5BB 1DEDA 3KXFA 3RU8H 2ZCLH 4UQ2B 5GS3A 1MCPL 4JN1H 4M1DH 2ARJB 2C5DC 4JM2F 1CFQB 4HWBA 3CH1B 5IMLB 3W2DL 1JWUA 3BQUA 3DSFH 1ZXQA 3ZHKA 4LKXA 1QRKA 4OZHB 2CO7B 2MHAB 2AJVL 1WBXA 4K7PH 1AJ7L 2RFXB 2SEBB 4AZ8A 4Z8FL 2BCKB 1MAML 4Z7VE 4JGJA 3SGKC 1P7KA 3LS5H 1FFRA 1MJUL 4NKMB 4KJPD 1BVZA 3BQUD 4MA8H 1Z9SA 5FM5O 2JTDA 1IAKA 5JHDE 4UQ3A 3CVHA 3MRHB 3FRUA 2C3WA 4XCEA 4AM0A 1DDHA 3K80A 5LXGL 2QQNL 3MACH 5HHNB 3O8XC 4I3GA 4O2CB 3STLA 4U31A 4HGWA 3B2VH 1YZZA 3BHBB 2BNQA 4NN6C 4LRIC 1I75A 5DJ6A 4LVHB 1V3MA 3KG5A 3S96A 1UACL 1CS6A 1OF2B 1ONQB 2H2PD 3TO2A 4BSVA 2NY0D 2W0PA 3Q6GH 1S7RB 43C9B 3A67H 3L5IA 4NQCE 4Y16D 2R4SL 5E2WL 1W2KT 5E9DA 5DUBA 3QIUD 4HWEL 1X9QA 1F4WH 2DIBA 2MCG1 4Z7OE 4QF1A 3KWWB 5I1IL 3X3GH 5D1QB 1JI1A 1Y0LB 2IFGA 4HJGB 4N8VG 4NRYB 4RZCB 3DROA 4QOKB 1NFKA 1OSZB 1NGQH 1YC8A 1WV7T 1IAOB 2DQIH 5ACLA 1RQ5A 2UYLA 1CFVH 2I9TB 3PP3H 3BW9A 1YDPA 3MREA 4HJJH 3B9AA 3LZFL 2NY0C 3SGEI 4RISH 3QQNA 5D7JB 3V6BR 1DR9A 1BQHA 3B5TA 3QDJD 1MWAA 1B0RA 3DWTA 5C0CB 5IFHL 4RX4D 3N1GC 5CJOL 4DJMA 4YR6A 4JAMB 2ED9A 2XQYG 5TDPA 5GGRB 4X6DB 3NFNB 3HC0B 5DZLA 1NBZB 2Q20A 3QIWB 4ZFZA 2DBLL 4FQIH 3QPXH 2DIJA 2UZXB 4JM2A 3BAEL 3OAUH 1ONQA 3TT1H 4YFLI 5JIPA 5C6TH 1V3LA 1Y6MR 3V5DA 4E42B 4ZSOA 1EHLL 1VEMA 3FO9B 3TH2T 2WW8A 3BP5B 4EN3B 5L8JB 1ZOXA 1HILA 2PO6C 2Y7QA 4X5XB 3RWFA 1PX3A 4YK4C 1T66D 1U41A 1J5OL 3BT2L 2L0DA 1QEWA 3W2DH 4TTDC 3QQ4B 3UBXG 1R6VA 4FZEH 1U42A 4QXWA 1EIBA 1EDQA 4Y7MA 3K7UA 4ERSH 3T0DA 2DI7A 1MCLA 1C5BH 3OAYK 1ORQA 4JJ5B 5J9PA 4YXKH 1G0YR 3VXSD 1DBBH 3NACH 2EO1A 2W92A 4ZO6A 4RMSA 4K7FA 1BZ9A 1XR9B 3FO9A 4MAYC 3O2WH 2Z9TA 1QACA 1RJCA 4JFDA 5DXWA 4QCIA 4X6DA 1QR1B 3ZSTA 4UAOC 3T2NL 1PEWA 4NM8H 4FQCH 2DIAA 1PLGL 4Z7OF 2VDPH 4ZUUB 2H32B 3ZDXF 1KYOJ 4HS3A 2GSGB 2BSSB 3QUML 3T3PF 4CNIA 4LCIL 2AEPH 3I50L 4JAMA 4PTTB 3MYZA 3FN9A 3OB8A 2XPGB 3MLXH 2ZCHH 3PE9A 1AR1C 3O8XA 3ULUL 2VABA 4OI8A 1YDPB 3HG1B 3MREB 3V0VA 1FNSH 3GRWA 2HTLC 5TFSL 4J4PC 4M6ML 2NY5L 2F19H 1FN4A 3REVB 3AREC 4KK9D 1A6ZA 3BX7C 3P73B 2FO4A 4IOIA 1VFOA 3Q3GA 3OG6B 4NBYB 3HE7A 5H37G 2D7OA 4G7YL 4M43L 4FNLH 4NWTH 1FAIH 3LKQB 4F80A 1CBVH 1VSCA 3ZDZF 5J12B 3TO4C 4DOHB 4JFED 2LE9A 4XVUD 5GGVH 1LE9B 3O11B 5KS9B 3KLHD 5AZEH 3QFJB 4OFYD 3G5XB 4MAUH 3K74B 5AUMA 2Z31A 4CUCA 1N0XH 1UGNA 1HQRA 5DJ2B 1EVUA 2XRAL 2G2RA 1ZT1B 3QHFH 2XTJE 2ENYA 2R8SH 1RU9L 1MJ8L 5IG7A 3UXFA 4OKDA 3QFDB 3H2WA 3CCHB 3G6DL 1LO4H 5MEPB 1DBML 3ECBA 3P0VH 4RMRA 1YJDL 1E27A 4Z18A 4DK6A 2X4UA 5BV7B 3QIWD 5DMJB 4KK5D 4ZDHB 2Z31D 5FYJL 2K7PA 2BY0A 5D7KD 1WBYB 3MRDA 1RZKC 2ZNXA 4UUJA 2VLRB 3DXAB 2N7AA 2JB5L 2DAVA 2YEZA 2BVEA 4P3CH 2Q8AL 1F58H 1NC2D 1IGJB 4EKXA 1BLNA 5SWZE 1NC4A 1IGCH 4XC3H 3DURB 5ESAA 4DKEL 4EQ3A 2BVPB 1MHHA 5D2LE 1K4CB 1YJDH 2VOTA 4WWKD 5CZXD 3V52L 1SYSB 3H9SD 4FQPA 2VXQH 4TULL 3MYJA 1LVEA 2SEBA 2J6EL 1BD2D 4XNZC 1MNUH 4RMWA 1N7ML 3B9KA 4JDZB 3EO0B 3T0BA 4GRWB 3TNNB 5HGDB 2Q86B 4L8SA 2D31B 3KLHC 1A9EA 4KV5E 1NCBH 4GMSH 1AKJD 2Z91B 4Q6IA 4WY7H 5EZOL 3UYRH 3IXTB 4TNWK 5JXED 1T80A 1UKQA 2R0LL 1QRNB 5C0RH 5HHVH 1JNJA 2Z8VC 5D7LE 2DOCA 3SDDB 2YXFA 4K3GA 1XF2A 4C58B 1J0ZA 3ALWA 4JO1H 3QDAA 1NQBA 4OV5B 2OTPA 3BPLB 4XPFL 5I1CH 4OZHF 1NGPL 1G7JA 1PG7W 1CGYA 4JG0H 1SYSA 3Q2CA 5E8OA 5B22A 4PJGA 5KSAB 5KVFH 2CD0A 4OLVH 1NGWA 3BZ4A 1MHCB 3DURA 3CVHB 2NY1D 1MPAH 1U93A 1DUZA 1NEZG 5FCUH 1BQHG 1OGAA 4HUXA 5TJWK 4YXHH 1Q94B 4YLQT 4XP1L 2HH0H 4XPTL 3SGJC 5A2IH 4PRNA 4MXQD 4XB8A 4RFNC 4XZUA 1MCPH 2YZ1A 2NYYD 3LB6D 3VXMB 2X4UB 1KCUL 4R8WH 4JM2D 4KAQL 1FAIL 1XR8B 1OW0C 2VL4A 3D18A 3K81A 3LOWA 5SWQA 3FN0L 4JFOA 5F96L 2ESVD 4QYOB 3C8HA 5GIRB 1JTTA 4NQCA 4V2CB 5IHZA 3Q1SH 1QA9B 1P4IH 1OW0A 5L7XL 1OAQH 2DI9A 1U8NA 3WLBA 2OZ4A 4LLDA 5FYKU 1MJUH 4H8WC 3OB0K 3RL2B 3AGVA 3U0WH 1RK1B 4UDTA 1MQKH 3FOMA 4AENA 3MXWH 1I9IL 1YNKL 1FNLA 5K59E 5BW7C 1FSKB 4XI5C 4HH8A 3QNZB 2P8PA 4MD0A 3VFSB 4CN6A 5I17B 1YEHL 3D25A 3KPSD 3H3KA 1JF1B 5KW9H 3ULVL 4EIZC 4F8TA 5F9OH 1T1ZA 1FVDB 3U7WL 4I0PB 3HAEA 4FFVD 3BXNB 4GW4B 1SJHA 1E6JH 1T5WA 3DMMD 3MV7D 4UZGA 1ZSDA 1NGZB 1QFUL 