1U6AH

Crystal structure of the broadly neutralizing anti-hiv fab f105
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
222
structure length
222
Chain Sequence
VQLQESGPGLVKPSETLSLTCTVSGGSISSHYWSWIRQSPGKGLQWIGYIYYSGSTNYSPSLKSRVTISVETAKNQFSLKLTSMTAADTAVYYCARGPVPAVFYGDYRLDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords F105 LIGHT CHAIN
publication title Structure of the Fab fragment of F105, a broadly reactive anti-human immunodeficiency virus (HIV) antibody that recognizes the CD4 binding site of HIV type 1 gp120.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2004-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u6aH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u6aH01
5EUKA 2EIDA 3RA7L 4PG2C 4ZTPL 1KSRA 4XI5C 4XMLL 2JE8A 3P4OB 2EZ0D 3TIDB 4CN6A 4EXPX 5F89B 1JPGA 4MJ5A 2W0PA 3PGCB 4HGWB 4MS8D 3MV7D 4NM4L 4XNZC 5CGYC 1Z3GH 4PTUB 4WFFE 4NHCH 3U30B 4FQXD 1RVFL 4TRPL 3UC0H 5TFSH 2YSSA 3BESR 5T1LD 2DL2A 5T3XH 3O4LE 5JW5A 4G6KH 5BZWB 5D70L 1HWHB 2YD1A 2EDRA 3MRHA 1S5IH 3HMXA 4D9LH 2CKBB 3VGEA 4ALAH 4JQVC 5ICZA 2BDNL 1BZ7A 1FPTL 1KT2A 4E0RB 1OP9A 2OTWA 2NXZC 1NMAL 1Q9OB 1TZIB 1XIWB 5ID1A 4WHYG 1C5CL 1X5GA 1UC6A 3TVMA 4BM7A 3SE9H 5HDQL 1DL7H 2X4TA 2PXYD 2QSQA 1A1MA 2Z31A 3WJLC 3I85A 2NR6C 3PQYE 5EC1B 2IALA 3O2VH 5CINH 3VH8A 3IB4A 2OM5A 2WM0A 3MLYL 1F45A 1F58H 3EYOB 1Q38A 4GMTH 4YDJA 4LLDA 1UCBL 2P43B 2V7HB 1BEYH 2XFXB 1UKQA 1KGCE 4KJPD 2EKSB 3QEUB 4ORZC 1UWXH 3QUMH 1PFCA 1MIMH 3T0WA 3WXVH 1HZHH 4F7PB 4RMVA 1D9KA 4L8DB 2Y36H 3E6HB 3FL7A 3NZ8B 4OJFL 1D5BA 3MCKA 2CR6A 3DGGA 5TH2B 4ZNEE 3IDGA 3JV5A 3IT8D 2IG2H 3BW9B 3V6OE 4P5MA 1RZKC 4MA8H 4Q9CA 1OOAA 2FHBA 3KYOB 2DM3A 1Q9WB 4JKMA 5F9JA 2OL3H 2V7NB 3NCMA 2ITDA 3QJHA 3PGFL 5AD0B 1WSST 3BEVA 3ROLA 4OZGB 1U92A 3SE4C 3PV6B 5GRZA 3QA3B 3PL6C 4MJ6A 4X7SH 4YE4H 1N2RB 4HHAA 1WWAX 4ETQB 3CDGA 1I75A 1FLRH 3QWOB 3MYJB 5HYEA 4UV7H 5I17A 2QR0B 2H1PL 3W39B 2RB8A 4GXUN 1J1PL 4QRUA 4N90D 1B4JL 4LPXA 2P5WE 4X6EA 2A77H 3OXRB 3UTPE 3UJTL 4Q97A 5E2UL 3LKNA 4OSUH 2LU4A 3WXWH 5JIHA 3W82A 1SJEB 1DSFH 5TDNA 4BSWA 2VAJA 5IJKA 1DBJL 3TNMA 2FCBA 5IBUB 4YDKH 3VGFA 4Q9BA 3QDJE 5DRNA 4UUJA 4I0CC 4HBCL 3IRPX 3PHQB 3ARGB 3S37L 1C8PA 3VE0B 1KTLA 3LB6D 3PWNB 1LE9A 1E4WL 3NCJL 3RUGF 5KSUB 5JPMB 3MRQA 1RJLB 3M8OL 3LEVL 5FGBA 3X3FL 1FSKB 5IG7A 3GMOA 3QUZB 1RQ5A 3OF6A 5GGQL 5EWIL 4S1SL 3IXAA 4NNPL 4Y5VB 5C8JA 3MACL 3MUY1 2F74B 2CK2A 2D9QB 4L3CB 5KS9A 3VWKA 1VFMA 4FXGA 3TT1H 1AR2A 4IM8A 3TV3L 5JXEC 4M93B 3OXSB 2HFEB 4J3XA 3MA9L 1TJHH 3PWPA 3LQZB 2AK4A 1LVEA 4X9FA 1OQXA 5HDOA 3OTTA 4TVPL 2MNUA 4UOW0 2YN3A 1KN4L 3L5WB 3RZWA 5IF0B 1MWAB 2X4NA 1MCQA 2CR3A 2YK1H 1YN6A 1N5AB 1VFAB 2AQ1A 5D1ZA 1CFVH 1HDMA 3ZDZE 4YBLC 5CKAA 4YHML 4N8CH 5DI8B 2GCYA 2HTLC 3IXTA 4GW1B 5CJ5A 4HUVB 5EBLA 1P7QA 2D0HA 3E3QE 2EZ0C 2WK2A 1DLHA 2HH0H 1PBYA 4NGHL 4MS8C 5ID0B 3K1DA 2ILLA 4FQXC 1QRKA 3L3HB 3WJJA 4HV8B 2UZIH 1R5IB 4Z7NF 3MLPA 1NCCL 5A2KH 5KSBB 3GMNB 5HHXH 2PW1B 3B5TA 1IKFH 1JWMB 2ESVD 2KL6A 5LCVH 5KS9F 2IPUG 3QDGE 1JZ6A 1CIDA 1BFTA 3PIQA 5E5MA 2VXTL 3RGVA 1QSEE 3ARGD 2I5YH 2QQLL 3HCVB 1CDIA 2XXMB 3LOWA 5FCUL 4ERSL 2FL5A 1I1FA 4LLQB 2PXYC 4QRTB 2ZUWA 4HT1L 4OCSH 2CDEB 3GUTA 1D5MB 1JJUA 1WISA 2O5XL 3WUWG 1TFHA 4HBQA 1GOGA 3HPLB 3RY6A 3QUZD 1ETZA 3HFML 3SDAA 4R3SA 3QDJB 3VXNB 1QR4A 1D3CA 4WFED 5D7KE 1PGRB 3TF7C 4DK3A 1GIGL 3HR5B 4OKVA 3HRZA 4MNQE 1FVDA 1PG7W 2VE6B 5D1XA 5IB1B 1WBYA 4JPVL 4ZS7L 5DZOA 1BZQK 1QQDA 3C5JA 3MNWB 1P9MA 2OI9B 4X7TA 1MELA 1QNZH 3FTGA 4KY1H 2WBWB 4CVXB 1DDHA 2DN7A 2EE9A 4BQ8A 5LWYL 1BZ9A 1G7PA 2NYYD 2QSTA 3HLAA 1A4JA 3TN0A 1LO2L 5HHNB 5DC4B 1UXSB 3U0WL 1MRCL 3SKUD 1PG7L 5E8NB 1CDUA 1MAJA 5EO1A 2YUVA 1D5IL 1FFRA 5IMLB 1MLBB 1K3IA 2VDOH 3F12B 2AEIT 4UI2A 3QCTH 2F53D 1ROWA 1UVQB 3G6DL 1JZ4A 1ZA6B 4LKXA 2IWGA 3QEQB 3WD5L 3KGRA 2IAMA 1LO3L 3QHTC 4ZODA 3Q1SH 3T4YB 3AMLA 5CFHA 5BCAA 4XAKE 1HXMA 1IQWL 1RZJC 1JWSB 1QO3A 1XR9B 3K4ZA 1VGEL 3FB8B 2OSLB 2GTZA 5IEKA 5C92A 3QHZL 2Z9TA 4JAMB 4L8SB 3VJ6A 2X41A 5EN2A 1LDSA 4K3GA 3UTQB 4PLJD 4NN7B 2XQYK 4EQ3A 1N7ML 3ZTJG 1AQKH 2BC4A 4JM2A 5D7JA 1R3HB 4XWOD 2MCG1 3ZL4H 4ZUUA 4KK8D 2H9GB 4OFIA 1FYTE 3FO1B 1WIUA 4PG2A 2C7UB 1QG3A 1WWCA 5FECA 3DVGA 5SWZE 4NBYB 1Y6MR 3LB6C 4K8RD 1QSEB 2FYYB 4PREB 5DFVC 1UZ8A 2ENYA 5DVMA 5FM5M 3QNYA 4OGYH 1LE5B 2VRAA 1QACA 3MLVH 1CLCA 5JHLH 5K9KA 4A2MA 4WI4A 3H8NA 4KXZI 4L4VE 4MD5B 4WEMB 4JY4B 4G43A 1ADQH 4XCCH 4JY6A 1EEZB 1ZLUH 2X9XA 5IOPA 5DJ0B 4JQVA 4Q74A 2BOBA 3GMMB 3WLBA 1RIUH 1U8QA 4HMDA 1EH9A 3KLHD 4OCWH 1XCTA 4MNQB 2DQHL 4KJYA 2J8UB 1U58B 1CDYA 4KPHH 3WS3A 4P46B 4BUHA 3BI9X 3WJLA 4PPTA 7CGTA 2V2WA 1ZSDB 2VXUL 4GMSH 5C08A 1RUMH 2FJFB 3HZVA 3GRWA 3KYAA 2QQKL 4G7VH 4JQXC 4UAOC 5LVEA 2OTUA 4BELD 4JM2F 3QEQD 1KIRB 4OIIH 3ULVE 2VXSL 1H3UA 3NTCL 1P4IH 2PF6A 3O3BB 2HYMA 4F8QA 1TJGH 2EDOA 2Y07H 1X5IA 2J6EH 5INCB 2HJKA 3HZMB 5F7NC 3H42L 4BH7B 4LIQL 4LF3A 1ZGLB 5TJWK 1DBKH 4I9WD 4OF7A 3IETA 1R3LB 5GJTH 2A1WH 4IIQA 3L9RA 4PGDA 3FRUB 4DWHA 5DJZB 1VKXB 1SEBB 5EZIH 4AL8L 5DD1L 4HZAA 4QRRD 1K8IB 5HYJA 3SKNB 2E7MA 1AD9B 5I1DB 2YMXL 1W72A 1H5BC 3I3EA 3N1QC 4P9HC 