1U6BA

Crystal structure of a self-splicing group i intron with both exons
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Self-Splicing Group I Intron with Both Exons.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/rna
molecule keywords 197-MER
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u6bA00
2YH1A 1N52B 1R8HA 3N9UC 2M8HA 2DH8A 2VODA 1X4CA 3VF0B 2VOPA 4UY8T 2M9KA 1DHMA 2KH9A 1OO0B 2M70A 5IM0B 2JVOA 3MD3A 1X5SA 1WG1A 2CQ1A 2AYMA 1U1LA 3OW2R 3S6EA 1ZH5A 3NNCA 1HL6A 3EX7B 1SJFA 2HYIB 1WI6A 3CPWR 3CXCR 2MZRA 3CUNA 1N8RT 4TU9A 3K0JA 2CQBA 4OZ1A 3EGNA 2M4MA 5HO4A 2M2BA 3UD4P 2MKSA 2E5HA 3ZZZA 1UP1A 3DXBA 3SDEB 3CF5Q 5IFMA 4LIRA 2Q79A 3G4SS 2CPFA 2B0GA 1X4EA 1VQ8S 1K9MT 2G0CA 1DBDA 2DHXA 2KI2A 2VONA 3EGZA 3US5A 5IM0A 2RRBA 3CCRS 4LMZA 3DLLQ 2VOOA 2MKHA 2RVJA 2CQHA 3SMZA 2KFYA 3FEXB 2ZJRQ 4WFNQ 1FJ7A 2DH7A 1CVJA 2XS7A 1WEYA 3J7YU 2JRSA 2LCWA 2X1AA 3TO8A 2CQDA 2CPHA 5DDOC 1N54B 3VAGA 1YJWS 2KM8C 3ZZYA 5LJ5Y 3R27A 4WFAQ 2XB2D 2DITA 2RQCA 1VQ5S 2KRBA 2RRAA 1OIAA 1RK8A 2KG0A 2YTCA 2LECA 2CPEA 3VALA 2KXHA 4WKRA 4YOEA 3ULHA 1KQSR 2CQ2A 2K8GA 1M5KC 2M7SA 3HI9A 2MXYA 5LXYA 2QEXS 1KOHA 2MKIA 4ED5A 2FC9A 1ZZFA 2EK1A 2L9WA 2LMIA 2MGZB 3D2WA 1G2EA 2MQPA 3J7ZT 2MY8A 2ADBA 3VAMA 2MQMA 2CPIA 3UCGA 1KC8T 1K8AT 2HVZA 3NNAA 5DDRC 3CCLS 1Q7YT 4W90B 3S01A 5JVGQ 4CH1A 3MUVP 5HL7Q 1YIJS 1SJ4P 1HA1A 1VQ9S 4ZKAA 4RU2A 3G8TA 3SDEA 3VAHA 3R1LA 2MB0B 1UFWA 2X1BA 2RU3A 2EK6A 2MKCA 1S79A 1H2UX 2DHAA 2KU7A 4FXWA 1N88A 2HGMA 2D9OA 3THTA 5GADU 2DNNA 1U1QA 1WEXA 2DIUA 1NO8A 2MQNA 5LJ3Y 2KXNB 1U1KA 4QU7A 3G71S 2X1GA 1WEZA 1L3KA 1SXLA 2DNQA 1X0FA 4V19X 1M5PC 3NMRA 2XS5A 1X4BA 2XSFA 4C4WA 3G96A 1WHYA 1WI8A 2DGSA 2LQ5A 2DHGA 5CXTA 5JVHQ 2MY7A 5GAHU 1DZ5A 1YTYA 1QVFR 1Q82T 2M8DB 1YJNS 2N82B 1U1PA 2CQGA 3UWTA 4Y0FA 5DETA 3HHNB 4F02A 1WHVA 2LXUA 1SJQA 3MUTP 1X4DA 3THPA 4TU8A 2ZJQQ 2KXFA 1A9NB 3P3DA 2LKZA 1YJ9S 1QM9A 1U1RA 1QVGR 2RNEA 4PR6A 4W92B 3CCVS 2NLWA 2HGLA 4TLQA 1M5VC 2CPDA 2QFJA 3MDFA 1AUDA 1PO6A 2AYEA 4CIOA 2DNKA 4YB1P 3P5TL 1WF0A 2JWNA 4IOAQ 2LYVA 5IQQA 1YI2S 2KRRA 4TU7A 4C7QA 1D9AA 3CD6S 1U2FA 2LXIA 5CA5A 1Q81T 4IUFA 4Z2XA 2CQ0A 2D3OR 3CCSS 1VC6A 1YWXA 2JVRA 2I38A 1X5PA 1VQOS 2DGQA 1YHQS 3RW6A 4IO9Q 2OJ3A 2I2YA 2DB1A 2M52A 2GHPA 1DRZA 2MZJA 2DO0A 3U1LA 3IWNC 3UCZP 2MZQA 2JX2A 2FHOB 1UAWA 2RT3A 1F9FA 1H2VZ 3BS9A 3L3CA 2J0SD 2G1DA 2LEAA 3BO3A 5GMKa 1VC5A 3MUMP 4C0OC 4F25A 2CQCA 2RS8A 3VAJA 4EGLA 1D8ZA 2E44A 2F9JA 3NS6A 3JB9k 1JJHA 5DM7Q 5H1SV 2L41A 2G4BA 4UQTA 3P49B 3CTRA 3MD1A 2ZJPQ 3V4MA 5CYJA 2KHCA 1RKJA 2DNOA 1IQTA 1PGZA 1JJ2R 3CC2S 2FC8A 1JMTA 3CMES 5GAGU 4QU6A 3UCUP 4A8XA 1WF1A 2A3JA 2AD9A 2DNMA 3NNHA 4M5DB 1WWHA 4WIIA 3MXHP 2CPYA 2SXLA 2ADCA 1NJIT 5DDPC 2CPJA 2DH9A 2KVIA 2OSQA 2OIHA 2DGUA 2O3DA 4PKDB 4WCEQ 2D9PA 1U6FA 1K73T 2U1AA 1X5OA 2MQQA 3CCUS 2GO9A 2PE8A 3BO2A 1SJ3P 2MYFA 4J5OA 1VQPS 1B7FA 2CQ3A 1X4AA 5MLCV 3S8SA 2DGXA 1FT8A 5DDQC 3FEYB 2J0QD 2OTLS 4OZ0A 1YITS 1WHXA 2CQIA 1FJCA 2E5JA 2E5IA 2DHSA 2F9DA 2DNYA 3VAFA 2UP1A 3CCMS 2DO4A 2KN4A 1O0PA 5DM6Q 4YUDA 2XNRA 2MHNA 1WELA 4QQBA 1Q86T 1X4GA 1X4FA 2MJUA 1VQ6S 1WF2A 4QPTA 1M5OC 3U1MA 3BO4A 1VQLS 1UW4A 3B4MA 2FPHX 5GVQA 4P6QA 2ERRA 2N7CA 2CQPA 1WHWA 4CQ1A 2MZSA 1OWXA 3TYTA 1VQKS 1VBYA 1WG4A 2DNRA 3MI7X 3PIPQ 3CCJS 2KM8B 2M0GB 1VBXA 1HD1A 1FO1A 2RQ4A 2DGTA 1FJEB 2J8AA 1U1NA 5FJ4A 2BZ2A 1R8PA 3CC7S 2X1FA 2DNPA 2DGWA 2MPUA 2MKJA 1ZZNA 1P1TA 2LA4A 2AYBA 1JJ4A 3MOJB 4LJMA 4IOCQ 1NU4A 3B4DA 2QA4S 2OTJS 4CH0S 4U67Q 3Q2SC 5D77A 4Y00A 2DNGA 1SJRA 2BOPA 2KT5A 2HZCA 2OSRA 5LXRA 2LEBA 1S72S 3CULA 2YWKA 3TP2A 1M1KT 3G9CA 3P6YC 5D78A 1A7GE 2N3LA 3CCQS 1VQMS 2MMYA 3NS5A 5LSOA 3G8SA 2L08A 1FNXH 2MGZA 3UE2A 1WG5A 2WBRA 4FXVA 1VQNS 3BEGB 1XN9A 2F3JA 1U1MA 2U2FA 2N3OA 2MZTA 3CMAS 3VAKA 2DK2A 2M88A 2MSSA 2YKAA 1W2BR 2DNLA 2MZ1A 3UD3P 1U6BA 1BY9A 3CCES 1FXLA 3IRWP 4BS2A 2RS2A 2XS2A 2RUGA 1H2TZ 2YH0A 2CPZA 2MQOA 1URNA 2HGNA 3LQVA 1M90T 2FY1A 2DIVA 4ERDA 2DNHA 1VQ7S 1P27B 2NZ4A 1KOOA 3I55S 2MJNA 2DGOA 3RW7A 2CJKA 1X4HA 2KYXA 4PRFA 4WFBQ 3I56S 1OPIA 2DNZA 3LPYA 2MQLA 4F26A 2E5GA 5GAEU 3Q2TC 2K3KA 2DGVA 5LSLA 1VQ4S 1VC0A 3CC4S 3PIOQ 2KG1A 3R1HA 4WF9Q 1VBZA 1KD1T 2PEHA 1FHTA 3S7RA 3SXLA 3VAIA 2CQ4A 5ITHA 2J76E 5BJRA 3MURP 1WTBA 5EN1A 2MKKA 2EVZA 2V94A 1U1OA 1X5TA 1HD0A 2DISA 2LA6A 3H2VE 2MSTA 3G6ES 2CPXA 1H6KX 3H2UB 2XNQA 2AYGA
chains in the Genus database with same CATH superfamily