3SE4A 2WBJB 3PV6A 2AJZB 1WT5C 4R96A 1FNEB 4Y2OA 4Y5VC 5GQBA 5BJTA 4ZD3L 5HGHB 3CFKA 1QSEB 5HGGS 4MD5B 3VDCA 3GMRB 1KCRL 5F9OL 5BMFH 1RZGA 3ESVF 1FZJB 4PJCF 1FE8L 2GK2A 1ZHLA 1BJ8A 1YNTB 3GKZA 1MIMH 4H1LH 3QIBD 3WS3A 4PJBE 4OCNC 1G9EA 4MHHI 4MX7B 1JWMA 2LVCA 4GBXB 4JFQA 1FFQA 4RWYL 4ZXBD 1XMWA 4JVWA 1YEKL 2Z8SA 3WE6B 3HE6C 1I1FA 1I1AB 3N1PC 1D6VH 3ARBA 4UU9A 3SDDD 2IQ9L 4PJ7E 3BKJL 4R4NC 3O2VH 3VD9A 5E4IA 4GSDL 3B5GA 5L0QB 1NL0H 1AXTL 2F15A 1RUKL 4PJGF 3T0WA 1I7RB 1HOCA 1QUNA 1N0LA 4LPVA 1JI2A 1CE6A 1JPTH 1X5IA 5A16A 5FEBA 1Q9LA 1NUGA 3BWAB 5J6GB 1G6RA 1MCBA 3ARGA 4P9MH 2ZSVA 5C3LD 3SE8L 1NCWH 5DS8B 4NT6B 5AAMA 4EEEA 2AKRA 4WI3A 5ECJE 4CNIB 3NZHL 1K8DB 1MFCL 5DJDB 1NKRA 1CN4A 3OKKB 1YMMD 3AY4C 1JGLL 4NQUA 4YZFE 3L1OL 3CK0H 1DANU 2VJXA 5DVNA 1OP5H 1QRNE 5ICZB 4PJAE 4Y0GA 1CGXA 4XWOD 3QHZH 1KFAL 4L9LC 4XBPB 2B4CL 5I8KH 3D9AL 1BIHA 4OD3H 4PY7A 4ZS7H 4X6CF 4OLZH 2DQCL 1GPOL 3RDTC 25C8L 5L7XH 1D6EB 2A83B 3MNVB 3OWEA 3VXUE 3L3IA 5DRNA 1JPFB 3QQ9D 1WBZB 4DAGL 2OTWB 3W82A 1EV2E 1CI5A 2Z31C 1OCWH 2DLIA 1JHKH 2M26A 3WKMH 3DX8B 4JKKA 4XXCC 4Y1AD 3FT2A 3OAZH 3A6CH 5DWUH 1M71A 1PY4A 1OM3L 5JXEC 3EOYG 5I15H 3GUTB 5TQ0L 4XC1L 1P6AB 4OF5A 3QR2A 1FZOB 4MA1B 5FIEA 3RUGF 1FNSL 1KEGL 1RIHH 5D2NE 3FHQA 1WTLA 5D7LB 4PJCA 1OGTB 4J4PA 1XF3A 4BH8B 2FR4B 1SQ2N 3EOTH 1BQHB 1HYSC 1P4LA 1JHLL 5KVMC 5ICXA 4P99A 5EOTA 3VFWA 3IDYC 1NBYB 4L4VA 3MLZH 2NZIA 4V2BA 2AQ1A 1UJ3C 2J3SA 2V7NB 2VABB 4RISL 3F7YB 2BY2A 2HVJB 3DBXA 2CK0H 1ZLWK 4KMQA 2ERJC 4P49A 2DDQH 2MQ0A 4XPBH 2P45B 2EDYA 5ADPL 4NNXB 3T0ED 1NAKL 4YNYB 1FL3A 1J8HD 4U2ZA 4G6ML 3VXME 4NQCD 5JW4R 5IT2L 4NN5C 1R24B 5IMKB 4PRPD 4CMMA 1F11B 4KUCD 4WEMB 4H1LG 3M17B 4ONFH 1X5XA 4Q7DA 3JV4B 1NFDE 5AG9A 1QPXA 2X4PA 5JO5B 4JM2C 1MWAL 4HS8L 5CIPA 2WUCL 1B2WH 3KAAA 4RGND 1CE6B 1X4XA 2QQKL 3ZE0E 5LQBH 3IJSB 1XGUA 4JJ5A 1FL3B 4JKWA 1NSNH 3RWGA 4LSUL 4JPKH 1ZVSA 5IKCB 3QUXC 4LVOC 4X6BA 2HP4A 3ZKNC 2GTZB 1LNUA 5GGTH 2ADGA 3LKRA 1FL5A 1FVCA 2PW2B 1RIVL 2GAZB 1IKNA 3TGXA 2P8MB 3TBTA 1JRHL 2JK5B 5MHSD 3GMQA 5IFJA 3EYFB 2V2WB 3HRZB 3MLWH 2H6PB 1FG2B 4A6YA 5HHQA 5JA8B 2VDPL 4RQQB 5SX5H 1G6VK 4NUGH 1LD9B 1PBYA 4M5YH 4PJXE 5BVJB 1CE1L 1VCAA 3MA7B 4LGSB 1J86A 4FQXD 3Q6GL 5A2FA 1KJ2L 1ZA6B 3SY0A 3SKJL 4P59H 2WP3O 2B1HL 2VLJE 3EFFA 2CGRL 4PGDB 4QRQB 5E9DE 5E94A 5E2VL 1X44A 4RBPK 4GLRI 3EOAA 2X4OB 5HVHC 3GM8A 3C8KA 3O3EB 3QEQB 5EU3B 2VZ1A 1DQQB 4KHTH 4POZD 5H94A 2GYSA 3PQYE 1HH9A 3SOBL 3WFBL 3V6OA 1ZVSB 3P9MB 5IB5A 5JZ7C 1N6QL 3LZFH 4LCWA 4XP6L 4GKNA 5DC4B 1OM3H 4LSRH 4N5EC 3DV4B 3MRFB 4C57C 4RCAA 3C5ZC 1QO3A 4UDTB 5FO9A 3OGOE 3D5OF 1Q72L 4FQJH 5BO1H 2BOBA 3JBG7 1KEGH 5T1KD 4JHBA 1KB9K 3EO1A 4XVSH 4S10A 1EH9A 1XCTB 1I3GH 4CGTA 4QHMA 4YEEA 3RVUC 2H26B 4X7SH 3T0EE 1ZGLM 4TUJA 4GMTH 1U3HB 3G6AA 4EI5B 4KHXH 4R4FH 4HUVA 3MA7A 3TFKC 5IB1A 3SGKA 1OP3H 4F37F 5BMFL 4NQSB 2ZUQB 4TRPL 3SJVD 4M6NL 4PRNB 3HAEH 5FV1L 1IQDB 4WJ5B 4WO4B 3P77A 1MCIA 4K8RC 3TPKA 3RGVA 1NLBH 4GMTL 3L3JA 4HJ0C 5CILH 3HFMH 1HCFX 4BQCA 1IARB 4TNVF 1ZT4A 4HFUH 1DTUA 3AY4A 2VN7A 2YS4A 3G9VA 1UXSB 3SJVA 3R1GH 3HNSH 4FXKB 4PV8A 3GSWB 3NZ8A 4BZ1H 3BISA 5B3JE 4YHNA 1XGUB 1XGRA 5L2KA 5HPMA 3U7WH 1U8MB 5C9KA 1V05A 3L3DB 5MENB 3MJ8B 3T2NH 4KDVA 3FZUD 4WUUA 5IMMB 2VWEE 2BHYA 3VG9B 3LN4B 3QHTC 2Z4QA 1BWMA 2X4TA 5MEOB 3NTCL 5CINL 3BJLA 3VA2C 4MMXC 1LO5B 4AMKL 2DS4A 4MQ7A 3IDIB 1GH7A 2P5WA 3ZHLA 1X6NA 1NDGA 2VXTH 4HIHA 2FYYB 5KN5A 4OKVA 2IWGA 5C0FB 2BRQA 3RVXD 1KT2A 5FUOL 2ESVE 1T89A 5HHMB 3VFTB 1IBGL 4Y88A 1RZ7H 4A6YH 4HPOL 3BPOB 1B0RB 5DD3L 1S9XB 3PIQB 2R2BB 2EO9A 2NY6B 2V7NA 4XPFH 1MFAL 5F1IB 5EO1B 1VACB 3GNMH 5FO7A 1G7QB 3BP6A 3WKNA 4EBQH 5EOTB 5C0EB 2NY2B 4NFCA 4K3EH 1KPVA 3QQ3B 1CT8A 2AJVH 4G7VH 2H2SD 5HHOA 2A73B 3CX5J 3GMMB 5LGKA 1AGBB 2DMCA 1INQB 1KIUA 5ICYB 5FO8B 2FEDC 3BESR 3VD3A 5E03A 2JCCA 5DTFB 4MYWB 4JKLA 4X4ZA 5GJTH 4S1RH 3TYFB 5DVMA 3QISA 1UB6A 4AH2B 3V4UH 3ESUF 1CK0H 5BOPA 3VFRA 1KJ2B 5FUCE 2PTUA 2E9WA 3U7YL 4QYOA 4BSJA 4DCQA 1IKFL 2I5YH 4HIXH 1EFXD 2BNRA 3N9GH 3VGEA 5C2UB 5CZVL 1J9CT 