2NX5E 4GAGH 5T1MB 3P73A 5E8DH 2LTQC 2XN9E 4NZTH 4U1NA 1GGCH 1GC1H 3GB7A 4U7KA 3BT2H 4K71C 2VQTA 2XNAA 3N9GH 3QNZA 3S88L 1MVUA 3SE4A 4F33A 3PL6A 3RWGB 5D2LA 2JJSC 3P11L 2FIKB 1N6VA 5EOQH 4XP1H 5SWZB 3DRTA 5DJ8B 3ZKQD 5IGXL 4X6CB 4YNYB 4HLZG 4K7PL 4XGZB 2EE2A 1G9EA 3PP3K 1YYLH 5FF6A 4HJJH 4RIRB 3HC4H 1JZ5A 4L4VB 3N85H 4HZLA 3PE9A 3CCHB 4I5BA 3KPRA 4OGXL 5ALBH 5I1CL 3DROB 3EO1B 5ERWA 5GRUH 2AW2A 1QHOA 5IHZB 4K2UH 4OTXL 2HG5B 1T80A 1FIGH 2UYLA 1JNNL 3M1BB 3U83A 5C0IB 1OLZA 3U7YL 1FE8H 1UM4L 3QQ3B 1HSAA 4FFZH 4OLUL 1I8LC 3RWFB 1LD9A 4Q9QH 4D9QD 1A7PL 4Z8FL 1R24B 4OD2A 1FO0B 3V2AR 3VD9A 1A4KB 4H25A 5FYKU 1S9VA 1AXTL 3MMEB 32C2B 3W0WE 1OAKH 1KIQB 1I8KA 1SBBA 3P9LA 5DHYB 5EBMB 3CFKA 5DQDL 3FAWA 4ZFOL 2CLRB 2NW3A 3VDBA 5C0FA 4LDEB 3GJFB 5MENA 5CSBA 1CQKA 4FZ8L 2DTML 4P4RB 4PJ9A 3QUXD 5JXEA 3V95A 4FQCL 2Y1VA 5D2LF 3QAZC 3WHXB 4N0FA 1CVSC 2J1KA 2XPGA 2GY7B 3RWCB 3MLTB 1L7TL 3S3PA 3STLB 4ZFZA 3TEUA 1MJUL 1Z5LA 2YUZA 4JKPH 4S1RL 1IT9H 3WNOA 3MO1A 2X05A 4FQIL 4NKOA 1CLYH 4MA1C 1WEJH 1QBMH 3MV9E 4OKDA 1BVKA 2UWEE 5GIRB 4QHLB 43CAA 4XWOC 3THMH 1EFXD 2R4SL 3T2NH 2H26B 4OB5L 3Q6FB 1ACZA 1P1ZB 4KK8C 1BQLL 2NX5B 4QT5A 4DKEH 3O6LH 2V5MA 4RAUA 4BH8B 1NLDL 4NQSB 4H26B 3I84A 4NO2B 3P0VL 3MV7A 4K8RC 3MFFA 4FQXA 4OCRH 5T1LA 1G1CA 2ATPB 5HSFA 4F2MB 4MAUH 2NTFA 3IDIA 4MJIB 1BQSA 1A9BB 4RBPH 2CGRL 3T1FA 9CGTA 1UKTA 4PV9B 2G9HA 3EYVB 1M1SA 2DWDA 3EYUH 4L4VD 3U9PL 1D5XB 5C86A 3NAAH 2OI9C 3NN8A 4LPYA 4W81A 4YC2B 3PWLA 4UMGA 3KLHC 2OK0H 2NY0B 1ND0B 1JN6A 3H9SE 3RNQA 1A5FL 1MFAH 1RU9L 4K3DH 2PXYA 4MHHI 4PJHE 5CSZA 3V0WL 1YMHA 2AQ2A 5HHPB 1ZOXA 4ODWB 1ZA3A 6FABH 5CEZH 1RK1B 5EULV 5L0QC 3QEHB 3VI3E 3B4NA 5DO2D 1C16A 1P7KB 3B9KD 3MRNA 4PJAB 1RZGA 4QCIA 4QGYA 2IGFL 3O9WC 3DO7B 7FABH 4M5ZL 5FHAH 5IB5A 3HI5H 3W0WB 4J1UA 3CUPA 1HKLL 1KB9K 5FV2A 3S36X 3U4AA 1ZAGA 2QHRH 2XTJD 4D94A 5F7WC 3RA7H 2L7UA 2O5ZH 1KB5L 2P8MA 4H1LB 2A73B 3GM8A 3D18B 1C1EL 3W9EA 2C3HA 2EO1A 5EU6E 2QADB 4TRPH 1RVFH 5HTSA 4CGTA 1MJ8L 2QBWA 1KYOJ 3LKOB 3EYQD 3X11A 1AO7D 4G42A 3HMXH 3FQXB 2L0DA 3TO4D 5D70H 4HS8L 2KZWA 3TIDA 3MV9B 5D96B 1NUNB 2BDNH 3PGCA 2HFGL 3QG7L 1B0WA 4OQTA 1XMWA 1TIUA 1NMAH 3U1SH 4Z76B 2VDPH 2VERN 4GUPB 4EI5C 1C5CH 4LEXH 5HDQH 4MJID 3N1GC 2CKBL 5C0GB 5JZ7D 1HI6B 4HGKC 5TE6H 4DVRL 3GM0A 5GRJL 2J5LB 2VXQH 4QRSB 5I8KH 2D03H 3IDNB 5F72S 4RA0C 1JWUA 2NY0D 3D1MC 3LEXA 5JLZA 3JWOC 1OAUL 4HKZB 1N0LA 1Q0XH 4ZTOL 5AG8A 3ZE0E 2VYRE 1XF4A 3L3IA 5F6IB 5IMKB 5GPRA 1T7WA 3CLFL 4KWUA 2VNCA 1VFOA 1Z9SA 3MA7A 1MFNA 4IOSD 1RD6A 3KWWB 3EOTL 3H9SB 2Y7QB 1AE6H 1ZHNA 2HT4D 4PJHB 1VFBB 3ZE2F 5H37H 5BS0E 3F7VA 3PWJB 3KPLA 3R1GH 1NFIB 5F93C 2XFXA 1KXVC 5HXMA 1DQTA 3CIQA 5KSVB 3GNML 1CG9B 2VLKE 4H88H 1JUFB 3EJYD 4JO2L 2APXA 3BD5A 4OF6A 2ZUSA 4GRWE 3QIBC 4R2GB 1UENA 3OKEB 4M6OL 5DDHB 4C56A 3PGFH 3QUXC 2ZPKL 1NBQA 1HHJB 1T1ZB 3L7FA 3HNTL 1OVZA 4JGJA 4AMKL 2P47B 4K94L 2N7BA 4JDZB 3BW9A 3CAFA 5FV1L 1ZEAH 5EO9B 3BKYH 4PJDE 3KYOA 4JQXA 1Q9WA 3FT4B 3LPGA 4U1SB 1QSFB 3C5SA 3CFCL 4TUKL 4JANA 3MV9D 1IEHA 1J1PH 2CO6B 1ZT7B 4LVNB 4OZGA 3TJEL 4F9PA 1KEML 2AXHA 4QYOA 1LEGB 3GMLA 3MV01 3MV11 4PRIE 4XBGB 2HTKD 1QP1A 1JGVL 1N2RA 4N1EA 1BM3L 4D9RE 3FO2A 1YC7A 3DI3B 5E2UH 1FL5A 1IM9B 5MENE 3QWOA 3MRIA 5EIIB 3HHRB 4JJHA 4F15C 4KKLD 3NVQA 2HFFB 5JNYA 3S37H 3OQ3B 4OZHE 4W68A 1GHFH 2BP3A 4F3FB 1U8MB 4XNQB 1H5BA 1BBDL 4NM8H 3UJIH 4B7IA 2Z0BA 2DQIL 1IAKB 5GGQH 4M5YH 2ESVA 5EWIH 5I8EA 3TGXA 2FD6H 3FQNA 2DDQH 3ORJA 3ARGA 2BVUA 5FXCH 3H9ZA 2R1XA 3LN9A 2EIZB 1U41A 3MLSL 5ILTH 1CE6B 2H32H 1T89C 4I0PB 1HEZA 1G0DA 2LQRA 1U3YA 2QLVB 3I6GB 2ZUXA 2JJSA 1KNOB 1IC5L 1T0PB 5DVOA 4PS4L 3QUZA 3MXWL 1T2QL 3X14B 3FQTB 4PRNB 1NCUA 1CLOL 2YUXA 5BMFL 5IIEB 4M1GL 4WGWB 1FZMA 1OSZA 1FNAA 3CFIC 4UIKL 2FJGB 3B9KC 4JGUA 1IGYB 5KBNC 1KN4H 3EDFA 4R2GD 4OZGF 5BS0B 4DCQA 1LEIA 4NNXA 3LKPA 4NN6B 4O9HH 2Q87A 2VWEC 2HFEA 1BQUA 5E56A 1S9XA 2XTJC 4NJAL 3E6FB 3LQZA 1LGVA 3WN5C 1JPST 4GRWB 4UT6L 1P4LA 1TJIH 4ZPTB 1NLBL 1NEUA 5FUZL 1MWAL 5SWQA 1VENA 5D7LD 1S7XB 1YPZE 1QSFD 1I8LA 3TC9A 3KPOA 3T09A 1T1WA 3EYQC 3DX7B 5GGRB 5HVGB 1QLFA 5IQ9A 1KJ2A 1HH9B 2F53A 1B4RA 2OBGA 1NMBL 3RL2A 3TO4C 4HUVA 2EEDA 4PJDB 5AWNL 1AFVH 1BGXH 4A6YB 3D0VA 3VFUB 2AEWA 4WTWA 3QYCA 4PJ8B 3EOBA 4HKBB 4GQ9L 5I1HL 1Q0YH 2XWBB 5ISZE 4H20H 4PRIB 2QQLH 3HZYB 4LLVB 2YEZA 1RI8A 3B2VH 5FB8A 1OF2B 3L7EA 1FNGA 4HT1H 5JZ7C 5E99H 1BQHB 2OJZL 3KPSE 3K3QA 2O5XH 3GSVA 3D6GA 4U4BA 2VZUA 3HFMH 3EO9L 4OFDA 4YC2C 5I8OH 1H9VA 3FCTB 3REWB 3RWDB 4GW5B 5HHQA 1TZHA 4KK9C 4OZHB 1GIGH 5SX5K 3SO5A 4IRSB 5HDBF 5FM8A 3HCVA 2V6HA 1UJ3B 3CX2A 3BDXA 4RRPG 1EHNA 2R1WB 2AJXL 4EDXB 3H9HB 4LVOC 5CHNB 2CDEA 4ZS7H 1A6WL 1AC6A 1XGYL 1YNTA 5FOBB 1K5NB 3HPLA 2PTTB 1T66D 4GT7A 2F58L 4L8BA 3T65B 2ED9A 4NRZB 4XCNB 3VXNA 3O3DB 2FGWH 3IJYB 4R7NB 5LWYH 2BOCA 4KMLB 3CNKA 4M6NL 1OQOA 1Q94B 4JZNA 2Q3AA 4P2RE 2VLRD 2F8OA 3DSFL 1U8PB 1A6UL 2VE6A 1MRCH 5DJAA 1RZ7L 3U0WH 2DKSA 3GSNA 5I71C 1T22A 1UKSA 3VFSB 3MNWA 5IB2A 3JTTB 1BJ1H 4G8EB 4LSQH 3IDJB 2CIIB 4CVXA 3O6MH 1S7QA 2XACC 3KPPA 3WD5H 1MHPH 1L0QA 1JZ7A 1RZIB 3L95B 2GEEA 4QOKD 3S5LG 3GK8H 3MJ7B 1B9ZA 4JQIH 