2RIJA 2UU9F 2W2OP 4A8OA 1YBTA 1CJUA 1ITPA 4LF9J 2HS3A 1U2RA 2COLA 3K57A 2D3UA 3J7Z5 1N52B 4K4YA 1IJFB 4X4QA 4EZ6A 2XZWA 4ECRA 3RJMB 2YKMB 3T9NA 4XPEA 4ZVFA 2M9KA 1JIHA 4BDPA 4UY8T 1RBAA 2GQ2A 2V5HG 3R3TA 4M8LA 1OO0B 2IRYA 4U8VA 1T3OA 3JAMU 3Q83A 2Y3YA 3J81Y 3DLBA 4B3MF 1RWVB 1NHUA 1S0NA 1WC6A 3MD3A 4TY8B 1WG1A 5HSPA 2AYMA 4OX8A 4PYAA 1LK7A 2CJAA 2PIIA 3DGPA 1ZTTA 1LWEA 1J5EJ 3OW2R 3AQPA 4ZITA 3V5RA 1RWKB 1TKXB 2ZWOA 1ZH5A 4TLRA 3ZC4A 2ZVSA 1HL6A 3I4PA 2OH2A 5ETSA 2ROEA 4Y6IA 4DX7A 1SJFA 4FF2A 2DTJA 2OEKA 1LW0B 1EB0A 2CJQA 3T1YF 2LFVA 5L1IA 3T1HF 3CSKA 2HHXA 1L3SA 3OXFA 2DY1A 3CXCR 3IBFB 2H51B 4C8NA 5SZTA 2AV5A 2YNFA 3NGUA 4MYUA 4QU6A 3M6VA 4TU9A 1KFDA 3H98A 2UUBF 4OYOA 4O23A 2CQBA 4OZ1A 5HJYA 4U8YA 3EGNA 2M4MA 3RRGA 3N6NA 2VBWA 4JI7F 3NCRA 3V81A 1GX6A 1AZSA 1NXIA 4BWMA 2PT0A 4BC7A 5HROA 1B3TA 1UP1A 5F9LA 3QT6A 3HPOA 5IT9Y 1FDBA 3ILJA 3SDEB 1UVIA 1JLCA 5IFMA 2UXBF 4KQZA 3O44A 2Q79A 1EETA 3GILA 2Z2MA 1X7VA 1BXNA 2B0GA 3AFGA 1SJ1A 3ITHA 2CIMA 4G6VB 4ZPVR 1K9MT 2G0CA 4KPCA 1NM2A 4HL9A 2B8QA 4ZS6A 4F0HA 2YBVA 1KVJA 1LFPA 1S48A 1SV5B 2WCXA 4F7VA 2VONA 4CLTA 2RRBA 3EGZA 3L7PA 4LMZA 4KGVB 1L5UA 3KK2B 3DLLQ 1KVIA 1KEKA 4PG8A 4I6AA 3MOZA 4RLEA 3TVZA 4UT4A 5D3GA 2CQHA 3EICA 3BH7B 3SMZA 2HAFA 1H38A 2V2QA 4PUOB 2QSWA 4YHHJ 5KG6A 1T9WA 3NY0A 4WFNQ 2KJWA 1B7YB 4LF8F 1WEYA 1VLOA 2XBPA 2LCWA 2CQDA 1RP5A 3PJXA 2MTLA 4C48A 1N36J 2FVSA 1P6TA 2CG8A 1KP6A 5ETMA 4CRJA 1N54B 5J1EA 4YY3J 4JV2A 2B4OA 3DNCA 3EVWA 4L74A 4DR3J 2VKZG 2IBKA 3JAMY 1RTZA 3H42A 2FLLA 3C2PA 4PWDB 2RQCA 2WAQD 4DSIA 3ZTOA 3DHXA 5I3QA 5I42B 2GV1A 3KK3A 2KRBA 3GYXB 2W25A 2XGPA 3OD2A 2RHQB 3M2UB 3PW0A 2YTCA 2UXDF 3OT9A 1S4FA 4ZLPA 1UPMB 2ZE2B 2CPEA 2B4UA 3OL7A 2Y8YA 4RW8A 1B0TA 8RUCA 2QMWA 2NS1B 3M9OB 4DLEA 4M5JA 2IM1A 4OJ1A 3HI9A 3KLGB 1ZM4A 5KFUA 2QEXS 2DCUB 2VPYB 2DKOB 4JI8F 4NMLA 3T41A 3CJKB 3POTA 1U25A 1ZM2A 1TKTA 3NL0A 1HBMB 3HP6A 4USMA 2CPIA 5F8MA 4LF1A 4OV6A 1K8AT 1L3UA 3X1LB 3PDNA 5D8HB 1LXJA 5HMWA 4GVLA 1RJJA 5DDRC 2HQGA 3C66A 1Q7YT 4W90B 5GMEA 4ED7A 2AIRB 2HEKA 3MWBA 4HDHA 5DG9A 4O4GA 1T0TV 2WVCA 4OYAA 3W9JA 4ZHRA 2Q66A 4ZPBA 1RWNB 3R2CJ 1ZBTA 1V3ZA 3HCXA 3UO0A 1KTQA 3HJVA 3TAMA 3VAHA 3I9V9 2MB0B 2QA2A 1UFWA 1JNRB 3PYGA 3M32B 3DLEA 5H9EJ 4QYZJ 1VJWA 4NCGB 3IN5A 2MKCA 4PXDA 4NX9A 5J1NA 4Z7CA 2KU7A 5F8NA 3W2VA 4FF3A 1SQEA 2D9OA 2IVMA 1QTNB 5KFOA 3HHDA 4X4TA 4JV5F 1R0CB 2B5JA 4JV1A 3Q8PB 3L4BC 2MQNA 2V4JB 4QU7A 3G71S 2RSQA 3I5AA 3QFWA 4ZP8A 2AGOA 2BJ1A 2J9EA 2K1RA 2Z58B 1GMVA 1WEZA 2BUNA 1TK5A 1SXLA 3D4JA 1B99A 5M2UA 3R7BB 4L73A 1X4BA 4NZ6A 1R0AA 3C3LA 2XSFA 5KOWA 3GIKA 3KJFB 1BWVA 1WHYA 2W8KA 1F0XA 2XMKA 1GMWA 3IAS9 1K1QA 4IFYA 5KT7A 1N34J 3UNYA 1B0PA 2LQJA 2R42A 1SH2A 3MF5A 4KHRA 5D4NA 1C1BB 5C5JA 3PX6A 2FGCA 5ETTA 5A0YA 3M6UA 4DQQA 3OSPA 2D3O1 2DHGA 3R5JB 4WZMA 2AW0A 2OLWA 5KFCA 2MY7A 3DRRB 4U7CA 4J9QA 1NJYA 1QVFR 4YS2A 2PD1A 2ZWPA 3IR7B 3MMAB 4OZJA 5KG1A 5L1LA 3SQOP 2RE1A 1Q82T 2HNDA 2M8DB 1CLFA 1EP4B 1HQUA 1WKKA 2CQGA 3ENVA 5B0FA 2Y1IA 3H90A 4JYAF 3MAQA 4Y0FA 2QG9B 3JTNA 4B3RF 3PTWA 4NA2A 3KNAA 4F02A 1SJQA 1WOPA 4DXLA 3MUTP 3OR2B 3HVTB 1X4DA 3UFCX 3TUZC 5CYMB 1N36F 5ETLA 3LWMA 1A9NB 4NLQA 2C2DA 2IBOA 3Q8UA 5F9NA 4YHHF 3ZTRA 5C42A 2RD5C 4ZCMA 4R25A 2BXJA 2EBGA 4FKXA 2NREA 1SQFA 1QM9A 4IR9A 1IBLF 1QVGR 2GQQA 1XR7A 2HHSA 2YKPA 1UWBA 3H5UA 4KE5A 3VGVA 2VASA 5C24A 1Y5NB 4X4SA 1UKUA 3AD9C 3CCVS 5DS7A 1H7WA 3PX0A 2IM2A 4KYZA 3FSXA 1ZAVA 1TV6B 2N4DA 5DGBA 2CNKB 3L7UA 4OZNA 1Y4ZB 2VBXA 3DCAA 3J7YI 3BR8A 2CXEA 2HS4A 2QYGA 2XSJA 2AYEA 5HK4A 4JV0A 4RZRA 2DR8A 4P2MA 3DLKA 1TKZA 2BMBA 3C19A 5HMZA 5EX3A 4NRTA 4B3SJ 3HKZD 5K5MA 5FLXU 2W9CA 4YB1P 4ECYA 2BQ3A 3ICLA 4AXIA 1JLEB 1VHFA 3DOLA 4IOAQ 1YBAA 1SUQB 2F65A 1HMVA 2FIUA 5IQQA 2MKYA 2VPWB 3CO0P 4TU7A 4JI8J 4C7QA 1D9AA 3CD6S 1U2FA 2NXNA 3C15A 2QLFB 3FSYA 2IJFA 5LSRA 1HNWF 4Z2XA 5HN0A 4Q5VA 4MK7A 2HSEB 2CQ0A 2IC3A 2BRKA 3HD1A 1HFEL 1WC0A 2POKA 2IY5B 5T7LA 3L09A 3MEDB 2HMIA 1NHVA 1UTAA 2DB1A 2WBMA 3BGUA 3NOCA 4DMZA 5L1KA 1DRZA 4DR4F 2AX1A 4DV6J 3IWNC 3UCZP 3G82A 4DL2A 4RWWA 1U8WA 3BSAA 2ASYA 2RT3A 4CLKA 3BS9A 1WUUA 5C7PA 3FEZA 4CP5A 3BKFA 2V4RA 1YVFA 4AFFA 5EWEA 4LUBA 2R2SA 1JWWA 1NKEA 1XQIA 4OHVA 3WBZA 2CG4A 4N5SA 1PKUA 2O67A 3C16A 4Q7AA 5D0EA 4ELUA 3OXLA 4G1QB 4DWIA 2G4BA 2L41A 1FEEA 3P49B 1R6VA 2CNLB 2PSZA 3VZHA 4DV4F 2IJRA 3W2WA 3V4MA 5I42A 2KHCA 1GFWB 1RHRB 2DNOA 3I9ZA 2PMWA 3H5YA 3THVA 2J7WA 1JJ2R 3FDSA 2FC8A 3IP0A 5BYSA 1JMTA 1J5OB 4B9NA 4ICLB 3RAMA 1F9HA 2B43A 3GMGA 3GJRB 4WWSA 2PA3A 1IWAA 3V6HA 3SCJE 2DNMA 3B6BA 2XLIA 1PJ5A 1R0AB 3NNHA 4CT9A 3DRYA 4M5DB 3UN2A 4EYIB 4KHPJ 1FFWB 2BJEA 2CJYB 2R2UA 1IUJA 1QSLA 3MXHP 1FKPB 1ZM3A 2IYGA 2WONA 3QGGA 5ETQA 5KFBA 2ADCA 1N6QB 4RUCA 1HWIA 4LRFA 1L3TA 5FIIA 1X60A 4CLPA 2QE5A 2R7OA 3KLHA 1S9FA 1K73T 1F9EB 2FZGB 3K59A 2R9LA 4ANEA 2JEFA 3BO2A 2HBRB 3PW7A 1IR0A 1RT1A 2V2ZA 2VD3A 4FP9A 2RDJA 5KG2A 1SJ3P 1NK9A 3CCTA 5A8WB 1SL0A 4DV1J 4J5OA 4K4ZA 9RUBA 5C25A 3OBIA 3ENAA 3PFEA 1X4AA 1ULRA 2C3YA 2VG7A 3HVAA 4PAAA 5MLCV 1EETB 1ZM9A 4ECQA 2I8EA 4U7UD 5KOXA 1SB6A 3QMQA 4NOHA 3PW2A 4JV5J 4CO1A 4FVCA 2C2RA 2YX4A 2CQIA 1MNEA 2E5LJ 1OJ4A 4O3NA 4FS2A 2M3DA 4P72A 4B3TF 2NUUG 2F63A 2ZBPA 3OR1B 2OAUA 3WIUA 1C1CA 1S1TB 1IKXB 4G1IA 5E3CA 1O5JA 5HVHA 1SL1A 3N5FA 2KJVA 2DO4A 3MPVA 1PC4A 3GPAA 3W9HA 1SKUB 3DLKB 2DT9A 5LM7E 3I31A 4AQYF 4DF4A 1X4GA 1S4EA 1Y3KA 4JB8B 4KHMA 3W62A 4LR7A 2VQEJ 1BQNA 4KY3A 3GFYA 1X0PA 5D15A 1NEEA 3U1MA 2X3DA 3WHIA 3HSDA 1Q16B 2MQ8A 3BO4A 1Y5LB 2B7BB 1VQLS 3HSZA 3B4MA 1SC4B 3BGLA 4Q2LA 3DOMB 4UTGA 5KFEA 2WVEA 2C3MA 3NOGA 5KFPA 4DR5J 1NSPA 3LP0B 3TX8A 3A13A 2JSXA 2HLUA 2MZSA 4S0MA 4OYBA 2MLXA 3TYTA 2E1RA 3Q8RB 1WDTA 3W8PA 3MI7X 1QAJA 2WB1D 4PABA 5KT6A 3J81j 2VPZB 5H9FJ 2JDJA 3QZ7A 