1U78A

Structure of the bipartite dna-binding domain of tc3 transposase bound to transposon dna
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
103
structure length
103
Chain Sequence
b'PRGSALSDTERAQLDVMKLLNVSLHEMSRKISRSRHCIRVYLKDPVSYGTSKRAPRRKALSVRDERNVIRAASNSCKTARDIRNELQLSASKRTILNVIKRSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 26-MER
publication title Structural analysis of the bipartite DNA-binding domain of Tc3 transposase bound to transposon DNA
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Dna binding protein/dna
total genus 33
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2004-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01498 HTH_Tnp_Tc3_2 Transposase
A PF11427 HTH_Tnp_Tc3_1 Tc3 transposase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1u78A02
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1u78A01
2JA6J 1UHWA 3HTUA 3TQNA 1J0RA 2DA7A 1S29A 2ZJ2A 1F5TA 4HNVA 2TDXA 3M3YJ 3IWFA 1GXPA 3T5XA 3NEUA 1XCBA 1RPWA 2HS5A 2Z3YA 4IHTA 4M3BA 2D2WA 3JRGA 3ZMDA 1B4AA 4RGSA 1USSA 2XB5A 1MSEC 2DLLA 2L4MA 2OPTA 1JT0A 1JTXA 3NARA 3FZVA 4N0BA 1YRNA 4XSXF 3QPHA 1POGA 1OYYA 4M72A 2LF8A 2E1CA 2A5YB 1MD0A 2HQNA 4KDPA 1P6RA 3CDLA 2EA2A 4DQ2A 2FRHA 1IV6A 3BT9A 3HRMA 5E1XA 1K6OA 1NHAA 2GIVA 1AWCA 1A6IA 5FGMA 2DO7A 5EEGA 1OCPA 3VODA 3GYHX 3WHBA 2DQRA 2A6EF 3WG9A 1MDMB 1FTZA 2R0QC 2EFOA 1DU0A 4DNCA 4LD5A 5FO5A 5LGTA 5J8CA 4M6VA 3WTVC 3F0CA 3SQNA 2R5ZA 4BXXJ 2XV4S 1HKTA 2BBYA 3BG9A 1YTYA 3DP7A 4ZYEA 2Z5UA 5BPDA 2R92J 2MBFA 1ETQA 1XD7A 5E18F 2FXAA 2HFHA 1JTYA 5CVJA 5FD5A 1UFMA 5L3BA 3GX4X 3HGGA 3S1RJ 1P7JA 3QPTA 4HF0A 4IF4A 4L9JA 1J9IA 1ZAOA 3I4MJ 2STWA 4I6ZA 1R23A 5D6FA 6PAXA 4M73A 3LSGA 2MH9A 3K2ZA 2A68F 2QQ9A 4IRHA 2HKXA 2NS8A 3MKLA 1SD4A 5TJJA 4JX5A 2XVCA 1ZREA 3FMSA 3TO9A 2XUBA 2VKEA 3S16J 1EH7A 3W6JB 2V1DA 1ONVA 1CQTA 1OYIA 2G7UA 2NS0A 1FIPA 2HOAA 1FZPB 3Q5FA 3FK7A 3ZN0A 2VODA 1FY7A 1W0TA 3TW7A 3CQZJ 2H1KA 3F6OA 2JZYA 3WTXC 1BI0A 5CJ9A 5J1RA 2WB1N 4HX7A 1T98A 4XLPF 2DMPA 5M3MJ 3U1DA 3HSFA 5EG0B 1CGPA 2O7OA 4N9IA 1ZGAA 2EFNA 3K69A 2QBYA 1MGTA 2H8RA 1JGSA 3GBGA 2H6BA 3HM5A 1S3JA 4MTDA 3GW2A 2XGXA 9ANTA 4FX0A 3BJ6A 2HI3A 1ZKGA 2IAIA 2YUSA 3E6DA 3ZQGA 3ABUA 5EGOA 3S1QJ 1FP2A 1L3LA 1TWGJ 3GFLA 4A3BJ 1DPRA 3F8MA 5FFXA 2LTPA 3GTJJ 2OF7A 3IV5A 2FQ4A 3C2BA 1JUMA 3P7NA 3VPRA 2LNBA 5E1ZB 1IN6A 2LFBA 1SFOJ 4MFDA 5E8IA 2COBA 4KYWA 4R1HA 4A0XA 1LEAA 3ABTA 5D4RA 1UHMA 3S1NJ 5LHGA 4Q5SF 4DW6A 2G9WA 4LB5A 2E2JJ 1BIBA 1PUEE 1LE8B 4YFXF 3F23A 2MLKA 4CHUA 3ULQB 2KIMA 2KRFA 3WGGA 1D8JA 2QCOA 3ZMVA 2X9DA 1WI9A 1VF9A 3A01A 1W0UA 4K2EA 5IOZA 2Y0MA 4A5MA 2YSRA 1W7PD 5AONA 5E3OA 3JR9A 1DUXC 2LF7A 4WF2A 1RUNA 4LMYA 5ERIA 1YW7A 2DPDA 3BR5A 1GVJA 1K78A 5EEAA 3R0AA 5F27A 2L9RA 4V2FA 2XPUA 1MBKA 1KYZA 3WODF 3PFIA 2HQ5A 2XRLA 3LOCA 3N4MA 2ZB9A 2MSYA 3SJMA 3O6BB 2WTEA 4C3JJ 1W4MA 3EQLF 3COAC 1K7AA 2Y30A 3FM5A 4ZZDA 4A3LJ 3HRTA 2BV6A 3BOQA 1HW1A 1KA8A 4ZYGA 3J81Z 4ENMA 3TP0A 1JHHA 2NVTJ 2VONA 1B72A 4MQVA 1E3OC 2HTSA 4M74A 3IH2A 1W7PA 4BHCA 1U5TA 1FLIA 4KMFA 5BNGA 2V79A 3OV8A 2AXLA 3KETA 3W6VA 3GTQJ 3BTIA 3FISA 