1U74B

Electron transfer complex between cytochrome c and cytochrome c peroxidase
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
108
structure length
108
Chain Sequence
TEFKAGSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWDENNMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLKKASE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cytochrome c peroxidase
publication title Electron transfer between cytochrome c and cytochome c peroxidase in single crystals.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 30
structure length 108
sequence length 108
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00034 Cytochrom_C Cytochrome c
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1u74B00
2BCNB 2JTIB 3HQ8A 5KKZB 1CIHA 4WQ9A 1CIFA 3KZIV 1BCCD 3L4MA 4YE1A 2PACA 3ZOOA 1MG3D 1L9JC 1EB7A 2C1VA 1N9CA 2JQRA 3H1LD 1J3SA 1AYGA 1CRHA 2VHDA 3L4OA 5EXQA 2C8SA 2CA3B 2AXTV 2CE1A 1CRIA 3O5CA 3A9FA 2MHMA 2N9IA 5GTHV 1BE3D 3RN1A 4GEDB 5KAFV 2OZ1A 3PXTA 1NNOA 1S5LV 1DW2A 1C7MA 1A56A 4AAOA 1YICA 2B0ZB 1B7VA 3SWSA 1CXAA 3HQ7A 1A2SA 3MK7B 1FI7A 1I6DA 3ZCFA 1GU2A 3TGUD 5DJQC 1HJ4A 3CU4A 2PCBB 1KIBA 1BGYD 1M60A 4EICA 1IRVA 1E29A 1CTJA 4IL6V 1DT1A 451CA 4PWAA 1CYCA 1CSXA 4DY9A 4AALA 2OZ1B 4WQ8A 3DP5A 4UB6V 3ZOYA 1HH7A 5B66V 5KLIB 4H0JA 3O20A 5DFSA 3L71D 4WQEA 1P84D 1CRCA 1H9YA 1YTCA 1CCHA 1C2NA 1F1FA 3NBSA 4FA1A 1I54A 4FANA 5CIBB 5CIDB 1PPJD 1SQBD 3O0RC 2ZBOA 1YFCA 2GIWA 1VYDA 3L75D 4PJ0V 5DF5A 4FAVA 1MG2D 3H1ID 1KB0A 1DW3A 2N18C 2ZOOA 1LFMA 1GQ1A 1OAEA 1YEBA 3L74D 1KYOW 1FJ0A 1KX2A 2GC7D 4EIEA 4JCGA 1HCMA 351CA 5H2FV 5KAIV 1I8OA 1QL4A 2BH5X 1BL9A 4MU8A 1WVEC 2A06D 3RMZA 2N3YA 3VNWA 3TYIA 1RZ5A 3CXHD 1K3HA 2YCCA 2C1UA 1FI9A 2B12B 2YQBA 3RLMA 1NTMD 2HV4A 1AOQA 4PW9B 2B4ZA 3ZIYA 1N90A 3WC8A 1I8PA 1CIGA 1IRWA 1JDLA 3HQ9A 2B10B 1A8CA 3CX5W 2BLFB 1CRGA 1FI3A 4L3HA 4RSZA 1AOFA 1U75B 1QKSA 1NIRA 5C9MA 1W2LA 3X39A 4WQ7A 1H33A 2EXVA 1I6EA 1RAPA 1SQXD 3CP5A 4EIDA 1CHIA 2ZONG 2CXBA 1HRCA 5IY51 1I5TA 1NTKD 1CYIA 2ZZS1 3MK7C 4P4QB 2PCCB 3JBTB 2QJKB 1CO6A 1RAQA 1LC1A 1NMIA 1DIIC 2BGVX 2YIUB 4U3FD 1CRJA 3BCCD 1SQVD 1CHJA 1CORA 2DGEA 3M97X 4AX3A 4WQDA 3CYTI 1RZ6A 5C0ZA 1HJ3A 3OCDA 4WQAA 1N15A 1R0QA 1DW1A 1OCDA 1IZL0 2BPBB 1LMSA 1NTZD 1M6ZA 1H33B 3SLEA 1N50A 2QJYB 2YK3A 2FRCA 2BCCD 1LS9A 1L9BC 1C52A 1CIEA 4WQCA 1GDVA 1ZRTD 3SJLA 1YIQA 4O1WA 1NU1D 1YCCA 1CEDA 3H1JD 4WQBA 2C2CA 4XYDB 4KMGA 5CIGB 5KLVD 4FA5A 3CWBD 4L3GA 3A0HV 3O1YA 1U74B 3SXTA 1C6SA 1CHHA 3RN0A 1GJQA 1H32A 1DIQC 4L1QA 3OCDB 4D6TD 2ZXYA 3H1KD 1C2RA 4FA9A 1CRYA 3L70D 4Q5PA 2N9JA 3NWVA 3WFCC 3VRDA 2DVHA 4Y5RA 2V07A 3PXSA 3DMIA 1CC5A 1H1OA 3ORVA 1QN2A 1QYZA 5TISV 2D0WA 1M70A 1H31A 3L73D 4EIFA 3SVWA 2FYNB 1CSUA 2AIUA 2QJPB 2XTSB 1NMLA 1COTA 4N0KA 