2Z2YB 2J8AA 2G2YA 1R3NA 1HMVB 4XDCA 4YDDB 5KG5A 1NK5A 5FJ4A 3EWGA 4ER8A 1PIEA 5L8RC 2BZ2A 4IFVB 1CULB 5J2PB 1VBKA 1OSDA 4Q8EA 2YY3A 4CI0B 2HIQA 4WU2A 1U0SA 4I6WA 2EFQA 1JKHA 2MPUA 2LU2A 2UUCF 1B64A 1H73A 1JQGA 3PYFA 3ZZUA 4A8QA 5EUHA 2GJFA 1JJ4A 4C8ZA 4ZP9A 5E0OA 3NP5A 1JKHB 1V9OA 1RWXB 1RACB 1TL5A 4LSLB 3M6XA 3OLBA 3R8YA 1UA1A 2MLZA 3DHWC 3GIIA 2W01A 2IM3A 2Z56B 1U45A 3DRRA 1N33F 1I6JA 2OTJS 3CD5A 3NAIA 5DQGA 1QY7A 4ZA1A 4EBCA 2F8MA 2KL8A 4X64J 2HWIA 1M5SA 4UZCA 4U67Q 3AXMA 2P6TA 3D6HB 3Q2SC 4QJVA 4Y00A 1HHQA 1RT4B 4ZDNA 2ZHAA 4J9NA 4ECVA 2B9XA 3EYZA 2ACYA 1RWUA 1KLMB 1F2GA 5KFGA 2OSRA 5M2PA 2J9DE 1S49A 3P6YC 3H5XA 3CCQS 2B7CB 1IN0A 1M1GA 2NQPA 1JLBA 5BXIA 3QRRA 2A2CA 3ONQA 4KHPF 3GTYX 4DV7F 4RJVA 2L08A 3G86A 2B6AA 2I9SA 2HHVA 1FNXH 2G13A 2K7KA 5F0UA 1FKOB 4RNNA 1T95A 1HI1A 1BQMB 1XN9A 2F3JA 4RW7B 3RU0A 1U1MA 2KTQA 1DFDA 3M7VA 3CMAS 1MN9A 3CO9A 5AE2A 4K2XA 2MSSA 5KFQA 1XMOJ 4YB7A 1TV6A 4DUYF 1AYEA 2DHHA 4WK1A 2ZH2A 4Q0BB 1C0TB 2LXFA 4RBVA 2MZ1A 3UD3P 1BY9A 2KFNA 4NL5A 3NMAA 1I1GA 4H4MA 3DYAA 4NLXA 1XNQJ 2MQOA 1H2TZ 1OY8A 2CPZA 1FRJA 2GQCA 3LQVA 4K50A 1P1LA 4H4KC 2DNHA 2QMXA 4NXMF 4CLWA 3EE3A 1VQ7S 4E2FB 2HNYB 3LTOA 2EG2A 5IOLA 3GE9A 4UUXA 4AL5A 2CJKA 2OFGX 1DY3A 4AUKA 4ZPTR 2JLEA 2B51A 4WFBQ 2I6WA 1S1WA 1IBCB 5ETRA 3SSSA 2DNZA 5E3QA 4J9KA 1UVJA 3N5BA 4MYTA 4F2RA 4C11A 5GAEU 3Q2TC 2K3KA 2DGVA 1M1KT 5A8KA 2IMWP 1Q79A 4J9LA 2NYHA 4Q44A 2KG1A 5T14A 1S6OA 3OVAA 3EZ5A 2LDYA 2BKNA 1KVKA 4WF9Q 1EARA 5E3RA 3PACA 4USVA 1KD1T 2Z4PA 4KO0A 5KTQA 1JLFB 2P9CA 3VAIA 1RISA 1REVA 2CQ4A 4NZ7A 2ASLA 4P9SA 1J5OA 3OXGA 4WFYA 3NWGA 4ANCA 4B17A 1N5SA 4OIXA 4GKJF 1KN6A 3R7NB 1G3OA 1ROFA 4B9TA 2V94A 2VIHA 2NPIA 1GT8A 2BANA 2YQ0A 4Y65A 1X5TA 2DISA 4J9UE 3IWXA 4A8WA 2GVZA 3DM2A 2GIFA 2PI5A 3NRBA 3V6DA 1ZPWX 1DQ8A 2XMTA 3G6ES 2CPXA 3KMSA 3PRVA 1DARA 2Q3PA 3LW5C 4Y2KA 4O0NA 3Q86A 2AJFE 1P8GA 1G7CB 3SEOA 5AE3A 4FKYA 3QLHA 4MKAA 3LH2S 3AT1B 3CVKA 2M8HA 5DQHA 1RWOB 4RW8B 2VODA 3VF0B 2VOPA 4ZVOB 5F8IA 2JFKA 4QWEA 5LMNF 5JUMA 2M70A 2VBYA 4DDFA 5IM0B 1BC6A 4X62J 2MLYA 5HATA 3RB4A 2DVIA 2HMIB 2XMJA 2AZ1A 2NXUA 4IG0B 4BCAA 4CYUA 2AEMA 1DAXA 3S6EA 1Y0HA 3CCZA 1U6ZA 2DRDA 2I5JA 1Q1KA 3MCNA 2KZMA 2PFFB 3Q8YA 1WNEA 1GXTA 3KMQA 4RW9A 1GH8A 2E7VA 3I96A 1NK7A 4XPCA 3UN5A 4I2PB 2ZD1A 5J2MB 3F0NA 5IS2A 4KGZB 3K5LA 3DDNA 4J91A 1HNWJ 1FWLA 2RDDA 4LBPA 2VC0A 4EMDA 2Z8QA 2RMLA 4JI2J 2UXDJ 4DV5J 5DRKA 2IMOA 2YPYA 4FYXB 3D0GE 3CUNA 3RR8A 3NWRA 1RQ0A 4AQYJ 3JXOA 2OFHX 2XLJA 4JI1F 2GX8A 1H98A 1RABB 3NBPA 3CJ4A 5HO4A 2W2PP 2XI3A 1EJ7L 2AJ2A 3PFOA 4NI2A 5KFKA 3PX4A 3DLHA 2Z2ZA 2E5HA 3ZZZA 4EFAC 1IKYB 4F4YA 1FVSA 1WC3A 4B02A 3A3NB 3M1VB 2D1CA 2OD6A 3IGNA 4MFBA 3P96A 2UXBJ 2Y1RI 3CT9A 2QLBB 3GFHA 4LIRA 2OHDA 4OX7A 2XI2A 4DR5F 1L3VA 1ZPVA 2V2KA 3ZFVA 1VQ8S 3GJQB 2R8IA 4FZVA 1LWXA 3FCWA 4M63A 3T5KA 2BX6A 3KJNB 2NSBA 4LRCA 2ZH7A 1JXLA 4MKVA 5DJBA 5IM0A 1TVRA 3CCRS 4B3OA 2J9CA 4KH1B 4O3OA 5IC6B 4PZVA 2ZH3A 2RVJA 4PQUB 5B0BA 4DSEA 2KFYA 4USUA 1U0HA 4UF4A 4TXSA 1ZS6A 3FEXB 2ZJRQ 4C11B 1NSKL 4GC7A 5AJ3F 2AF6A 2ZBIA 4FNHA 5ETOA 1BD6A 4NRUA 5IT0A 1MROA 2JRSA 3RAXA 2X1AA 4L3KA 2KVQE 3TO8A 4ES2A 1WSVA 1LQ9A 1NNDA 2E1CA 3D1HA 1YJWS 1IBMJ 3IS9B 1YBUA 5KG4A 2R3VA 2NXJA 3ZZYA 5AXKA 3R27A 1PAUB 3ZO7A 4Z37A 4WFAQ 2DITA 4HI1A 4M5KA 3TRGA 3JSYA 1N5YA 4DL7A 2H1YA 1R31A 2VDIA 3BF4A 4TYBA 3ZNJ1 4WP9A 3UDCA 4KIAA 2KG0A 1E6YA 4ILMA 2CJBA 2XZTB 2UVVA 1S57A 4DPYA 5CD4A 4KO0B 2LECA 2J7UA 5BR8J 3VALA 1QUVA 2KXHA 1VISA 3DI6B 5M2RA 5F3ZA 1KQSR 4LF4J 3HF5A 3IR5B 3FUYA 3GR0A 3KUHA 2BJ3A 2JJ4D 4ECWA 4LRBA 5B09A 1ZTWA 2AGQA 2OEJA 2MKIA 4DG1A 9ATCB 4ED5A 1BWEA 3A8JA 3K5PA 3T5JA 1J2VA 4EK2A 2MGZB 3D2WA 4R0JA 3IC1A 1K1SA 1OY9A 4B3OB 2GVDA 1HNVA 2MQPA 1VIXA 1S1VB 2MY8A 3MPUB 3RR7A 2MQMA 2HVZA 5HJXA 1XMOF 3DRSB 1MWZA 3TANA 3CCLS 2R2RA 4O3PA 4NLOA 3FNNA 4X84A 4CH1A 1R43A 3GWCA 5HL7Q 2RB7A 4A8MP 4NLUA 3IWLA 1HA1A 2ZNZA 4RBUA 3LP0A 1FTRA 1T03B 1SKRA 1XJWB 4F4WA 4NE9C 3SDEA 3R1LA 2OPPA 2HHWA 2EC2A 5E3AA 4C3LA 1S6PA 2X1BA 4WFXA 4OZ2A 1V5VA 3MPDA 4LSNA 4F4ZA 4P7TA 2WOMB 1C4AA 1F60B 3AD8C 2V68A 2JEGA 4OHYA 1WC5A 2GVDB 2C1EB 1NHKL 2RILA 1CJKB 2GMLA 1KR4A 2DHAA 3A8EA 2FUG9 1YQHA 1FRMA 1N88A 1VFJA 2PGCA 2MHEA 2PFDA 3GSDA 3KLHB 1RWPB 1HWKA 2WVBA 3THTA 2XMMA 1GTHA 2DNNA 2BV3A 2DIUA 2V67A 2YNFB 5LJ3Y 1CC7A 2XY6A 1U1QA 1U1KA 1FKPA 2J9DA 5GAEI 2Y9HA 2BJ8A 1F3FA 1IKXA 4C8LA 4LF9F 2V6AA 2ZOGA 2BKOA 2R7TA 3MCSA 3SFUA 2NYIA 4KAIA 2FJWA 2AQ4A 1XR6A 1M5PC 2C3PA 4LF7J 2OPPB 2BVZA 4C4WA 4OHXA 1NCLA 5EX0A 2R4FA 1TKXA 1WI8A 3B82A 3DOKA 1HNZJ 1PYOB 1TQLA 3DLGB 1U49A 3VHQA 3W3SA 2CNOB 4NYZA 3MHYA 3VGUA 4P2XA 2YWEA 2Z2LA 4ZIVA 5CXTA 1IQTA 1J5EF 3T3FA 1DZ5A 2EKNA 2GGPA 3DOMA 2ZKTA 2GCFA 4NMXA 1N5QA 1N4LA 1IKWA 1X31C 4Q2MA 3CMQA 2APOA 2YWWA 2W8LA 1K0VA 2FVCA 1BQNB 4KGKA 4JI6F 1YG0A 3MM9A 3ZTPA 3HX9A 3MEEB 1HBNA 3KHRA 1HARA 5DETA 3T1YJ 3V4IB 4DSKA 2YNHA 4B3RJ 1GMWD 1VHIA 2HNDB 1UMJA 3CEDA 4HR2A 2P2CB 5KFYA 3VVUA 4R8UB 5KFJA 4F3MA 1IBLJ 4DI6A 2E9ZA 4TU8A 2KXFA 3AHPA 5CYQA 1LK5A 2Y0BB 3U7JA 3W60A 1NZAA 1TFYA 1XWLA 4KB7A 3G87A 4N77A 4OJ3A 