3JAMZ 4HA8A 1QVTA 3WGHA 2I10A 1HF0A 2W57A 1U9OA 2B0LA 3K1MA 2F5EA 3DQVC 3M8EA 4HOBA 1RETA 5EGOB 2XPWA 3FF5A 3AAFA 1YW9A 1UCRA 3TKYA 5AIQA 1BW6A 1F4KA 1MBFA 3HYIA 2ESNA 3Q9VA 2JPCA 3C1DA 3D0SA 5JFRA 2ME6A 3O2PE 5F6FA 1O7FA 1PDNC 1WPKA 1V4RA 2ZNYA 2BE5F 2HZTA 2X0LA 1XSXA 3UKGA 3QRFF 4QWQA 4UV9A 4Y7NJ 4Y13A 2DA1A 2R7ZJ 2R7FA 3J80K 1GV5A 3I5UA 1NK3P 4O3MA 4HDUA 5IT9K 1ZN2A 3WTZA 2VBZA 1WI3A 1R36A 1R22A 1XB4A 1ON1A 3KEOA 4EGYA 2VN2A 2NAZA 5BPIA 2X4HA 1IUFA 4FE7A 2DK8A 2L02A 3A01B 1ORKA 4IHWA 4C3HJ 4BQAA 4P5OA 3GFMA 2Q2EA 4UVAA 2JSCA 5EEHA 5D6EA 4EQQA 4F7ZA 2XAQA 2HWVA 1U8RA 1IN5A 4D0PA 3HIFA 1FEXA 2CW0F 3QPLA 5D5VB 2EZIA 4LLGF 2RKHA 2P5LC 2ME0A 1O3RA 1MH3A 1DDNA 4BY1J 1ZYRF 2HXIA 5FKLA 3ROUA 3CJNA 1NK2P 1E17A 2PG4A 3CUQA 1EH8A 5DS9A 3I64A 4A3EJ 1B72B 5KK1A 1ZLKA 2RN7A 1B6AA 2E2IJ 2FBKA 1XDUA 3HTSB 4RS8A 2IVMA 3Q0WA 4ENNA 2EZKA 1O4XA 3K1PA 3B73A 1RKWA 1B59A 5LEKA 3C3WA 5C4XJ 1MH4A 4DYQA 3DCFA 5CVIA 3FK6A 2K02A 3F8NA 1SD7A 1FP1D 1JJ8C 1IC8A 4P9UA 1OMIA 1HKQA 4Q48A 2IJLA 5CYVA 3K7AJ 4KT5C 2M87A 1Z0XA 2HDDA 1Y1WJ 3IRRA 4MNUA 1O57A 1H0MA 1XDSA 2EFQA 2XAGA 2HYJA 2ETHA 4P55A 4R8HA 4I02A 3CO6C 2OAZA 4I09A 1JHFA 2AHQA 3HOTA 2XGDA 3JRAA 5H6QA 4O5VA 5CVRA 5ICFA 3FX3A 2GBYA 3WU0A 3D5LA 4U88A 3R60A 4YFKF 3BWGA 4CYCA 4AIHA 2VE9A 4EJUA 1SFEA 2ADUA 1WWXA 2FSWA 1IRZA 2EFPA 1LNWA 5D4SA 2M30A 2VOOA 1FYKA 1J2XA 2RAEA 4B8XA 4OINF 1KU7A 1BBYA 2Z9OA 5GP9A 4LGWA 3O3KA 4I0BA 5D5UB 4RB0A 3TEDA 4WX9A 1BJAA 1FPQA 4A3CJ 4OIRF 4E70A 3HRSA 3JTGA 3NAUA 3ZMSA 3KLNA 4DZJA 5K7HA 3H3ZA 2NOGA 4M9SA 3DEUA 3NQOA 2N8GA 3BTLA 3RJPA 2CG4A 3E6BA 2UWMA 2XROA 4ENKA 2O61A 1S7EA 1UB9A 2MC3A 2ZFWA 2ISZA 1QGPA 2YU9J 1YQAA 1B9MA 5LRSA 4XICA 2VI6A 4G94A 4RB2C 3LFKA 4RGXA 3F72A 3HOXJ 2CYYA 1IDZA 1ZG3A 1SD5A 1GT0C 4ESJA 2M45A 3JRDA 3LWFA 1KQ8A 2CQXA 2XHKA 4JP0A 3HSRA 2MW8A 1SMYF 1TNSA 3SDGA 4BH9A 1MDMA 1XCVA 1Z7UA 1HW2A 4G6DA 3DXJF 1OPCA 4KMUX 1JT6A 4QIWN 1NTCA 5FLXK 5K7FA 2P6SA 1D3YA 2LLKA 4AC0A 4UVBA 4A12A 3JSOA 3BPVA 1R58A 2CWEA 1P4AA 4MEYF 1TQPA 3MEXA 5LLQA 5LEJA 3HHGA 3KP7A 3FXQA 2V6CA 3BR0A 4UV8A 4CYCB 1ZRFA 1FBUA 2JA8J 3TW6A 4I0AA 2X48A 2K40A 2E7XA 1U2WA 2FNPA 3RQIA 4LOCA 2ZKZA 1E2XA 2PN6A 4A93J 3HRUA 2FX0A 2RV8A 4Q4ZF 1H88C 2PLYA 1RESA 5J1YA 3SXYA 2P6TA 3JSPA 2NS7A 2AO9A 5L3EA 4BAYA 3F8BA 3ECOA 4HBLA 1J7KA 3LA3A 1H9TA 3ZMTA 2CSOA 4BHBA 2EV5A 1IG7A 5EF6A 2EBIA 4HLYA 2YU3A 1I5ZA 3ZPLA 1TTYA 5EG0A 5E20A 5DUKA 2A61A 2IA1A 5LRRA 5J6XA 4FTHA 2CQQA 1WRJA 4DYRA 1DPUA 5LGNA 4X1EA 1RKTA 1SAXA 5FKKA 2YX4A 4ZH4F 2P81A 2O6GE 1SMTA 4MIMA 1OFCX 1XSVA 1JKRC 4S0HB 4HV6A 4ABZA 3JREA 1ETWA 3JRFA 3KFWX 3T1BA 1MJ9A 5JI6A 1B9NA 1FSEA 2AS5F 5E1WA 2K9SA 4L9NA 2EB7A 3IRQA 3LSRA 3FM3A 3R4KA 3E6MA 3E7LA 1XN7A 1K79A 1XMKA 2LKXA 3KP6A 3OOPA 1KYWA 1T38A 4DYCA 2W85A 1J75A 4OIOF 2VOPA 3G73A 4EM2A 1QO0D 2VE8A 4RB3C 4A3DJ 3T8TA 1ITYA 1X3UA 1BJZA 1LE8A 1X58A 1D5VA 3V8LA 3O8HA 2ZBKA 4EJVA 2CQKA 4CDGA 2DMTA 3HSEA 1S7AA 3ZQ7A 3SZPA 3FMQA 3M4OJ 3HDDA 4D5FA 4CXFA 1LDKB 5FLVA 3RDIA 4OIQF 5CVVA 1OR7A 5F0FA 4RAZA 2M5WA 4GGGA 1BN5A 5F1RA 3KEQA 3A02A 3HKZN 3V8KA 1RUOA 4MGRA 3B6CA 4KIBA 2GZWA 1S7OA 3BG3A 4YFNF 