2ZUQC 5KSBF 1DBML 2X1XR 1R3KB 1IQWH 4YDLB 4OF3A 1CGXA 1BD2E 4U6XB 3SDDB 3C8KB 2P8LA 3HC3H 3RKPA 1WZ1L 3QEQA 4JKKA 1SVCP 2D7TH 4CL7A 1YPZB 4PJ8D 1EEUA 2OJEB 3CVIH 2R23B 3O9WA 1N7MH 3DXAD 4JFQA 4EN3B 4Z0XB 3OKDB 5GS0C 2HTKC 2I25N 1JWSA 1PX4A 2AXFA 3DX9B 1BLNB 3FB8A 3I9GH 3G5ZB 4NQDB 4R96A 1HHKB 4QHNB 2W0KA 1ES0A 4KKLC 2FNBA 4WRLA 5EIVA 3T3PF 1X5ZA 4HIHA 5IJVB 3G5YB 3KJ4B 5ISZB 2E9WA 3ZHKA 4QRRA 4H5SA 1U3ZA 3WO3B 5LGHH 1K9TA 4IRSD 4K23L 4L5FL 2VDQL 3D39E 5TF1L 3NFNB 3KPSB 3FO1A 1EXUB 1TCMA 3HE6D 3T0XA 1MEXL 2C7UA 4YHZH 4AM0B 3BZFA 4G7YL 4WUUD 1W0WB 5HYFA 5JOPE 3LKSA 3U4BL 5KVGH 4EIZC 5F88A 5F9AC 4TSCH 4CRPA 3MGOA 2FYYA 3TYGL 2ATKA 4JRXE 4EI5A 1FZKA 4RAHA 2ZKHL 1A6AB 1GCFA 2VL5B 3QDAA 4KVCL 3HR6A 2DOCA 4RMTA 4X80H 2VXUH 4YXKH 1UA6L 5C1MB 4PG9B 3N0PB 1TETL 1DQJA 4GO6B 1JYVA 4YXHL 4Z7QF 4FQHA 3QFDA 2VXSH 1A02N 3NTCH 1SQ2N 3ARWA 1QRNE 2F5AH 4U1LA 5FCSH 5K9QG 1RUAL 1X6LA 1T20A 4AG4L 5C3TA 1ZSDA 2J8HA 3DV6A 5IFJA 3IF1A 4LIQH 2FJFA 3BHBB 1MAKA 3SDDD 1U6AL 4PV8B 4JFHE 1KIRA 4YWGH 3SPVB 4NZUL 4RA3A 5EH1A 2ADGB 2V9RA 3O3BA 3U7AA 1OAQL 2IH3B 5DD1H 4EN3D 4YK4B 1G9NC 2YMXH 3HZMA 1MREH 2DYPD 3GMRB 1ZGLA 4F37F 3UPCA 4NQDD 1VHPA 2XZQH 3QIBA 1V3JA 4GXUM 1YY8A 5HVHB 4LCCB 1JTTA 2NY3B 3QUXA 1IILE 1MHEA 3S88H 3RVVD 4XC3H 1AD9A 4LLYB 4HH9A 3G08B 3MXVH 1VFUA 3P11H 5EZOL 1B88A 5CD3A 3LAFA 1F6AB 1BVLB 1INEH 2DQEH 4LLUA 5DZLA 5IGXH 1EFXA 3K8MA 5CEXA 3BFOA 4K7PH 2J8UF 4W70A 4K3JL 3O6KH 4NYLB 3D39B 5HGHB 5DMKB 3FFCB 4CAGA 5BV7B 1H0DA 2MPAH 3G9AB 3QJFA 3SDYL 1WC7B 3HZKB 4TOYL 3U4EB 4OGXH 3BAEL 5EOCL 5CJBA 3N1MC 3FHQA 5DJ8A 5BXFB 3LPWA 4QHKI 5CZXD 1HNFA 1A6ZA 5I76A 3Q2CA 4JRXB 1JNNH 4R90H 3U7YH 2EXYC 3BIKB 3V5KB 1UM4H 4OM1L 1NH6A 1FVCB 4OLUH 1AC0A 1A1OA 5FGCB 1A7PH 4C59B 3RP1A 2R29L 1J0JA 2YRLA 1AXTH 3EO1A 3FT3A 4K3HA 4KUZL 4X4MA 4PLKD 4G80B 2HG5A 5EDXA 5FDWA 4I3RL 2VDMH 1LO0H 4NZDA 3GIVA 1EUTA 1G7HB 1T89A 1X7QA 5C0EB 4FZ8H 3TO2B 1FO0L 3BISA 2DTMH 3RWFA 4XXCC 1HILA 5IESL 2DMCA 5HY9A 4ELMB 2FBJL 2IC2A 4DGVH 2DD8L 1RMFL 2V2TA 1CXFA 3MMEA 3QDMA 5B38G 2E27L 2WUCL 5DHVH 3MODH 4PP2A 3ULVL 5DHYA 5BO1H 4I3GA 1MJUH 2FATL 3B9KA 3ECBA 4RFEA 3VG0L 5ABDE 1DN0B 1J7VR 1M7XA 2R4SH 1BQLH 2DTSA 3LN4A 4KKNA 1YMME 3RWCA 3WN5A 5CAYB 1Y6KR 4KMQA 4PB9L 4X6CF 1NLDH 3BWAB 3TYFB 1GGIL 1EAPA 2BX5A 1OM3L 3HA0A 3LRSB 2YD5A 1FDLL 2H26A 4UNVA 1UB6B 3G5XB 2AJYL 1AO7A 1AQDA 3TO4A 4U1JB 3FFCD 3WEXB 3HE6C 5ELIA 3MSPA 5BQ7A 4X9GA 1E4XI 3KXFD 3Q5OA 3R8BB 4NQSA 3BP7B 2DQGH 4XMKL 4O4YH 4G5ZL 1N5YH 2B5IB 2NXYD 2F15A 2X1QA 4WHCA 3IGAA 2H6PA 2NLJA 4XRCB 1MFEL 3QCUL 2FX8L 4X5LA 2DQDL 2JB6B 3IFOA 4MJIA 5DFWH 4PV9A 4WENB 1IJ9A 1D5XA 1OGAD 3MRBA 1QR1B 3TCLA 3HG1E 3OKOA 4OZFB 1S7TA 1XGTA 5B39G 3IS1X 5A2JH 4LSPL 1J0IA 1NEZB 1ND0A 3WNLA 4PJGB 2JB5H 2YPKA 5EFIB 5D7SL 4GRMA 4K9EH 1C5BL 4ZQKA 3BVNB 2CLVA 2ZOLA 3M17B 4X98B 4YHOL 4OI8A 3QXWA 4P4KB 1VPOL 1HKLH 5E94A 4KQ4L 3SDDC 5B8CB 1BPVA 2F54E 1ZT1A 2AKRA 2W38A 2Q6WB 2AV1B 4NPYB 4PIRF 5F7FA 3NA4A 1J86A 1P7KA 2X70A 4MYWB 1C1EH 1NANI 4PJAA 1EDQA 3W5NA 3QULA 3DO7A 5F44A 3DETC 1MJ8H 4Y7MA 5FO9B 1EMTL 5DTFB 1J1OL 1LILA 3M07A 3WFBH 3VFPB 4H1LA 2XZAL 3D18A 3DUHA 3HE7B 5EUOE 2X42A 2BSRB 4WU7B 5DGQA 3JXAA 4ZUTB 3QG7H 3RVVC 4L3ED 1JZ3A 1S7SB 3LKOA 1NUDA 4XPBH 4WHTB 5EOTB 4K55A 1YMMB 5L7XH 4M9OA 4MNGB 2VO5A 1PZ5B 2CKBH 1NBZA 3SKOB 1J18A 1RJYB 3DVIA 5GRVK 5F1NA 4ZFGH 5GRJH 1VEMA 3QBTB 1CTNA 4DFHA 5GZNC 4GKNB 3JSSA 2GUOB 4KXZH 5F96H 5IROC 3OKKB 1JGDB 1UCTA 4I4WB 5DC0A 1NGXB 3UO1H 4HWZA 1WZKA 2AGJH 2X9YA 4DKAA 1F4XH 4F7MB 1SJXA 3UZEA 1M71B 2ZUVA 3CLFH 5F3BB 3BKMH 2EH8L 4QRSA 4PBVC 4PJAF 1UG9A 4UOJA 3OJDB 3UBXA 4DW2H 1TVHA 4KQ3H 1QFWM 4Q6YA 2VIRA 1A3LH 5DQJA 1JZ2A 2BVQA 2I9TB 4KU1A 1XCQA 5JIIA 5TPWL 3GNMH 3HG1B 5IMKA 3P0YL 3QRGH 3E8UL 4XNYL 3QXAB 4YFEA 4P4KD 4JO2H 3K2UL 5D9SB 1IGCL 1IGFH 1H15B 4TPRH 3ZDXF 3P9MB 2Y7QA 4RQQA 4M6OH 1E6JH 4M7KL 5E2VL 3OR6B 1S78D 4LHUD 2ZPKH 4GLRI 4FZEH 1JF1B 1I85C 1L0XA 1MI5A 5INDB 3CDFA 1JUFA 2F54B 5FK9A 4YR6B 4G9FE 1I7UB 3C5ZB 1U8IA 5HVHC 4BKLB 3FJTA 2NZ9D 3OKEA 4YHKH 5DDHA 3SHSA 1WIPA 2D0FA 4NQTA 3HE7D 5T1DL 5FYJE 4X4ME 3TJEH 2R2EB 4P5KA 4QY8B 3CLEL 5C70A 4QHUB 3VFTB 5EO9A 2EDEA 1AGFB 1J5OH 2BJML 5D7LA 2YKLH 5EUOB 1QSFA 1HHIA 1KULA 1EO8L 4G6JL 3ZSTA 4JO4L 3U0PB 3QDME 4F9LC 2Z92B 1F3JA 2IADA 1CQYA 2GITB 3S3JA 1OAXL 5IVXB 5E7FA 4CVUA 3KLSA 3VGAB 3H2WA 4OUUB 1YEJH 2DQIH 2B2XH 2NXYC 5JOEA 3P9WB 3G6JA 1OAZL 3CFEB 2HFFA 2C1PB 4LKCA 3BIBX 1SMAA 3ZKND 2VQ1A 1P7HL 1NCBL 3JVGA 5MEPB 4XP4H 4ZD3L 4F37K 1MQ8A 1KEGL 1U8MA 4XNQA 2FSEB 5CZKA 4L29A 2APBA 4Y5XC 4PS4H 1MJ7L 3MXWH 4FP8H 4Q7DA 2ZCLL 1AY1L 1CLOH 4WFHE 4BSJA 2AS5M 1RZKL 2BHYA 5DJ2B 3ZE1F 3ULSB 1I9EA 2IPUK 3I6GA 1KNOA 5F9WC 1U0QA 4WW2C 4NJAH 3T77B 5IIEA 4IJ3C 2F54D 4UT6H 4LARL 2EYSB 1NLBH 2X4QA 3CSGA 3C6LC 1IGYA 5J13C 1MWAH 3DBXA 3LKQB 2P5EB 2VLRA 3O45B 4MNHA 4CVZB 5MP6H 1UB5B 2VMFA 4PYHA 3WIIL 2VN7A 4CN4A 3BP6A 5DMJB 4R97B 1IC1A 4G9FB 2BVEA 1WF5A 4WDIB 2FWOB 3G6JF 4ZPTA 5EU4B 3BEWB 5SWSB 3F6LA 5HI5D 1K4CB 4QOKA 1JYNA 2BHUA 3VXSD 3QWRD 1LEKB 3V4UL 5IB3B 5I1HH 1BJ1J 1BP3B 4XXCA 4LCIL 1WVZA 1MHCB 5IW1B 4AT6B 4Y4FC 