2AXHA 5AWNH 2IQAA 1HXYA 1H5BC 1B0GB 1UWXH 5DFVD 4WWKB 2BVTA 3L7FA 4P3CL 5C0AD 5C0AE 5I2IA 2OR7A 3LKOB 4OD1L 1X5AA 5F9AC 4ZMAT 1CZ8L 4NPYA 5E8PB 5SWZA 5BQ7B 3RQ3A 1G7MA 5EBWA 5I74C 1DP0A 2KUTA 4CVZA 1TJIL 4KKCC 3UTSB 3SGJA 3LHPH 3V8CA 4DN3L 2MSPA 2R0KH 4UT9L 2FO4B 2FRGP 2XG5A 3QQ3A 4LHJB 3AS3A 1BD2A 4I13B 2RGSA 1QYGH 5DJDA 4GRWF 3G6JF 3LV3A 1UCBL 3VXRB 4E0RA 1BFVH 3ARRA 3CDFA 1S78C 3F58L 5SWZD 3ZE1E 4BM7A 3LQZA 4PJBA 3NH7H 4GOSA 3ZKXC 4HUMB 2RB8A 2I26N 1TTFA 1RURL 4JZOB 1BVLA 3PXJA 2I07A 4ESKA 2ICEB 3VXUB 3UTZA 3PABA 1A1MA 1MLBB 4K2UH 3VI3E 1IAII 3HZMA 1G7LB 1A6WH 3NA9H 1JPGA 1CQYA 3VXQB 1JZ3A 4Q0XL 2KPNA 4B53A 4C56B 4NQDA 5MEOA 3CUPA 4IMLA 3QXWA 3GMLB 1KIRB 3NH7L 4JRYD 3UX9B 5HY9B 1BZ9B 1P4BL 2YUXA 4G8EB 5INDB 4NC1E 2XA8H 1YEJH 3RHWK 1UJTA 5JLZA 1Q0XH 3MGOB 3WLBB 4U1NB 2XZCH 2OL3H 4WU5A 1OGAE 4H1LA 4ODSL 4J3WA 2A74A 1VERA 1J7VR 4U33A 1HE7A 4KDWA 4R3SA 3KPRA 1ZAGA 3PWNB 4OZHE 4MS8D 5IF0A 3SHSA 3T3ME 4P9HL 1JPTL 4P5MB 2GJZA 2NY6D 1J0JA 1ERNA 2YN5A 3GI8L 4PJEA 1TETL 3QDJA 5D7JC 4KKLC 3QG6A 4Z7VB 2HWZL 5I71B 3FOLA 3NOIA 2DQTH 3T1FB 3QRGL 1ZSDB 5E8DL 2BVOA 2JCCB 3DRTB 2EDRA 1FYTD 5HHOB 4DKFH 4N5ED 2AW2A 3RWIA 3ARDD 3RIAF 5JOFA 3HAEB 4LDOB 4L4VE 1MREL 5CCKL 3GSVB 4JPIB 1A9BA 4X83A 1WC7B 2J8UB 3TT3L 1ZA3A 1YPZB 2BNUB 3FQRB 1KENL 3CK0L 3U4AA 5ID1B 4DUXA 3PV7A 2V2TA 1YEHH 4HKZB 2AQ2A 1M4KA 4L3AA 3RVUD 2VXSH 4IDJL 3W0WE 4XCCH 4FQ2H 2CDFA 1SYVB 2PO6B 4ZPVB 3SGDH 1G0DA 3UJJH 1T7VA 3PWUA 3AAZA 4MD4A 2K7QA 3GSQB 1ZANL 4MXWH 1DQDH 3EFDH 2ED7A 2CMRL 3P9MA 4GKSA 3QPQD 1GZQA 5HDQH 5TFSH 1I9JL 1U91A 1QFUH 2A1WH 3VDBA 5JUEH 2P5WD 5CIPB 3JWOL 4M6OL 4EXPX 2FJGA 2ZP0T 4UMGA 1EFXB 1JN6A 4Y4KA 5JXAH 3GJFA 3WEXB 3UJIL 3FQNA 2D9QB 5B4MC 4M1GL 5BRZD 2NYYC 2R0ZL 2AV7B 2GSGA 4OFYA 4G43B 3OKNA 1FO0L 3SKOA 2YUVA 3NCCB 4RQQA 4IHOB 1KPRB 2OJZH 4CL7A 1U8KA 3HE7C 1K3IA 3AS2A 5T3XE 1CD9B 3GMQB 4U0RB 4WO4A 5JXAL 5ICXB 1VKXA 2FIRT 5EOQL 4PTUA 3RWDA 3BWUC 5C6PB 1U3HD 3E8UH 1LP9A 1KNOB 3ZTJH 4LLYA 5DF0A 1VPOL 4RMUA 5HYQB 1JP5A 2JLLA 5KVEL 5T33H 1F4AA 1KPRA 3NMEA 4LLMB 5FF6A 4HWZB 1QEWB 5EH1A 3S36X 1BECA 1CFVL 3ES6B 2J5LB 3WUWB 3WFDH 4OM0H 6FABH 1DBBL 3NACL 2CLRB 3IFLL 4J7RA 2NW3B 2BNRD 1NCWL 3FO0H 4P23D 4MJ5B 1FCCA 3JV4A 2D7NA 4KQ4L 3K2UH 2WSKA 2IBBA 1I1CA 1YEFL 4G8GB 3UMTA 2DICA 1Q1JH 4GKNB 3VRIB 4E41D 1BM3L 3IXAA 2I60H 3ZT5A 3OV6A 1RUML 5K9KA 2C26A 2DKSA 4D0CA 1ND0A 5ANMA 5IMOB 4R7DA 2OI9C 1GZQB 5EBMA 5DO2C 4PREA 1TETH 2VLKA 4XNQA 4NN6B 3BAEH 3PHOA 1IC5H 3OF6A 5BV7C 1MCWM 4LVHC 4A2MA 4PGEB 4J1UA 2CO6B 5TE6L 4F33B 1ZVHA 4KQ3L 5HYQA 4ZUVB 5MERB 1NPUA 3IB4A 5HPOA 3D39E 1SMOA 4FZ8L 5EU6D 4U0QB 4LHQB 2Z8WC 3FQRA 4OQTL 4X5WB 4AEEA 3OQ3B 4M6MH 4FNLL 4JFXB 2ZOKB 4JPWH 4Z9KB 4A2LA 1DFBL 1MIEL 3CCHA 1LO0L 3DETD 1V7ML 2RQ8A 4X6CB 2DQHH 1B9ZA 1L4IA 5MENE 2YD8A 5FKPB 5FYKH 1IAIL 5K93A 4P59L 4DUWA 1Q9LB 4HDIB 5HHXH 1FGVH 4NQXA 5JHDB 4N90E 5CEXA 2NY0B 3CFCL 3UC0L 4XGZA 1LILA 3B2VL 1QHPA 3UTPD 1VGEH 3P11H 4CMHC 1EVTC 3W11C 2PYED 4PJCE 3V5KB 1NMBH 3QH3A 4R3SB 1YEEL 3PDGA 3ZDYF 1CDIA 5CP7A 4ONGL 5J56B 4N9GB 5KS9E 5EBMB 5F7DB 1DQLL 4L4VD 4TTDD 1KELL 5C0BB 1GOFA 3CFCH 2EDLA 4GW1A 3B5HA 5CFHA 1XCQA 1QFWH 4XCNA 2HTLD 4HKJB 4ENEC 4X7SL 1IGML 4TPRH 1KIRA 5KSAC 4X4MA 3QNXA 5EWIH 5KBNC 4M3KB 3UTTA 2FH6A 1RZGB 4PLJD 3FQWA 1F6FB 3WSQL 5I9QB 3BO8A 3CU1A 3W9DA 3PL6C 1GGCL 3NCFB 2OK0H 1UQSA 2EYRA 1CGVA 3BKYL 3EO9L 4HUUA 4N1EA 4XMKL 4RFNB 2CXGA 5GISH 2DLFL 5FHAL 4KZEH 4TSCH 2DWDB 5IEKB 3SKMB 3TBVA 2XOTA 4Q2ZB 4BUGA 1P7QB 1AP2B 2YPVH 4QXTA 2NTFB 3JWDL 4HC1H 2F54B 4ODVH 3O9WA 2QHLA 2E6QA 1OSZA 4HH9A 2YXMA 3G6JE 5DVOA 5IP4A 1XF4B 3PL6D 1LE5B 5D7LA 5FHAH 3W0WB 1SY6H 3RDTA 3LEYL 3LN4A 4JPVH 3MUY1 4F2MB 5CUSL 2D9CA 5C1MB 1YN7A 2XN9D 1HYSD 3MRKA 4TVPE 3GSRA 4FRWA 5BV7L 3OMZA 2OSLA 2MCPH 4EUPB 2IQAB 3HS0B 1GCFA 3STZA 5EORL 3DX6A 5LCVL 1KYOK 4Y4HA 1FPTL 3QO1A 5A43C 3K1KC 3L3JB 4YFDB 3U36A 4MD5A 1H3XA 2E3VA 1WGOA 4HPOH 4NCC1 4XPHH 3OKMB 2CJUH 2R1WB 1FORH 3IVKA 1MQ8A 1FNEA 3FT4B 2AJZA 1JNHB 3VD4A 2AGJL 4P2QD 2HMIC 1MREH 5HGHA 