1YJ9S 1MWQA 4TKTA 4X62F 1A0OB 4DFMA 2HG4A 1U1RA 3ZXWA 8AT1B 1SKSA 3LUYA 1Y9OA 2F40A 1TUWA 1ZA1B 2RUSA 2ZBQA 1R6YA 2UUWA 3FKBA 1HIYA 2IHR1 3PEHA 3TJAA 3GV8B 3C6TA 2C3OA 3A3PB 4RBTA 3OV7A 4W92B 1VOMA 3W8GA 4TY9A 1AFIA 2AX0A 4OV1A 4TLQA 1JLCB 2HWTA 1MN7A 2L48A 4U7UK 1UFKA 2A2DA 4XDDA 4USKA 2CPDA 4ZVHA 3SIPB 1S1XB 4DCJB 2UVWA 2QFJA 4JI1J 3R5DA 3A8IA 3NBPB 4OYZA 3V2UC 4DZDA 1S1VA 1WDDA 4PG4A 1REGX 2QT7A 1FRHA 3BGOP 4PXCA 1S0OA 1S1WB 4D3GA 5ETVA 4N56A 3RBEA 4F67A 4CIOA 1D8YA 4LF6J 1NDKA 2DNKA 4CLYA 6FDRA 5F8HA 2B3TB 4YP3A 3GQCA 3P5TL 5A6WA 3AA8A 1WF0A 3R9LA 3FBCA 3JQJA 3PKYA 1SPBP 3LANA 3M8WA 3MZIA 1C1CB 2WZ1A 4FNIA 2NXEA 5JJBA 1QAIA 2VB6A 3N0VA 2E29A 3ISNC 3U27A 5CA5A 4J9MA 4NASA 1XTZA 2OPRB 2RF2B 4N8OA 4EZ9A 4IUFA 2GNKA 1OQ6A 3W65A 1UWBB 1KHVA 1T9VA 3GONA 5KFWA 4B9LA 3CCSS 4F3OA 1YWXA 2JVRA 2I38A 3A12A 1X5PA 3C15B 2DGQA 1RT7A 4OI6A 4BBYA 5C25B 4DL3A 2J6SA 4K4UA 1NDCA 4DU7A 2MZJA 2DO0A 3U1LA 1V6HA 3RRKA 1T9UA 4YN3B 2D3ZA 2YNIB 4DJBA 2MZQA 1RI7A 2DXEA 1JLQA 2FHOB 4OZ5A 2A0FB 3JTPA 3K5OA 3MR5A 3NCQA 4DX6A 2VH7A 3QO9B 3ENQA 3MTJA 2J0SD 3N01A 3SSRA 1VCTA 2DYAA 2H4WB 3BN4A 3QAUA 3OFHA 1RAHB 3TUJC 2NCKL 1HBUB 3QGIA 4C0OC 1NPRA 3G9CA 4WZQA 2ZC4A 3MEGB 4KTQA 4JI4F 1VDHA 1FFGB 2B56A 1D8ZA 3CJ8A 5DM7Q 4I69A 2I5JB 4UQTA 1RTDA 5E3PA 5CH7B 4URSA 2B9EA 3MCOA 2BJ7A 2VHGA 2PDAA 3CTRA 4DR1J 3V6JA 2ZJPQ 4DZ6A 3TI0A 1OS5A 5CYJA 3ILIA 3LGHA 1VQYA 1AROP 2QTWA 1ZOTA 3LAKA 3LF0A 3R6LB 2P9EA 4MH8A 3I82A 3DKDA 3JYTA 1YZ6A 3CC2S 2RJZA 2VFTA 2OMOA 4ED1A 3RB3A 4ELVA 1RTIA 3B8HA 4KFBA 1U7LA 2QFIA 3IBCB 5GAGU 4R5PB 3UCUP 4A8XA 4WXWA 5CD4H 1SCJB 1WF1A 3EGVA 1RAAB 2A3JA 3OHAA 3G6XA 4LVNP 2ZH9A 2KKHA 3QLHB 1WWHA 5K14B 5KT2A 1TP7A 3BJYA 3MAAB 2W2MP 1XIQA 2ROGA 3PJWA 2CPJA 4AT1B 4QBUA 1OMSA 3PYDA 3OHBA 2WTFA 2OSQA 3GFZA 3M30A 4I2QB 1FCAA 7AT1B 3VGTA 2OIHA 4ILRA 1RYSA 4PQUA 4WCEQ 2D9PA 1IVZA 2XSJB 4LQ3A 2U1AA 3I87A 3N79A 1KTVA 3OL8A 2PE8A 3FFIB 1GMUA 3C14A 1RT2A 1YZ7A 2YVSA 1LEOA 1FXDA 3MM5A 3PO5A 4LIWA 2WSFC 2A18A 1HW9A 1WD6A 4FYYB 1Z2LA 2E5LF 4DFPA 2X51A 1S6PB 2EXUA 1KHWA 2JNJA 2MYFA 5T7LB 4DN0A 2H54B 1VQPS 1U02A 5CQGA 3T1HJ 2DR7A 1NUEA 1V3RA 1MW7A 4PWWA 1R8CA 4UOCA 4F0KA 4O44B 4RNFA 1IR1A 4OX9J 4X2BA 2FLPA 1IBKJ 2F1FA 1YITS 2AWZA 1EAYC 2OUGA 4P2SA 2LU1A 2E5JA 5B0EA 5F8LA 1RYRA 1S5ZA 4J9OA 3GZ7A 4M1KA 2AEFA 4UQGA 2DHSA 4ZVRB 3D66A 1N32J 1TMJA 1K44A 3MM8A 4KKOA 3EUNA 2ZUAA 3W9IA 1U4BA 1OSCA 1XK8A 3QGPA 3ZZTA 4F4XA 3HVTA 1X9SA 5DM6Q 2W4DA 4MMOA 4QZVB 1D3WA 1WELA 1BUXA 5BYQA 3UN3A 3IRXA 1S1TA 4LF5J 4FF4A 4DV7J 1S1UA 2MJUA 1VQ6S 1HQ2A 1YDLA 2ZZNA 1UL3A 4ZPWR 2Y8WA 2K3IA 2BE2B 2F8HA 1Q86T 1WORA 1RT5A 1EKSA 1N5VA 1S9EB 2WVDA 1RT7B 3CD7A 3M2RB 3M8YA 3QAEA 4WPAA 4C8MA 3G6VA 3V6DB 4JI0J 4OI0A 4P6QA 2H4YB 2W9AA 1WHWA 5B0GA 1HWJA 5KT5A 3FK4A 1UA0A 1NJXA 1D0EA 2H5EA 4OX6A 1WG4A 3Q23A 1XBWA 2DNRA 3PIPQ 3CCJS 2KM8B 3MPYA 2M0GB 1TL4A 4JI6J 1UZDA 1FDAA 1U24A 3KG1A 1YSJA 2XO6A 4WYWA 3H2LA 3C14B 3MM5B 2HQIA 2J0WA 4M5MA 5J1EB 4DR2F 4R8UA 4U95A 1NPKA 3QT5A 1S7HA 1Q78A 4IRCA 1CQMA 2DNPA 1AXQA 2CVIA 2DGWA 4FYVB 2XTJP 1DQ9A 4I0WA 3MM9B 1P1TA 2YKQA 3NGDA 4DV3F 3BSCA 4EO8A 3OTOJ 1ZZNA 2BR0A 2AYBA 1F2HA 3OFGA 2W2QP 3GIRA 1KONA 4JUZA 1QSYA 4LF8J 3B54A 1ZAXA 3HHLD 1CEZA 1HI8A 1K47A 2W4CA 1JLBB 3QFHA 4IOCQ 2YNIA 3DRXA 2D69A 3IBWA 4OYPA 2WRMA 2OTLS 3OUYB 2FYXA 3A1YG 3TUIC 3M32A 2C28A 2W9BA 1AB8A 2YNGA 1UZHA 3JQMA 1IM6A 3DDKA 2VUGA 4MKBA 2BOPA 4DSFA 5AXMA 3Q24A 4DL4A 3D68A 4M94A 3QWUA 4ZCIA 4K0KJ 1YRXA 1HHSA 2RF2A 2R7QA 4H54A 3TP2A 3TZXA 1T05B 1A7GE 2N3LA 2MDAA 3O1LA 4MIAA 5CYQB 1Z4UA 1VR6A 1F5BA 3G8SA 2W7OA 3PY8A 3MMCB 4C8YA 1TU0B 1OPZA 2BE9B 4U9RA 4OI3A 5D4OA 2RQMA 1FK9B 4P2FA 5CAAA 2C42A 1DTTA 1WTFA 4IYQA 3SCLE 3POTB 2FJDB 5KG7A 2B4VA 4CLUA 1TL7B 4CCHA 1WG5A 5LL6d 2E9RX 4FXVA 3BEGB 1IKWB 4RX6A 3JSMB 2F4VF 5K8NA 1FKOA 3GB0A 2XC9A 1XC9A 4RWXA 2U2FA 3IAM9 2GW8A 3EJMA 4B3TJ 2EKYA 5FDLB 2DK2A 2FB0A 2DRAA 5A8RB 1O51A 4X4UA 4RNMA 1CS4B 2C2OB 3DLEB 3RAQA 2GHVC 4LREA 2JEJA 1APSA 4DSLA 4ZPDA 5GAHI 4ZCLA 2XEXA 3IRWP 2RS2A 2FJXA 4BS2A 1FXLA 1NH8A 4B9MA 5LMNJ 2Q6CA 3DOKB 3FCHA 2GIQA 3H4DA 1URNA 3I0SA 1NMEB 3DFEA 3BV8A 3ETOA 4QR2A 3KK3B 2DIVA 4IG0A 3DRSA 4PWDA 4OZ3A 2Z57B 5T41A 3CDEA 3AJ2A 4NWBA 2WSCC 4H4KA 3TNVA 3I55S 2NZ4A 2V0NA 4ED4A 4FBTA 1TL3A 2MEWA 2ILYA 3BYPA 3B78A 3P4UB 4I1TA 1JK9B 1PYTA 1TKTB 2DXFA 4AYBD 1QD1A 4QYZK 3QBCA 1M5HA 2IAJB 4YR0A 2HS0A 3I56S 2DEIA 3M8QA 3WC0A 5L46A 4OJHA 4LF5F 4DPOA 4CNYA 1HBNB 3ELHA 5JXSA 4X4NA 3RBDA 2FZKB 3VGSA 3X3UA 1VC0A 3CC4S 2WOMA 2Y1JA 2DY9A 2Y1LB 1FD8A 1J27A 3R1HA 1HNIA 4JI4J 2AEJA 1SC3B 3VV2B 3AODA 5HAOA 1UEVA 2XZDB 3KJVA 3ZZRA 2EG1A 2PA8D 4KR0B 4PEOA 1SC1B 3SXLA 2XWYA 1LXNA 3PR4A 2C2EA 3KG4A 2J76E 2UUTA 3BKTA 3CE8A 1S99A 3P45B 2FHMA 4RR5A 4Z7YA 1WTBA 5EN1A 4B3MJ 2IJNA 3SFGA 1TL1A 2EVZA 4Y2IA 1U1OA 3SQGA 3QRQA 3F73A 4WE1B 3GIMA 1RT3A 2BABA 1V3SA 4ILLA 4FDFA 2AZ3A 4GO5X 1UVMA 4QCLA 4CTAA 2ZC3A 3KLEA 2QMUB 2KDOA 1FERA 5IV3A 2ATCB 3BKUA 1RDRA 3FQKA 4ZVSB 2GZOA 1F1BB 1KQFB 2LLZA 2BE7D 1PSDA 1BHNA 2RAQA 3FMWA 1H72C 2QL5B 4OFZA 5LT5A 1S77D 3G8QA 2R2TA 