3OHXB 1AHWB 1CFNB 2R9HD 2G75B 4A6YA 2OJZH 4EOWL 4PJ8A 1QPXA 3QXVA 2W0FA 3DMMB 3EO9H 3IU3A 2CK0L 4GBXB 3ILQD 5FM4A 3U9UA 3DXAA 1MF2L 3VFRA 1W0VB 2ZG1A 3ULUE 2X4OB 5E0QA 4QNPE 3L6FB 2CXKA 1DEEA 5CEYB 4PRAA 3ARED 2AJXH 4AYFA 2IH1B 3C9NB 1IAOB 2ERJB 1DE4B 1T04A 1TQCB 1NUFA 1P2CB 4FQ1L 2VZ3A 1E28B 1J8HE 1XGYH 2V9QA 2OQJB 2NY2D 1TTFA 3QZWG 5DC9B 5EA0L 5HVFB 2F58H 1EIBA 2V5RA 4I2XE 2WUBH 3RWDA 2VUYA 3L3OB 4GW5A 3RGHA 5C09E 3CZFB 3ABZA 4IRSA 4M6NH 5CUSH 1RZFL 5CS7A 5JOFA 4EDXA 3DSFH 1A6UH 3BMWA 5CHNA 1RZ7H 3HE6A 3QXDB 4OLZH 3JV0A 3PJSA 1K8DA 4DGIL 3U7WL 4F80A 4WUUA 2PTTA 1U91B 2HP4A 3L3DA 3WDIA 1YA5A 2EYRB 1FV1A 1VERA 1ED3A 1OGTB 2FJHA 3EGSA 1N0XH 1UH4A 4LEOB 4RGMC 2YN5A 3MGTB 4NWUL 1S78C 3JWDC 3UEZA 2CRMA 2P5ED 4UTBL 3RL1A 2EDLA 3BN9D 1XF3A 1DBMH 4OIBA 4PJDF 2O5YL 1NCNA 1PKQE 3S4SG 2W59A 1T2XA 4QHMA 1QA9B 3QQ9D 4OCXL 2A9MH 5GS2H 2A83A 2Q86B 5DJ6B 5SWSD 4FN0A 3TCXA 1RZIA 4Z18A 3EFDL 1KCUL 3S98A 3ARBC 5GSRB 5B4MD 3GI9L 4JFDB 4XPAL 3MJ7A 5AZ2L 1ITCA 2DWEB 3CK0L 3ME0A 3EOAA 5CLTA 3OR7B 1R3KA 3OZ9L 3ARFD 1EGJH 4HS6A 5EORH 5I66A 4R6UA 3SDDA 3C8KA 1T0MA 2A0LC 3V0VA 4M4RA 1G6RB 1HXYA 1MI5E 1WWWX 3DMMD 4GBXD 2Y72A 3TBTB 1TQBB 3LN5B 2AI0H 3FN0L 2DYPA 4L5FH 2VDQH 2EDNA 2Y5EA 5TF1H 3GSWA 4NQDA 3O0RL 4MDJB 5DD0H 1HHKA 4OLXL 4QHNA 3QO0B 1FGVH 1IEAA 4F7EB 1PQZB 5IJVA 1BOYA 5DJCB 3RIAK 4X5WA 2Q7YA 5E8OB 3ZKNC 3OB8A 1N64H 4Q2ZB 3ZZ1A 1L9MA 1G1YA 3H7LA 4Y1AE 4ONGL 1J8HB 1I7ZB 3IAPA 4KVCH 4NIKB 3RPIB 1BIIB 1Q9LB 5JXAL 4I2XB 2BY3A 1UXWB 4HFUL 5C09B 3MBXL 2C3VA 3H9YA 3A6CL 3NOIA 3CGTA 1TETH 1T5WB 1U8LA 3JWOH 4GS7B 4XBPA 1S7RB 5IROA 3UP1A 3MBED 1YEHH 3WE6A 1FNSL 1I7RB 1RULH 4OQTL 1A6AA 1T1XA 1INQA 1RUAH 4KKAD 2J12B 1HIML 1OARL 2PYEE 1RZJL 4OM0H 4S10A 1XZ0A 2X5PA 4PG9A 4U6TA 4NKIL 3QO1B 4ELKA 3MRKA 3LS5L 1U6AH 1IBGH 1H3PL 3BYYA 3QPXH 5GHWH 2BNQE 1GPOH 3BN3B 4NZUH 1A22B 4XZUB 4JFDD 3UAJD 1OAQH 1ZVSB 3FOMB 5F9OH 1PKQB 4IOIA 3SDXA 4XPTL 3GZKA 3IJHB 4TTDD 1NCWL 5HI5C 3VWJC 5E9DB 3P40A 1EBPA 5K9OB 5FM5O 4PJ7A 5DHXB 2VQUA 4H8WC 3PWVB 3CXHK 3UPRB 2B7DT 2ADGA 3RTQD 1I85A 1U3HD 5ADOL 2P46B 5IK3B 2R9HC 3TZVD 1MCRA 3IFLH 1VACA 4LMQI 5EU7C 4I3SL 2NTSP 3ILQC 4X8JB 4UILL 4N8VB 5I74C 2VZVA 4O2CA 1F90H 5DJDA 5EPMB 1CIUA 3AREC 5E6IB 3VXPB 3I02A 1X4XA 4LLYA 1BWWA 2ADJB 3KPQA 3B9EA 3G6AB 2NY2C 2V2XA 2VXVH 5HYSG 5DK0A 2DL9A 3SDYH 4RFOL 3DHJA 2AEQL 5C6PB 1BVLA 4IS6A 1PYWB 1QYGL 4LCYA 4PTTA 5I2IA 2C4XA 3JV6A 2CD0A 5BV7L 2HKFH 2YUWA 4JLRB 4F9LA 2ICWB 1I1AB 5HGHA 5H2BA 2Q76B 2FRGP 3O11A 4NO5B 4HWBH 4FQQA 1M05B 4R0LB 3IFPB 3KXFA 4KI1A 5CJXC 4Z95L 1WC7A 3HZKA 2K7PA 2R29H 3KPNB 1SJHB 4OD1L 4KUZH 5HPMB 5GSVA 4OFPA 2PO6B 4PJ7F 4MQSB 1FFNA 1RURL 3MRJB 4M43L 1G7LB 4JG1L 3V5KA 4EUPA 1WFOA 2EDKA 2QSVA 3V5DA 4JFYB 4W6XB 3WO4C 3MV8E 1FO0H 3BN9C 3MLWL 4YIQA 1M6OA 1Y0LB 1OGAA 2PYEB 4BZ2H 4Y5XA 1C08B 4V2CB 3MGAA 3QQ9C 3BPOB 5E95B 3FQUA 2E27H 2WUCH 4P9HL 1JNHA 3ULVH 2WBKA 5CZVL 1IFHH 1CL7I 2BNQB 2IEPA 3GJFH 5E9DD 3NGBB 4G6FB 4I48B 1HQRB 1G7HA 4M1DL 4NQCA 4OD3H 2XG4A 4KTEL 3KAAA 5TGBA 3ARFC 3QEGH 5I1GL 3MYZA 2ZCKH 4WW2A 3INUH 2GJJA 4ZO7A 3S97C 1JF6A 1AH1A 1C12A 4ZUVB 3L3GA 2APVA 3AS3A 1GGIH 4OLYL 5CP3A 1OM3H 4CMHC 1KPVA 3OAYH 3SO3B 4QTIH 3VRLF 3TWCL 4HUWB 4QKXB 3VRJB 3AS2A 3KS0H 3OB0H 3VH8G 5DT1H 5DEGB 1PX3A 5CBEA 3O2DA 2M1KA 2FECI 4B5EA 1QPPA 1YEEL 4JO3L 3BWAA 3PABA 2UZYB 4ZYKA 1O5DT 4XMKH 4WTXA 3STBA 1JCKA 3VRIA 4J3VA 4LGPB 3ZSSA 3WFZA 1JE6A 4L3EA 1A47A 3LRSA 1MFEH 1JHLL 1UB6A 2R2HB 4G6ML 1RJZB 2FX8H 3G5XA 4CADB 5LJYH 2DQDH 4O51B 3IYLW 5F6HI 2YPVL 5DUMH 3MOBH 1FH5L 3WEXA 2YZ1A 3FOLA 4RFNB 2EC8A 2F5BL 5DK3A 4PJEE 2OXGA 5J1SC 2YC1A 3OX8B 5ACMA 1CR9H 4MB3A 3BP7A 4NQXB 2RCSH 2CO7B 4NFDA 2CQVA 2PO6D 3CFBA 2FBOJ 3VFNA 4BFIB 1TDQA 4N0YH 3MBEC 1NDGA 5FKPB 4XP6L 2BFVH 1H3XA 4Y4HC 4ELMF 4YBQD 3HKFA 5D7SH 2AJSL 1C5BH 3U0TB 4KKAC 1T4KA 4Z7VA 3L3KB 2J3SA 4YHOH 1JGEA 1KCSL 4QXUL 5C7XL 4ODVL 5GRVL 1QR1A 1Z9MA 5GQBA 5JR1H 4OZFA 4UQ2B 2HJFB 4KQ4H 5IMMA 4BYHA 2HMID 3CVHA 1NEZA 4KGLA 4AY0A 4WWKD 2VDLH 5J11B 3QIUB 5D93B 4HD9A 5JORA 4G6FD 4L4TB 3A67L 4UT7L 3UAJC 4ODXA 2KPNA 5ICYB 3M17A 3UTSB 1PSKH 4PRHB 3REVA 3UZQA 5B3JE 4P4KA 4KH2A 5I75B 1RJCA 1XF2A 5B8CA 3UMTA 2A74B 4JFOB 3KJ6L 5CBAA 2XZAH 4FTVA 4DEPC 5C0AD 1WUNT 4LHUA 4JZJC 4PJIA 2WWMD 3A0OA 5K59E 1T2JA 3RTQC 1DEDA 1U3HC 1EA9C 2VLMD 2EDJA 4F7CB 3TZVC 4WO4B 1AJ7L 1JFQH 4X7EC 1KLUB 1NMCB 3UXFA 1F02I 1RUPL 3TLRA 4YH6A 2HRPH 2G5BB 2X4SB 3HRPA 4HMCA 1FFPB 4NDMB 4HIXL 4FMFA 2X1OA 2YD3A 5FYKE 1WBXB 1JIBA 3SDXE 3HC0A 4P3CL 1NC4B 1NGPL 4Z7VF 1MH5A 5DQ9B 2AJZA 3PWUA 5FYLD 2PTUA 1N6QH 3TESA 2ZUYA 1PZ5A 2ARJQ 2H41A 4FFWD 1JRHI 1RJYA 4DN4L 3SY0A 4RNRB 4PJGF 4LAQH 5IV2B 3NH7L 1QBLL 2IBZX 2EH8H 3Q6GL 1U3JA 4GS7C 1F11B 1NDMB 3OKKA 4Z7UA 2B0SL 3PNWA 3HNVL 4HFWB 5IQ7H 3AMKA 5TDOA 3WIHA 3EYFB 4PJEB 1A9EB 3TNNA 4PJXA 1IKNC 3RWHA 4BSVA 5H94B 3VXRB 3DRQB 1A6TB 3E8UH 5D72H 1HQ4B 5BVJB 4FFYL 1FZOB 5ITBL 1A7RH 5EZJB 2VC2L 3CZJA 1YQVL 4D8PA 1Z6JT 5C2BL 4AEIL 3CX5J 3AXLB 2ITCA 3DV4B 2HVKB 2BVYA 1HYRC 2J8OA 3AM8C 3BYTA 3QIUD 4I18C 4M7KH 4L4TD 5KSAB 4TVPE 4EVNB 4QTHB 3UTSD 2WMPA 2E8YA 4PRHD 3VXQB 4N9GB 