3IU4L 4NFDA 2ICWJ 5BJTB 5D7JA 3AB0C 5CJQH 2P24B 3Q6FB 1GJIA 3FO1B 1FJ1A 1KB5L 1U8JA 2A2QT 4LCWD 2ITDA 4Y4HC 2DQDH 3ULUH 5HHXL 3TYGH 4NSKA 1FC2D 4P2QA 4OFIA 1B3JA 5KANG 1UB5A 5IGXL 3IAGC 3WJLC 5IBLC 1E4JA 3F7RA 1J0KA 3HE6B 4LCCC 2COQA 4JFFD 1UH4A 2OL3B 4X99B 5IJKC 3S3PA 5GRXG 3IGAA 2IANB 4P23C 5F72S 5B8CB 5KW9L 1A9EB 3STBA 1UZ8B 1ZLSL 4FMFA 1KCSL 2Z4QB 1WJ3A 1ZEAL 2IADA 4ELMB 4M6NH 1F5WA 3QUZC 3KPRB 1T1YB 4KTEH 1S7VA 3VDAA 4CN4A 5ESQB 4HAGA 4EVNA 4WUKL 2WMPA 3QRFM 4DZ8B 3CJJA 3JV0A 4BYHA 1MJ8H 3QA3B 3BI9X 2DTSA 4E5XA 1DQJA 1HCVA 3EGSA 4TSBL 4XP9L 4XNXH 3H3PL 4LLAA 3RZWA 5FB8B 3FB7A 4GG8A 4P2QE 2A6JB 1A02N 2DTMH 3LN5B 3QZWA 1A0QL 2PR4L 1IC1A 5EU6A 3IDMA 3MV7B 3RI5F 4QRRD 3VRLE 4JZNA 1KCVH 4I3SL 1P7KB 4IRZH 5I1GL 2VN4A 5E4EC 1SJEB 1WEJH 2X41A 3GJEB 1KACB 3AXLA 4HGKC 4RWYH 5C07B 4X9HA 3IETA 4RIRA 1A3QA 2OBGA 4XC3L 1T1XA 3V4PL 4MWFA 5D6DA 3NAAH 3ARZA 4KK6C 2DTML 3BPLC 3S35L 5SWSE 1JWUB 4WFFD 1NL0L 3CH1A 1ZGLB 2VLRE 2H26A 2XTJC 4FA8A 1SEQL 1S9WA 4Q6IB 4LAJH 4NO3B 3KJ6H 4Y1AA 3REWB 5BS0E 3TNNA 3GIZL 4ZTPH 1OTSD 3SGEH 1AR1D 3O11A 1EMTH 1HXMB 1XGYL 2Y36L 4WI7A 5KS9A 4HLZG 1REIA 1DLHA 2CKNA 2VIRA 2ZCKH 4YJZL 2HLAA 3MRGA 3SE8H 3NCJH 5EORH 5LCVH 3OR7B 4YE4L 5GS2H 5J1AB 3VA6A 4MA7H 3PWLB 2ENSA 4HLJA 3L3DA 5DHYB 2VDLH 3UEZA 3MTRA 1YNLH 2V5YA 2EYTB 1OAYH 1ZTXL 4M8QB 2BVPA 1R5IB 1A21A 4GQ9L 2QQLL 1T20A 3S37X 3MMEB 3QIBC 3DO7A 3SDAA 3KPOB 3VFUB 5CWSB 4QRSA 3CFBB 1WBYA 4PGDA 5EUOE 1BFOA 3BKJH 1VKXB 4PJHE 4W68A 2QQQA 4XZUB 5I1EL 3B9KC 1T1XB 3VGGA 2EDBA 4AIZB 5KSAD 1JMXA 2F58H 1XZ0B 1T89C 1FSKC 1EEYB 3MRBA 5J11B 1K8IA 1E4XH 4A6YB 2GJJA 2VSCA 5D96B 3D3VE 3FT3A 1Q1JL 1T66C 1JZ7A 4PJAB 1AD0A 4MNGA 1ZT7B 4U1MA 4Q9QL 5GRZA 1CU4H 4PUBL 3O4LB 5A2JH 2IH1B 2EXWD 1CGTA 4L4JA 4APQA 4OV5A 4BQ6A 2IAMC 1QOKA 1AQKH 2WBJC 3ZZ1A 4CJ1A 1A5FL 2Q7YB 1K3ZA 1GOHA 2JIXB 2CGRH 2GSIA 5ESQA 1ZLVK 3S36H 2OZ4H 2QEJA 1OPGL 4NHCL 4DWHA 5C6WH 4X6BB 1F4XH 1QFWL 2CMRH 1FCGA 2Z93B 1OARH 3L3GA 2EE2A 3WO4C 4ZG1A 2AJYL 5E5MA 4QRTA 4PBWD 3H6JA 1MCRA 1JHLH 5GRJH 4O02H 1J1XL 2YK1H 4G8FA 4WW2C 2R4SH 5E2WH 1WWCA 1J05A 4PPTA 3KDMA 4JGMA 1YECL 4U1LB 2FEDD 4ODXB 3VFNB 4RDQF 4YHYB 2OK0L 1ES0B 3NFNA 2FATH 3S36L 4DFHA 2HJKA 2LAAA 4LL9A 1OP9A 1FGVL 3WHXA 5F6HI 4MNQA 3TO4A 2V9QA 2VZUA 1HSAB 4FTVB 3NCMA 4QHNA 4ZTOL 5I0ZA 2VAAA 3DBXB 4Y2DA 3ZDZE 4ZUUA 4HIEA 4KI5E 3KDMB 3OX8A 4PJ7A 5E6IA 3DXAA 3S7GA 3VFGH 3QXDA 1A4JB 2EDWA 2V7HA 1PY9A 3TO4D 3IKCB 3PGCA 1S9YA 5SX5K 5I30L 3ARGD 2X44D 1WCBA 2EDHA 2Q76B 4WI5A 3RVTC 1MCOH 3GMPB 4UT7H 5E2UL 2HFTA 4PGBB 3E1F1 2OR8A 3FB8A 4H26A 1Z9LA 2EDOA 1YEKH 3AROA 2DBLH 2YZ8A 3QFDA 2MCPL 3CDGB 4UOJA 3ULVD 1RJLB 3K0WA 4K7PL 3LQAH 3DSNA 3OPZL 3D0LB 3O4LA 1JZ2A 3R1GL 4PJ8C 4NWUL 1LE9A 4PP2B 1BM3H 4PR5A 1KXQE 1L7TL 5I1DA 1R3KB 3CFEB 4P2OA 4NUGL 1YMME 3JVGA 2O5ZL 3U46A 4H26B 3VCLB 1YNTA 2NXYD 2XYCA 3ET9F 1G7LA 7FABH 4GAJH 2ZUQC 4FQ2L 2W9EL 5IB4B 3RPIB 5E2JA 1FYTE 5ICZA 1YEDA 5F9DC 2MPAH 5DFTA 2H1PH 4UTAL 5D93C 5C08A 5IEKA 1RUQH 4RGNC 2PN5A 1CVSC 5BS0A 2AI0H 3BW9B 1B0WA 3KPLA 3T0XA 3I6LD 4P4RA 1LO0H 3GIVA 5GZOD 4KAQH 4JPWL 1R3JA 4OIIH 3VRJA 3LDBC 3IXAB 1IJ9A 2V5SA 4MJ2A 3ZTNH 3CC5B 2XWBB 1G6RL 2V5TA 4Z0XB 2IALA 4M93C 4ZS7L 4BFBD 5IMLA 1NCDL 1VGEL 5KOVC 3PQYB 4NO3A 4Q6YA 1FO0H 5CZXC 5D9SB 3DYPA 4R7NB 5AD0A 4QRTB 5J9PB 4XMLH 2P8LA 1T5XA 3T0EC 1K4DA 4O58H 4GRMB 3PQYD 3ROLB 1MQKL 3V0AC 2ADGB 3U9UB 3MRLB 4M5ZH 4N9GA 5CP7B 4WO4D 3ARXA 4LSTH 1MI5A 2HFFB 1EJOH 4PJHF 4GJTB 1FP5A 1MJJA 4JKPL 1H15B 4TOYL 2FZ3B 4NN5B 4N8CH 5EOCH 1JNNL 4GQPH 2FD6H 4ZOCA 4XCFL 1YY9C 5IFHH 4G9FB 4AM0B 2UWEB 2EIDA 5AZEL 5FO8A 4NRXB 3O2DH 3QHFL 1IGFL 4R97B 4U1KB 2IEPA 1Q0YH 2L7UA 1A64A 3H9YA 5D7IA 3V0WL 2UWEF 4H8WL 1BAFL 4YGAB 4LRIA 1NGWB 4S1QL 2HFEA 4JO2L 3R8BB 1AY1L 2CLZA 4LVOB 1XZ0A 3MFFB 3EIFA 2FGZA 2HKHL 3V5HA 5ILTH 3LQMA 4M7KH 1RVFH 3BE1L 5D7SL 1CFSA 5KSUB 4HW6A 4D9QD 4PJBB 2F8VA 4V1DD 4FZEL 5GGQH 1DN0A 2APBA 4Z77A 4AEIH 3RWHA 2VLKD 4XP4L 1AY1H 3D25B 4WU7A 5DQJA 3SQOH 3U4EA 2G5BA 1H5BB 4JVUA 3B6SB 4S2SA 3LRHA 5J8OA 3L95A 3S37L 