3GTMJ 3JAMK 1PUFB 2IP2A 1X2MA 2KT0A 2ZXJA 1P2FA 2A07F 3HB9A 1Z6TA 4M9ZA 1FSHA 2DMNA 3QOPA 2P7CB 3LA7A 2FU4A 1V3FA 2FNAA 3GFIA 5E17F 5K1YA 1IXCA 2QLZA 2VPRA 5A2QZ 1LB2A 2ISYA 3GXOA 5H20A 1Z6RA 2EWNA 2V1UA 4FCYA 4U7DA 3DV8A 2OQGA 3TOBA 1FX7A 3CUQC 3I0TA 3HEFA 5D5XB 4QLCU 1GDTA 4EMSA 1QRYA 2K4JA 2O8XA 1QNTA 3E5UA 4M3GA 3C7JA 4IHXA 2ZO4A 3BJOA 3KLOA 3BJAA 2FQ3A 1KU3A 5KVRA 1BM9A 4HQMA 4P9FA 2EZHA 3KZZA 2IBDA 1FBSA 3BR3A 1LDJA 2P4WA 2XASA 2QQAA 2PJPA 3ZMZA 4EM1A 1XC5A 3BZ6A 1B8IB 1TWAJ 1AU7A 3HBLA 4A0ZA 1K83J 3FWEA 4WXCA 2R5YB 2BYVE 1FTTA 4HYEA 2ZMEB 3H0GJ 1BI1A 2H94A 3V7CA 4GYGA 5JHUA 4BBSJ 4KNYA 2B63J 1JKQC 4HDVA 4UUSB 4I76A 4A3FJ 3G1LA 3EUHA 1MSFC 4Y15A 1JUPA 1ZQ3P 3DKWA 1JUSA 1JJ6C 2E7WA 2O3FA 2IW5A 4M3EA 1TWHJ 4GCVA 3CMYA 2CGPA 1CF7A 1MJBA 1RIOH 2FF4A 3I4NJ 1XS9A 3W6KB 5EYRA 3Q9SA 3RI4A 5HDKA 2JK3A 4A0YA 4A6EA 2CJJA 1HOMA 1IAWA 1T56A 1KQ0A 5E3LA 3IHUA 3GTLJ 3BR6A 4YIFA 4OU0A 3K2AA 3KP4A 5K5QA 5D8KB 2HYFA 2LK2A 4M3DA 1TWCJ 5F08A 3S15J 1EH6A 3S2WA 1FC3A 4D7NA 4UHTA 3PM1A 4XRSG 2OZUA 4R79A 2H09A 2XKPA 4G7ZF 3P9KA 1FJLA 3MFKA 4KN7X 2HOEA 2P7VB 3CDHA 2E2HJ 4I2OA 1F1ZA 4JX4A 1ZHFA 4JX6A 4NDLA 2HOSA 4D7MA 2XGEA 1IXSB 1L0OC 4S05A 3QPSA 3IKVA 3TO7A 2PMZN 3VB2A 4ESFA 2V1XA 3BR2A 2Y31A 3I59A 4PZJA 2EH3A 2VUMJ 5DUIA 5L3GA 1TW2A 2V9VA 1OJLA 1ZRCA 5IT3A 1GXQA 3GZ5A 4U7BA 1KU2A 1IRFA 4UXNA 3L2CA 2QWWA 1KGSA 4YIIA 2A6HF 1ETYA 2R93J 5J8FA 4RBOA 2HXOA 3KP2A 3JRHA 4MEXF 4A3JJ 1ODDA 2F2EA 2HEOA 1QZZA 3HOWJ 1PP7U 2Z99A 3V4GA 1ETKA 1HLVA 2E19A 1O3QA 5M3FJ 1XSDA 3RKQA 3BPXA 5E3MA 1R1VA 1HCRA 4QTRA 1I50J 4BNCA 2JJ7A 1QQIA 3I58A 2K27A 1F36A 2CUFA 1ZTRA 3PO2J 1AKHB 3BP8A 1IN8A 5ED4A 1TBXA 5K5RA 1YS7A 1STZA 1WKMA 1MJAA 1HSTA 1HBXG 5IP7J 2M8EA 2A69F 2LKPA 5D5WB 3HOYJ 1CF7B 3MWMA 2ELKA 5HDNA 2PI0A 3S2HJ 1JE8A 2L7FP 5IYBJ 2FA5A 1ZG1A 2EJRA 4A3KJ 1P92A 3Q0UA 3I71A 4GFBA 2ZCWA 3RPQA 2M9HA 3E5XA 4HF2A 1G4DA 4WCGA 5LHHA 3HOZJ 1TW3A 1APLC 4RGRA 1BW5A 5M5WJ 5JR3A 3REOA 3MQ0A 3KCCA 1GUUA 2DJNA 3JRBA 3P9IA 3OOUA 5BOXA 1B1BA 1G3WA 2GAUA 4Z2YA 1VFCA 3IH3A 4FISA 3FIWA 5LHIA 5F1JA 5BMZA 4KICA 1HSJA 2P5KA 4NQWA 3OIOA 4KN4X 4V2GA 3TDUC 5FKOA 3IL2A 3WU1B 5GPAA 2W24A 4OOIA 4ENJA 1OCTC 1A04A 3V7SA 5H6RA 2QZ8A 5D8LB 2HR3A 2LSOA 1BC8C 2DBBA 4O6JA 5LGUA 5IP9J 3HOUJ 3I59B 3PO3J 5HODA 2LR8A 1RR7A 1T6SA 3HOSA 3GLXA 1WH5A 4XBFA 3CLOA 4EM0B 1FOKA 1TQIA 3WE2A 1HDPA 1BC7C 1YW8A 2L7MP 2YR2A 3FHZA 4IRIA 5F64A 1W5TA 1R5GA 2EK5A 3B02A 3LSPA 1S6LA 4WWCA 2L0KA 2X6OA 3N97A 4EJWA 1Z9CA 2JWTA 5GPCA 1Z77A 2GQQA 1IXRC 3D1NI 2GLOA 3ZQFA 1P7IA 2RNJA 2NVQJ 2RVCA 4EJOA 5HS9A 2WV1A 3B6AA 1DP7P 3MVPA 4BY7J 1G3YA 2XKOA 4MFEA 3GFJA 5HLGA 5CLSA 3FXUA 5J3LA 4N9HA 5AIPA 1R7JA 1ZGWA 3IWZA 4A3GJ 2PQ8A 3GEZA 1VNDA 2NRAC 2O9LA 4G12A 2K4BA 3JRIA 2QQBA 4HAMA 3V7RA 4LG0B 4HX4A 3RKWA 1QVUA 3H3UA 4I7HA 3GUDA 3LSTA 1ETXA 3HGYA 1GVDA 2FMYA 3J80Z 2D1HA 2CRGA 4A2UA 4WXHA 2Q8KA 2FBHA 2LVSA 5K5OA 5E3NA 4GYIA 3CTAA 1HDDC 2XRNA 2EFWA 1USTA 4HW0A 4L5JA 1O3TA 2QM3A 4U0VA 4LLLA 4OMZA 1IUYA 1BI3A 2IPQX 4M3FA 2JPBA 2K7LA 2VC0A 3G3ZA 4MLOA 2Q0OA 4A6DA 1HW5A 1EF4A 4RAYA 2H27A 2ACJA 1DU6A 3ZMUA 2MD5A 2LD5A 4HV5A 