3VW3H 3VG9C 2GJ6E 3P9MA 1ZHKA 1BFVL 4Y89A 3QUMA 4MA3A 4DFIA 5T1DH 2ZNXA 3ZYIA 1RUKH 3BDYH 1QLRB 2YD4A 1KCVL 1TXKA 4LSSH 3NCEB 3H0TA 5B39A 4WY7L 1ZT4A 2DQTL 8FABB 1KENL 4LCWB 4TSAL 1MFCH 4JHAL 4D0DA 4G6JH 5SV4A 3BPNC 4JO4H 1S7WA 2R2EA 1IGML 1P53A 4QY8A 2OL3A 4E41B 3VFOA 4HX1B 1GC1C 1F8TL 4FXKB 1MPAH 4WV1B 2XYCA 1DQLL 4NQCE 3VWJA 1V5JA 3VXSA 5CWSB 1TZGL 1FHGA 4WW1A 3O81A 3R8QA 3T0EB 1OAZH 4PY8J 4R4FH 1IE5A 2DIBA 4GRLB 1KTDB 1F13A 1NCBH 1CK0L 5BRZE 8CGTA 5DJXA 1DZBA 1ZMYA 4NRYB 3DIFB 3E0GA 3C2AL 4ZUWB 1QEWA 2LE9A 4R0LC 4J6RL 3MNVA 4OUUA 5KANG 1SEQL 1YN7B 3ARDB 2MJWA 3CSPA 4YHIA 1HCFX 1JHKL 1MJ7H 1FNEB 4OLEA 2FX9H 1Y18A 2ZCLH 3VXRD 1AY1H 1RHHA 3GFUA 2MQ3A 1I9JL 4P2CG 1CGTA 1FAKT 3IFNL 4Y4KD 5A2LH 4YBQC 3AREA 5MEPA 5I0ZA 2GSGA 2ICWI 2Q3ZA 5M7QA 2FSEA 3K8LA 3S5LB 1SYVB 4YUEH 2MTPA 1EAJA 3CC5A 5CD5C 5HGBA 4ODTL 4AQOA 4WWKC 3NGBC 2A6IA 4GW4A 3GJEB 4OF5A 4NT6B 4H0GA 2YA2A 1GGBL 3ULSA 2X44D 1R3JB 2XA3A 5CJXA 2XRAH 3WIIH 4HC1L 5IMOB 1OTSC 2ICEA 1H3WM 1CL7L 2C1OA 4GRWH 4JHZA 4OZIB 3HN3A 2VLJA 2GJ6B 4XP5L 3QFJE 2P5EA 4LCWD 2WWMC 1SHMA 2XA8L 1SMOA 2OCFD 3KYNB 3CH1A 5IVXF 3TA3B 2EDQA 3O8XD 4LCIH 5L2KE 4KHTH 1PDKA 2DI9A 4M7ZB 4XT1C 5ACLA 4E41D 1CS6A 2QQNL 1S8DA 1AXSA 2VISA 4XNMA 4P23B 4WDIA 2FWOA 3W5MA 3NFPB 3DUSA 5FYJL 2FHCA 3QG6A 3TT3H 3EJZD 5D2NC 5EO0B 2FECL 1HOCB 1MF2H 5JHDE 3T0ED 1UH3A 3ARFA 4HK3N 1GH7A 4GRLD 3X13A 1E4XH 3QUKA 2Y6SC 3P4MB 1CFNA 4FTVE 2HT3D 4Z0BL 2G75A 1AKJB 2XWJB 5DWUL 4FFWC 1M7IA 4GKZB 3A6BL 4PJIE 1KFAH 5EA0H 2MWCA 1I4FA 1ZS8A 2R2BA 4GBXA 1TPXC 2WW8A 5E6YA 4FNLH 4M8QA 5BRZB 5IR1A 4JRYD 1FNHA 5CEYA 1CXHA 5F7DB 2R4RL 3PUCA 5JTWA 1P2CA 1L6ZA 3U7WH 4DGIH 2ZSWB 2P8PB 4XCFH 4P2OB 1UM5L 4GG8A 1G7QA 2HWZL 1LNUA 4BA8A 5IM7A 3FO9B 4EI6A 3C8DA 4NWUH 2X4RB 4WGVB 2D31A 1PLGL 4Y19D 3I75B 2MHAA 3S9DB 3QXDA 1U36A 4LSVH 3KPTA 5T3XE 2H2SD 3CPLA 2R8SH 2GTWA 5DS8A 1OP3K 4OBSA 4APQB 5IW6A 1J0YA 4Z7UE 2MSPA 1MCSA 1OGTA 3LS4H 1CD1A 3MBEA 1ULVA 2YPLE 1R5WA 4Y4HA 1CLZH 1KCUH 1TTGA 3GI9H 1J0HA 4XPAH 1CF8L 1WAAE 4HMEA 4JFXB 5IKCA 3TA3D 2ADIA 2AP2A 5F8RC 1I8IB 3OZ9H 4JFFE 4YAQB 3O3EB 2BHZA 3DSNA 5FUCE 2Y5TA 2FZ3B 3BH8B 1UYWL 1IVLA 2FGZA 4AH2A 1EHXA 2Q86A 3QFJB 4P23D 5A16B 5DJ6A 3V4VL 4XWGL 2GT9A 5MEQB 1T3FB 5GSRA 4M61A 2DBLL 1LO5B 1T21A 4JFZH 1HNGA 4JFDA 4XBEH 4L9DA 3C09C 4XVSH 3LEYH 5F1IB 5L2KB 4OCYL 3VI4E 5C0BE 4IOFD 3KR3L 4XHJD 2YA1A 3JV4B 2NQCA 2Z8VC 4KGJA 1JPTL 4NUGL 3H3BC 4OLXH 1G6RL 3BKJH 2VAAA 2C3XA 4TQEL 3GGWA 4Z7OF 1X9QA 4JFED 4LASL 2PR4L 1MFBL 4JZJA 5JHDB 1AD0B 1G0XA 3RTQA 1U3HA 3BIAX 1YQ2A 3ROOB 1RUQH 3TZVA 5C71A 3GSOB 2DQCL 1N59A 4V1DB 3D3VE 1JRHL 4XPFL 2LAAA 4WEBL 3GSRB 3HAEH 4PBWD 3MREB 5JXAH 3QO0A 2W65A 2DI8A 1FFQA 4JPIA 1VADB 4HFUH 4K3EL 4EXKA 4XPGH 4IRJB 4RZCA 4Y4KC 1CD9B 5GS1C 3UTTD 2COQA 3RZCB 5FKAA 3D69B 5F7EL 4O58L 4OI7A 3MRMA 1FNSH 3PHOB 1I7ZA 3FQWB 3ZKMC 2BVOA 3V6ZA 1AGBB 2YD2A 1BIIA 1CGSH 2PUQT 2BMKB 4N68A 4J2XA 1FVEA 3BRFA 1UXWA 1T6VN 3K80A 5IHUH 1KCRH 4MSWA 1D6VH 2I60L 3ZKXB 1I8MB 1T5WA 5AYQA 1C5DB 5B38B 1ADQA 1MRFH 1GZQA 1R5VB 1I3RB 1H3PH 1FRGH 1KPRB 1S7RA 3DNKA 2EDDA 1I1YB 4GLRH 1CN4A 4RMQA 3PDDA 4NQVA 1S9WB 4NRXB 4PJFB 5EOCJ 3RVXC 3OKNB 2I07B 5TE7L 5J1AB 3P0GB 1IKNA 4MCZA 4X5XB 1QSVA 3GO1L 3QZWA 5GS0L 3KLAA 4XPTH 2W9EH 2YD7A 3DX6B 5I1JH 3F58H 1IGTA 5IBLD 3HPJB 5I1EL 5D7IA 1NCWH 2DIAA 3HUJA 3BH9A 4U6VL 3VXOA 4NQEB 1JNLH 1FL3B 1NCAH 5L88L 5EZLB 4BJLA 2X4PA 1EVTC 3AM8A 5M94B 4UTAH 2E8ZA 2P7TA 3O8XC 4XNUL 1FJ1B 1ZVSA 3R0MA 4JFFB 2NW2A 1KXTB 3QR2A 3CFDB 5ADOH 2Q8AH 2NZIA 4UZGA 4YXLH 3W9DB 3MFGB 5DRWB 3RWJB 5E9DA 5EC2A 1D6EA 3L5JA 2J6EA 1RFDL 3ULUF 3TH2T 4Y2OA 4ZOBA 3EJZC 4K7FA 2MOVA 1WCBA 3UPRA 4MQTB 3U82B 2VLJE 4ZNCD 4OCNC 1JPSL 4S0SD 1TNMA 2HT3C 3I2CH 4KRLB 4V1DD 5AZEL 4XCEB 1JGLH 3Q3GA 2B1HL 3TBWB 4X8JA 5LAXB 4DZBA 3WYRA 2A9NH 5FA4B 2CXGA 5EPMA 5F8QC 2BRQA 4IRJD 5BV7H 1CFSA 3VXPA 3D3VB 4NO0A 1BAFL 1FL6A 4RGNE 3X12A 2ADJA 4NSKB 3G6AA 4N0CD 4Z95H 3IDYB 3RU8L 3MRPA 4D0CB 4PGCB 3HUJF 3KS0J 4U6YB 2LAGB 1NGYB 3TBYA 4JN2B 1PYWA 1RURH 1X6NA 5BZDB 3CSYA 3DVNA 1S7UA 4M43H 2WBJB 4JLRA 1J1XH 2AJ3B 3MR9A 3EAKA 4R0LA 3MLWH 2ICES 4C57C 2O26U 1MCWM 4M62H 3GSUB 4HJGB 1PJ9A 1UWEL 4PP1C 2V5SA 3VXTB 2EICA 3MRJA 4X6BB 5CZVH 4MVBD 3QNXB 4CUCA 2XWTB 2ED7A 3BP4B 3BQUB 4NQED 2BVPA 2XZCH 5MHSE 3JZ7A 4M1DH 4ZPVA 2H2PC 1N8ZB 5EU5B 12E8H 3TA3C 1UWXK 3SEPA 3I6LD 5DD3L 2ZOKB 1KYOK 4P23C 4WUKL 4WWKA 4G9DB 3ZTNH 3EOYG 1XFPA 4OLYH 2BZDA 5MI0B 2D7OA 1HQRA 4JDVB 4G8GE 5DHVB 2BNRD 2EDYA 3TWCH 1U2HA 5FO8B 5M95B 3HI1B 1H8OA 4IOFC 3V7AG 5D6DA 4XHJC 4WHYH 3LMJL 2YXFA 2HN7A 3KG5A 3GI8H 1YEEH 4KTDH 3VGHA 5IEHB 1R0AH 2EDHA 3FO0L 5C0AA 1ORQA 1A2YB 4LSUL 3MPCA 1MHHB 3BPCB 4FQJH 4URTB 2R69L 4P2YA 5DYOA 4HJ0D 3QI9B 3T04D 2DJ4A 4OAWA 4LBEB 5AUMB 3S37X 3FB5A 1RPQA 4KVNL 2FDBP 5EBGA 3MLUH 4XH2B 1X5FA 4XHQA 2DQUL 2ORBH 4NHUB 4LU5H 2VDNH 5D2NA 2OR9H 2VUOA 1ORSB 1I1CA 3RBGA 2WBJD 4O51A 1A0QH 4BZYA 1SYSA 2AJSH 5AAWA 4HKJA 2X89D 2X6MA 4OZFH 4QXUH 4DTGL 1T03L 4N0UA 5ACZA 5K9QI 5A40E 5I6XC 1S3KH 3GMQB 1IQDB 5FKPA 4Y5YC 1N3NB 4ZXBD 1U8KB 3BQUD 1G7IA 1NFDA 1J0KA 1VESA 1XGRA 4UT7H 2E9IA 3MJGX 