1IQCA 2V08A 3DR0A 1K3GA 1CSVA 1GKSA 1W5CT 1YEAA 1L0ND 4NFGB 5B6QA 3C2CA 2AI5A 4LJIA 1SQPD 1HZVA 1C6OA 5B5EV 1KV9A 5CIFB 5CICB 3VYMA 1H32B 1FHBA 1S6VB 4QAOA 4FA4A 3PXWA 2ORLA 4XXLA 5DJQB 2FWLA 4FB1A 1MZ4A 1E2RA 4GYDA 3NBTA 5CIHB 1CSWA 1H9XA 1AKKA 2CE0A 1H31B 1GIWA 2C1DA 1KB9D 4AAMA 2MTAC 1C6RA 4AANA 1DVVA 1CCRA 4H0KA 1CTZA 4K3IA 2GB8B 1HZUA 3WFDC 2FYUD 1HROA 1KYOD 3CXHW 3H1HD 4J20A 4PD4D 2N3BA 2C9XB 5CIEB 1F1CA 1C75A 1SQQD 2L4DA 3OA8A 3HQ6A 3L72D 2D0SA 1DVHA 3A0BV 2IBZD 1HJ5A 1DW0A 5GTIV 1CXCA 3ZOWA 3WUIA 1CYJA 1E8EA 2GC4D 2N18B 2LIRA 2C1DB 2BH4X 1KX7A 4V2KA 1CTYA 2I8FA 1PP9D 1I55A 3WFEC 155CA 3ZBMA 1FCDC 1YNRA 1ZZHA 1LC2A 3WFBC 2LITA 5CYTR 1ETPA 3PH2B 5E79V 3CX5D 2B11B 1EZVD 1IO3A 3OA8B 1L0LD 4O1QA 3ZOXA 4UB8V 5AURA 2CA4B 1FOCA 1CNOA 1WEJF 3WU2V 1QL3A
chains in the Genus database with same CATH superfamily
2BCNB 2JTIB 3HQ8A 5KKZB 1CIHA 4WQ9A 1CIFA 3KZIV 1BCCD 3L4MA 4YE1A 2PACA 3ZOOA 1MG3D 1L9JC 1EB7A 2C1VA 1N9CA 2JQRA 3H1LD 1J3SA 1AYGA 1CRHA 2VHDA 3L4OA 5EXQA 2C8SA 2CA3B 2AXTV 2CE1A 1CRIA 3O5CA 3A9FA 2MHMA 2N9IA 5GTHV 1BE3D 3RN1A 4GEDB 5KAFV 2OZ1A 3PXTA 1NNOA 1S5LV 1DW2A 1C7MA 1A56A 4AAOA 1YICA 2B0ZB 1B7VA 3SWSA 1CXAA 3HQ7A 1A2SA 3MK7B 1FI7A 1I6DA 3ZCFA 1GU2A 3TGUD 5DJQC 1HJ4A 3CU4A 2PCBB 1KIBA 1BGYD 1M60A 4EICA 1IRVA 1E29A 1CTJA 4IL6V 1DT1A 451CA 4PWAA 1CYCA 1CSXA 4DY9A 4AALA 2OZ1B 4WQ8A 3DP5A 4UB6V 3ZOYA 1HH7A 5B66V 5KLIB 4H0JA 3O20A 5DFSA 3L71D 4WQEA 1P84D 1CRCA 1H9YA 1YTCA 1CCHA 1C2NA 1F1FA 3NBSA 4FA1A 1I54A 4FANA 5CIBB 5CIDB 1PPJD 1SQBD 3O0RC 2ZBOA 1YFCA 2GIWA 1VYDA 3L75D 4PJ0V 5DF5A 4FAVA 1MG2D 3H1ID 1KB0A 1DW3A 2N18C 2ZOOA 1LFMA 1GQ1A 1OAEA 1YEBA 3L74D 1KYOW 1FJ0A 1KX2A 2GC7D 4EIEA 4JCGA 1HCMA 351CA 5H2FV 5KAIV 1I8OA 1QL4A 2BH5X 1BL9A 4MU8A 1WVEC 2A06D 3RMZA 2N3YA 3VNWA 3TYIA 1RZ5A 3CXHD 1K3HA 2YCCA 2C1UA 1FI9A 2B12B 2YQBA 3RLMA 1NTMD 2HV4A 1AOQA 4PW9B 2B4ZA 3ZIYA 1N90A 3WC8A 1I8PA 1CIGA 1IRWA 1JDLA 3HQ9A 2B10B 1A8CA 3CX5W 2BLFB 1CRGA 1FI3A 4L3HA 4RSZA 1AOFA 1U75B 1QKSA 1NIRA 5C9MA 1W2LA 3X39A 4WQ7A 1H33A 2EXVA 1I6EA 1RAPA 1SQXD 3CP5A 4EIDA 1CHIA 2ZONG 2CXBA 1HRCA 5IY51 1I5TA 1NTKD 1CYIA 2ZZS1 3MK7C 4P4QB 2PCCB 3JBTB 2QJKB 1CO6A 1RAQA 1LC1A 1NMIA 1DIIC 2BGVX 2YIUB 4U3FD 1CRJA 3BCCD 1SQVD 1CHJA 1CORA 2DGEA 3M97X 4AX3A 4WQDA 3CYTI 1RZ6A 5C0ZA 1HJ3A 3OCDA 4WQAA 1N15A 1R0QA 1DW1A 1OCDA 1IZL0 2BPBB 1LMSA 1NTZD 1M6ZA 1H33B 3SLEA 1N50A 2QJYB 2YK3A 2FRCA 2BCCD 1LS9A 1L9BC 1C52A 1CIEA 4WQCA 1GDVA 1ZRTD 3SJLA 1YIQA 4O1WA 1NU1D 1YCCA 1CEDA 3H1JD 4WQBA 2C2CA 4XYDB 4KMGA 5CIGB 5KLVD 4FA5A 3CWBD 4L3GA 3A0HV 3O1YA 1U74B 3SXTA 1C6SA 1CHHA 3RN0A 1GJQA 1H32A 1DIQC 4L1QA 3OCDB 4D6TD 2ZXYA 3H1KD 1C2RA 4FA9A 1CRYA 3L70D 4Q5PA 2N9JA 3NWVA 3WFCC 3VRDA 2DVHA 4Y5RA 2V07A 3PXSA 3DMIA 1CC5A 1H1OA 3ORVA 1QN2A 1QYZA 