3MLYH 2EYSB 5FA4A 1DVFD 4P5TD 3BP7A 5GS1B 5GZNC 2EIEA 2QQKH 4LIQH 1RZFH 1R3KA 5CUSH 3MRGB 2HLAB 3D85B 3GI9L 5DSCB 3RRQA 4RRPA 3IRZA 5I74B 3GUTA 5FA3B 1ZVYA 3WJLA 1ZLUK 2J4WH 4YUEL 2J7LA 2XY1A 5GS0C 1ADQH 4ETYA 5GGTL 2VH5L 3U1SH 1NFDA 2J8UF 3SCMD 3KVQA 2HG5A 2DJ4A 5GRVL 2HAZA 2EXWC 4LBEB 1OAXL 1T0MB 1PG7L 4LIQL 5D7IE 3BKML 2ZUXA 4GUPB 5D8JL 4GAFB 1U92A 2YD5A 4WCYH 4OZ4B 3LRSB 5F44A 3ZKXB 1WZ1H 2QSCH 3C5ZB 5DK3A 2R2EB 3SQBA 1N2RA 2AXJA 3VWJA 2Y6SD 1TJHL 2EEDA 1RJYB 5E6ID 1SMAA 1W72A 1JHTB 5DJ8A 4F58H 1OTUD 5T1KA 4F15B 3MC0A 2BY1A 3OKDA 4GH7B 1T04B 5E99H 5L88H 3MRIB 5T1LA 4EI5C 5E8DH 1U0QA 5I75C 2GFBB 1MFEH 2WUBL 3LCYA 4AJ0A 3BKCH 1LO2L 3GDBA 1IEHA 2JJVA 4WEBL 1OCWL 1A6PA 1DLHB 2VIRB 2WQRA 4HX1A 4LSQL 3I3EA 1C7SA 1JPSH 3H9SE 2VR5A 1N6QH 1SBSL 1PYWA 1MOEA 4N5UA 2GEEA 1HXMA 1IAIM 4EOWH 1DEEB 2ARJA 2PXYD 1WCQA 3GMOA 4QT5B 1NKOA 1ZLSH 1NCTA 4M9PA 2D31A 2DQFA 2CKBH 3MRJB 1LK2A 3C6LB 3F58H 2G75A 3TJHD 4LPUA 5I71C 5FHBL 1FYTA 2AK4B 1JWSA 1S7QA 4M61B 3ZYOA 3TLRA 3HZKB 4G8IA 3TF7C 4PRHD 3E2HB 3MLZL 3AXLB 4Q0XH 5D7LD 3HPJA 5BRZA 5I1HH 3GSVA 5TE7L 1A6WL 3NA9L 2ZJSL 3FT3B 4RWHA 4YDJA 3TCXA 4MLIA 5DRZA 3MSPA 1LEKB 3P77B 3PP4L 2L7JA 1SEBA 3B2UC 3V4PH 3GSUA 5C0BA 3BPOC 4HHAA 1M7IB 5DD6B 1NDMA 4S1DC 5CJBA 3HNTL 1N2RB 3BSZL 4Z0BL 2CLVB 5TE4L 3DNKA 4IIQA 2E6JA 2AXGA 2NY2C 2G2RB 2BSRB 5DJ2A 3FAXA 3UBXI 4GW4A 3AM8A 4GRMA 3JTSA 5C07E 3QI9A 2PXYC 1KG0B 5F7LB 3FQXA 3LY6A 1BBJB 3WMSA 5J13C 2BVUA 5TE4H 5IV2B 3VXMD 4HXAH 5TDOB 4CU7A 2OJEA 1QBLL 3CMOH 3GSNB 4ODUB 1CL7I 2G60L 1SJXA 4JFXA 2R39A 2VYRE 5D8JH 4K3JL 3WIIL 3QDHA 5A3ID 1IC4L 1WZ1L 1XAUA 1Q9KB 1RUQL 3CXHK 4NO5B 4KI1A 1RHHA 4U0RC 3RP1A 4EQ2A 3OG4B 1ZGLA 3DI3B 5C0EA 5AAWA 3UTZB 3MV7E 2R29L 3HG1A 4ERSL 4NKOA 1ADQA 2P48B 4GRLB 1W72B 4S0TD 4MXWL 4OFPA 1F8TL 2ID5A 4JDTL 2FB4H 3KPPA 4J3UA 1S5IH 2YPLE 1B88A 1DLFL 5C0GA 3PXHA 2HTKD 3MV8B 5T3XL 5JIIA 2ZOLA 5F93C 1KF9B 1GGIL 4XPAL 3LAFA 3DARA 4B50A 3DX6B 4JANB 4U1GC 4P9HH 4U1KA 4LSQH 2BNQD 2FNBA 5D7IB 1GC1C 1DJSA 1FZMB 2BY3A 3AVEA 3STZB 3LMJH 4X80L 2K3TA 4PJ5A 4WGVB 4O9HL 1QFWM 2FB4L 2JJUA 2EXYC 2H9GA 3QFJA 4FQLL 1PD6A 2W9DH 1A5FH 3L7FB 4S1SH 5JA9A 1J88A 1HWGB 4WWKA 4FQJL 3MRLA 4OLZL 5E9DD 3F5WB 3BH8B 1ETZA 1AC0A 2ATKB 2CRIA 3RWGB 4UNTA 4OD1H 5F21B 1AD9A 1PKQB 2CR3A 3GHEL 5CGYD 2V17L 1OP3K 3Q3GB 4OF0A 4LLUB 1WZMA 2VXSL 2NY3D 1A47A 5FGCB 3SO5A 4O02L 5GGUB 3QG7H 3RTQB 5IVNA 3KJ4B 4G6KH 1IZKA 5C7XH 1TZHA 3RNQA 1ACYH 1TNMA 4MJIE 2YRPA 3O8XB 3SDCD 5D6CB 4PB0L 1AH1A 4DTGL 3P9LA 3E0GA 3V5HB 3S5LA 2VAAB 4P4RB 3GMMA 2GI7A 5K9QG 4P2OC 1KGCD 3DI2B 1TVDA 5C08B 3RGVC 5DRXB 2D4FA 5FKAB 4Y5XB 4OAWB 2ATPB 5E2TH 3IFLH 3G5YA 4WDIA 4ZYKA 5F1NB 3FMGL 3BDBA 4HKXA 1U2HA 3MLYL 1RUKH 1A1NB 4NQVA 4ZO9A 1U91B 5KS9F 5KZCD 1FO0A 1T7YA 1NEZA 5I6XB 1IAOA 1HOCB 4RAVA 2BHZA 4P4KB 4QRUB 1LEGB 2E7LA 1K85A 4M4RA 5LWYL 3EJZD 4OFDA 4HV8B 3TIDB 2VISB 2XWJA 2X9XA 2VWEC 3ARDA 2GSIB 1CDBA 1TENA 3UJTH 2XFXA 1A1OB 3DHJA 4P2YA 1EX0A 4NKQB 4FFYH 1JTOA 4R2GB 3HKFA 2CH8A 3RDTD 4PP2A 2X9WA 4AYFA 2ITCB 5EO0B 4AEFA 5E8EB 4LEOB 1JV5B 2UV3A 1LHZA 4W6XB 4QY8B 1NEUA 1N4XL 3CDYA 3JWOC 4OQ1A 4XPGH 1WFUA 3GEWB 5I9QC 2E7LC 4OUUB 1NFIA 4LCUB 2HJLB 5JR1H 1WCBB 5ADOH 5JW3L 4TUOA 5E0QA 4PJFE 4GMSL 4Z76B 1KNOA 3EYFA 5EZJA 1G84A 1J1OH 4HQQH 4GRLA 4AT6B 4TTGA 1XF5B 4PRDB 1UXWA 5EC1A 3HMXA 4P2CG 2VXVH 3SPVB 4Y5YB 3ARBD 4EN3C 3QEHA 2HT3C 1HEZB 2D4DA 2DJUA 4NYLB 3TESA 4X4XB 5ISZD 5H37H 3W9DB 3QDMB 3GKWH 3A6BH 5FYJD 3S5LB 4M61A 5J1AA 1KELH 5CJ8A 3VJ6B 3MGTA 3IJSA 2IAND 4O5LH 1W8OA 4K94L 2XWTA 5GGVL 4G8GA 3L9RA 1OLZA 1RK1A 4J8RB 2IAMA 5FCUL 1CFNA 3RVTD 3RL2A 3NCBB 1KC5H 1RIHL 2E5EA 1GHFH 5EU4B 2IPKB 5FYLD 3DV6A 5JHLH 3PGFL 1F11A 3QEQE 5E08H 1IMHC 4JFFA 4O51A 5EA0L 3X12B 4MZ3A 2X7LA 4PJIB 1CZ8H 4KY1H 5EUOB 4YX2L 3VFMA 3SOBH 4ZO8A 3RIFK 4BZ2L 3CU7A 1YUHA 3BPNC 5IK3B 1OWRM 4LSSH 3VGFA 1YMMA 2VO5A 2EDKA 3SKNB 1EEZA 1T1WA 3B8YA 3T3MF 5FK9B 4O2CA 4XHJD 4RIRB 3UZQA 1IGFH 1P84J 4AT6A 5F70A 2Q8AH 3RVXC 1LP9B 2XN9E 3QUXD 4G6MH 4PLNC 2AP2A 3AREB 5FYKE 3BUYB 