4DCOB 2XYGB 2VG6A 3W5YA 5IC4B 2CADA 3MPWA 4N41A 1SIWB 1P9YA 1MMLA 3N9UC 1N5TA 1X4CA 3TW0A 1IBMF 1DHMA 1FNMA 2GAHC 3TQEA 3H0PA 3OL6A 2KH9A 2GMJA 3DU5A 4PQAA 1C1BA 1RAEB 2JVOA 3MEDA 3OTEA 1NBEB 1NK6A 4YFUA 1O6XA 1X5SA 1S7IA 2CQ1A 3K89A 4UOGA 1N48A 5H9EK 1T03A 2M5YA 4K5SA 1N32F 2YQ3A 3W7BA 2GJIA 3BPDA 3DLGA 3LP2A 1KDNA 3BR9A 3NNCA 3DYAB 2R8HA 2JHEA 3CJ2A 5RUBA 2ALYB 2GHWA 2GJ2A 4E98A 1WI6A 4Q8FA 2LQ9A 4CO5A 4ZLNA 2BOAA 2P5VA 5HP1A 4CM2A 3CJ3A 3CPWR 4C8OA 3CD0A 2W7AA 5E7OB 3KG0A 3SSQA 2J6UA 2IPOB 4P74A 3PR5B 1N8RT 3TX0A 2GFFA 2O5DA 2OGUA 2KT3A 3PYEA 1JLAA 2M2BA 3BGFA 3UD4P 3P8BB 2MKSA 1MU2B 2QGFB 3RGIA 3TZWA 3OPKA 2VV5A 2BKPA 2UV8G 1FNOA 3QSIA 4X4PA 1LW0A 4DX8H 1HWLA 1E6VB 1Y7PA 2C2ZB 3CIMA 4RL1A 4JI3J 1CQNA 3HHLA 3H25A 3UVJB 3GV7B 4FXDA 4WE1A 3HHKA 2W4PA 3QNWB 2EFVA 1LWEB 2XYHB 1VI7A 1WJ9A 3JTOA 4I7FA 4LSZB 2W9BB 2DHXA 3UR3C 2KI2A 4NCBA 4A8FA 2UXCJ 4QW8A 3IS9A 3US5A 5E5NA 4HHHA 1SBRA 2DBBA 2PO4A 2HRTA 2OPSA 4Y34A 4QWBA 3C16B 1LNQA 2MKHA 4W98A 2D7SA 4DR2J 2AP6A 5J2QA 3MR2A 3QJPA 2AJ1A 3CJTA 2F4FA 3OFFA 4CM0A 1PJ7A 3KLGA 1H74A 1VQSA 5K14A 3WC2A 4B3SF 2FVQA 2WONB 1N6QA 3KJQB 2FJAB 1FX2A 1NK0A 1U0HB 2FDNA 2XMAA 3J7YU 4K4TA 2XS7A 1FJGF 2KFZA 1QAYA 2ZE2A 1Q8KA 4FN5A 4RW9B 2CPHA 5DDOC 3VAGA 2EFOA 1BE4A 1M5VC 1WACA 1TL3B 1KNZA 4JYAJ 1EHWA 2OP5A 3JSRA 3GSIA 4UOFA 4ZJOA 2XB2D 4ZVGA 4CLFA 5BR8F 3VQTA 2E7XA 1VQ5S 3SBMA 1RAOA 2J0XA 4KGMA 4X4VA 4HEA9 2UU9J 4F2SA 1FE4A 2ZH6A 3ZNUA 2XQCA 2G9OA 1OIAA 2RRAA 3O8WA 2DR9A 3HSJA 1CBKA 1XMBA 1FE0A 2WSEC 3TVKA 3NS7B 1WSRA 2CKWA 1H7XA 4G1QA 3KLFB 3KHGA 3Q8SB 2NR0A 3EMTA 3GJSB 3E01B 4WKRA 4QIFA 3HVWA 2QA4G 2CQ2A 4V1Ak 2FJEB 1RHJB 5FDLA 4J7CA 5D4PA 2MXYA 2QIFA 1KOHA 2G0IA 3BBCA 1HLWA 1U8SA 2FC9A 4HLBA 4RW6A 5AXNA 2W9CB 1JLGB 3LP1A 2EK1A 4P75A 2L9WA 1RZMA 1RBLA 1W26A 2LMIA 5DGAA 1IBKF 3CGIA 2HBYB 3OTBA 4YDXA 3LAMA 4N8NA 2F4VJ 3J7ZT 1EX8A 3J80U 4O0IA 1VRQC 4QWDA 1TVRB 3VWSA 1Q5YA 1WC1A 2HFNA 3UCGA 3W61A 1KC8T 4I67A 3D1OA 3ITHB 4TN2A 3S01A 5EHHA 5JVGQ 1FVQA 3MUVP 1NJWA 1SJ4P 1R0BG 2FZCB 1JXVA 1VQ9S 3I5BA 3NXZA 4ZVQB 4BHQA 4CLZA 4RU2A 3G8TA 4ID5A 2H9ZA 4I6YA 2RU3A 1FDDA 1JB0C 3V6KA 2EK6A 2ZUGA 1UJ5A 2B4PA 4GVBA 1S6QA 5KG3A 1H2UX 2QO3A 1VK3A 5KAKA 2UUCJ 2R7XA 1OY6A 2IA0A 4P52A 1BQMA 3GG1A 1S12A 3PM9A 2NXCA 3D7SB 5GADU 2ZHBA 2LDIA 4IH7A 1S59A 2XMUA 3N4WA 5GADI 1P9QC 1FRKA 4I64A 4F8RA 5LOQA 4L75A 1PBAA 4DV6F 1YLXA 2UUAJ 4ECXA 2BQUA 1AA1B 1VRUA 3NLCA 1X0FA 3DLJA 2EBEA 2O66A 3DI6A 3IR6B 1QSSA 4V19X 4ID5B 5G0RA 1F3VA 2VPXB 2HNZA 3IG1B 4M5GA 1BMQB 4O3QA 2AU0A 1I94F 1S0VA 3G96A 4M5NA 5U47A 5H9FK 1E6YB 3UI3A 4Y3CA 4EU0A 4B9SA 3R6GB 3QRPA 1SL2A 3EVOA 4ZJLA 2DCLA 5IQ6A 4G65A 2LQ5A 1RKIA 5D6GA 3QJLA 1Q8LA 3ZZPA 4EBEA 3AAWB 3K8WA 4PWUA 3WX4A 3WX8A 2R7UA 5HANA 5GAHU 5J2NA 2GAGC 3M8PB 4NYOA 4C2MA 1YTYA 1Q4RA 4DV4J 2VDHA 3FCVA 3IGVA 1W2IA 1Y00A 2XWXA 1YJNS 1KQKA 1NPPA 3OR2A 1X9MA 4CDIA 4EUVA 4DX5A 3EXYA 3AB4B 3OQ2A 2VFSA 2L9DA 3M6WA 3NKYA 3TEHB 4C0HA 8ATCB 2B6AB 2CWXA 3W63A 3HXMA 2LXUA 3BQ1A 1NSAA 4K5RA 2HQFA 1EP4A 5J2PA 2R7VA 2B9YA 2ZJQQ 4DQPA 5SUHA 2OPSB 3HULA 2CZVC 3J80Y 1NLKL 5HLFA 1VGYA 2QYCA 1ICEB 2H3EB 3FRZA 4HACA 1OYEA 1XERA 5K9FA 3ILLA 5KFDA 2UV8A 5L1JA 2ZKUA 4ECTA 2EEYA 1BGXT 2WHOA 2ZNYA 1XR5A 3GV5B 2VJUA 2XY7A 4O44A 3J7AN 1M0SA 4HT7A 2BW7A 4Y2AA 4IDKB 3CJRA 1HR0J 2NLWA 2HGLA 2FHJA 2V2VA 1EZZB 1KS2A 3AA9A 3R97A 1SVDA 4CWBA 1RT6B 1JNZB 2YKNA 3C6UA 3HFZB 4YEAA 4ID8A 4KV8B 4IG3A 2LQ8A 2XMWA 4F36A 4B9VA 4LF2A 1HBMA 1SIZA 4DR4J 2K7JA 3R5GA 4K7QA 4TQSA 2CZ4A 2XCPA 1S10A 1Q95G 4G1PA 2ZBCA 4RW6B 3BQ2A 2JH3A 4X66F 3AB2B 3DN9A 2NUHA 4PYDA 4UZBA 2JWNA 2YWGA 3GYGA 2LYVA 3SCKE 4X65F 2FVRA 1CJVA 2QLJB 3GYNA 2KRRA 3E01A 1GXLA 2FHJD 4I7FB 2R8JA 3PHEA 1X9WA 2E66A 1RT6A 3C6UB 4CO2A 1KFSA 2EFPA 4DUZJ 4UOHA 3O6QA 4IH5A 2VC1A 4ZPCA 5KFLA 1TMMA 3UVJA 3ILOA 3UDVA 3HMJG 1TKDA 2D3OR 4O4GB 1SH0A 2OPRA 5EWGA 3BM7A 5B0AA 1QJHA 1VC6A 2FHKA 3RW6A 2CDQA 4F3QA 3HT3A 1RAGB 2HFVA 4PPZA 2M52A 3SYZA 5JMNA 4USIA 4ZK7M 3OJUA 3MMBB 2HVHA 1MLAA 2FGOA 1HNZF 5KFIA 2E7WA 3K5MA 5ETNA 3L3CA 2G1DA 3DMJB 2LEAA 1SC6A 1I3OB 2CJXB 2HFSA 4K2JA 4JBCA 3BO3A 1U47A 3LPEA 5GMKa 4K4WA 2XCAA 3MUMP 1VC5A 3H40A 4NYPA 1XMQF 1HQUB 4A46A 2RS8A 1JX4A 2OI2A 3VAJA 4J9RA 4OLOA 4HTJA 5CZXA 3PO4A 2AMCB 2BBEA 2E44A 2F9JA 2P8IA 4DFKA 1JJHA 3JB9k 4IQMA 3C6TB 5E41A 2DJWA 1RB0A 1Q53A 1RTHA 2Q1LA 2ZH8A 5LMUF 4GKJJ 2J6TA 1HYSB 3M05A 1XNRF 2QV6A 3QJJA 1RKJA 3U1NA 2HKEA 2VFUA 4NLVA 2EPIA 2Z30B 4IFYB 2GO8A 4A48A 5D4LA 1G6BA 5HVGA 1LW2A 1RTJB 2CYYA 3IA0A 3OFEA 1DTQA 2VF3A 3DXSX 3QPIA 3E51A 3I4HX 5HQLA 2FVPA 3NGKA 2BDPA 4NA1A 4YQWA 4C0BA 2AD9A 3FBBA 4P10A 2ZHOA 2HRUA 3EM1A 4FVMA 3L9ZA 2P9GA 1YJVA 1Q7LB 1Y5IB 2CPYA 2ZOFA 3GR1A 3MEEA 2ZM6J 1NJIT 4DPWA 3N6LA 5DDPC 1HHTP 4DQSA 2KVIA 3JQKA 4WTOB 4MTPA 2Y0SD 2JC1A 2DGUA 2HBZB 3BPSP 3D3BJ 2N4CA 3K17A 3MR7A 4PKDB 3VTIA 3AOAA 5L9XA 1U6FA 2ASJA 3HDSA 3CCUS 1GX5A 4A8KA 1U09A 2VA3A 2GO9A 4M5LA 3PG9A 2HVEA 1XNQF 2GS8A 3MR3A 4MKYA 3CDBA 5EDWA 3I0SB 2CQ3A 1VYAA 3LP2B 5IZHA 1IM4A 3G2XA 3PKMA 1S97A 1C0UA 4MFBB 2ZITA 4OYXA 2DGXA 1FT8A 2GA7A 