5TISV 2D0WA 1M70A 1H31A 3L73D 4EIFA 3SVWA 2FYNB 1CSUA 2AIUA 2QJPB 2XTSB 1NMLA 1COTA 4N0KA 1IQCA 2V08A 3DR0A 1K3GA 1CSVA 1GKSA 1W5CT 1YEAA 1L0ND 4NFGB 5B6QA 3C2CA 2AI5A 4LJIA 1SQPD 1HZVA 1C6OA 5B5EV 1KV9A 5CIFB 5CICB 3VYMA 1H32B 1FHBA 1S6VB 4QAOA 4FA4A 3PXWA 2ORLA 4XXLA 5DJQB 2FWLA 4FB1A 1MZ4A 1E2RA 4GYDA 3NBTA 5CIHB 1CSWA 1H9XA 1AKKA 2CE0A 1H31B 1GIWA 2C1DA 1KB9D 4AAMA 2MTAC 1C6RA 4AANA 3D0WA 1DVVA 1CCRA 4H0KA 1CTZA 4K3IA 2GB8B 1HZUA 3WFDC 2FYUD 1HROA 1KYOD 3CXHW 3H1HD 4J20A 4PD4D 2N3BA 2C9XB 5CIEB 1F1CA 1C75A 1SQQD 2L4DA 3OA8A 3HQ6A 3L72D 2D0SA 1DVHA 3A0BV 2IBZD 1HJ5A 1DW0A 5GTIV 1CXCA 3ZOWA 3WUIA 1CYJA 1E8EA 2GC4D 2N18B 2LIRA 2C1DB 2BH4X 1KX7A 4V2KA 1CTYA 2I8FA 1PP9D 1I55A 3WFEC 155CA 3ZBMA 1FCDC 1YNRA 1ZZHA 1LC2A 3WFBC 2LITA 5CYTR 1ETPA 3PH2B 5E79V 3CX5D 2B11B 1EZVD 1IO3A 3OA8B 1L0LD 4O1QA 3ZOXA 4UB8V 5AURA 2CA4B 1FOCA 1CNOA 1WEJF 3WU2V 1QL3A
chains in the Genus database with same CATH topology
2BCNB 2JTIB 3HQ8A 5KKZB 1CIHA 4WQ9A 1CIFA 3KZIV 1BCCD 3L4MA 4YE1A 2PACA 3ZOOA 1MG3D 1L9JC 1EB7A 2C1VA 1N9CA 2JQRA 3H1LD 1J3SA 1AYGA 1CRHA 2VHDA 3L4OA 5EXQA 2C8SA 2CA3B 2AXTV 2CE1A 1CRIA 3O5CA 3A9FA 2MHMA 2N9IA 5GTHV 1BE3D 3RN1A 4GEDB 5KAFV 2OZ1A 3PXTA 1NNOA 1S5LV 1DW2A 1C7MA 1A56A 4AAOA 1YICA 2B0ZB 1B7VA 3SWSA 1CXAA 3HQ7A 1A2SA 3MK7B 1FI7A 1I6DA 3ZCFA 1GU2A 3TGUD 5DJQC 1HJ4A 3CU4A 2PCBB 1KIBA 1BGYD 1M60A 4EICA 1IRVA 1E29A 1CTJA 4IL6V 1DT1A 451CA 4PWAA 1CYCA 1CSXA 4DY9A 4AALA 2OZ1B 4WQ8A 3DP5A 4UB6V 3ZOYA 1HH7A 5B66V 5KLIB 4H0JA 3O20A 5DFSA 3L71D 4WQEA 1P84D 1CRCA 1H9YA 1YTCA 1CCHA 1C2NA 1F1FA 3NBSA 4FA1A 1I54A 4FANA 5CIBB 5CIDB 1PPJD 1SQBD 3O0RC 2ZBOA 1YFCA 2GIWA 1VYDA 3L75D 4PJ0V 5DF5A 4FAVA 1MG2D 3H1ID 1KB0A 1DW3A 2N18C 2ZOOA 1LFMA 1GQ1A 1OAEA 1YEBA 3L74D 1KYOW 1FJ0A 1KX2A 2GC7D 4EIEA 4JCGA 1HCMA 351CA 5H2FV 5KAIV 1I8OA 1QL4A 2BH5X 1BL9A 4MU8A 1WVEC 2A06D 3RMZA 2N3YA 3VNWA 3TYIA 1RZ5A 3CXHD 1K3HA 2YCCA 2C1UA 1FI9A 2B12B 2YQBA 3RLMA 1NTMD 2HV4A 1AOQA 4PW9B 2B4ZA 3ZIYA 1N90A 3WC8A 1I8PA 1CIGA 1IRWA 1JDLA 3HQ9A 2B10B 1A8CA 3CX5W 2BLFB 1CRGA 1FI3A 4L3HA 4RSZA 1AOFA 1U75B 1QKSA 1NIRA 5C9MA 1W2LA 3X39A 4WQ7A 1H33A 2EXVA 1I6EA 1RAPA 1SQXD 3CP5A 4EIDA 1CHIA 2ZONG 2CXBA 1HRCA 5IY51 1I5TA 1NTKD 1CYIA 2ZZS1 3MK7C 4P4QB 2PCCB 3JBTB 2QJKB 1CO6A 1RAQA 1LC1A 1NMIA 1DIIC 2BGVX 2YIUB 4U3FD 1CRJA 3BCCD 1SQVD 1CHJA 1CORA 2DGEA 3M97X 4AX3A 4WQDA 3CYTI 1RZ6A 5C0ZA 1HJ3A 3OCDA 4WQAA 1N15A 1R0QA 1DW1A 1OCDA 1IZL0 2BPBB 1LMSA 1NTZD 1M6ZA 1H33B 3SLEA 1N50A 2QJYB 2YK3A 2FRCA 2BCCD 1LS9A 1L9BC 1C52A 1CIEA 4WQCA 1GDVA 1ZRTD 3SJLA 1YIQA 4O1WA 1NU1D 1YCCA 1CEDA 3H1JD 4WQBA 2C2CA 4XYDB 4KMGA 5CIGB 5KLVD 4FA5A 3CWBD 4L3GA 3A0HV 3O1YA 1U74B 3SXTA 1C6SA 1CHHA 3RN0A 1GJQA 1H32A 1DIQC 4L1QA 3OCDB 4D6TD 2ZXYA 3H1KD 1C2RA 4FA9A 1CRYA 3L70D 