5HHME 4PJCA 1V7ML 3ARYA 4U1KA 4UU9A 4NO3A 2IAMC 2IANE 1V3KA 2JELL 3S35L 1Q9KB 3NPSB 1FBIL 1NAMB 1NSNL 3QDHA 5CIPB 5KJRH 3HB3D 1IM3A 3KPMB 5E08L 3K81A 3MQIA 3JWDH 5I1LB 4S2SB 3QIUA 5TQ2L 2NY4B 3C6SB 2D7MA 4L4TA 4M03A 4Y16B 4UIMA 1KB5B 4Z7WE 4JPWH 4PRHA 3AU1B 5BJTA 3PG2A 3VDCA 4XXDB 1YEIH 5F7YC 1FFOA 3QQ4B 4IMLB 4O2FB 4L8CA 4ZO9A 4LHQB 5ANMA 4AIXA 4HIXH 4G8GB 5DK2A 5TDPB 2C4FU 5DUBB 5C6WH 4PR5A 5AYUL 1KELL 4MXVE 4RMSA 5IBUG 2BSSA 1DQML 3JTSA 1CE1L 4KROD 4JE4B 1KBGL 1NGPH 5D7IE 1IEBB 4Q6IC 3H7BA 4HK3J 4XMPL 2A6JB 3QI9D 3U6RB 4J8RA 5DUPL 1FFPA 3MOAL 1Z9OA 4NC1E 5I1KL 4PGEB 4NNYA 3RWIB 3NACH 3NH7H 3F5WB 3MLRL 4R4BA 5CP7B 1NFDF 5E7BA 4YFDB 4EQ2A 3BPLB 4PJCF 3BO8B 3WIHH 3EDDA 2EC9U 1BOGA 4PYGA 5DQ9A 3O6FB 2NY7H 1RAMA 3F7RA 3D0LB 3DOSA 3EZ8A 1JVKA 2J4WH 1INDL 2XI9A 4LSTL 3GKWL 5DRZA 2FR4B 3VXUB 4GG6E 4FFYH 1WIOA 1HHHB 4P2QE 3TIEB 5ITBH 2VB5A 2VC2H 5KG9A 5KN5B 4ODBD 3LIZL 5C2BH 4FA8A 5T1KB 4P57B 4AEIH 4PJ5D 3T4AB 4ZOAA 4HFWA 1FN4B 1F4WL 4HG4K 5I73B 2X40A 2P24A 1VB9A 4HUXB 5A43C 4ZS6D 3VXRA 3DRQA 3SOBL 1M7DB 3L5XL 5JDSA 1WFTA 4MVBC 2E5EA 2PN5A 4Z78B 2OLDA 1PG7X 4Y4KA 1KOAA 5GS1A 4QHKJ 2BY2A 2Y06H 1OP5H 3ES6B 1OSPL 1U8OA 2G2RA 3AXLA 3OKLB 5E00B 2HVKA 4YEFA 5E70A 4HKXA 3B8YA 4DKFL 4I13B 4IIQC 4HUUB 1KCVH 4MA7L 4QTHA 3VXQA 5E1HB 4X99B 5E4EC 1F4HA 1CCZA 3RUGA 4WY7H 3FB7A 1GRWA 4NZJA 4PGBB 1KENH 3O4OC 3AB0B 1RZ8B 1OL0A 2B1AL 5E2TH 3QCVL 4D3CL 3WCYA 4YHNA 4Z7WB 3GSXA 2X09A 1IGMH 1QLRA 4C4KT 1XEDA 3SE8L 3VFGL 3WLWD 2X4UB 2Z35A 4JFPA 4JPKL 4DQOL 4P5TB 1Q1JH 5GRXG 3MRCB 1ZLWH 4QRPE 2IPKA 1TZGH 2GY5A 1FIEA 4H8WH 5I8CB 3G04B 4GSDL 1VA9A 2UVFA 3O8XA 4HJ0C 4E41A 1CK0H 5ITFA 4UDTB 4BQBA 1B0RB 3C2AH 5D8JL 2AABL 5LXGH 3RIFF 1XIWD 3HNSH 3O4LB 1OHQA 4WV1A 4X6DE 4YDIH 5FYKL 1JHKH 1VSCA 4HIIB 3ZKSD 2A38A 5CJOH 2BCKA 4JG0L 4MD0B 5GGVH 2Q7NA 4JM4L 4KI5D 4YBHA 2XTLA 3PV7A 3WNKA 3T0EA 5C0CE 1I9JH 2R0ZH 3VXUD 2X7LA 4GRLA 3MZTA 1NGZB 4LQFH 4NRYA 1NCDH 1X5HA 3DIFA 3SJVE 1YC8A 1XR8B 1MLCB 4KZDH 3NIDE 1UACL 2SEBB 4ZSOE 3PQYB 4P2QB 3S4SB 5D6CB 3LSOB 1ZHLB 2X1PA 4ZXBC 1MCOH 4HIJA 4JRYA 5GGSB 1MCCA 2W60B 4KAQL 5T3ZE 4YZFE 4M48H 1JHTA 3FN9A 1DQQB 3BXNB 3KNBB 5DSCB 3B6SB 1U8JA 3BX7C 5K93A 4ISVA 3T3MF 1ZLUK 3DVFA 4HC1H 2H32A 4PJ9C 2RHEA 1CL7H 4MDIA 3HB3C 5ECJE 5HHOA 4HK0A 3VU2A 2DLFH 1DFBL 2D0GA 1GAFH 4JZOA 3BOVA 4XP5H 4Y19A 3GJEA 2VDRL 2LU7A 5IVZA 2XA8H 4F58H 2O61B 3ZTJH 1YDPB 4N0UE 1WCQA 3MLXL 5IMOA 3SDCC 2BRRH 5ESVB 2QQNH 3UYPA 4FABL 3T2OA 4ZAKB 4FMKA 2ZSVB 1KC5L 4P5TD 4U1HB 4GXVL 5FYJH 5C0RH 5D4QA 3DECA 1AP2A 1P6FA 3VDAA 1EJOL 4PRPE 1BX2B 1PD6A 3D85B 2UZXB 2BK8A 4P49A 4KROC 3TA3A 5FGRA 1DTUA 1K6QH 2BSED 5JW3L 1NBYB 1WFUA 4WFFD 1JGUH 1ZGLM 3T1WA 4M7LH 5CEZE 4P23A 1EZVX 4QXTB 1HINH 3PGDB 1CFBA 1KG0B 2EIEA 1FAIL 5C0JB 3O4LD 1IC7L 3F6IA 4RAVB 1ONQA 5GRWA 3BKCL 2KZ1B 4HPYL 3K4AA 4ORGB 5CILH 4HIEB 5KVFH 5C6TL 2P5WB 5ANME 4DVBB 4X6DB 4DN3L 5KVEL 2XWJA 1U8HB 5TE4L 4K7PX 3OG6B 1MCJA 1DUYA 4JFEA 1UM5H 1ZANH 2JCCA 15C8H 1DVFB 3HI6L 2HJLA 3P30L 1DP0A 3RNKB 1CGUA 5GJSH 3PQYD 1U42A 1MUJB 4U0RB 3L3JA 4F8TA 3QUYB 1PLGH 5HI3D 1NJ9B 1ACYL 4OZIF 3T0AA 1T1YB 4ONFL 4MX7B 2P8PA 2XT1B 4QO1A 5J6HA 4KJPC 5D1QB 1TVBA 4K9EC 4ODUB 3LKRA 1KGCD 1RIVH 3UTTA 3CXDL 3SGDI 2DQJH 3BUYA 3NIFE 1R6VA 2EYTB 4AIZA 4Y2DB 1IAIH 1BF2A 3O2WL 3OPZL 3LV3A 4UT9L 5I16B 1CF8H 5DR5H 5DGRA 1MNUH 1YYML 3G5VB 4LLWA 4JDTH 2YD6A 3H3PL 3LQAL 2OTPA 4MZ3A 5KTEH 4U1IA 5GGTL 3K1KC 2ENSA 3PXJA 4ZAKD 4Y5YA 5I18L 4XWGH 3U2SA 2EEBA 1QFWI 3D9AL 4YHPB 3CMOL 4WI5A 4FFVD 3V6FB 2DQFB 3NFSL 3VCLA 4XAWH 2EDFA 1QTYT 2H8PB 4PJBA 3WLWC 1U95A 3O3EA 4CNIA 5DJYA 3EFFA 3U30C 3BE1L 5MERB 3C60B 2JCCF 3EYSL 5DD5L 4JREB 1NBVL 2ICCA 1KJVB 3ARQA 1G6RH 5A16A 1A7NL 2VITB 4TQEH 5HYSB 3DHMA 2V5YA 4UV4H 4XVTL 1IGJB 1S5HA 3DURA 1MFBH 3MJ6A 4HW6A 1TTUA 1LK3L 1WK0A 3D48R 2R0KL 3FZUD 4HLZH 2Y4SA 3OWEA 4KK6D 1XIWC 1JRHH 2P5WD 4U1GB 2NNAB 4WEBH 3NA9H 1PEWA 4KJQD 3UTPD 3AVEA 4KI5C 1HSBA 3ULUH 5E8PA 1AD0A 1DVFD 4K3EH 4WNQB 3QDGB 1DJSA 1NCTA 2JK5A 4YHLL 2VOTA 2CIKA 3QDJD 1MIEH 5J9PA 3MJ8B 4CW1A 4Q6IA 1B2WH 5EUKB 1TMCB 3LHPH 3QUYD 1ERNA 2DJSA 5E2WL 4LDLB 1IGIH 4QWWD 4FXLA 1JPGB 4MJ5B 3FMGH 3MNZA 3V8CA 4BK5A 5CGTA 5T33H 2YSSB 2EECA 5I1IL 5C3LD 3W2DL 2PW2B 1F4YL 4RBPK 5JW5B 4PJBF 3ILPA 3PHOA 5TE7H 3MRHB 2MKWA 2YD8A 2L7JA 3FRPA 1PY4A 4DUXA 3GO1H 4KZEH 2BMKA 1ZGLP 5J4MA 1BZ7B 1KT2B 1Z3GL 2OTWB 5I1EH 4NHCL 1WTLA 4U6VH 4TUJA 1C5DA 5ID1B 3GHEH 4UNTA 1I3RA 1KIPA 2AK1H 5T3XL 4M7JH 2X4TB 3MUGB 1OAYH 4G6KL 4PJFA 1A1MB 3X3GH 1SBSL 1S5IL 3B5GA 4JY5H 4XNUH 5GS2D 4Z7NE 1IAMA 4NP4H 4D9LL 4YPJA 3SGKC 5FO7A 4ALAL 5FA3A 3VH8B 1E27A 1BF8A 1OB1A 4Q9RL 4F9PC 3DUUA 2R56H 3HPJA 4NKDA 3C60D 4ZG1A 4P5TC 4YDJB 2R0LL 3BJ91 1RFDH 5KS9E 1YEDA 1FL3A 4IMKC 1G9MH 1DL7L 1AGCA 2Z93A 3MJ9L 3IJSA 1FJ1A 4UDUA 4NN5B 3RPKA 3O2VL 5CINL 3PWPE 2CLZA 5JA8B 3ESUF 1F58L 1YZZA 2AK4E 1D9KB 5AZEH 1I7TA 1UZ6F 5ALCL 5L2JA 3MRFA 4NQUA 3EUUA 4XCYA 1D5BB 3BZEB 2BNRA 3MCKB 1KPUA 1BEYL 1YUHB 3DGGB 4QRQB 4Y88A 3QDGD 2RFXA 3LD8B 3ARGC 4P3DA 1A6PA 4P5MB 1QSED 2CSPA 5KOMC 1HZHL 1OPGH 3NZHH 3UYRL 4XCEA 3L5IA 1FYTB 4XPHH 4ENED 2YR3A 1GL4B 