3LO3A 3S8SA 3M8SA 4ZHRB 3AJ1A 4ED8A 1T9XA 2J8SA 3KHLA 2J0QD 2AJ4A 4DUYJ 1IWGA 1CS4A 4MJKA 4NXNJ 1FJCA 2K2PA 1LOUA 2X7IA 4NI2B 4Q0BA 3HZGA 3GLJA 2F9DA 2HHHF 5B08A 4LFBJ 4ETZA 3FGVA 1OYDA 4DOZA 1HR0F 2KN4A 1O0PA 2R8KA 2MHNA 1T9YA 2D41A 2Z0GA 3CJ0A 4JOUA 1FRXA 4QQBA 3CJKA 1FK9A 1HQEB 5KT4A 1NJZA 3MAHA 3G82B 2OD4A 3UNGC 4QPTA 3R7SB 4U6PA 4Y2CA 1RADB 1FF2A 2QN6B 4KV8A 1M5OC 1HNXJ 2YKNB 5G4DA 1PG5B 2HBQB 3AJDA 2UUAF 1YX2A 1RXOB 1T9TA 1IR2A 1UW4A 2FPHX 3UDEA 3KLEB 4OZLA 3I0RA 4DUZF 2RQKA 3PV8A 3EZUA 2PN6A 1PAEX 2CVEA 2CQPA 4HHJA 2N7CA 5A2QY 4AL7A 3CNQP 3T5HA 5EGYA 4DPTA 3FSIA 1VQKS 1VBYA 1TUVA 1NB7A 4C8KA 4RNOA 4TY8A 1FRLA 1NAQA 2QA1A 4DV2J 1VBXA 2IDLA 1FO1A 3D6TB 1R89A 4ALZA 4TQRA 1GQEA 3GJTB 3K58A 4DS4A 1FJEB 5AJ3J 4DPUA 5DQIA 5D0RA 2VA2A 5CYMA 3BB5A 1HKAA 2UUBJ 4GKKF 4WJBA 4LSLA 2EWHA 2X1FA 1NH7A 4C6AA 3GFXA 1HWUA 2LA4A 2V8GA 1KLNA 3CB4A 3ZZ0A 3V4IA 3IO1A 4USWA 4ETXA 5KFVA 3M8QB 3CWJA 2VQFJ 4OMFG 3CCWA 4OLPA 3MOJB 3QIPA 3NEKA 4LJMA 4LQ9A 2RHSB 3K8VA 2KB2A 5ETKA 2QA4S 3FZBA 4GO7X 4CH0S 3TQ1A 4Q43A 4DR7J 2ZVIA 2HFUA 1UVNA 3TJ9A 4NEYA 2DNGA 1SQGA 4WKYA 2ZZTA 3HSGA 3J81U 1SJRA 2UVRA 1HYSA 2C2NA 1JLFA 2KT5A 2HZCA 5B0DA 5LXRA 2HNZB 1S72S 3CULA 4QIVA 2OEMA 5CZVA 1RU1A 3CJQA 4HDGA 3MFHA 1HBOB 1RT5B 1VQMS 4OYWA 2RKIB 4LFCJ 2HHQA 2CFXA 3F44A 4LVOP 3D28A 1HNIB 4EWTA 1MROB 1RE1B 4NLTA 2AKWB 2IVYA 5KFFA 1TK0A 3HK2A 1S1UB 4X65J 2PC6A 3M2VA 2I1RA 2HQ3A 5CCMA 2V9WA 2QSFA 3PRDA 2MGZA 5E2QA 1QDUB 3CJ5A 4LBIA 2ZDOA 3UE2A 2IRUA 3T6JA 1HI0P 4KGXB 2UVUA 1GEHA 1YRUA 5KFXA 4DHVA 2ASDA 5IXUA 2PI4A 1DTTB 4K59A 1VQNS 1Y10A 2HHTA 2N3OA 2MZTA 2BJDA 4KSEB 1PCAA 2W1BA 4WFZA 2ZD1B 2M88A 3R5AA 2HZVA 4C9DA 3RBZA 4FS1A 5A0YB 4LSNB 2HPUA 2DEJA 3DGVA 3QGHA 1D1UA 4F0MA 2DNLA 2IIHA 1U6BA 4P71A 3MECB 2RDIA 2AJ0A 5KFAA 1VS3A 3F41A 2NSCA 2KT2A 5J1PA 3MFIA 2XS2A 1PJ6A 2H5JB 1ZYQA 2YH0A 1N56A 1KSPA 2JC0A 1C0UB 3MECA 3W5XA 3ET6A 4CLSA 3QSYB 1M90T 1C0TA 3A4TA 2V8HA 5KFRA 4DFJA 1N34F 3FFIA 1CJVB 4PG7A 2MJNA 5EWFA 2DGOA 3I32A 1HW8A 1HNVB 1X4HA 2KYXA 4OJGA 4XAKA 3M30B 1IKVB 3BYRA 3PW4A 3TARA 4LF7F 1S9GA 1RWMB 3O2IA 3LPYA 7FDRA 4LRDA 1Q0NA 4M5IA 1TL7A 5KFTA 3BDPA 2PEBA 3LWLA 3MEKA 5LSLA 3K2YA 2YPZA 4GVBB 3FQLA 4KBIA 4QIWD 2QZ8A 3PIOQ 2HQDA 1GTEA 3E8OA 4LFBF 4M5DA 4OYIA 1ELOA 2Q6BA 4F4AA 1XMQJ 3M8PA 4WXOA 3VR1A 2OPQB 4RUAA 2F7VA 2BQRA 1FHTA 3S7RA 4ICLA 2HK2A 1KLMA 1URRA 2J7KA 2VG5B 1LW2B 4NLRA 4PPDA 3RBXA 3DRPB 3KLIA 4USHA 1S76D 2DXDA 4Y28C 1JJCB 4I4BA 4QR1A 4WBFA 4J9VA 2V4QA 3UR0A 3BSOA 1HD0A 2XYPB 3IG1A 2LA6A 2MSTA 1H3DA 1U2CA 2C2MB 5HLFB 3KOAA 2XO7A 3ETMA 4GKKJ 1DLOA 1N33J 1YJTA 2K1RB 5I4MA 1TR0A 1NRKA 2H48B 2FD2A 3R2DJ 4DR6F 4L76A 1C4CA 2G0JA 3CDAA 2VBZA 2YH1A 4K4VA 1R8HA 3OTCA 3D1QA 2DH8A 2RU9A 2OELA 4FYDA 1RCOB 3BZQA 4KKOB 2NZCA 3DC2A 1SKWA 1FEHA 3AY0A 4YB5A 4YR3A 4DR7F 2ACMA 2GVZB 3DM2B 5GAGI 1FI4A 2FY8A 4DR1F 3NGSA 2EFNA 2ZOMA 4FBUA 3SCIE 1UJ6A 3I5CA 1EIYB 4IRKA 4EBDA 1U1LA 4MK8A 1FESA 4NEZA 1YKWA 4G3IA 1BQXA 2VU5A 3J7A1 3I0RB 1W7WA 2HFOA 4NPOA 4RU9A 1B0VA 3FBEA 1S6UA 3EX7B 2JEIA 3AQOA 1MMDA 4N47A 2HYIB 2K06A 1MWYA 1QUPA 4F04B 2H5IB 1RT2B 2EFGA 4ZP7A 4D3HA 3KWMA 5A8KB 1HNXF 3NGTA 5HBMA 2HHHJ 4DV0F 1H0HB 1X8DA 1KBRA 2MZRA 3BDEA 4XIUA 4WU3A 2XGQA 2B5JB 2ZZMA 2E1PA 2C3UA 5HQMA 1NKBA 5D0GA 3K0JA 3IM9A 3RB0A 1Z2ZA 5HI7A 1NK4A 1C2PA 3A3OB 4OI4A 1RHKB 4JP8A 3QWPA 4OHZA 5C2CA 1UPPA 3R5CA 1WKLA 2D74B 3DXBA 3KUEA 4ZVPB 3FMBA 4RKUC 4HKQA 1UCNA 3DU6A 3TAMB 4PXEA 3CF5Q 4I68A 4DCPB 1GXUA 1O8BA 3EXCX 2VG7B 5GMDA 3D3CJ 5THWA 4DQIA 4JI3F 1QAXA 2Q43A 4OX9F 2CPFA 4AE5A 1B70B 1X4EA 5I3UB 3G4SS 4H4MB 2VQEF 2FLNA 1E6VA 1DBDA 1FRIA 4NZ0A 1RT1B 2BYCA 3MM6B 2DPJA 4DV2F 2CJ9A 3CDUA 4QOTA 5IWAJ 3M9NB 4CO3A 4KT0C 3TOQA 4ECZA 3V81B 1JLAB 4ATNA 3BH6B 4HHUA 2VOOA 4PG5A 4LBHA 3QZ8A 3HJFA 2AHOB 3D67A 4GMKA 5F3TA 2YNHB 4LT6A 1HBUA 3OTDA 4ZVTB 4LF4F 3H8YA 1S0MA 3MAAA 4ZJQA 2WK4A 5I3PA 3TA0A 2DH7A 4PCQA 4J9SA 2AGPA 1CVJA 1FJ7A 5J2QB 3WQPA 3TA1A 4ECUA 3FVYA 1RGVA 4JI5J 1RTJA 4ZCKA 4EO6A 1CJTA 1MMNA 2HW3A 3ZZOA 2KM8C 5LJ5Y 2R7WA 2IVFB 2BM0A 3BBFA 3KK1B 4F50A 2IA6A 3W2WB 2G2ZA 1WKJA 1TUGB 4CO0A 2J5AA 1ACMB 3EPGA 4DV1F 3QATA 2JL9A 2IRXA 1U26A 3O5TB 1RK8A 3WDOA 2HVDA 4EI2A 2ZH4A 3T5LA 2OPQA 4LR9A 2KO1A 2YKMA 5D0HA 3KFWX 1RUSA 4KJIA 2QC3A 2HURA 4YOEA 3ULHA 4AXJA 2K8GA 1VRUB 1M5KC 3MEGA 3HO1A 2BE2A 4DV3J 1VJQA 2IFXA 2HIYA 2M7SA 2CNNB 6FD1A 2QX0A 1RHQB 3JSBA 3UDLA 5LXYA 3RB6A 2G2OA 2HLTA 4PUOA 1ZZFA 2V4JA 5KT3A 3ISND 1UFLA 4QWCA 4L6V3 4ZLJA 3M8RA 3D54A 3D5MA 1G2EA 1LFWA 1IKVA 1CULA 5HP1B 4C3MA 1CSJA 3KK2A 4CTAB 4DBQA 2YX1A 5FLXY 3VAMA 4ED6A 4DLGA 2ADBA 1S6QB 4JI7J 4ZVEA 3OL9A 1ZAWA 2ABYA 2HNYA 4RNHA 2ZBRA 3NNAA 1F5AA 4MIWA 5K8OA 4WTYA 5KFSA 2V50A 1YIJS 1FKAF 4OL8A 3QIDA 4B9UA 3C46A 4J90A 3W1YC 4ZKAA 3PW5A 3DGPB 1LWFA 4WIQA 4C98A 1LV5A 3EVMA 4L72B 5HQ8A 1W25A 2CUYA 2F8EX 2E9TA 1TAQA 2VICA 3TEGA 1AZSB 1SI9A 1YGYA 3GCWP 1S79A 5HROB 3AOCA 1Z1ZA 4DV0J 4FXWA 1T02A 2HGMA 3KNGA 3GG0A 3QIPB 1Q8BA 2IAJA 4DG1B 2YWHA 1WEXA 1Y3JA 1NO8A 1JLGA 2XULA 1EKRA 3PJ9A 2HFZA 4XK8C 5ETPA 2KXNB 1CJKA 2CZ9A 3QQCD 5K20B 2A6OA 