4Q5PA 2N9JA 3NWVA 3WFCC 3VRDA 2DVHA 4Y5RA 2V07A 3PXSA 3DMIA 1CC5A 1H1OA 3ORVA 1QN2A 1QYZA 5TISV 2D0WA 1M70A 1H31A 3L73D 4EIFA 3SVWA 2FYNB 1CSUA 2AIUA 2QJPB 2XTSB 1NMLA 1COTA 4N0KA 1IQCA 2V08A 3DR0A 1K3GA 1CSVA 1GKSA 1W5CT 1YEAA 1L0ND 4NFGB 5B6QA 3C2CA 2AI5A 4LJIA 1SQPD 1HZVA 1C6OA 5B5EV 1KV9A 5CIFB 5CICB 3VYMA 1H32B 1FHBA 1S6VB 4QAOA 4FA4A 3PXWA 2ORLA 4XXLA 5DJQB 2FWLA 4FB1A 1MZ4A 1E2RA 4GYDA 3NBTA 5CIHB 1CSWA 1H9XA 1AKKA 2CE0A 1H31B 1GIWA 2C1DA 1KB9D 4AAMA 2MTAC 1C6RA 4AANA 1DVVA 1CCRA 4H0KA 1CTZA 4K3IA 2GB8B 1HZUA 3WFDC 2FYUD 1HROA 1KYOD 3CXHW 3H1HD 4J20A 4PD4D 2N3BA 2C9XB 5CIEB 1F1CA 1C75A 1SQQD 2L4DA 3OA8A 3HQ6A 3L72D 2D0SA 1DVHA 3A0BV 2IBZD 1HJ5A 1DW0A 5GTIV 1CXCA 3ZOWA 3WUIA 1CYJA 1E8EA 2GC4D 2N18B 2LIRA 2C1DB 2BH4X 1KX7A 4V2KA 1CTYA 2I8FA 1PP9D 1I55A 3WFEC 155CA 3ZBMA 1FCDC 1YNRA 1ZZHA 1LC2A 3WFBC 2LITA 5CYTR 1ETPA 3PH2B 5E79V 3CX5D 2B11B 1EZVD 1IO3A 3OA8B 1L0LD 4O1QA 3ZOXA 4UB8V 5AURA 2CA4B 1FOCA 1CNOA 1WEJF 3WU2V 1QL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BCN B;  2JTI B;  3HQ8 A;  5KKZ B;  1CIH A;  4WQ9 A;  1CIF A;  3KZI V;  1BCC D;  3L4M A;  4YE1 A;  2PAC A;  3ZOO A;  1MG3 D;  1L9J C;  1EB7 A;  2C1V A;  1N9C A;  2JQR A;  3H1L D;  1J3S A;  1AYG A;  1CRH A;  2VHD A;  3L4O A;  5EXQ A;  2C8S A;  2CA3 B;  2AXT V;  2CE1 A;  1CRI A;  3O5C A;  3A9F A;  2MHM A;  2N9I A;  5GTH V;  1BE3 D;  3RN1 A;  4GED B;  5KAF V;  2OZ1 A;  3PXT A;  1NNO A;  1S5L V;  1DW2 A;  1C7M A;  1A56 A;  4AAO A;  1YIC A;  2B0Z B;  1B7V A;  3SWS A;  1CXA A;  3HQ7 A;  1A2S A;  3MK7 B;  1FI7 A;  1I6D A;  3ZCF A;  1GU2 A;  3TGU D;  5DJQ C;  1HJ4 A;  3CU4 A;  2PCB B;  1KIB A;  1BGY D;  1M60 A;  4EIC A;  1IRV A;  1E29 A;  1CTJ A;  4IL6 V;  1DT1 A;  451C A;  4PWA A;  1CYC A;  1CSX A;  4DY9 A;  4AAL A;  2OZ1 B;  4WQ8 A;  3DP5 A;  4UB6 V;  3ZOY A;  1HH7 A;  5B66 V;  5KLI B;  4H0J A;  3O20 A;  5DFS A;  3L71 D;  4WQE A;  1P84 D;  1CRC A;  1H9Y A;  1YTC A;  1CCH A;  1C2N A;  1F1F A;  3NBS A;  4FA1 A;  1I54 A;  4FAN A;  5CIB B;  5CID B;  1PPJ D;  1SQB D;  3O0R C;  2ZBO A;  1YFC A;  2GIW A;  1VYD A;  3L75 D;  4PJ0 V;  5DF5 A;  4FAV A;  1MG2 D;  3H1I D;  1KB0 A;  1DW3 A;  2N18 C;  2ZOO A;  1LFM A;  1GQ1 A;  1OAE A;  1YEB A;  3L74 D;  1KYO W;  1FJ0 A;  1KX2 A;  2GC7 D;  4EIE A;  4JCG A;  1HCM A;  351C A;  5H2F V;  5KAI V;  1I8O A;  1QL4 A;  2BH5 X;  1BL9 A;  4MU8 A;  1WVE C;  2A06 D;  3RMZ A;  2N3Y A;  3VNW A;  3TYI A;  1RZ5 A;  3CXH D;  1K3H A;  2YCC A;  2C1U A;  1FI9 A;  2B12 B;  2YQB A;  3RLM A;  1NTM D;  2HV4 A;  1AOQ A;  4PW9 B;  2B4Z A;  3ZIY A;  1N90 A;  3WC8 A;  1I8P A;  1CIG A;  1IRW A;  1JDL A;  3HQ9 A;  2B10 B;  1A8C A;  3CX5 W;  2BLF B;  1CRG A;  1FI3 A;  4L3H A;  4RSZ A;  1AOF A;  1U75 B;  1QKS A;  1NIR A;  