1FYMA 4AIJA 3RTRA 2NNYA 4AYBN 2G7HA 1XGSA 4W1UA 3GTKJ 4IJAA 4ASNA 1O7LA 4GXOA 2R7DA 3T0YA 3RZDJ 3KP5A 3S14J 3L7WA 5CVUA 3S17J 1K61A 3ZQCA 3H92A 5DCMB 4UNOA 3F8CA 2D5VA 2DPUA 2OD5A 1HQCA 2XSDC 3L00A 1LVAA 1S8NA 5A2QK 3F21A 5JLWA 5HOOA 2ESHA 3L1PA 2TCTA 3QU6A 2LP0A 3WGIA 4AD9A 4G9YA 1PUFA 3QP5A 2MGQA 3LAJA 2DA6A 3ZOBA 3IC7A 4PCQA 3CO7C 1C0WA 1JGGA 1QPMA 2OA4A 2OQRA 2XPVA 1XGOA 1RNLA 3ZP5A 3EETA 2JRTA 1ZH5A 1ZGJA 5ICGA 2ELHA 4JK1X 2HGCA 4LK0F 1TWFJ 4ON0A 1G6NA 4LK1F 4KIGA 5DYMA 4I98B 1G2HA 3RYRA 4HX8A 4L0ZB 1LFUP 3M9AA 1QBJA 1X2NA 3I54A 3K9TA 2QUFA 3EYIA 3C18A 3M8FA 2BEOA 1MNMC 3K0LA 2D45A 3EYYA 5DTDA 4W97A 1G3TA 3FMRA 1LJ9A 5HS8A 2DW4A 3DF8A 3GF2A 1U5TC 5FLMJ 1QZYA 2M1BA 2WAQN 2JT1A 4A5NA 3MAJA 1ZARA 2J5OA 4U0WA 2ID3A 1B8IA 1PP8F 4L9TA 4M6XA 5L3CA 4G7OF 1OKRA 2R5YA 4XRFA 2ZMEA 2DTZA 3KP3A 3QU3A 1WCMJ 3BG5A 4L18B 1IRGA 2RC4A 3WTWC 2Y9YA 5F0CA 3SFZA 4UUSA 4XK4A 3L09A 4BXUA 3ELKA 1T0FA 4HLXA 3FKIJ 4QSHA 3OSGA 2M0CA 2XAHA 4KA4A 1BL0A 1EV7A 1R00A 1VTNC 2DMUA 5M5YJ 2OBPA 3CUOA 2MG4A 1ON2A 3VOEA 3LQQA 4J19A 2MLGA 1R9TJ 2FD5A 1GHCA 5IPAA 4ZYHA 3J81K 3QQAA 5IOYA 4P96A 4FHTA 3RYPA 2NVYJ 3GVAA 5EZHA 2QVOA 5HS7A 4IRGA 2WC2A 1JXSA 2IEKA 1MKMA 3QP6A 1HXDA 3U2RA 1KQ9A 3H3VK 1LFBA 2FBIA 2VC1A 1WH7A 1U8BA 4RDUA 5HLHA 3RIRA 3P9CA 4CGZA 4I01A 2HDCA 2XAJA 3MCZA 5HLIA 3JRCA 5FLXZ 1ENHA 5EZGA 3L9FA 5K7ZA 2F5FA 5TRDA 4CYDA 4HQEA 1IF1A 2YS9A 3GTPJ 3T8RA 5IYDJ 3BQYA 4ZZLA 5F04A 1W5SA 3R61A 4L5IA 3I53A 2P8TA 5JLXA 2IRFG 4FT8A 2Y2ZA 4EGZA 3Q0VA 5ILSA 5FB2A 3G1MA 1ZG5A 3DEWA 4FX4A 1YRNB 1IN4A 1JKOC 4A3MJ 5FKMA 1R5HA 4RB1A 2GXGA 2NVXJ 1T2KA 1I27A 1IW7F 1I6XA 2L01A 4S04A 2QF7A 1J59A 4IVNA 4M6YA 1SANA 5DV5A 2J5PA 2WV0A 1ZK8A 3ZQHA 3ZQLA 1WGXA 2QENA 3WTSC 3HHHA 5FD6A 3ZQIA 4AUXA 4HF1A 1BOAA 4JBAA 2DAOA 5IYCJ 4Y17A 2MH2A 2F5DA 1Z05A 3WE3A 1AKHA 3NRVA 1ETVA 2VT2A 2HYGD 3MZYA 3DPTA 4ETSA 4M9XA 1SD6A 1MBEA 2F5CA 2R5ZB 1LEBA 2DA3A 3VFZA 2VKVA 4L0YB 2VXZA 5C3EJ 3F8FA 1R1TA 4A69C 5DEQA 1MBGA 3IKTA 2G0EA 3BDDA 1U6GA 1WQ2A 1YYVA 2BGCA 2ZNZA 4EJTA 2LY9A 3BR1A 2HOTA 2A3SA 2EV0A 4OMYA 2M8GX 2FMLA 2PMHA 4M71A 5ILVA 2PMUA 2DN0A 4TV7A 3LNQA 1RZ4A 3J7AO 3SHFA 1I6HJ 3E5QA 4U0YA 5ICCA 2O8KA 4Q47A 1P4WA 3S1MJ 1FT9A 1H8AC 2QYOA 3DPLC 2ECBA 3GTGJ 3WTTC 2DT5A 2DI3A 4FE4A 1G3SA 1GV2A 2XAFA 1J5YA 4KFCA 1BIAA 1YFHA 1XGNA 2HKOA 2L7ZA 5L3DA 1XGMA 3GTOJ 3RKYA 2KIUA 2NYXA 1JKPC 2DQLA 2KJCA 4G6QA 4KIFA 2W48A 1YLFA 2DA2A 3HOVJ 4G7HF 2CO5A 3WTUC 1I1SA 4X6AJ 1FWZA 3ZN1A 4OIPF 2DFIA 5L3FA 1IN7A 1UHSA 4JYKA 3JW4A 2OU2A 2XGCA 3ML6A 4IHVA 3OSFA 4BBRJ 2EV6A 1Y1VJ 4XRSA 2QBYB 2K9QA 2FOKA 5FFZA 2TRTA 1UG2A 2VT3A 1AOYA 2DA5A 4HZFA 3WTYC 3LQRA 4BKXA 3KE2A 2VBXA 5IP6A 1ZLJA 5ILUA 5E8GA 1U9NA 1SFXA 2LDUA 4CICA 1D8KA 1O3SA 2O0YA 1YIOA 4XRMA 1FIAA 1WSUA 2CU7A 2HTJA 1Q1HA 2P5VA 4NB5A 2VBYA 2FEZA 2PBIA 4MTEA 4YG2F 2K86A 3BY6A 1I1GA 3IH4A 1KU9A 2GA1A 1I3QJ 2EA4A 1ULYA 2CFXA 2IA2A 4IXAA 4IHYA 3S2DJ 3LSJA 2YPRA 4H0EA 4IPAA 4PDKA 4LG0A 2RQPA 4B1RA 3ISPA 3E3VA 4L9VA 5BS6A 3JTHA 3BQZA 2XIGA 4JQFA 2PEXA 1OYWA 2C6YA 4ESBA 1XMAA 4DZPA 1K78B 3U9GA 2DK5A 1BI2A 4EEFG 2RDPA 1IZ1A 5DDGA 3R6SA 3SFIA 4BHPA 