1T04A 5DD0L 4XP9H 1FZJA 2YD1A 1S9VB 4JREB 4XRCB 4OUUA 4GAYB 1P9MA 1D5IL 3QCTL 2HRPL 3VW3H 3H42H 5C0CA 5JOEA 3KS0J 5LBSL 3OF6D 2P5EA 4M8VA 3F65A 5GGQL 4R26L 1U8OA 5FOJA 2DN7A 1N5YL 3QXAB 4F7MA 1MRCH 1B4JH 4PLKD 1AHWB 3D85D 2DJSA 1UZ8A 1WICA 3WNNA 3MJ9A 1F02I 4I2XB 2LFGA 4L4TB 3DUHA 5E6ZA 4D9RD 5HYSA 2ADIA 3UBXB 1T20B 3DMMB 2XXMB 3BKYH 3EO9H 5ERWB 1KN2H 3S37H 3TA3B 3QT2A 2W07A 1OP5K 1RZFL 4F7CA 2R4RH 1AKJA 1G7IB 2P5ED 1OT2A 4IIQC 4K8RL 3C09B 2LTQC 3QEGL 4X99A 1RZJL 3MROB 4NNPL 5HD8D 4ODTL 4OI7A 4LK4A 3PP4H 4AMKH 3U0TB 2D0GA 4DZBB 1A6VL 1DZBA 2ADIB 3UBXA 3QUMB 5F88B 4OLVL 5DEGA 1AJ7H 2FX9L 4Y19D 1ZT7A 1JE6A 5IEHA 1TPXB 4F8QA 4D9QE 4U6VH 4WTZG 4JPVL 1BP3B 1Y18B 2CRZA 2VDNL 2ESVB 5HHOE 3NN8A 1LMKA 4O58L 5DURD 3VWJB 5DVKA 4FQCL 3T1FA 2J88H 2EH8H 1DUYA 3O3AA 4HHAB 3VXSB 1Y6NR 1T83A 5HHOD 2XTJB 3KXFD 1NCNA 2C7UB 4XVJL 5EOCL 4N8PA 2O61A 4U6HA 3TNMB 4H0GA 1F6AB 1HHHB 1MELA 4UTBL 3UZVB 4ZAKD 1I1AA 1I1FB 3EOBB 2GJ6E 2HLFC 2BJMH 1A6UL 4F2MA 3PWLA 2CUIA 3ROOB 1T1YA 2V17H 1RMFH 2W0LA 3MXWL 5HVGB 1OB1B 4D3CH 3WXWL 1M1SA 4U6HB 4AY0A 4N8VA 3U4EB 5F71A 5KTEH 3GMOB 1Z2KA 4QT5A 2FGWH 1X5JA 5I66A 2VDKH 1K4DB 2LU7A 5HDBF 1CGUA 2DYPA 2I5YL 4ZAKA 25C8H 2G9HA 2KZ1B 2XKNB 3WFHA 1XH3A 2R0ZH 1A1MB 2P49B 2NR6D 1T83C 3DECA 3V0VB 3GSQA 4KTDL 1OTTC 3X11B 2X89A 3B9KB 5IESH 1I8MB 5HYJA 3MUGB 4XBEH 2YPLB 1K9TA 1RY7B 1GIGL 3S97C 3BO8B 1KCRH 4OQTA 3WFCL 5J11C 1I8LA 3U7AA 1UQSB 2XQBL 5DLML 2VDRH 2IANE 1MIML 2R69H 1N6VA 1YYLL 5DUPH 3ULVE 4MNQD 4D94A 5TPWH 3IYLW 2X4NA 5HTSA 5T33L 5T5FH 4Y4HD 4LOUC 5ITFA 3QNZA 4Y2DD 1BFVL 2EECA 4K7PX 1GIGH 1QO3B 1ITCA 4P2RE 4NPYB 3RY5A 1OTUC 2BDNL 3B4NA 5D2NC 4O2EB 2AJUH 1XIWA 4U2YA 3WFCH 3ZT7A 5INCB 4PYHA 3QUYD 3H8NA 2VDLL 5IB5B 2ICWI 1EUTA 3LKOA 4AG4L 4YDKL 5I2IB 5IROA 3U83A 3LEXA 4MNHB 2EZ0D 5C0JA 5IVZA 1MHPL 2VLRD 4OD2A 2BVYA 1S7VB 5CS7A 4NIKB 3C9NA 4WI9A 5DJCB 3D48R 5F7YC 3D69A 2P43B 3MA9L 1GSMA 4AH2A 3MRKB 4JFHE 5CJXC 5EO0A 3UPRB 5SV3A 4I5BB 4EUPA 3EYVB 1N5AA 4LLWB 1UVQB 4PFEA 3IJYA 4G80A 1BQSA 3FAWA 3ZL4L 3WIFB 5HI5C 5E99L 3W39B 3EDKA 4YDKH 4PJFA 3QUYC 5I1EH 2YSSB 5E2TL 1P7HL 1SEBB 3WHE0 4X4YA 3R4DA 4L3CB 5TDPB 3X14B 5LAXA 1E28B 4NO0D 2OL3L 1LD9A 4WHDA 3X17A 1MWAH 2E27L 4GG6B 2Y5TA 4JN1L 2Q87A 1DQTA 1EEUA 2ZPKL 4JLRB 4WU7B 2HKFL 1QLRB 4OGYL 3MNWA 3C2AL 3FKUS 4S1RL 1G7JB 3HNVL 2NLJA 5IJVB 2V7HB 1RZKH 4ZSOE 3TZVB 3LRGA 1U8JB 3I2CH 4YE4H 2B0SH 2VAJA 2C4FU 3GKWL 2AK4A 4Q2ZA 4GAJL 3VH8G 1FFOA 3QIUC 4HUUB 1GPOH 5TQ2L 2Z8RA 1RZIA 4OIAA 3GHBH 1F4WL 1DLFH 1MCHA 2YRLA 5CCKH 2PCPA 3HI5H 5AG8A 4BSWB 5F6IC 2CDGA 1FFNB 3E6FA 3FO2A 1U58A 3S8WA 1X5GA 4OKVB 5E9DB 2IPKA 1NGQL 1I4FA 4OZGF 4QRRA 4PIRF 4HF5L 1RHFA 2BOBB 1EGJH 1XEDA 3TVMD 5JW3H 2NW3A 1G7MB 1T4KA 3GSRB 1BGXH 5TDNB 4AENB 1UT9A 1D5ZA 2XKSA 4HFWB 4OLYL 4I18A 1P4IL 4M7LH 1T7WA 2W9DL 2YMXL 3VXUD 5I8OH 5F7DA 2F53A 3OGCA 3WJJC 4L5FH 3RZCC 5DVLA 4XBEL 1CXLA 2IJ0C 1U2CA 1RURH 3D3VB 4J6RL 3VFGL 5D71L 4GO6B 4PLKC 3ZMRA 4NQEE 5D93B 1CDYA 1OLLA 1LO4L 1XF3B 4BH8A 2VUOA 4WJ5A 4M7LL 5IHLB 3EDDA 1IQDA 3OX8B 5D1ZC 2F53D 1OQXA 1AD0B 4MNGB 5ACZA 5L2JA 1NBZA 2CKBB 4GAYA 3EYOB 5F7EL 4GUPA 1FL6B 3JWNC 3VRJB 1K8IB 2EYRB 3HPLB 1KJMA 3BZEB 3UTTE 4NM4L 4J6RH 5EB9A 3X13B 3U82B 3KPSB 3HLAA 3P4LA 1M71B 5C0AB 4TSAH 1G7PB 4LMQI 4HWNA 4U6YA 3QUMA 1U3HA 4ELMF 2Z31B 4ONFL 1NUDA 1EFXA 5GHWH 4NKOB 4S1QH 5JNYB 4N0FA 4OM1L 3DVNA 1M7DA 1RI8A 1Z3GL 5D5MB 4M7ZC 4MXVE 4S0SD 5FA3A 3LQAL 4BH7B 1SY6L 1CLOH 2F5BL 3QWQB 4G6JL 3D1MC 2YWZA 4XCNB 2BXYA 2VISA 1AGCA 3DUUB 5E5MB 5EDXA 5IKCA 1G7IA 2PNDA 2Y36H 4LCYA 4F9PC 1IM9D 3D2UA 2VE6A 5D96C 4RAHA 2WLYA 3WDIA 4JZJA 3VGDA 3RBGA 1Z3GH 3B9EA 5ID0A 3UAJD 4JFZL 2VXUH 4PJ9D 2MKWA 3K2UL 2NY1B 1DCLA 2BSTA 5JPNB 1FORL 1R3IH 2WBWB 3D2UD 1FLRH 1HINL 4MA8L 5ALBL 3X13A 5HYJD 1BBDL 4GW5A 3H9SA 4R26H 1F4HA 3PHQA 4OIIL 2F5AH 5I76B 4OZIB 1MRCL 4F7TB 5I1LA 4UIKH 3VFOA 4NO2B 3GB7B 1MPAL 4NOBA 5HHNA 5B39G 3K3QA 4OLWH 1JYVA 1N59A 1A2YA 1IZJA 2EEAA 4YHYC 4KPHL 4UNVA 3RWEB 2G5RA 4BJLA 5BZDB 4B7IA 3V79C 4Y2DC 5JUEL 1SVCP 3TM6A 