5C9M A;  1W2L A;  3X39 A;  4WQ7 A;  1H33 A;  2EXV A;  1I6E A;  1RAP A;  1SQX D;  3CP5 A;  4EID A;  1CHI A;  2ZON G;  2CXB A;  1HRC A;  5IY5 1;  1I5T A;  1NTK D;  1CYI A;  2ZZS 1;  3MK7 C;  4P4Q B;  2PCC B;  3JBT B;  2QJK B;  1CO6 A;  1RAQ A;  1LC1 A;  1NMI A;  1DII C;  2BGV X;  2YIU B;  4U3F D;  1CRJ A;  3BCC D;  1SQV D;  1CHJ A;  1COR A;  2DGE A;  3M97 X;  4AX3 A;  4WQD A;  3CYT I;  1RZ6 A;  5C0Z A;  1HJ3 A;  3OCD A;  4WQA A;  1N15 A;  1R0Q A;  1DW1 A;  1OCD A;  1IZL 0;  2BPB B;  1LMS A;  1NTZ D;  1M6Z A;  1H33 B;  3SLE A;  1N50 A;  2QJY B;  2YK3 A;  2FRC A;  2BCC D;  1LS9 A;  1L9B C;  1C52 A;  1CIE A;  4WQC A;  1GDV A;  1ZRT D;  3SJL A;  1YIQ A;  4O1W A;  1NU1 D;  1YCC A;  1CED A;  3H1J D;  4WQB A;  2C2C A;  4XYD B;  4KMG A;  5CIG B;  5KLV D;  4FA5 A;  3CWB D;  4L3G A;  3A0H V;  3O1Y A;  1U74 B;  3SXT A;  1C6S A;  1CHH A;  3RN0 A;  1GJQ A;  1H32 A;  1DIQ C;  4L1Q A;  3OCD B;  4D6T D;  2ZXY A;  3H1K D;  1C2R A;  4FA9 A;  1CRY A;  3L70 D;  4Q5P A;  2N9J A;  3NWV A;  3WFC C;  3VRD A;  2DVH A;  4Y5R A;  2V07 A;  3PXS A;  3DMI A;  1CC5 A;  1H1O A;  3ORV A;  1QN2 A;  1QYZ A;  5TIS V;  2D0W A;  1M70 A;  1H31 A;  3L73 D;  4EIF A;  3SVW A;  2FYN B;  1CSU A;  2AIU A;  2QJP B;  2XTS B;  1NML A;  1COT A;  4N0K A;  1IQC A;  2V08 A;  3DR0 A;  1K3G A;  1CSV A;  1GKS A;  1W5C T;  1YEA A;  1L0N D;  4NFG B;  5B6Q A;  3C2C A;  2AI5 A;  4LJI A;  1SQP D;  1HZV A;  1C6O A;  5B5E V;  1KV9 A;  5CIF B;  5CIC B;  3VYM A;  1H32 B;  1FHB A;  1S6V B;  4QAO A;  4FA4 A;  3PXW A;  2ORL A;  4XXL A;  5DJQ B;  2FWL A;  4FB1 A;  1MZ4 A;  1E2R A;  4GYD A;  3NBT A;  5CIH B;  1CSW A;  1H9X A;  1AKK A;  2CE0 A;  1H31 B;  1GIW A;  2C1D A;  1KB9 D;  4AAM A;  2MTA C;  1C6R A;  4AAN A;  1DVV A;  1CCR A;  4H0K A;  1CTZ A;  4K3I A;  2GB8 B;  1HZU A;  3WFD C;  2FYU D;  1HRO A;  1KYO D;  3CXH W;  3H1H D;  4J20 A;  4PD4 D;  2N3B A;  2C9X B;  5CIE B;  1F1C A;  1C75 A;  1SQQ D;  2L4D A;  3OA8 A;  3HQ6 A;  3L72 D;  2D0S A;  1DVH A;  3A0B V;  2IBZ D;  1HJ5 A;  1DW0 A;  5GTI V;  1CXC A;  3ZOW A;  3WUI A;  1CYJ A;  1E8E A;  2GC4 D;  2N18 B;  2LIR A;  2C1D B;  2BH4 X;  1KX7 A;  4V2K A;  1CTY A;  2I8F A;  1PP9 D;  1I55 A;  3WFE C;  155C A;  3ZBM A;  1FCD C;  1YNR A;  1ZZH A;  1LC2 A;  3WFB C;  2LIT A;  5CYT R;  1ETP A;  3PH2 B;  5E79 V;  3CX5 D;  2B11 B;  1EZV D;  1IO3 A;  3OA8 B;  1L0L D;  4O1Q A;  3ZOX A;  4UB8 V;  5AUR A;  2CA4 B;  1FOC A;  1CNO A;  1WEJ F;  3WU2 V;  1QL3 A; 
#chains in the Genus database with same CATH topology