2CUEA 4XSZF 3LA2A 3V8JA 4EVIA 2UXNA 1RI7A 1Q1VA 2HQRA 2UXXA 4WK8F 3F6VA 1YO5C 3K1NA 2KKOA 5EDNA 2L54A 3BTJA 2MA3A 2NNNA 1U3EM 1QPIA 1W7PB 2W25A 4AIKA 2JN6A 1U5TB 2FJ1A 4IEJA 2YX7A 1SFUA 3PQKA 3WHCA 2OZ6A 3A03A 3GZ6A 1ETOA 2XB0X 2L3DA 5ICEA 4RGUA 1UMQA 5HDGA 3I4PA 2DTRA 4MHGA 1ZR4A 4UUVA 3DFGA 5FKNA 4XLNF 1T33A 5M5XJ 1MZBA 4G8XA 1HKSA 1Z1DA 2VBWA 5LBQA 3F3XA 4B4CA 3MN2A 1BA5A 3GO5A 3TGNA 1A5JA 3FXRA 3G1OA 3KZYA 1AHDP 3BTCA 3R0JA 4B09A 5DCFA 1MBHA 4XIDA 5DCMA 2Z33A 3O8GA 2R3SA 1H9GA 1YG2A 2DA4A 1IGNA 4CZZA 3RKXA 2GWRA 3TOAA 2ECCA 3EDPA 3SZTA 2KDZA 4KUMA 4B3AA 1U78A 2STTA 1TQMA 4NHJA 4Y52J 4BYYA 4L5EA 2GXBA 1IDYA 2M2EA 2O03A 4WXDA 4A3IJ 4CO8A 2GM4A 2IA0A 1F9NA 4C2MJ 2E1OA 1Z91A 1F43A 4LJZF 4LB6B 2JA5J 2K9NA 5JVTA 1REPC 4MO7A 5J1UA 2D1VA 5BQTA 4PGHA 4LFUA 2WWYA 3MZHA 5IT9Z 2PFBA 4UVCA 2E1NA 3GWZA 2GA2A 2ID6A 1TC3C 3ECHA 3CUQB 1XG1A 4IHSA 5C44J 1ZRDA 3E6CC 1FNNA 5C4JJ 2DMQA 2KJBA 2RGVA 3TDZC 2JA7J 1H89C 2Y75A 2EQRA 5FJ8J 3PQJA 3ERED 1LQ1A 4AWXB 3Q3SA 3RPUA 3TO6A 2Y9ZA 2Y0SN 1D5YA 1VI0A 1Y0UA 2FE3A 4ZYDA 2UZKA 4D5CA 5DD4A 5DD8A 1P4XA 3TP3A 4MQ9F 3M7GA 3M1EA 2IT0A 4C3IJ 1LDDA 3RZOJ 4UUTA 2DU9A 4EV0A 1TLHB 2JTVA 3CCYA 5F0HA 3F22A 1YS6A 1TNTA 3BROA 1IJWC 1ZR2A 3HUGA 4PGGA 4LLNA 2COMA 4AVPA 5HVQC 2W84A 3LAPA 1MBJA 2JMWA 2KIFA 4GO1A 1FYLA 2Y48A 2EZLA 2M34A 2L4AA 2H6CA 1T39A 3QAHA 1R1UA 3E97A 1FBQA 3VEPA
chains in the Genus database with same CATH superfamily
3OIQA 1UHWA 2JA6J 2DOEA 1XX5A 2ELJA 3HTUA 3TQNA 1J0RA 2DA7A 1S29A 2ZJ2A 4HNVA 1F5TA 2TDXA 3M3YJ 3IWFA 1GXPA 4D1QA 3T5XA 2KQRA 5CKTA 3NEUA 1RPWA 1XCBA 2HS5A 2LY2A 2Z3YA 4IHTA 4M3BA 4IL6C 2OJED 1Z67A 5TISC 2D2WA 3JRGA 3ZMDA 1B4AA 4RGSA 1USSA 2XB5A 2V9KA 1MSEC 2DLLA 1QHGA 2BXZA 2L4MA 2OPTA 1JT0A 1JTXA 3NARA 3FZVA 2CV1A 4N0BA 1YRNA 3CJTB 1OQYA 1BR2A 5B66C 4XSXF 3QPHA 1POGA 1OYYA 4M72A 2LF8A 2E1CA 3OIPA 2A5YB 1SVOA 1MD0A 2HQNA 2K3PA 1P6RA 1LPQA 4KDPA 1MMDA 3CDLA 4JOMA 3KPHA 2L2OA 2EA2A 4DQ2A 1VQMI 2FRHA 1U0JA 1IV6A 3BT9A 3HRMA 1MNDA 2ZSIB 5E1XA 1K6OA 1NHAA 2GIVA 1A6IA 1AWCA 2QSGX 5FGMA 3TMOA 3OYNA 2DO7A 5EEGA 3K4BA 1OCPA 3VODA 3GYHX 3AKZA 3OYCA 3WHBA 2DQRA 2A6EF 3WG9A 1MDMB 1FTZA 2R0QC 2EFOA 1DU0A 4DNCA 4LD5A 5FO5A 5LGTA 4M6VA 5J8CA 3WTVC 3F0CA 3SQNA 2R5ZA 4BXXJ 2XV4S 1HKTA 2BBYA 3ASOH 2QSFX 3BG9A 1YTYA 3DP7A 4ZYEA 2Z5UA 5BPDA 2R92J 2MBFA 1ETQA 1XD7A 5E18F 2FXAA 2HFHA 1JTYA 2KIQA 5CVJA 3NWTA 3V42A 3HXLA 1UFMA 5FD5A 5L3BA 3DTIA 3HGGA 2KZVA 2M4GA 3GX4X 2Z16A 3S1RJ 1P7JA 4XKVA 3HUGB 1SVLA 3QPTA 4HF0A 4IF4A 4L9JA 3L2QA 1J9IA 1ZAOA 3I4MJ 2WAEA 2STWA 4I6ZA 1R23A 5D6FA 6PAXA 1LVKA 4M73A 3LSGA 2MH9A 3K2ZA 2KFDA 2A68F 4X0GA 2QQ9A 4IRHA 2HKXA 2NS8A 4E7JA 1K4TA 3MKLA 1SD4A 4JX5A 5TJJA 2L9SA 2XVCA 1ZREA 3S3OA 3FMSA 3TO9A 2VKEA 2QQ8A 2XUBA 2VLAA 3S16J 2DDBA 3MMYB 4NC7A 1EH7A 3W6JB 4YRVA 2V1DA 1VQ9I 2OTLI 3LL7A 1ONVA 1CQTA 1OYIA 2G7UA 1FIPA 2NS0A 4RAFA 2HOAA 2HU9A 4G6TB 1FZPB 1VQ7I 1HA8A 3Q5FA 4DJAA 3FK7A 3ZN0A 2VODA 3RSNA 1FY7A 1W0TA 3TW7A 4DBRA 3CQZJ 4OAZA 2H1KA 3F6OA 3CF5F 4LITA 2JZYA 3WTXC 2O5RA 1BI0A 5CJ9A 5J1RA 3VSLA 2WB1N 1D1BA 4HX7A 4XN0A 1T98A 1Y39A 4XLPF 2DMPA 5M3MJ 3U1DA 1K4SA 