4WFGE 2ITDB 4L1DA 1FSKC 1QFOA 5D5MA 5B22A 5LAXA 3QUZC 3BEVB 1U92B 4PJFF 4AENB 5IBTL 4Y5VC 3MX0A 5GXBB 2IG2L 5D7KD 2YA0A 4MJ6B 4HHAB 3UTOA 3CDGB 5LKNA 2OL3L 4MNQD 5I17B 3OAZH 4M93C 1NGYA 1UWEH 2W9LA 5IVNA 2YD9A 1RIHL 4JN2A 2APTA 4P46D 5JA9A 4QRUB 3V5HB 4JN1L 1LP9A 2P42B 4X7SL 2NYYC 2Z8RA 4HULB 4QLRA 3RIFK 4ZMAT 1UWGH 4IRZH 4L1HA 3LKNB 4H1LG 2X89A 1WZLA 1TCRA 3F7QA 1FLRL 4BSWB 3WKMH 2F19L 5ESQA 3TNMB 3GIZL 4BFEA 2VTFA 1MCHA 4UUJB 2XQBH 1JZ8A 1KN2L 3P2TA 4ZAKC 5I9QB 4X6BA 1LE9B 4ZXBA 1PVHA 3RWEA 1MOEA 2A77L 3QNXA 2H45A 3BP4A 2PCPA 3MRQB 3VI4F 1AGDA 1CU4H 4FFVC 4OSUL 3LH2H 5IG7B 3WXWL 1CXKA 3GMOB 4U3XA 3TBSA 1DSFL 1A14H 2HVJA 1G7JA 4ZFOA 2D3VA 3E2HB 4HCRH 3LMJH 1BFOA 3BP5A 4YDKL 5C8JB 5C07A 4NJ9L 4XAKD 5D5MF 3VXMA 1V7NH 1D9KD 1LK2B 3FO0H 2E6JA 4FXGB 1AGEA 1J05A 1CT8A 1XAUA 1V05A 4JDVA 4LSUH 4PLJC 5DHVA 5GS3A 3FZUC 3SBWC 2AVGA 3PP4H 2R69H 2CUMA 4KK6C 5F7HA 3BUTA 1JI1A 3AAZA 3SDCA 3UBXG 2AK4B 5IEHA 5D71L 2Q20A 4M9PA 1I3VA 4KVNH 1LP9F 3TT1L 2X4NB 1FYTD 1YN6B 5D1ZB 1HDMB 1L7IH 4PRDA 2OZ4L 1CVRA 2L4OA 3MRRB 2XN9B 3OJ2C 3LQMA 2AQ3A 3ZT7A 2BSTA 3HS0A 5SWZD 5JPNA 2GCYB 5FYLH 3LZFH 1TJHL 4U0RC 3IKCB 5EBLB 2PTVA 3QI9A 4DZ8A 3MUHL 4LLMA 1EUUA 3U36A 4LBEA 3FONA 5AUMA 3B3IA 4WJ5A 3RKDD 4F7TB 2GSIA 4XH2A 5I19H 4LQ1A 4OBRA 3O41A 1CFVL 1I3GH 4L4JA 1P6AB 1NL0H 1JYWA 1XH3A 5IHLB 1V7MH 2ZWLT 3O3AB 2Z4QA 5LBSH 4I8DA 2HH0L 4HQQL 3S35H 5LGJA 5HVWA 4PY7B 3PIQB 2BY0A 5E5MB 3RGVB 3P4NA 4JCLA 2UZIL 3ZHLA 4J3UA 2FL5B 4PJ5A 5TQ2H 4QXGH 5HHXL 4JHWH 4XVJH 1JNJA 1NGWA 1QFUH 5CLWA 1DUZA 3ULVD 4WU5B 1IKFL 1NAML 3SDAB 4XP9H 4R3SB 1L4IA 1Q9KA 5FGSA 1AI1H 3ZDYF 4CMMA 4OV5B 3NIGE 3KPMA 5C0DA 1SY6H 1QFWL 5F7UA 4YPGB 1I1RA 4ZTPH 4L8SC 4XMLH 5D1XB 1WBYB 3SE3C 3JBG7 1B0GA 4XTRD 3MRLB 4NN7C 3TBVB 3C5JB 1J9CT 1DQMH 3DYPA 4NM4H 4X7TB 1CE1H 5E8EA 5IB4A 2GAZB 3FTGB 5DURB 1CFTA 1DDHB 3QQ4A 5C08E 5MEOA 1BZ9B 1G7PB 2BXYA 2F9BT 3HLAB 1A4JB 3VMPA 3TN0B 2NX5D 2A6DB 4RGOL 5I1KH 1OWWA 5DUBA 3BD3A 3P4OA 3MLRH 5D1ZD 4B0MM 5EO1B 2UWEB 4LFHD 4M00A 2YRPA 2XN9D 5F89A 4HGWA 2NY6B 1FPTH 25C8L 1IEBA 4PTUA 4RCAA 5IT2L 4LKXB 2C4FT 2VN4A 3OV6A 4ENEC 4OI9A 2VKWA 1A8JH 4FQLL 1F00I 1INDH 2B4CL 5BZWA 5K33A 3RWIA 2CKBA 1HXMB 1OW0C 2VDOL 5HYJE 1QO3B 5IVOA 3RDTB 4E0RA 3MLYH 2GTZB 1Q9OA 1TZIA 2IQAB 1XIWA 1F4WH 1KCKA 3VJ6B 5EN2B 1UCBH 4R7DB 5EU3B 3SOBH 4P46C 3L5XH 2EC9T 3VXUA 3Q1SL 4S1DD 4JM2B 2NY1B 4WTZA 5D7JB 5E5RB 1JMXA 5EC1A 3TIEA 3RGVD 1KJ3L 4RWYL 4ZUUB 1OSPH 3EYOA 4M6AA 5JQHC 5D2LE 4DKFH 4CU7A 4OJFH 5FIEA 4HUXA 3CDCA 1HN1A 2J2ZA 2V7HA 4MA7H 3DVGB 3SDAD 1M7DA 1UEYA 4XNZB 2EKSA 4WVRA 1AQKL 3QEUA 4Z78A 1UZ8B 3RHWF 3QNYB 3W0WD 4M4PA 4UINL 2V17L 4D3CH 4F7PA 3ES6A 1HYSD 4L8DA 3E6HA 4G43B 3NZ8A 3SQBA 3LDBB 1CI5A 3KPRE 2ZNWA 5IOPB 2BOBB 3TPKA 2ZG3A 5TH2A 5DURD 2QADD 2NXZB 1XCTB 3N1PC 4PGBA 3AC0A 2DLHA 4OGYL 3MLVL 5JHLL 1QBAA 5A3ID 4KJYB 1BQHG 3QT2A 5E4IA 3WS3B 4N1HB 2EKJA 1WBZB 1SM3L 2V7NA 5EG6C 5EU6B 2H1PH 5AD0A 4HWUA 3ZYJA 2V9TA 5C08B 3LD8C 2APWA 3SGKA 2NY5L 2NY6D 1UGNA 4KI5F 2AABH 3PV6A 1B4JH 3QA3A 4OCWL 3WFDL 4I1NB 4P5TA 5FYKH 4LVHB 3UJTH 4QGTA 4BK4A 4ETQA 4IMKA 4JM4H 4UOW1 3MYJA 1DBJH 5C0ND 5JIPA 2QR0A 3T8XB 2HJKB 3W39A 4HBCH 2QTEA 4LF3B 3VXME 1UEMA 3RDTD 1B0RA 2YWYA 3OG4B 4ACPA 4G7VL 3RKDC 3IETB 1E4WH 3NCJH 3O4LA 2MQ0A 3OXRA 4MAYB 1VEPA 1E6OL 4OIIL 3M8OH 1F3DH 3LEVH 3X3FH 3L9RB 4PGDB 4CBPA 1P4IL 2WNGA 1SJEA 5L6YL 3FHAA 1PAMA 1TJGL 2FO4B 4S1SH 2J6EL 2UUDH 2NY1D 4NNPH 4KAQH 3MACH 1W72B 3PHQA 4J4PD 3VE0A 2AXGB 4MCYB 3PWNA 2VR5A 3P73B 1YJDL 3MROB 5IFAL 3DLQR 3H9SD 4XI5D 2AV7B 5KSUA 1MLCA 5JPMA 5F6HJ 1RJLA 2C3WA 5GJTL 3TV3H 4U1NB 4WI8A 3MV7E 4TSBL 1DBAL 2SEBA 3C2SA 5ETUB 4EZMA 2XNAB 3QNZB 2EEAA 3MA9H 3LSOA 5CGYD 1ZXQA 1N26A 4Y5VA 4Z7WF 2W60A 5LG1A 3PL6B 5DO2C 2VDRH 4TVPH 3KNBA 2F74A 4GAGL 4L3CA 4LP4A 3UZVB 3ULVC 4E42B 4GAJL 1ZTXL 5E8DL 4YO0B 3DRTB 5GGRY 4NZTL 1GGCL 2VLKB 1HKFA 3OXSA 3BT2L 4PRBB 4YHMH 5FF6B 3WMSA 2NXZD 2YBRB 4KRPB 1KC5H 4CN1A 1BECA 4HZLB 4G8IB 3VFWB 1B6DA 1EJOH 4I5BB 3L5WA 3KPRB 5EOQL 4NGHH 2VKXA 2ID5A 5IF0A 1MWAA 5ERWB 5EU6D 1N5AA 1VFAA 4ZNEA 5ESVA 1B6UA 2UYLB 5DI8A 4Z5RB 4ZAKA 3V6OA 1YYLL 1ODAA 1WFNA 1HSAB 1QUNA 4GW1A 1NCCH 4HJJL 4C55A 2IQ9L 2VSCA 5DA4A 4FRWA 4O2EB 3N85L 1LD9B 5ESAB 1BX2A 1IM9D 2D2OA 3BKCH 1EPFA 4H25B 1S9VB 5ID0A 5GRUL 1NBYA 3L3HA 1I8KB 2VXTH 4HV8A 2Z91B 3CFKB 1R5IA 5KVEH 4QXTA 5FCUH 4ERSH 1FE8L 2NW3B 4FFZL 5C0FB 4EBQL 5KSBA 4YFLI 5C0JA 3GMNA 1ZVHA 2PW1A 5MENB 4MAYD 1LWRA 1AIFB 1BREA 3HI6H 1EFQA 4YX2L 3SBWA 1JWMA 3GHBL 4WWID 3ZE2E 4N0FB 4ORGA 2NY0C 1E4JA 3ZLQC 1OAKL 2P5WA 5AG9A 5FOJA 1Z5LB 1U8HA 4LLQA 4I0PD 4QRTA 4NKOB 4PBXA 3ZMRA 4JPVH 4S1DC 1BVKB 1D5MA 4MWFB 1DVFA 3RNKA 1C7SA 4KKCD 4YBLB 5CSGA 3QDJA 4LP5A 1MUJA 1NJ9A 2HT4C 5T5FL 3HR5A 4RAUB 2CPCA 1IT9L 1LO2H 5BS0D 1CLYL 3MV7B 5IB1A 1PG7H 1QBML 3MFFB 3H3PH 3LQAH 5T3ZL 4FQXB 1D5IH 3EJYC 3V7AE 1FG2B 3THML 2VLKD 5T1LB 5GGTH 2KH2B 4N90E 4POYA 2IFGA 3G6DH 1Q72L 4KRPD 1HYSC 5KAQF 4IBLT 3D9AH 2G9HB 4DKEL 2DWDB 3O6LL 2VL4A 2ZUUA 1X44A 3KPRD 3NN8B 3DARA 3G5VA 5HHNA 1LO3H 1UXSA 3PWLB 2QADC 5E8NA 3EYSH 5DD5H 5IMLA 1MLBA 3F12A 1NBVH 5A3IC 4MAUL 