 2BCN B;  2JTI B;  3HQ8 A;  5KKZ B;  1CIH A;  4WQ9 A;  1CIF A;  3KZI V;  1BCC D;  3L4M A;  4YE1 A;  2PAC A;  3ZOO A;  1MG3 D;  1L9J C;  1EB7 A;  2C1V A;  1N9C A;  2JQR A;  3H1L D;  1J3S A;  1AYG A;  1CRH A;  2VHD A;  3L4O A;  5EXQ A;  2C8S A;  2CA3 B;  2AXT V;  2CE1 A;  1CRI A;  3O5C A;  3A9F A;  2MHM A;  2N9I A;  5GTH V;  1BE3 D;  3RN1 A;  4GED B;  5KAF V;  2OZ1 A;  3PXT A;  1NNO A;  1S5L V;  1DW2 A;  1C7M A;  1A56 A;  4AAO A;  1YIC A;  2B0Z B;  1B7V A;  3SWS A;  1CXA A;  3HQ7 A;  1A2S A;  3MK7 B;  1FI7 A;  1I6D A;  3ZCF A;  1GU2 A;  3TGU D;  5DJQ C;  1HJ4 A;  3CU4 A;  2PCB B;  1KIB A;  1BGY D;  1M60 A;  4EIC A;  1IRV A;  1E29 A;  1CTJ A;  4IL6 V;  1DT1 A;  451C A;  4PWA A;  1CYC A;  1CSX A;  4DY9 A;  4AAL A;  2OZ1 B;  4WQ8 A;  3DP5 A;  4UB6 V;  3ZOY A;  1HH7 A;  5B66 V;  5KLI B;  4H0J A;  3O20 A;  5DFS A;  3L71 D;  4WQE A;  1P84 D;  1CRC A;  1H9Y A;  1YTC A;  1CCH A;  1C2N A;  1F1F A;  3NBS A;  4FA1 A;  1I54 A;  4FAN A;  5CIB B;  5CID B;  1PPJ D;  1SQB D;  3O0R C;  2ZBO A;  1YFC A;  2GIW A;  1VYD A;  3L75 D;  4PJ0 V;  5DF5 A;  4FAV A;  1MG2 D;  3H1I D;  1KB0 A;  1DW3 A;  2N18 C;  2ZOO A;  1LFM A;  1GQ1 A;  1OAE A;  1YEB A;  3L74 D;  1KYO W;  1FJ0 A;  1KX2 A;  2GC7 D;  4EIE A;  4JCG A;  1HCM A;  351C A;  5H2F V;  5KAI V;  1I8O A;  1QL4 A;  2BH5 X;  1BL9 A;  4MU8 A;  1WVE C;  2A06 D;  3RMZ A;  2N3Y A;  3VNW A;  3TYI A;  1RZ5 A;  3CXH D;  1K3H A;  2YCC A;  2C1U A;  1FI9 A;  2B12 B;  2YQB A;  3RLM A;  1NTM D;  2HV4 A;  1AOQ A;  4PW9 B;  2B4Z A;  3ZIY A;  1N90 A;  3WC8 A;  1I8P A;  1CIG A;  1IRW A;  1JDL A;  3HQ9 A;  2B10 B;  1A8C A;  3CX5 W;  2BLF B;  1CRG A;  1FI3 A;  4L3H A;  4RSZ A;  1AOF A;  1U75 B;  1QKS A;  1NIR A;  5C9M A;  1W2L A;  3X39 A;  4WQ7 A;  1H33 A;  2EXV A;  1I6E A;  1RAP A;  1SQX D;  3CP5 A;  4EID A;  1CHI A;  2ZON G;  2CXB A;  1HRC A;  5IY5 1;  1I5T A;  1NTK D;  1CYI A;  2ZZS 1;  3MK7 C;  4P4Q B;  2PCC B;  3JBT B;  2QJK B;  1CO6 A;  1RAQ A;  1LC1 A;  1NMI A;  1DII C;  2BGV X;  2YIU B;  4U3F D;  1CRJ A;  3BCC D;  1SQV D;  1CHJ A;  1COR A;  2DGE A;  3M97 X;  4AX3 A;  4WQD A;  3CYT I;  1RZ6 A;  5C0Z A;  1HJ3 A;  3OCD A;  4WQA A;  1N15 A;  1R0Q A;  1DW1 A;  1OCD A;  1IZL 0;  2BPB B;  1LMS A;  1NTZ D;  1M6Z A;  1H33 B;  3SLE A;  1N50 A;  2QJY B;  2YK3 A;  2FRC A;  2BCC D;  1LS9 A;  1L9B C;  1C52 A;  1CIE A;  4WQC A;  1GDV A;  1ZRT D;  3SJL A;  1YIQ A;  4O1W A;  1NU1 D;  1YCC A;  1CED A;  3H1J D;  4WQB A;  2C2C A;  4XYD B;  4KMG A;  5CIG B;  5KLV D;  4FA5 A;  3CWB D;  4L3G A;  3A0H V;  3O1Y A;  1U74 B;  3SXT A;  1C6S A;  1CHH A;  3RN0 A;  1GJQ A;  1H32 A;  1DIQ C;  4L1Q A;  3OCD B;  4D6T D;  2ZXY A;  3H1K D;  1C2R A;  4FA9 A;  1CRY A;  3L70 D;  4Q5P A;  2N9J A;  3NWV A;  3WFC C;  3VRD A;  2DVH A;  4Y5R A;  2V07 A;  3PXS A;  3DMI A;  1CC5 A;  1H1O A;  3ORV A;  1QN2 A;  1QYZ A;  5TIS V;  2D0W A;  1M70 A;  1H31 A;  3L73 D;  4EIF A;  3SVW A;  2FYN B;  1CSU A;  2AIU A;  2QJP B;  2XTS B;  1NML A;  1COT A;  