1UVLA 4NA3A 2X1GA 1L3KA 2BW2A 4UW2A 2DNQA 4RUHA 2XS5A 2A6MA 2WW8A 1DTQB 4IFVA 5A76A 3Q89A 4Y2MA 4DL0C 4DN9A 1RAFB 1CC8A 2ATLA 2P6SA 2X3GA 4CYUB 3AOBA 2DGSA 4HH1A 3UD5A 2YKOA 3PCOB 2BRLA 4USTA 3JYTB 2XG8A 3HT0A 2YX7A 4DR6J 3IXQA 4USJC 4ZN1A 3KK1A 4PG6A 3ADAC 3CDWA 1PC5A 2YQ1A 3TZYA 4M95A 1B4SA 1V5IB 5JVHQ 2PMHA 4OQJA 4HH0A 2GMHA 3BBBA 1Q5VA 3D6MB 5DLFA 2BEFA 5DLGA 2N82B 1U1PA 1T94A 3KXDA 4ECSA 2H65B 3UWTA 1QE1A 1NSQA 1YRTA 2ZEJA 1UWAA 1IQZA 3S1TA 4CO4A 1FWPA 3FRYA 4QR0A 1CJUB 3L7OA 2XY5A 1WHVA 3HHNB 3HM9A 1RHUB 1WOOA 4IKAA 3AXKA 3THPA 3QO9A 4Q45A 2XHWA 1D09B 4I56A 1DQAA 1FX4A 1RAJA 3TR5A 2ZH5A 4K0KF 1AW0A 2UZAA 3P3DA 1IXKA 1U48A 4GC6A 2GGPB 3OR1A 2LKZA 3DDIA 3RYLA 1AT1B 2G1HA 3MMJA 3N6MA 1XNRJ 4EEYA 1TL1B 3QT7A 4FPIA 1KQGB 1RA7A 3LGNA 3HVRA 1ZETA 4K4XA 4JI5F 2RNEA 2HAIA 4JI2F 4NCAA 4PR6A 1NB2A 2JOQA 1DJ0A 1N0VC 4ZVUB 4K8RA 3PEJA 1VRTB 1Y11A 5BYRA 3M1VA 2L9NA 3KJVB 1RU2A 1G4CA 1HPZA 3VZIA 2V8VA 3QYYA 1KRPA 5A8RA 4QIGA 1T3NA 2AT1B 3MDFA 5KFHA 1AUDA 2CAJA 3D6FB 4YR2A 1PO6A 1JLEA 3DOLB 3FC9A 4QYRA 4B08A 1KWMA 2FJBB 4WP8A 3VCDA 3JSMA 4DV5F 1HQEA 1XEZA 3H4BA 3O3LA 3PRBA 3ZTQA 2V8PA 3EDQB 3D0IE 5ADZA 4URQU 3TJ8A 4X66J 4GRSA 3TAQA 2C22A 3PNIA 3OJSA 3MMCA 1YI2S 4DU8A 4K4SA 2E1AA 1PBUA 2ZM6F 1RWWB 3NMRA 1NDPA 5AE1A 4DUTA 1S1XA 1YJ7A 2LXIA 1T05A 4LFAF 2B8PA 1RCXB 4MAKA 5IWAF 1Q81T 3NGRA 4V19J 4E8UA 4RPFA 3K5NA 3MM7B 4TYAA 2O1PA 1R8BA 2ILZA 4IOBA 3TWZA 4HYKA 4URGA 3BN7A 3RRHA 1YHQS 1VQOS 2YNGB 4ED0A 3Q22A 4IO9Q 2OJ3A 3M2RA 3EDRB 2LVWA 2I2YA 3GP9A 1IKYA 5C42B 4BLGA 2GHPA 1D9DA 1AUSL 2IDEA 3MR6A 1SUQA 5CABA 3SV3A 5L9NA 1FXRA 2CDRB 2IM0A 1PYSB 3FZ2A 2JX2A 2HZAA 3D0HE 3GU0A 3LALA 3MGJA 1UAWA 3LP1B 3W64A 1F9FA 1H2VZ 2ALZA 3H20A 3BSNA 2XLKA 3MTKA 5HVFA 2W7PA 5CHCB 2EC0A 3KDOA 2RRNA 3GCXP 3MM8B 3PZPA 4ELTA 4CH7A 3DMJA 4I2PA 4LR8A 4DQRA 2PMZD 4ES1A 5J2MA 4F25A 1RSCA 2CQCA 5L38A 2R7RA 4DF8A 1JXEA 4XTTA 4EGLA 3F56A 4NLGA 4ZMMA 3NS6A 3OVBA 2DPIA 3M2UA 4MT1A 4ZLLA 4KRWA 5H1SV 2VJVA 4DSJA 1FA0A 4H4OB 2FTRA 5HMYA 5A2QU 4AD6A 5F8JA 3MD1A 4NXMJ 3HFKA 3SQGB 3KTQA 5A6PA 3WIVA 5FD1A 4X4RA 3PXGa 1Q8IA 2LQBA 3H7HB 4H4OA 2IC3B 3M4XA 2RH3A 3UQSA 1PGZA 1RTHB 1N5YB 1RTDB 2V63A 2OKQA 1RAIB 4CLLA 2W24A 3CMES 1UJ4A 3PHTA 2VKRA 4FYWB 3HKWA 2B9WA 4RW4A 2R8GA 4W4MA 4YY3F 3BGRB 2LEPA 4I2QA 3KUGA 2XMVA 2HWHA 2L3MA 1NK8A 1G1XA 1NDLA 4X64F 3KHHA 1ZA2B 4WIIA 1D9FA 2ZH1A 1FJGJ 3ISZA 1T8EA 2SXLA 3IRXB 3N28A 2DH9A 3NG8A 1S9GB 3FBFA 4CNZA 2ZDPA 3HLUA 2QLWA 4PXBA 2O3DA 3W2VB 3HD2A 5B0CA 4DS5A 4ZIWA 4KC5A 4QIEA 4XO0A 1PILA 1R27B 1X5OA 7FD1A 2MQQA 3G6YA 5J2NB 3D9BA 3MMBA 2GIRA 4BWJA 2BANB 4A8YA 2HHPA 3MM6A 4CT8A 4F4KA 4NXNF 3T6BA 1B7FA 2QLXA 2ROPA 4N7TA 3FJ2A 4ED3A 1CPZA 4JI0F 4BC9A 3TVYA 3VVTA 1UEUA 2WB4A 4DEZA 3DRPA 2IYIA 3KLIB 3HHLB 5L39A 5DG8A 1I94J 1WOSA 1I5OB 5DDQC 3FEYB 1VLYA 1RLDA 4RO0A 1LKZA 4OZ0A 5G0RB 4IO1A 3T19A 4ANDA 5C2GA 4LFCF 1WHXA 1FWKA 4MK9A 1S9EA 1MU2A 4ZN3A 1I51B 2E5IA 5IV4A 1NKCA 1AFJA 4HACB 4AL6A 2DNYA 3VAFA 3L95X 4QW9A 2UP1A 3E2EA 5CCLA 4RW7A 3CCMS 1T7PA 3RG6A 1SH3A 2BA9A 4IR1A 2V34A 4R0EA 4DL6A 4YUDA 2V9KA 2V69A 5AXLA 2XNRA 2XM3A 1TZ0A 1X4FA 1VMBA 1TKZB 3M2VB 1MG7A 2N7YA 1VIOA 2NPFA 3UW1A 1WF2A 2FJVA 4U96A 3RTVA 1EQ0A 3EGWB 1TFWA 3BGRA 1HPZB 4P73A 3HHLC 4RW4B 5F41A 4IG3B 6AT1B 4E0DA 1KKHA 2DD8S 4NLWA 1UVKA 3PVXA 5GVQA 1N0UA 3LGMA 3JS9A 4J9PA 4YMEA 2WW4A 2ERRA 4CZCA 2KZZA 4IDKA 4CQ1A 1TTHB 4NLSA 3I6PA 3Q8QB 3GIJA 1OWXA 1RT4A 3K7RA 2A10A 3Q0AA 2OMLA 3HHEA 3BQ0A 2KYZA 1RBOB 4YB6A 1HD1A 2RQ4A 2DGTA 3EPIA 2HRYA 2VG5A 1U1NA 1M1HA 2OO4A 3U02A 3OUYA 1RLCL 5K8PA 3CJSA 1R8PA 1CJTB 5DG7A 4OHWA 3CC7S 4HT5A 5KFMA 1QLNA 2E1MC 2CWKA 3NCPA 2F5GA 3MCMA 2R7SA 1RA6A 2C2KB 1QE1B 2MKJA 4WK3A 5B7WA 3P5BP 4KPYA 4UY85 2JFDA 3TUPA 1EQMA 1FFSB 4IH6A 4IQXA 1DURA 3LOUA 2VFRA 4NLDA 2VQFF 3VQSA 2RKIA 1NU4A 2EW9A 3B4DA 4FPRA 3OLAA 3MMAA 3IMQJ 3R5BA 2ZFHA 2CA9A 4WP3A 4QWAA 3C8YA 1RTIB 3E3XA 4KFBB 4L3NA 4R5PA 1GAOA 3IM8A 1UEKA 3AD7C 2JLGA 5D77A 3T1AA 2LP4A 4DL5A 3ET6B 1F6TA 4P7VA 4A47A 4C3KA 4C97A 4EYHB 2FQQB 3TAPA 1YK9A 5AT1B 2LEBA 1UW9A 1REVB 4RUBA 2YWKA 4DR3F 5I3UA 2WVFA 2DR6A 5D78A 3WZ0A 3ZTSA 4HTIA 3KLVA 2QL7B 2VZ9A 2BJ9A 4X4OA 2MMYA 1NZ8A 2O01C 3NS5A 5LSOA 3SI8A 2DRBA 5DZ6A 2V8DA 2JLFA 3LA0A 4NLPA 4ES3A 4TVAB 2HQCA 5MAOA 4OI1A 4QPXA 3AH6A 5K8MA 2WBRA 1TAUA 2BM1A 1JLQB 2EI5A 2QL9B 2VFVA 4DPXA 5KFZA 1R7IA 3VAKA 1T11A 4A4JA 2JZ5A 5HBMB 4MIBA 1SV5A 1YJUA 4ZPAA 5HMXA 4NCGA 4NLYA 2YKAA 3T9ZA 5KFNA 2W2NP 2CRLA 3H59A 4J37A 3H5SA 1HBOA 5F0WA 1W2BR 1LWCA 3NAHA 2BACA 3KLFA 3CCES 1QTMA 4LFAJ 3TA2A 4LF6F 3M8ZA 1R8AA 2RUGA 3BREA 4O4RA 3MM7A 2HGNA 1LWCB 1GNKA 4ZOSA 3W66A 2KHDA 2FY1A 5KG0A 4O3RA 3OVSA 4ERDA 4FF1A 5LMUJ 1TELA 1FTCA 5IT4A 4N76A 1P27B 1KOOA 1F5CA 2YWFA 3KYLA 2VL1A 3RW7A 1UETA 5DO2A 4PRFA 5DZ7A 2AJQA 1OPIA 3CIZA 4OI2A 4TNOA 2HVIA 2QJ3A 2MQLA 4ENOA 4F26A 5F8GA 1CG2A 2VG6B 2E5GA 1BLUA 3EZOA 4UUWA 3OSNA 2A1BA 1VQ4S 3QT8A 3HFVA 2UXCF 3IFEA 3W5ZA 4O3SA 1GK8A 4A8SA 1OQ3A 3A8KA 5D3GB 2FLOA 4IRDA 1VBZA 4ED2A 1FD2A 2HK3A 1DLOB 2XHCA 3UPFA 3SV4A 5IT9U 4WYLA 3SZ2A 2PEHA 5C24B 2I0XA 1RHMB 1LWFB 2YXLA 3HZEA 1VRTA 2GC8A 1YJRA 1RT3B 4KH0B 1K0TA 3RUBL 3TZZA 5ITHA 1MSWD 3KKFA 4HVZA 5BJRA 1TK8A 3MURP 4ZP6A 1IJEB 2MKKA 4OYMA 2QRRA 4M5HA 3RZAA 5A8WA 3M9MB 2DR5A 2HHUA 3CW2C 4ITSA 5E33A 3Q8VA 4LRAA 3OTOF 4HI2A 3H2VE 3ENWA 1A6LA 3KDNA 1H6KX 3H2UB 1WC4A 1VK8A 2XNQA 2AYGA 1FDNA