3HSFA 2DCEA 5EG0B 1N77A 2LREA 2O7OA 1CGPA 4N9IA 2M0MA 1MMGA 2VQGA 1ZGAA 2EFNA 5H2FC 3K69A 2QBYA 1MGTA 2H8RA 1JGSA 3GBGA 2H6BA 3HM5A 3DU5A 1S3JA 4MTDA 2CV2A 3GW2A 2XGXA 9ANTA 4FX0A 3BJ6A 2HI3A 1ZKGA 1BR1A 2IAIA 2YUSA 3E6DA 3ZQGA 3ABUA 5EGOA 3LSMA 3S1QJ 1FP2A 4XOPA 1L3LA 2BVMA 3AG2H 1TWGJ 3GFLA 4A3BJ 4IZZA 3CCEI 2R7SA 3H35A 2KRCA 1DPRA 3QYBA 3F8MA 2E5ZA 3CCSI 2LTPA 5FFXA 3K10A 3CCVI 3GTJJ 4CCJA 4XLEA 2OF7A 4IQJA 3IV5A 2FQ4A 3C2BA 3FXMA 2JUCA 1JUMA 3P7NA 3VPRA 2BXYA 4II3A 2LNBA 2ZJQF 5E1ZB 1IN6A 2LFBA 5JHFA 1SFOJ 4MFDA 5E8IA 1MMSA 2COBA 4KYWA 4R1HA 4A0XA 2JQ7A 1LEAA 3ABTA 3FBIB 5D4RA 4GDFA 1UHMA 1N25A 3S1NJ 5LHGA 4Q5SF 4DW6A 2G9WA 2XDVA 2E2JJ 4LB5A 1BIBA 5LFAA 1PUEE 1LE8B 4YFXF 3F23A 2MLKA 4CHUA 2OTJI 3ULQB 2KIMA 2KRFA 3WGGA 1D8JA 1M1EB 2QCOA 2X9DA 1WI9A 3GMEA 4Y33A 3ZMVA 1VF9A 3A01A 1W0UA 4K2EA 5IOZA 3PJRA 1D1CA 2Y0MA 4A5MA 2YSRA 1W7PD 5AONA 5E3OA 3JR9A 1PVEA 1DUXC 2LF7A 2X1DA 3ZGKA 4WF2A 1RUNA 4LMYA 2DT6A 2BY0A 3AG4H 3BR5A 1YW7A 5ERIA 2DPDA 1GVJA 5EEAA 4H4KC 1K78A 3R0AA 1D1AA 3PUFA 5F27A 4E6KG 4E7IA 2L9RA 2KHMA 2XPUA 1MBKA 1KYZA 4V2FA 3WODF 3PFIA 2HQ5A 2IS2A 5CQEA 2XRLA 3LOCA 3N4MA 2ZB9A 2MSYA 3SJMA 4UB6C 1WJEA 3O6BB 2WTEA 2XF5A 2GIZA 4C3JJ 1W4MA 3EQLF 2Y30A 3COAC 1K7AA 3FM5A 5KAFC 3OYMA 4ZZDA 4A3LJ 3PIPF 3HRTA 2BV6A 2IGMA 3BOQA 1HW1A 1OCCH 1QU3A 1KA8A 4ZYGA 3J81Z 3TP0A 4ENMA 1JHHA 2NVTJ 2VONA 1B72A 4MQVA 1E3OC 1A6QA 2HTSA 4M74A 4AYBA 2PJRA 2ZXHA 3IH2A 2Y0SA 4DBQA 1W7PA 4BHCA 1U5TA 5BNGA 4KMFA 1FLIA 2V79A 3S32A 3OV8A 1I39A 2AXLA 3KETA 3CMAI 3W6VA 3GTQJ 3BTIA 3FISA 1PYVA 3JAMZ 1YJWI 4HA8A 1FMWA 1QVTA 3WGHA 2I10A 1HF0A 1QZEA 2W57A 1U9OA 2B0LA 3K1MA 2F5EA 3CP2A 2IS4A 3DQVC 3M8EA 4HOBA 1RETA 5EGOB 2XPWA 3FF5A 4HSRA 3AAFA 1YW9A 1UCRA 2UV1A 5AIQA 3TKYA 1BW6A 3KX2A 4IKFA 1F4KA 1N78A 1MBFA 1XTAA 3HYIA 1OCRH 3I9V2 1X1PA 2IS1A 2ESNA 3Q9VA 2JPCA 2FUG2 3C1DA 5KNLA 3D0SA 5JFRA 2ME6A 3O2PE 5F6FA 1O7FA 1WPKA 1PDNC 5J47A 1ACIA 1V4RA 2ZNYA 2BE5F 2X0LA 2HZTA 1XSXA 3UKGA 3QRFF 4QWQA 4UV9A 4Y7NJ 4Y13A 2DA1A 4DGWB 1V54H 1E0EA 2R7ZJ 4F93B 2R7FA 3J80K 1GV5A 3I5UA 1NK3P 4O3MA 4HDUA 2X6XA 3OL3A 5IT9K 1ZN2A 3WTZA 2VBZA 1WJFA 1WI3A 1R36A 4RMNA 1R22A 1XB4A 1ON1A 3KEOA 1Y56A 3PFYA 4EGYA 2VN2A 2NAZA 5BPIA 2X4HA 1IUFA 4FE7A 4PSXA 2DK8A 2L02A 3A01B 1ORKA 4IHWA 4C3HJ 4BQAA 2DXIA 4P5OA 3GFMA 2Q2EA 4UVAA 2JSCA 4BDZA 2DOFA 5EEHA 1DP3A 5D6EA 4EQQA 5CPRB 4F7ZA 2XAQA 2CQ7A 2HWVA 1U8RA 1IN5A 4D0PA 3HIFA 1FEXA 2B9SA 2GOXB 2CW0F 3QPLA 5D5VB 2EZIA 3OR2C 4LLGF 2RKHA 2X6YA 2P5LC 3W2AA 2ME0A 1O3RA 1MH3A 3FXLA 1MNEA 1DDNA 4BY1J 1ZYRF 2HXIA 5FKLA 3ROUA 3CJNA 1NK2P 1E17A 2PG4A 3CUQA 1EH8A 5DS9A 3I64A 4XQFA 2M4KA 2Z1DA 4A3EJ 1B72B 5KK1A 1TT0A 1ZLKA 3LSIA 1VQ5I 2RN7A 1B6AA 3CLQA 1W36C 4IOAF 2CH0A 1K6YA 2E2IJ 4HRIA 2FBKA 1XDUA 3HTSB 4RS8A 2HZDA 2IVMA 3Q0WA 2EZKA 3L2VA 4ENNA 1O4XA 3K70C 3K1PA 1RKWA 3B73A 1B59A 5LEKA 1SC7A 3C3WA 4BEHA 5C4XJ 1MH4A 4DYQA 3DCFA 5CVIA 3FK6A 1V5GA 2K02A 2LKSA 3F8NA 1SD7A 1FP1D 2R7QA 1JJ8C 1IC8A 2DDAA 4E7LA 4P9UA 1OMIA 1HKQA 4Q48A 1ERDA 2IJLA 4E7KA 5CYVA 2JA2A 3K7AJ 3LSHA 4KT5C 2M87A 1Z0XA 2HDDA 1Y1WJ 3IRRA 2DFEA 4MNUA 4B47A 1O57A 1H0MA 