4N0K A;  1IQC A;  2V08 A;  3DR0 A;  1K3G A;  1CSV A;  1GKS A;  1W5C T;  1YEA A;  1L0N D;  4NFG B;  5B6Q A;  3C2C A;  2AI5 A;  4LJI A;  1SQP D;  1HZV A;  1C6O A;  5B5E V;  1KV9 A;  5CIF B;  5CIC B;  3VYM A;  1H32 B;  1FHB A;  1S6V B;  4QAO A;  4FA4 A;  3PXW A;  2ORL A;  4XXL A;  5DJQ B;  2FWL A;  4FB1 A;  1MZ4 A;  1E2R A;  4GYD A;  3NBT A;  5CIH B;  1CSW A;  1H9X A;  1AKK A;  2CE0 A;  1H31 B;  1GIW A;  2C1D A;  1KB9 D;  4AAM A;  2MTA C;  1C6R A;  4AAN A;  3D0W A;  1DVV A;  1CCR A;  4H0K A;  1CTZ A;  4K3I A;  2GB8 B;  1HZU A;  3WFD C;  2FYU D;  1HRO A;  1KYO D;  3CXH W;  3H1H D;  4J20 A;  4PD4 D;  2N3B A;  2C9X B;  5CIE B;  1F1C A;  1C75 A;  1SQQ D;  2L4D A;  3OA8 A;  3HQ6 A;  3L72 D;  2D0S A;  1DVH A;  3A0B V;  2IBZ D;  1HJ5 A;  1DW0 A;  5GTI V;  1CXC A;  3ZOW A;  3WUI A;  1CYJ A;  1E8E A;  2GC4 D;  2N18 B;  2LIR A;  2C1D B;  2BH4 X;  1KX7 A;  4V2K A;  1CTY A;  2I8F A;  1PP9 D;  1I55 A;  3WFE C;  155C A;  3ZBM A;  1FCD C;  1YNR A;  1ZZH A;  1LC2 A;  3WFB C;  2LIT A;  5CYT R;  1ETP A;  3PH2 B;  5E79 V;  3CX5 D;  2B11 B;  1EZV D;  1IO3 A;  3OA8 B;  1L0L D;  4O1Q A;  3ZOX A;  4UB8 V;  5AUR A;  2CA4 B;  1FOC A;  1CNO A;  1WEJ F;  3WU2 V;  1QL3 A; 
#chains in the Genus database with same CATH homology
 2BCN B;  2JTI B;  3HQ8 A;  5KKZ B;  1CIH A;  4WQ9 A;  1CIF A;  3KZI V;  1BCC D;  3L4M A;  4YE1 A;  2PAC A;  3ZOO A;  1MG3 D;  1L9J C;  1EB7 A;  2C1V A;  1N9C A;  2JQR A;  3H1L D;  1J3S A;  1AYG A;  1CRH A;  2VHD A;  3L4O A;  5EXQ A;  2C8S A;  2CA3 B;  2AXT V;  2CE1 A;  1CRI A;  3O5C A;  3A9F A;  2MHM A;  2N9I A;  5GTH V;  1BE3 D;  3RN1 A;  4GED B;  5KAF V;  2OZ1 A;  3PXT A;  1NNO A;  1S5L V;  1DW2 A;  1C7M A;  1A56 A;  4AAO A;  1YIC A;  2B0Z B;  1B7V A;  3SWS A;  1CXA A;  3HQ7 A;  1A2S A;  3MK7 B;  1FI7 A;  1I6D A;  3ZCF A;  1GU2 A;  3TGU D;  5DJQ C;  1HJ4 A;  3CU4 A;  2PCB B;  1KIB A;  1BGY D;  1M60 A;  4EIC A;  1IRV A;  1E29 A;  1CTJ A;  4IL6 V;  1DT1 A;  451C A;  4PWA A;  1CYC A;  1CSX A;  4DY9 A;  4AAL A;  2OZ1 B;  4WQ8 A;  3DP5 A;  4UB6 V;  3ZOY A;  1HH7 A;  5B66 V;  5KLI B;  4H0J A;  3O20 A;  5DFS A;  3L71 D;  4WQE A;  1P84 D;  1CRC A;  1H9Y A;  1YTC A;  1CCH A;  1C2N A;  1F1F A;  3NBS A;  4FA1 A;  1I54 A;  4FAN A;  5CIB B;  5CID B;  1PPJ D;  1SQB D;  3O0R C;  2ZBO A;  1YFC A;  2GIW A;  1VYD A;  3L75 D;  4PJ0 V;  5DF5 A;  4FAV A;  1MG2 D;  3H1I D;  1KB0 A;  1DW3 A;  2N18 C;  2ZOO A;  1LFM A;  1GQ1 A;  1OAE A;  1YEB A;  3L74 D;  1KYO W;  1FJ0 A;  1KX2 A;  2GC7 D;  4EIE A;  4JCG A;  1HCM A;  351C A;  5H2F V;  5KAI V;  1I8O A;  1QL4 A;  2BH5 X;  1BL9 A;  4MU8 A;  1WVE C;  2A06 D;  3RMZ A;  2N3Y A;  3VNW A;  3TYI A;  1RZ5 A;  3CXH D;  1K3H A;  2YCC A;  2C1U A;  1FI9 A;  2B12 B;  2YQB A;  3RLM A;  