1CU4L 1UFUA 2X40A 4PS4H 4LARH 5GS0H 3S98A 3VFPB 3EJJX 2X4QB 4CW1A 2W9EH 1CDJA 3EAKA 1J0IA 4N0YH 4TNWF 5F7NC 3FN3A 5JPNA 4U1NA 3KXFE 3QAZB 1ACYL 4JFFB 3S6CA 12E8H 5H2BB 1A3LL 3AMLA 2APVA 4QEGA 3ULVC 4ELME 1IEBB 2J1KA 2JCCE 5EA0H 1Z5LA 2A9MH 3RPKA 3UAJC 3HUJA 2XFXB 3H0TA 5JHLL 1U3ZA 5IESL 1QSFA 4NC0B 3I85A 5D71H 4H88H 2JJSA 4YNYA 4X6DF 1H3WM 1JUFA 4M9OA 4ALAH 1GAFH 2VE6B 3WIHH 1M05B 1A3LH 5DURB 3VWJD 3GM0A 5GJSH 3V52H 3EUUA 4UT6H 1V3KA 3EDJA 4I0KA 3N9GL 1OOAA 3PJSB 3D0VA 4APQC 5ID1A 1WT5A 4IRZL 2EC9U 3GSOA 5I8CA 1WTGT 3SDXF 4GG6E 1S3KH 3VH8B 4FQHA 4PRPB 1A9BB 1WZLA 4FFZL 5EZJB 1ZA3B 2BNUA 4YHZH 1I7TA 1NLDH 3UO1L 2FO1A 1PQZB 1P4LB 4CVZB 3HLAB 4NRYA 3GSXB 1X7QA 4X9GA 5I75B 4Y4FC 2AJSL 2YSSA 2QL1A 4KDTA 1U3YA 5HI5D 1T2XA 5SX4I 1W0WB 3O41A 4Z7WE 2D2OA 4IRJD 1EAPA 4XMPL 5C0ND 1G7HB 2FGWL 1IE5A 1J11A 2QJDA 5JIHA 3VGHA 5GGSA 1HXYB 5DFVC 5A16B 1GGTA 1Q9WA 4MLSA 5IVOA 5EULV 1RSFA 1KIPA 4RGNB 3V6ZB 4K9EL 4DKAA 3VXOB 1RJLA 3SJVE 1DVFB 3RJDA 1TZGH 4C54A 5FXCH 3D69B 2AJSH 3MODL 4UV7L 3QUKB 5DJXA 2X1WL 1LGVA 3DPBA 3IDUA 1HZHL 3PNWA 5ISZB 4HUKB 4UOW1 1NMCC 3C6LC 4X6FA 4M4PA 2E27H 3RWFB 1CXKA 2R2HA 3BMWA 2DM2A 2BMKA 3NIGF 4MZ2A 3QI9D 3VE0B 4FQXB 4HXBL 3HC3L 4OCXH 5B38B 5DD1L 1OAZL 1OGAB 4HUXB 2BK8A 1A6VH 1WISA 3TFKD 3RKDC 3I75B 2IPUG 5K9OB 3ILQC 4UQ3B 5J3HD 2LQRA 3AM8C 4ZS6D 4Q9CA 1TZIB 5IIEA 3IF1B 3HZMB 4OGZA 3FO1A 4NGHL 4DVRH 3ARFB 2NY5H 3NN8B 5DI8A 5E08L 5DFWH 3MX0A 1S9XA 3PIQA 4FP8H 2Q8BH 4CADB 4NP4L 3BQUB 1FNGA 1U8PA 4KZDL 5GRUL 3WNKA 1JCKA 4PJEB 1EZVX 1INDL 4LSSL 4HIXL 5JQHC 4G6AC 4E41A 5HGDA 1G9NC 1NC4D 3OB0H 1CIUA 3GBLA 3TH4T 2HYMA 2P8PB 3HUJB 3GSNA 3HS0A 4ODUA 5IMMA 4I3RL 2PYEB 4OFKA 3S88H 5CSGA 4H0IA 3THML 4DAGH 3AMKA 3EOBA 3QWRA 1A3RH 3ISWA 3ROOA 3MGOA 2I27N 1B0GA 1INDH 2R15A 1BVKB 1RV6X 1KEMH 1MI5B 2P47B 3HZVA 4PRBB 3JV5A 4QXUL 4BQ8A 1HN1A 35C8H 4PJ9A 3MR9A 4PJDE 3SDXA 4QGYA 5I1HL 3MZGB 4ETQA 4I5BA 2IG2L 1MRDL 4G5ZH 3DXAE 5DJ6B 1QYGL 5T3XD 3WLWC 4P23A 1ZANH 3Q1SL 5E7FA 2K1MA 2VDKL 3P4MA 4PG2A 1EUUA 3RNKA 2C7UA 3MV8A 4U1JA 1OAQL 2F9BT 3VI4E 3W5MA 1MAKA 4KTDH 3L7EA 2VNCA 5J6HA 4QXUH 1QNZL 4M6OH 4GKZB 3H3PH 4ONOA 4YBLB 3C08H 3GSXA 4C55A 1YEGH 1VFAB 4UV4L 5IVXB 3FRUB 4XCEB 1PQZA 3DX9A 1INQA 5ICYA 3OR6B 3LEYH 1PDKA 1AFVL 1T3FA 4QXGH 5A2KH 2BVQB 2ADJA 1WEJL 4R90L 3OJDB 1BD2B 5ABDE 4PJ9C 3F8UB 4P5TB 1AI1L 2IMMA 4NQDD 4TVPH 3EO1B 4KUZH 1ACZA 4Q9RH 3VD7A 15C8L 1YQ2A 2EDTA 3MLSL 4JB9L 3ILPB 4GW1B 5HI4C 3HMXH 2FSEA 4I0PD 5FA4B 1A4KB 4HJJL 2VLKB 3LIZH 4K3JH 3WIIH 4Y16C 1EO8L 4F15C 4YXLL 4G42A 5K9KB 2EIZB 2FH8A 4OGXH 4NWUH 2MQ3A 2FWOB 4ODSH 5EUKA 4EJ1C 3UTTD 3T2OA 3D87B 3ZLQC 1WK0A 4LMQE 1FQ9C 32C2B 4Z78A 5JW5A 1ORSB 3WLWD 3NCEB 4ZOEA 4ODWA 1CF8L 3KJ4C 3VXNA 3S4SB 3ULUF 3IDNB 1F3JA 4QOKE 1ZA6A 1KJVA 3BEVB 2DQTL 2HT4D 3TYFA 1J8KA 4ISVB 3EFFB 4HS6B 5D1QC 3RY6A 2XZAL 3EBAA 5C07A 1S7UB 3O6FB 1ZLWH 3QEHB 5DRZB 4KH2A 2DWEA 2NMSA 3EYOA 1KTDB 4K3DL 5I0DA 4C83A 2EDDA 2AI0L 2EDXA 1I7TB 5E8NA 4OZGB 3RVVC 3LN5A 3LMJL 4X80H 4PRIA 3BMVA 5KSAA 5IOPB 1X5FA 1U6AH 4PBVC 1I1YB 4LQFH 3KPQB 4G7VL 3FQUB 2W0FA 5HVFB 2ESVA 2KQMA 2UVEA 2XACC 3EYUL 4XCCL 5FGBC 4DN4H 4XHQA 3LKNA 4P4KC 4EI6B 1L0QA 3BIKB 4EXKA 1E4XI 2VXUL 2AK1L 3FQTB 4HK3N 2UZYB 4PJIA 4ORGA 1ZV5A 5F88A 1MFCH 1QZ1A 3RY4A 1J12A 4Y4FD 5FOBA 3MQIA 2PYFA 4APQD 2VZVA 3U0TA 2BOCB 2ZUTA 1DE4A 4R2GC 4WHTB 1PYWB 4OLEA 3DGCR 3X3FL 5IQ7H 1F45A 4Z5RA 2FJGB 4P3DB 4GG6F 2APFA 3PGDA 2Z92B 4K55A 2B4CH 5DUPL 5I8KL 4ZXBA 1JNNH 3BH9A 4HWEH 1U8NB 3BZFA 4JVPA 4XWGH 3G5ZB 3SGDI 1XGPB 2UWEE 3MRCB 3O3BA 4HWBL 3QULA 4NNXA 1D5MB 3MZTA 1FN4B 3REVA 4OLXL 4L1HA 4DEPB 3MBXH 1EA9C 3V5KA 1E4WL 2PO6A 2W0FB 3QWOB 3GJFH 3C8KB 2XIDA 1XIWD 2YEZB 2PXYB 3E8UL 5DRXA 1XF5A 2Y1VA 3E3QC 5F6HJ 2X4OA 4S1SL 1U8OB 1MEXL 2VLRA 3MOBL 2DKMA 2AV1A 3N0PB 1JK8B 1U95A 4KI5D 2AK4E 4X6CA 4PGCB 5D70L 5DMGC 1E4WH 4OCWL 3PWVB 3DXAD 5DC0A 1QR4A 5EU5B 2GK0B 1Z9OA 3VXPB 4QHKJ 4ZFFB 1BQUA 4K2UL 4WGWB 2M8XA 4GLRH 1MCKA 1R0AH 1YN7B 4BZ1L 1A1OA 2C3VA 4GRLC 2GTZA 4JHWH 5ADPH 3K46A 3LKRB 2FWOA 1WAAA 