1XDSA 2EFQA 2XAGA 2HYJA 2ETHA 4P55A 4R8HA 1Y8QB 4I02A 3CO6C 2M7AA 2OAZA 4I09A 1JHFA 2E36A 3H1CA 2AHQA 3HOTA 2XGDA 3JRAA 5H6QA 1LKXA 4O5VA 5CVRA 5ICFA 2GBYA 3FX3A 3OS1A 3ERMA 4N4OB 3WU0A 3D5LA 4U88A 3M07A 3R60A 4YFKF 3BWGA 1Z3XA 4NC6A 4CYCA 4HNUA 4AIHA 2VE9A 4EJUA 2XAUA 3U1KA 1SFEA 2ADUA 1WWXA 2FSWA 2W82A 1IRZA 1YJ9I 2EFPA 1LNWA 5D4SA 3UR3C 2M30A 2VOOA 1FYKA 1J2XA 2K3FA 4NBQA 2RAEA 4B8XA 4BJ6C 1VQNI 4OINF 3PL8A 1KU7A 3VYTB 1BBYA 2Z9OA 1NG7A 4XORA 5GP9A 4LGWA 2E1MC 3O3KA 4I0BA 5KCMA 5D5UB 2WB1A 4RB0A 3TEDA 4WX9A 1BJAA 4CCMA 1FPQA 4A3CJ 4OIRF 4E70A 2XF6A 3HRSA 3JTGA 4AVZA 3NAUA 3EUAA 3ZMSA 3G4SI 3KLNA 3C2GA 4DZJA 5K7HA 3H3ZA 2NOGA 4M9SA 4ZTFA 3DEUA 3NQOA 2N8GA 3BTLA 3RJPA 2CG4A 4CCNA 3E6BA 2UWMA 1R4NB 1QHHD 2XROA 4ENKA 2O61A 1S7EA 1UB9A 1X1CA 2MC3A 2ZFWA 2ISZA 2HPIA 1QGPA 2YU9J 3OMYA 4B48A 4CCOA 1YQAA 1B9MA 4XOTA 5LRSA 3L2UA 1S5LC 3RQ4A 2VQCA 5FRNA 4BE1A 4XICA 2VI6A 2W4SA 4G94A 1R4MB 4RB2C 3LFKA 1DGRM 4RGXA 2KDOA 3F72A 3TL4X 2CYYA 3HOXJ 2CW8A 1IDZA 1ZG3A 1SD5A 1YJNI 1GT0C 4ESJA 2M45A 3JRDA 2BZTA 2CQXA 3LWFA 1KQ8A 2XHKA 4JP0A 4V19K 3HSRA 2MW8A 1SMYF 2W7NA 1TNSA 3SDGA 4BH9A 1MDMA 1XCVA 2CMPA 2HDWA 2V1NA 1Z7UA 1HW2A 4G6DA 1BOBA 3DXJF 1OPCA 4KMUX 1JT6A 4QIWN 4KISA 1NTCA 1XMXA 3PSFA 5FLXK 5K7FA 4YIRX 2P6SA 3EPZA 2L9VA 1D3YA 2LLKA 4AC0A 4XN3A 4UVBA 4A12A 3JSOA 3BPVA 1R58A 2CWEA 4Y3OA 1P4AA 3MZ8A 4MEYF 1TQPA 3MEXA 5LLQA 5LEJA 2DFFA 3HHGA 1WJ5A 3FXQA 2V6CA 3KP7A 3BR0A 4UV8A 2QA4I 4CYCB 3K70D 1ZRFA 1FBUA 2JA8J 1R6RA 3TW6A 4I0AA 2X48A 2K40A 2E7XA 1U2WA 2FNPA 3RQIA 3GLLA 4LOCA 2ZKZA 1E2XA 2PN6A 4A93J 3HG9A 3HRUA 2FX0A 2RV8A 3CF2A 4Q4ZF 1H88C 2PLYA 1RESA 4IQ4A 4ZDPA 5B1AH 5J1YA 3SXYA 3K6GA 4FASD 2P6TA 3JSPA 2BVLA 2NS7A 2A6TA 2AO9A 2H8WA 3CCMI 5L3EA 4BAYA 2UUZA 3F8BA 3ECOA 4HBLA 1VQ6I 3CC4I 1J7KA 3HJEA 1MIJA 3LA3A 3K4KA 1H9TA 5E79C 3ZMTA 2CSOA 4BHBA 4BU2A 4F3QA 2EV5A 1IG7A 5EF6A 3MKYB 2EBIA 4HLYA 2YU3A 1I5ZA 4ZDLA 3ZPLA 1TTYA 5EG0A 5E20A 5DUKA 2A61A 2IA1A 5LRRA 5J6XA 4FTHA 2CQQA 1WRJA 4DYRA 1DPUA 2IGOA 1SVMA 2F5VA 5LGNA 4J01A 4X1EA 1RKTA 4CCLA 1SAXA 5FKKA 2HQAA 2YX4A 3CDIA 2EILH 4ZH4F 2P81A 2LOOA 4XR6A 1FMVA 3PNTA 2VQLA 1UELB 2O6GE 3PSIA 1SMTA 4MIMA 1OFCX 1XSVA 1JKRC 4S0HB 1IO2A 4HV6A 3LMMA 5J40A 3S3NA 1VQ4I 4ABZA 3JREA 1ETWA 3JRFA 3CD6I 3OYJA 3KFWX 3T1BA 1MJ9A 3NWSA 5JI6A 1B9NA 1FSEA 2AS5F 5E1WA 2K9SA 5GTHC 3ABLH 4L9NA 2E60A 2EB7A 5FROA 3IRQA 3H5RA 3LSRA 3FM3A 3R4KA 3E6MA 4HPQA 3H0DA 3E7LA 2ZJPF 1XN7A 1K79A 1XMKA 2LKXA 3KP6A 3OOPA 2V9PA 1KYWA 1T38A 4DYCA 2W85A 4XLCA 1J75A 4OIOF 2VOPA 3G73A 4EM2A 1QO0D 2VE8A 1VZ0A 2K9LA 4RB3C 4A3DJ 3T8TA 1ITYA 1BJZA 1X3UA 3KIOA 1LE8A 1X58A 1D5VA 3CMEI 3V8LA 2CW7A 1D0XA 3O8HA 3FHNA 2ZBKA 1R5ID 4EJVA 2E35A 2CQKA 1ZELA 1WJBA 4CDGA 2DMTA 3HSEA 1S7AA 3H9JA 3BZCA 3ZQ7A 3SZPA 3FMQA 2NXNB 3HDDA 4D5FA 3M4OJ 4CXFA 1LDKB 5FLVA 3RDIA 2BW3B 4OIQF 5CVVA 1OR7A 3KYLA 5F0FA 1WJDA 4RAZA 2M5WA 2KL4A 4GGGA 1BN5A 3FBNB 5F1RA 3KEQA 3A02A 3HKZN 3V8KA 1RUOA 4MGRA 3GZNB 2WA0A 3B6CA 4KIBA 2GZWA 1S7OA 3BG3A 4RAGA 4YFNF 3GTMJ 3JAMK 4XONA 1PUFB 1X2MA 2IP2A 2KT0A 2ZXJA 1P2FA 2BY1A 3DPUA 3OYFA 3HB9A 2A07F 2F4IA 1Z6TA 4M9ZA 