1NTM D;  2HV4 A;  1AOQ A;  4PW9 B;  2B4Z A;  3ZIY A;  1N90 A;  3WC8 A;  1I8P A;  1CIG A;  1IRW A;  1JDL A;  3HQ9 A;  2B10 B;  1A8C A;  3CX5 W;  2BLF B;  1CRG A;  1FI3 A;  4L3H A;  4RSZ A;  1AOF A;  1U75 B;  1QKS A;  1NIR A;  5C9M A;  1W2L A;  3X39 A;  4WQ7 A;  1H33 A;  2EXV A;  1I6E A;  1RAP A;  1SQX D;  3CP5 A;  4EID A;  1CHI A;  2ZON G;  2CXB A;  1HRC A;  5IY5 1;  1I5T A;  1NTK D;  1CYI A;  2ZZS 1;  3MK7 C;  4P4Q B;  2PCC B;  3JBT B;  2QJK B;  1CO6 A;  1RAQ A;  1LC1 A;  1NMI A;  1DII C;  2BGV X;  2YIU B;  4U3F D;  1CRJ A;  3BCC D;  1SQV D;  1CHJ A;  1COR A;  2DGE A;  3M97 X;  4AX3 A;  4WQD A;  3CYT I;  1RZ6 A;  5C0Z A;  1HJ3 A;  3OCD A;  4WQA A;  1N15 A;  1R0Q A;  1DW1 A;  1OCD A;  1IZL 0;  2BPB B;  1LMS A;  1NTZ D;  1M6Z A;  1H33 B;  3SLE A;  1N50 A;  2QJY B;  2YK3 A;  2FRC A;  2BCC D;  1LS9 A;  1L9B C;  1C52 A;  1CIE A;  4WQC A;  1GDV A;  1ZRT D;  3SJL A;  1YIQ A;  4O1W A;  1NU1 D;  1YCC A;  1CED A;  3H1J D;  4WQB A;  2C2C A;  4XYD B;  4KMG A;  5CIG B;  5KLV D;  4FA5 A;  3CWB D;  4L3G A;  3A0H V;  3O1Y A;  1U74 B;  3SXT A;  1C6S A;  1CHH A;  3RN0 A;  1GJQ A;  1H32 A;  1DIQ C;  4L1Q A;  3OCD B;  4D6T D;  2ZXY A;  3H1K D;  1C2R A;  4FA9 A;  1CRY A;  3L70 D;  4Q5P A;  2N9J A;  3NWV A;  3WFC C;  3VRD A;  2DVH A;  4Y5R A;  2V07 A;  3PXS A;  3DMI A;  1CC5 A;  1H1O A;  3ORV A;  1QN2 A;  1QYZ A;  5TIS V;  2D0W A;  1M70 A;  1H31 A;  3L73 D;  4EIF A;  3SVW A;  2FYN B;  1CSU A;  2AIU A;  2QJP B;  2XTS B;  1NML A;  1COT A;  4N0K A;  1IQC A;  2V08 A;  3DR0 A;  1K3G A;  1CSV A;  1GKS A;  1W5C T;  1YEA A;  1L0N D;  4NFG B;  5B6Q A;  3C2C A;  2AI5 A;  4LJI A;  1SQP D;  1HZV A;  1C6O A;  5B5E V;  1KV9 A;  5CIF B;  5CIC B;  3VYM A;  1H32 B;  1FHB A;  1S6V B;  4QAO A;  4FA4 A;  3PXW A;  2ORL A;  4XXL A;  5DJQ B;  2FWL A;  4FB1 A;  1MZ4 A;  1E2R A;  4GYD A;  3NBT A;  5CIH B;  1CSW A;  1H9X A;  1AKK A;  2CE0 A;  1H31 B;  1GIW A;  2C1D A;  1KB9 D;  4AAM A;  2MTA C;  1C6R A;  4AAN A;  1DVV A;  1CCR A;  4H0K A;  1CTZ A;  4K3I A;  2GB8 B;  1HZU A;  3WFD C;  2FYU D;  1HRO A;  1KYO D;  3CXH W;  3H1H D;  4J20 A;  4PD4 D;  2N3B A;  2C9X B;  5CIE B;  1F1C A;  1C75 A;  1SQQ D;  2L4D A;  3OA8 A;  3HQ6 A;  3L72 D;  2D0S A;  1DVH A;  3A0B V;  2IBZ D;  1HJ5 A;  1DW0 A;  5GTI V;  1CXC A;  3ZOW A;  3WUI A;  1CYJ A;  1E8E A;  2GC4 D;  2N18 B;  2LIR A;  2C1D B;  2BH4 X;  1KX7 A;  4V2K A;  1CTY A;  2I8F A;  1PP9 D;  1I55 A;  3WFE C;  155C A;  3ZBM A;  1FCD C;  1YNR A;  1ZZH A;  1LC2 A;  3WFB C;  2LIT A;  5CYT R;  1ETP A;  3PH2 B;  5E79 V;  3CX5 D;  2B11 B;  1EZV D;  1IO3 A;  3OA8 B;  1L0L D;  4O1Q A;  3ZOX A;  4UB8 V;  5AUR A;  2CA4 B;  1FOC A;  1CNO A;  1WEJ F;  3WU2 V;  1QL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...