1QQDB 5JR1L 4S2SB 1XGPA 3AU1B 2J4WL 4YUEH 1P4BH 3C5ZD 3HI6H 3JWDH 1BJ1J 2Z91A 5J12C 3RUGA 2QSTA 3TVMC 3INUH 1JUFB 4P9ML 5FUZH 3UTPE 4YBHA 2HT2D 5BVPL 1C5BL 4Z77B 4RMQA 3CMOL 2DQEL 1T4KB 5D2LA 5DMIH 4HKZA 5SWSB 4K23L 4LFHD 3DV6B 1NC2B 4IMLB 5ACMA 5HGAA 3O2WL 1NUNB 5DR5L 5EIVA 5EN2A 1OSPL 2IALB 4EUPG 4QRPE 3FFCE 3SBWA 5CGMA 1T3FB 4QRQA 4UIMB 2ARWA 4NQEB 3P9LB 2V9RA 1PGRB 4Z7WB 4GFTB 5IVXA 4JRXE 4CBPA 4HULB 1NCBL 3LKNB 2VZSA 1BGXL 1NC4B 2DQHL 5KANI 4IBLT 1H3UA 2CRYA 4NBXB 1NAMA 4NKDA 3PDOB 4YIQB 4PB9L 2A9NL 3KGRA 4GRWH 2DQCH 3U2SA 2H1PL 1HZHH 3WXVL 2DM7A 4YHLL 1XR9A 5I8OL 1HNFA 2EH7L 3PGFH 4JRXD 3EDEA 3MLWL 2NLJB 5DMYA 5IJVA 1MFEL 2WUBH 1HHJA 1D5BA 4OCSH 1BF8A 3DROB 3DMMC 3CSYA 5GPRA 3SDCA 1Y0LA 5D5ME 2FIKB 3HE6D 4TUKH 4PJXA 5CEZD 3MACL 4P2OB 1N6UA 4XNZB 3QA3A 3QH3B 4KJQD 4LEOA 4N0YL 5CBEB 1TTGA 1OGAD 3RUGE 3HR5A 4XNYL 4BUHA 3G5XA 3QCVH 5FYJE 5HI3C 2KZWA 3P40A 3IFOA 4LKCA 1ORSA 3WS3B 1U8IB 4Z78B 4JY6A 3V6FB 3EJZC 1A7QL 1X3DA 5DDHA 1S7WB 3FTGB 4J3SA 4Q97A 3CVIH 3K8MA 3HFML 5I16B 2H8PA 4H5SB 5GSRA 3HC0A 4LAQL 4M7JL 1UWXK 1H3TA 3KYKL 43CAB 2D0HA 3RX7A 5DHVH 3I3DA 1HHJB 4KUCF 5I1IH 1S9YB 4N8CL 2CDFB 4AIOA 2WBJA 3PV6B 4JFHD 2R1XA 4JR9L 1EEQA 3CVIL 2HVKA 4YHZL 1OY3B 4FFZH 5E56A 1DSFH 5FKAA 4R0LA 4RAUB 5DRWB 5EOQH 4MD0B 2FBOJ 1WAAF 4R7DB 3BD4A 5E1AA 2WUCH 3NFSH 4CVXB 2OS7A 3RWCB 5EBWB 2Q1EA 3ELAT 4HJGA 3MV11 2X4SB 3SE9H 1I1RA 1MHEB 5ILTL 1FLRL 1HINH 2H2PC 4I3SH 1KCVL 2VL5B 1SJVA 3EYQC 1C5CL 4YPJA 5CLWA 5T5FL 1CFQA 5IQ9A 1KT2B 2PF6A 3BFOA 1NCCL 5C0DB 3I3BA 4XCYB 3ZE1F 3B43A 3SDAC 4MJ4A 4Y5YC 4OCRL 2ATKA 2R0WL 4QWWD 3S9DB 3TT1L 2OSLB 1I7RA 3ARPA 3FB6B 4XAWH 4I18C 2G60H 3MRMB 1C08B 5H35B 1BVKA 3BH8A 3HHRB 3KLSA 5E5UB 1IC4H 3NIGE 1JIBA 4LU5H 3QIUA 5EU7E 3HC4H 1BZ7A 3SE4C 3O4OB 2DD8H 3CFDA 3UZEA 1W0WA 3O41B 5DD6A 1SJEA 5JTWA 1JMZA 1QG3A 3SCMA 1CXHA 1SBBA 1OAKL 1S9VA 5C09E 1MHCA 3U30C 3GMLA 4K71B 1CBVL 1G6RH 4C83B 1DQML 5GGRA 3PWVA 1L6ZA 2R23B 2ZSWB 1U58B 3VXQA 1V5JA 4AL8L 4NGHH 5CBAA 2YBRA 5CSZB 2NQCA 2NY3C 2WIMA 5D6DC 4KKCD 3DRQB 4RMTA 3T77A 3MLRL 3QUYA 4PY8I 3H7BA 4OZIF 5D2NB 1YYMH 4Y5VB 1P69B 3WL9A 1VHPA 2BX5A 4LNRB 1QLEH 1U8HB 2DQFB 4JQXA 5L88L 1CF8H 3KR3H 1QRNA 1G6RB 4M62H 5J1SC 1T1ZB 5GGSY 4XX1E 3MUJA 2FYYA 4NUJA 1F13A 2J6EA 5F96H 4P2OD 4WEUD 2Z93A 3L3GB 3C6SB 4GXVL 4PJDA 4W81A 3SDXE 2EKSA 1LO5A 3GBMH 5D1QA 2P46B 5IW1B 3BH9B 5GJTL 4D0DB 2D0FA 2Y06L 4CVXA 3BKCL 3PGDB 1CG9B 1PKQE 1KG0A 4OT1L 2VERN 4H25B 1AXSB 4FQQB 4PJEE 1B4RA 3QUZA 5DMGD 4LAQH 4M7JH 4HF5H 5L0QC 4PG9B 2IG2H 1AHWC 5DMKB 5C08D 3RAJL 2QR0B 3VXSE 2C3HA 5GZND 4PP1C 2AABL 4JFOB 3BE1H 1M7XA 1WLHA 3X3GL 3RWEA 2PW1A 3TZVC 1JBJA 3V4VL 3V95A 2Y06H 5KVGL 4NZUL 3MRBB 4NQXB 5JHDA 1KV3A 4S11A 3PWJB 2NZ9C 4IIQB 4MWFB 3JZ7A 5D2NA 3OHXB 1BIIB 5C8JA 5J6HB 1V8HA 3VXRE 3L7EB 3RKPA 3R06B 1QSEA 5IJKA 3LKPB 2X05A 3S35H 4Z7QE 4LCCB 4Z76A 1NH6A 3W9EB 4O2EA 2R1YB 4U6XA 3LRSA 4XB7A 2C1OB 4NKIH 5B3JF 1BOGB 2DQGL 2YD6A 1LP9E 2JJSC 2PW1B 1IGIH 2XN9B 4L8CB 5HYJE 2AJ3A 4MQTB 3MR9B 2ZJSH 3SDXB 1CTOA 4WRLA 5IW6B 1T2QL 4IOFD 4KRPD 5FYLE 1N5YH 4M6AA 4YHPA 1QSED 1DQJB 3EGSB 3FL7A 3OAYH 3QUZB 3V9FA 3T08A 4JG0L 5ID0B 1BREA 5I1JL 3VWJC 3DVGA 1IRAY 5AYUH 1PJ9A 2GY5A 5BVPH 1EO8H 4YXLH 1XF4A 1LE5A 5J06A 2IQ9H 2R9HC 2F8XC 1Q8MA 2Z0BA 3BSZH 4Z0BH 2X7LB 2O26U 1WIPA 4E41B 4WCYL 3MFGB 4MA3A 3SDCC 4X7TB 5IM7A 2EXYD 3I9GH 2YPKA 4JQIH 1C1EH 5D7IF 1OSPH 4LLVA 4O51B 3X12A 1IM9A 5C08E 2OTUB 3T8XB 1UM6L 1RUAH 3LD8C 2OL3A 1VA9A 3V7MA 5T3ZH 4JZOA 4E9LA 1KLUA 2B7DT 3U4BH 2YN3A 5KSUA 4MA1C 3N1MC 2OLDA 4Z7WA 3T77B 3ETBF 1CL7H 2YBRB 2XICA 3L5XH 3H7BB 2ZCLL 1EHXA 1A22B 1DQDL 3VFPA 4Z6AT 1JYNA 3NPSB 1UEMA 4MDJB 4BFGA 8CGTA 2Q6WA 4ZFOL 1I9IH 1YNKH 4HSQA 3BDYL 5LGHL 1JGEB 3IDYB 1ZWIA 5C0IB 1FIGH 2A6KA 4IRSB 4KU1A 2QSQA 1TCRB 5DC9B 1EAJA 2H3NB 4GKZA 4KJWD 2N4IA 5CD5D 1AQKL 1FVCB 1FL5B 1KFAH 5BZWB 1XF2B 4OB5L 4DGIH 3DOSA 3T09A 4MQXC 2MQCA 1GGBH 4Z7UA 3U48A 1NFDB 3K4DA 1HQRB 3S5LG 3UYOD 3U9UA 1D9KB 1T0MA 3V6OC 2FCBA 4GW5B 1W8NA 2YK1L 1KSRA 4JGUA 3IS0X 4G3YH