1VGEH 1UVQA 5J0BA 1A7NH 3RNQB 1ZA6A 2ED8A 3QHZH 2PXYB 5CSZB 3EYUL 1LK3H 4AEHL 1O7VA 2R0KH 2DQFA 3F7YB 3NAAL 5D96C 5L8KB 4P59L 1ZA3B 4X6DF 2NY6C 5C2UB 5IUSA 2OR8A 3T4YA 4W6WB 2WQRA 2OK0L 3C60A 3L1OL 4PRID 1XR9A 1C16B 2OSLA 4D9RD 3MRNB 1MFAL 1RZGB 1EGJA 4QCIB 4K3DL 4ETYA 5KANI 4JAMA 4C56E 5C0NC 4L8SA 5MEND 3SE3A 3UTQA 4J1UB 4YHLH 2J5LC 3CUPB 5CEZL 4EUPG 3HTLX 1R3HA 2P8MB 1J87A 2H9GA 5E2WH 2D7NA 3W9EB 4Z9KB 5F6IC 5FHAL 3HI5L 4DOHE 3HAEB 3QDGA 1YEKL 4OZGE 4UB0L 4J4PC 3X11B 1F4YH 1QSEA 3MJ8A 4PREA 4G42B 2QHRL 4LLAA 3QISA 1LE5A 2O5ZL 2DQHH 3X17A 1KACB 2FH6A 4X0KB 4MD5A 4JY4A 1OD7A 1EEZA 1YNLL 5DJ0A 3J7HA 1G0YR 1OW0A 3GMMA 1FCGA 2PW2A 1MCKA 2QQKH 3ZDZF 4R2GC 3HMXL 4B41A 4P2RB 3RAJL 1SBSH 2R15A 4MNQA 3LDBC 4WI6A 2J8UA 2ESVE 1U58A 2ICWJ 4P46A 1MJJB 4Q9RH 3QRFM 3U1SL 4FQPA 1JWUB 2VDPL 3LEXB 5JLZB 3H42H 2E7CA 4D0BB 2R0LH 2F8VA 4LEXL 4YDVB 3OMZA 1KIUA 3MUGA 3MJ9H 1RK0B 1XF4B 3L3IB 5TE6L 1I3UA 4WFEE 4LVNC 4AL8H 4RSVA 2VXQL 3MA7B 5I8KL 2D03L 5INCA 1BD2B 5ALCH 4LVHC 4BH7A 1ZHNB 1P5VA 3F7VB 3KPLB 1Q0XL 3QH3B 1R3LA 5HDBE 4UQ3B 3FRUA 5DJZA 1VKXA 5ISZD 1SEBA 4HEPG 5DRXB 3RHWK 5F7KC 1K8IA 3SKNA 3UYRH 3JVGC 4RX4D 2NCMA 1NGQL 5I1DA 4XC1L 1AE6L 4MAYC 4C56B 2DICA 5T1MA 3BZEA 2IF7A 3KPSD 3L7FB 3R1GL 1YUHA 5ENWB 4OZFG 5IBTH 4H88L 4QRQA 3VMNA 2F53E 2JIXB 1NEZG 5HYIA 4UAOB 4I0PC 2ZZUT 1UFUA 1FYTA 3RWGA 3C5SB 3NIFF 2C9AA 4JANB 2FIKA 1T66C 2I27N 2DM4A 4KKCC 3U46B 1RIHH 4DOHB 5I1CH 2A6KB 1JF5A 4JN1H 5SWZA 4AENA 4OTXH 4QYOB 3GMLB 4C4KO 4X6CA 3BDBA 4YNYA 1X5XA 3BZ4B 4TN9A 1ZEAL 3UROR 3FO2B 4XGZA 2CUIA 5KSBE 3BKYL 3DJ9A 1FL5B 4RIRA 5HGDB 4P2RD 4LHUG 4TUOB 3MRIB 4NN6C 4L4VA 2F19H 3GIZH 4HWBA 4OUOA 3CCHA 4Z8FH 3SGEI 4G6AD 5JNYB 1KN2H 4LOUD 3DROA 3V5HA 3S3SA 5IHZA 4KRPC 5T5NF 3ALWA 3KLDA 1H5BB 3M1BA 3AUVA 5DQDH 5C0IA 3QQ3A 2ESVB 1OT1A 5I8EB 1QRNB 5J7CC 3OJVC 3FQNB 2LTQB 3FN3A 1ZLVH 3OKMB 1R24A 1I9IL 4FQCH 1FO0A 1A4KA 4NJ9H 4K71B 2R1XB 4N9OB 4NFBA 4OFYD 32C2A 1GHFL 3T3PE 4MJ2A 5DFVD 1BD2D 1HEZB 1KIQA 5EBMA 3Q5YA 1L7TH 5A2FA 3BGMB 4NM8L 4S1RH 4PJ8C 3UJIL 2CLRA 1PKOA 4FQIH 4CJ1A 4M5YL 2RGSA 3GJFA 1KLFA 3BWUC 2FD6L 2NY3D 4P4RA 2G5RA 2DDQL 1FZMB 4OB5H 1OSZB 3WHXA 5D71H 5ILTL 1LK2A 4DCQB 1LEIB 4NNXB 3MLTA 3LKPB 3FFDB 3STLA 4C56D 4KKBD 2OZ4H 1Z0NA 3P0VH 1HHGB 3BSZL 1S9XB 5GIRA 4QHLA 4OV6F 4IRSC 2JIXD 1DQDL 1P4LB 3Q6FA 1UJ3C 1P1ZA 5EB9A 3D39D 3OAUL 2NX5A 2CGRH 2YOCA 5SWQB 2OYPA 3QEQE 1EV2E 3U9PH 3KPOB 1SVZA 4O9HL 4BH8A 4Z7QE 4H26A 1T1WB 2XN9A 3MRRA 4NO2A 1QLFB 5IQ9B 5JOPD 4IEFB 1KJ2B 2F53B 4NKQB 3MOQA 3RL2B 3IKCA 3Q5TA 2GJZB 2ZCHL 2ATPA 4JRXD 4I9WE 3D0VB 1TJIL 4F2MA 2CJUL 1A64A 3CX5K 1A5FH 1A9BA 3SGDH 1RU9H 4HQQH 3EOBB 4F7TA 2ZJSL 1P84J 3EYVA 3V0WH 4DAGL 2AXJA 4WI2A 4C58B 1CBVL 4QRRE 1JI2A 3ULVF 2YEZB 3QAZB 4C83B 5FB8B 4KFZC 2BVTA 2R2CA 3L7EB 1FNGB 2CDGB 5H8DA 1AFVL 1BGXL 5I30L 3GSVB 3O3AA 1R3IL 4Z77B 3LPFA 1NAMH 2IGFH 5CIPH 4MA1B 1QRND 2XV6B 1NQBA 1Q0YL 4M5ZH 4PY7A 2GFBB 5HHQB 2KBGA 4RMRA 1TZHB 5HHPA 4ODWA 4YDLC 1QFWH 4H20L 1H3TA 3ZO0A 1RK1A 3B2VL 5K9JL 4HPOL 4OLWL 4B53A 3QEHA 1KB5H 5E99L 1YNTB 3RRQA 4JFHD 1LMKA 4WU5A 4YFLF 4L8BB 5I8OL 4EN3C 4NFCA 5EIQA 5JW4N 4OV5A 1JK8B 2BOCB 3W0WA 2W91A 4YPGA 4JZNB 1YNKL 4RGOH 4U05A 2DI7A 5DJAB 4HS8H 2J8UE 3MRLA 3GSNB 2A73A 3TBVA 1T22B 1A3QA 5IB2B 3KJ4C 4X8XA 4S0TD 2HFGH 2GAZA 25C8H 4HXBL 2FGWL 1IARB 4LVEA 5IT2H 1S7QB 3KPPB 4FQLH 1V8HA 1HE7A 2B4CH 3FQXA 2A6DA 4D9QE 1A7QL 3MV9A 4DVRH 2UWEA 5HDLA 4LSQL 2WZPD 4Z76A 2DMKA 5L0QB 1OTTD 2P8LB 4GUPA 3O6ML 3GSQB 1OAUH 5BOPA 1GOFA 1MHPL 4ZTOH 4PUBL 1RHFA 3GK8L 1YEGL 5C0GA 4ZUSB 1HI6A 3O9WB 4JFQB 4JQIL 5CZXC 2K1MA 3TH4T 3V4PL 2I26N 1F5WA 4M1CD 1KJ3H 2AXFB 3D87B 3RDTA 4RWYH 3ARSA 1MFDL 3IDNA 4R96B 2IQAA 3EOTH 3HC3L 1ES0B 2D7TL 5SV3A 4J3SA 4HWNA 4R7DA 4B50A 4HKZA 2DIJA 4HIHB 4G6AC 5EU3A 4G3YL 3CVIL 1CGVA 4LOUC 1URLA 4QRRB 4H5SB 4PLKC 2WIIB 3QXUA 3WS6C 3WUZA 1FG9C 1KTRL 4UINH 2V17H 4J4PA 2QJDA 3DYOA 3I9GL 4X7CC 1QHPA 3KWWA 1F3DJ 3H9SA 1T7YA 4PJHA 1VFBA 1S9YB 2VJXA 3BZFB 2D7PA 3PWJA 1NFIA 3LKSB 3HNTH 4MXWL 4AMKH 4K94H 5F88B 5KSVA 3MGOB 4X6CE 1CG9A 4YK4C 2ATKB 5LGHL 4JO1L 4EI5B 1FZKB 2UWEF 3VD7A 4CVWA 1IAIM 1J11A 1EHAA 4LCCC 1BVZA 1SM3H 1NUGA 3CFCH 3PHSA 2NY3C 4TUKH 4YHZL 2X9WA 1HHJA 1T1ZA 2NY5H 2VR4A 5KVGL 1DQJB 4TSCL 1KEMH 1BHGA 4JDZA 3WFDH 4FQHB 5F71A 3CMGA 1JGVH 1BM3H 3QFDB 2GK0B 1YMMD 4KKBC 2DKMA 3S7GA 4U1LB 3FT4A 4U1SA 5GGVY 1T20B 1WBZA 2BERA 3WUWB 5EU6A 4KHXL 4X80L 3GRWL 4YXKL 3DV6B 5IFJB 2GKIA 3IF1B 1ZT7A 4LPTA 3BRGC 1H3VA 1LEGA 4TNVF 4XBGA 5BV7C 1E6OH 1BBDH 1D5ZB 1IM9A 2F5AL 3I3DA 5L6YH 5EIIA 3O9WD 3EKCA 3QQNA 1ZHBB 4HAFA 4YQXL 1CYGA 2VWEE 3T8XA 4PJHF 3VGBA 1LHZA 2XTJE 3H6JA 3MLSH 1YJDH 5IFAH 3TPUB 3QIBB 1VEOA 1KUMA 1YY8B 4F3FA 4MAYA 3MRDB 4YWGL 2JJWA 1X4ZA 3QUXB 1IC5H 4TSBH 1DBAH 2XY2A 1JV5B 3VI3F 1IAKA 1MHEB 1T2QH 2KQNA 2FO4A 1MCDA 1W72L 3HG1D 2A2QT 5BMFH 4M1GH 4OF0A 1MREL 4HH9B 1AO7E 4UIKH 2AXGA 4MCYA 2EIZA 1K3ZA 4GAJH 1IZJA 3MROA 1CE6A 1ZTXH 2XZQL 3NIGF 4I0PA 5CD3B 2AV7A 4LLUB 4LGSB 1EFXB 3FQRB 5ETUA 5CEXB 3X14A 3FQTA 4PRNA 4XC3L 2E7BA 1DLFL 1OTUD 1H0DB 4O02L 4EI5D 4MJIE 3MXVL 1PW3A 2FJGA 3QJFB 5FUZH