chains in the Genus database with same CATH topology
2RIJA 2UU9F 4A8OA 2HS3A 1U2RA 2COLA 3K57A 2D3UA 3J7Z5 1N52B 4K4YA 1IJFB 4X4QA 4EZ6A 2XZWA 4ECRA 2YKMB 3T9NA 4XPEA 4ZVFA 2M9KA 1JIHA 4BDPA 4UY8T 3R3TA 2GQ2A 2V5HG 4M8LA 1OO0B 2IRYA 1T3OA 3DLBA 3J81Y 4B3MF 1S0NA 1NHUA 4PWDB 3MD3A 4TY8B 1WG1A 2AYMA 4OX8A 1ZTTA 1LK7A 2CJAA 2PIIA 3DGPA 1LWEA 3OW2R 3AQPA 3V5RA 1TKXB 1ZH5A 4TLRA 3ZC4A 2ZVSA 1HL6A 3I4PA 2OH2A 2ROEA 4Y6IA 1SJFA 4FF2A 2DTJA 1LW0B 2CJQA 3T1YF 5L1IA 3T1HF 3CSKA 2HHXA 1L3SA 3OXFA 3CXCR 4C8NA 5SZTA 2AV5A 2YNFA 4MYUA 3M6VA 4TU9A 1KFDA 3H98A 2UUBF 3RRGA 4O23A 2CQBA 4OZ1A 3EGNA 2M4MA 3N6NA 2VBWA 4JI7F 3NCRA 3V81A 1GX6A 4BWMA 5HROA 2PT0A 4BC7A 1UP1A 5F9LA 3HPOA 5IT9Y 1FDBA 3SDEB 1UVIA 1JLCA 5IFMA 2UXBF 4KQZA 3O44A 2Q79A 1EETA 3GILA 2Z2MA 1X7VA 2B0GA 1SJ1A 3ITHA 2CIMA 4G6VB 4ZPVR 1K9MT 2G0CA 4HL9A 4ZS6A 1KVJA 1LFPA 1S48A 1SV5B 2WCXA 2VONA 3EGZA 2RRBA 4LMZA 3L7PA 1L5UA 1KVIA 3KK2B 3DLLQ 1KEKA 4PG8A 4I6AA 3MOZA 4RLEA 3TVZA 5D3GA 2CQHA 3SMZA 1H38A 4PUOB 2QSWA 5KG6A 4WFNQ 2KJWA 4LF8F 1WEYA 2XBPA 2LCWA 2CQDA 1RP5A 3PJXA 2FVSA 1P6TA 5J1EA 1N54B 4JV2A 2B4OA 3DNCA 2IBKA 2VKZG 3JAMY 3C2PA 2FLLA 2RQCA 2WAQD 4DSIA 3DHXA 5I3QA 5I42B 2GV1A 3KK3A 2KRBA 3GYXB 2W25A 2XGPA 3M2UB 3PW0A 2YTCA 2UXDF 1S4FA 4ZLPA 2ZE2B 2CPEA 2B4UA 3OL7A 4RW8A 1B0TA 2QMWA 2NS1B 3M9OB 2IM1A 4OJ1A 3HI9A 3KLGB 1ZM4A 5KFUA 2QEXS 2DCUB 2VPYB 4JI8F 4NMLA 3CJKB 3POTA 1U25A 1ZM2A 1TKTA 3NL0A 1HBMB 3HP6A 2CPIA 5F8MA 1K8AT 3X1LB 5D8HB 1L3UA 3PDNA 1LXJA 5HMWA 1RJJA 5DDRC 3C66A 1Q7YT 4W90B 4ED7A 3MWBA 4HDHA 5DG9A 4O4GA 4ZHRA 2Q66A 4ZPBA 1ZBTA 1V3ZA 1KTQA 3TAMA 3VAHA 3I9V9 2MB0B 2QA2A 1UFWA 1JNRB 3M32B 3DLEA 5H9EJ 4QYZJ 1VJWA 4NCGB 3IN5A 2MKCA 4PXDA 4NX9A 5J1NA 2KU7A 5F8NA 3W2VA 4FF3A 1SQEA 2D9OA 2IVMA 4X4TA 5KFOA 3HHDA 4JV5F 2B5JA 4JV1A 3Q8PB 2MQNA 2V4JB 4QU7A 3G71S 2RSQA 3I5AA 4ZP8A 2AGOA 2J9EA 2K1RA 1WEZA 2BUNA 1TK5A 1SXLA 5M2UA 4NZ6A 1X4BA 1R0AA 3C3LA 2XSFA 5KOWA 3GIKA 1WHYA 2W8KA 1F0XA 2XMKA 3IAS9 1K1QA 4IFYA 1B0PA 2LQJA 3MF5A 1SH2A 4KHRA 5D4NA 5C5JA 1C1BB 3J7A1 3PX6A 2FGCA 5A0YA 3M6UA 4DQQA 3OSPA 2DHGA 4WZMA 2AW0A 2OLWA 5KFCA 2MY7A 3DRRB 4U7CA 4J9QA 1NJYA 1QVFR 2PD1A 3IR7B 5L1LA 3MMAB 4OZJA 5KG1A 1Q82T 2RE1A 2HNDA 2M8DB 1CLFA 1EP4B 1HQUA 2CQGA 3ENVA 5B0FA 2Y1IA 4JYAF 3MAQA 4Y0FA 3JTNA 4B3RF 4NA2A 3KNAA 4F02A 1SJQA 1N36F 3MUTP 3OR2B 3HVTB 1X4DA 3UFCX 3TUZC 5CYMB 1A9NB 3LWMA 4NLQA 2C2DA 2IBOA 5F9NA 4YHHF 5C42A 2RD5C 4ZCMA 4R25A 2BXJA 2EBGA 2NREA 1QM9A 4IR9A 1IBLF 1QVGR 2GQQA 1XR7A 2YKPA 1UWBA 3H5UA 4KE5A 2VASA 5C24A 1Y5NB 4X4SA 1UKUA 3CCVS 1H7WA 3PX0A 2IM2A 3FSXA 1ZAVA 1TV6B 2N4DA 5DGBA 4OZNA 1Y4ZB 2VBXA 3DCAA 3J7YI 3BR8A 2HS4A 2XSJA 4JV0A 2AYEA 4RZRA 2DR8A 3DLKA 1TKZA 5HMZA 5EX3A 4NRTA 3HKZD 5K5MA 2W9CA 4YB1P 4ECYA 2BQ3A 3ICLA 4AXIA 1JLEB 1VHFA 3DOLA 4IOAQ 1YBAA 1SUQB 1HMVA 2FIUA 5IQQA 2VPWB 4TU7A 4C7QA 1D9AA 3CD6S 1U2FA 3FSYA 2IJFA 5LSRA 1HNWF 4Z2XA 5HN0A 4Q5VA 4MK7A 2IC3A 2CQ0A 2BRKA 1HFEL 2POKA 5T7LA 3L09A 3MEDB 2HMIA 1NHVA 2DB1A 2WBMA 3BGUA 5L1KA 4DMZA 1DRZA 4DR4F 2AX1A 3IWNC 3UCZP 4DL2A 4RWWA 3BSAA 2ASYA 2RT3A 3BS9A 3FEZA 2V4RA 1YVFA 4AFFA 5EWEA 4LUBA 2R2SA 1JWWA 1NKEA 4OHVA 3WBZA 2CG4A 4N5SA 2O67A 4Q7AA 4ELUA 3OXLA 4G1QB 4DWIA 2G4BA 2L41A 1FEEA 3P49B 3VZHA 2PSZA 4DV4F 3W2WA 3V4MA 5I42A 2KHCA 2DNOA 3H5YA 3I9ZA 3THVA 2J7WA 1JJ2R 3FDSA 2FC8A 5BYSA 1JMTA 1J5OB 4B9NA 4ICLB 3RAMA 2B43A 3GMGA 2PA3A 3V6HA 1R0AB 3SCJE 2DNMA 2XLIA 3NNHA 4CT9A 3DRYA 4M5DB 4EYIB 2R2UA 2BJEA 1QSLA 1IUJA 3MXHP 1FKPB 1ZM3A 2IYGA 2WONA 3QGGA 5KFBA 2ADCA 1N6QB 4RUCA 1HWIA 1L3TA 5FIIA 1S9FA 2QE5A 2R7OA 3KLHA 1K73T 3K59A 2R9LA 2JEFA 3BO2A 3PW7A 1IR0A 1RT1A 2VD3A 4FP9A 1NK9A 2RDJA 5KG2A 1SJ3P 3CCTA 5A8WB 1SL0A 4J5OA 4K4ZA 5C25A 3OBIA 3PFEA 1X4AA 1ULRA 2C3YA 2VG7A 3HVAA 5MLCV 1EETB 1ZM9A 4ECQA 2I8EA 5KOXA 1SB6A 3QMQA 4NOHA 3PW2A 4CO1A 4FVCA 2C2RA 2YX4A 2CQIA 1MNEA 4O3NA 4FS2A 2M3DA 4B3TF 2NUUG 3OR1B 2OAUA 1C1CA 1S1TB 1IKXB 4G1IA 5E3CA 1O5JA 1SL1A 3N5FA 2KJVA 2DO4A 3MPVA 1PC4A 3DLKB 2DT9A 3I31A 4AQYF 4DF4A 1X4GA 1Y3KA 4KHMA 1BQNA 3GFYA 1X0PA 3U1MA 1NEEA 3BO4A 4DLEA 1VQLS 1Q16B 1Y5LB 2B7BB 3B4MA 3BGLA 4Q2LA 5KFEA 2C3MA 5KFPA 3TX8A 3LP0B 2JSXA 2HLUA 2MZSA 3TYTA 2E1RA 3Q8RB 3MI7X 1QAJA 2WB1D 3QZ7A 5KT6A 2VPZB 5H9FJ 2JDJA 2J8AA 1R3NA 1HMVB 4XDCA 4YDDB 5KG5A 1NK5A 5FJ4A 5L8RC 5J2PB 2BZ2A 4IFVB 4Q8EA 1OSDA 2YY3A 4CI0B 2HIQA 4WU2A 4I6WA 2EFQA 1JKHA 2MPUA 2LU2A 2UUCF 1B64A 3ZZUA 4A8QA 5EUHA 1JJ4A 4ZP9A 5E0OA 3NP5A 1JKHB 1V9OA 1TL5A 4LSLB 3M6XA 3OLBA 1UA1A 1U45A 3DHWC 3GIIA 2IM3A 1N33F 2OTJS 3DRRA 1I6JA 3CD5A 3NAIA 5DQGA 1QY7A 4ZA1A 4EBCA 2F8MA 2HWIA 1M5SA 4U67Q 2P6TA 3Q2SC 4QJVA 4Y00A 1RT4B 4ZDNA 2ZHAA 4J9NA 4ECVA 2B9XA 3EYZA 2ACYA 1RWUA 1KLMB 5KFGA 2OSRA 5M2PA 2J9DE 1S49A 3P6YC 3H5XA 3CCQS 2B7CB 1IN0A 2NQPA 1JLBA