1FSHA 2EPFA 2DMNA 3QOPA 3RCOA 4BUPA 4RM3A 2P7CB 3LA7A 2FU4A 1V3FA 2FNAA 3GFIA 1HC8A 5E17F 2VASA 4PJLA 5K1YA 3J7YJ 1IXCA 3OYBA 2QLZA 2VPRA 5A2QZ 1LB2A 2ISYA 3GXOA 5H20A 1Z6RA 2LH9A 2EWNA 2V1UA 2CS3A 4FCYA 4U7DA 3DV8A 2OQGA 3TOBA 4XNFA 1FX7A 3CUQC 3I0TA 3HEFA 5D5XB 4QLCU 1GDTA 3OY9A 4EMSA 1QRYA 1X1DA 2K4JA 2O8XA 3G71I 3DTEA 1QNTA 2X1CA 3E5UA 4M3GA 3C7JA 4IHXA 2ZO4A 3BJOA 3KLOA 3BJAA 1D0ZA 1KU3A 2FQ3A 5KVRA 3F9KA 1BM9A 3BG7A 4HQMA 4P9FA 2PX9A 2EZHA 2VPLA 3KZZA 1A35A 3OL4A 2IBDA 4OWRB 1FBSA 3BR3A 1LDJA 2P4WA 2XASA 2JUGA 2QQAA 2PJPA 4PJNA 3ZMZA 4EM1A 1XC5A 3BZ6A 1B8IB 1TWAJ 1AU7A 3HBLA 4A0ZA 1VQPI 1K83J 1D0YA 3FWEA 4WXCA 2R5YB 2BYVE 1FTTA 1Y6IA 4HYEA 2ZMEB 3H0GJ 1BI1A 2H94A 3V7CA 2I5UA 3L2RA 4GYGA 5JHUA 1NH3A 4KNYA 2B63J 4BBSJ 2KLOA 1JKQC 4HDVA 4UUSB 4I76A 4A3FJ 3G1LA 3D5RC 3EUHA 1MSFC 4Y15A 1JUPA 1ZQ3P 3DKWA 1UJ8A 3UNGC 1JUSA 3E1SA 1JJ6C 2E7WA 2O3FA 2IW5A 3VWBA 4M3EA 1TWHJ 3I3LA 3PNVA 1YI2I 2GOMA 4GCVA 3CMYA 2CGPA 2VL8A 1CF7A 1MJBA 1RIOH 2E5NA 2FF4A 3I4NJ 1XS9A 5EYRA 3W6KB 3A4CA 3Q9SA 3RI4A 2JK3A 5HDKA 4A0YA 4A6EA 2CJJA 1HOMA 1IAWA 1T56A 1KQ0A 5E3LA 3IHUA 4CH7A 3GTLJ 3BR6A 4YIFA 1J09A 4OU0A 2DYRH 3VYUB 3K2AA 3KP4A 5K5QA 5D8KB 2HYFA 2LK2A 4M3DA 1TWCJ 5F08A 3S15J 1NG6A 1EH6A 4U87A 3S2WA 1FC3A 2E1MB 2AQEA 4D7NA 4UHTA 3PM1A 5GAGJ 4XRSG 2OZUA 4R79A 3PIOF 2H09A 1E3PA 2XKPA 2R7VA 4AM3A 4G7ZF 3P9KA 1FJLA 3MFKA 4KN7X 3OYLA 2HOEA 2L7KA 2P7VB 3CDHA 2E2HJ 4I2OA 1F1ZA 4JX4A 1ZHFA 4JX6A 4NDLA 3IAM2 4D7MA 2HOSA 2XGEA 1IXSB 5KHDA 1L0OC 4S05A 3QPSA 3IKVA 2WY8Q 2PMZN 3TO7A 3VB2A 4ESFA 3CCJI 2V1XA 3BR2A 1IV8A 2Y31A 3I59A 4PZJA 2EH3A 4EATA 4F52A 2VXDA 2VUMJ 2W00A 5DUIA 5L3GA 1TW2A 1OJLA 2V9VA 3CCLI 1ZRCA 5IT3A 1GXQA 3GZ5A 4U7BA 1KU2A 1IRFA 4UXNA 2ZFUA 4PSWA 3L2CA 2QWWA 1KGSA 4YIIA 4C30A 2A6HF 1ETYA 4UB8C 3AL0B 1T95A 2WAFA 2R7RA 2R93J 2LY1A 4RLFA 5J8FA 4RBOA 2HXOA 3KP2A 4ZTJA 2X1EA 3JRHA 4MEXF 4D9JA 4A3JJ 1ODDA 2F2EA 2HEOA 1QZZA 4CZCA 2V26A 3BLYA 3QWLA 3HOWJ 1PP7U 1JI8A 2Z99A 1ETKA 3V4GA 3KEYA 4BQNA 5B5EC 1HLVA 1QA6A 3A0BC 1WHUA 2E19A 1O3QA 5M3FJ 1XSDA 3RKQA 3BPXA 2VQHA 5E3MA 1R1VA 3AFHA 2IS6A 1HCRA 4QTRA 1I50J 2WADA 3H36A 2JJ7A 1QQIA 4BNCA 3I58A 2XF7A 1F36A 2K27A 2CUFA 4RA2A 3HPGA 1X4PA 1ZTRA 3PO2J 2ZXIA 1AKHB 3BP8A 1IN8A 5ED4A 2VIXA 1SEUA 1TBXA 1R49A 3PUBA 5K5RA 1YS7A 1STZA 1WKMA 1MJAA 1HSTA 2Q1ZB 4E7HA 5IP7J 1HBXG 2M8EA 4E4HA 2A69F 5JVGF 1XPXA 2LKPA 5D5WB 3HOYJ 3SEQA 1CF7B 3MWMA 2ELKA 5HDNA 2PI0A 3S2HJ 3FXJA 1JE8A 2L7FP 1SAUA 5IYBJ 2FA5A 3K4JA 1ZG1A 1WZ2A 2EJRA 4A3KJ 1P92A 3Q0UA 3I71A 3HL2A 4GFBA 1X1BA 2ZCWA 3RPQA 2M9HA 4ANJA 3E5XA 4IO9F 3BC8A 1G4DA 4WCGA 5LHHA 4HF2A 1TW3A 3HOZJ 2JVGA 1APLC 3SZGA 4RGRA 1WJCA 1BW5A 5M5WJ 5JR3A 1GUUA 2DJNA 3KCCA 3MQ0A 3REOA 3JRBA 3OOUA 3P9IA 2DFHA 3SYTA 5BOXA 1B1BA 1G3WA 2GAUA 4Z2YA 1VFCA 3IH3A 4FISA 2A05A 3FIWA 5LHIA 3ESWB 4XL9A 5F1JA 5BMZA 4KICA 1HSJA 2P5KA 4NQWA 3OIOA 4KN4X 4V2GA 5FKOA 1MMAA 3TDUC 3IL2A 3WU1B 3P5JA 3EUKL 3OYAA 5GPAA 2W24A 5KAIC 3IAS2 4OOIA 3MD2A 4ENJA 1OCTC 3OYIA 2LMDA 1A04A 3V7SA 5H6RA 2QZ8A 5D8LB 2I8DA 2HR3A 2LSOA 1VQKI 1BC8C 2DBBA 4O6JA 5IP9J 5LGUA 1VQ8I 3I59B 3HOUJ 5HODA 3PO3J 4KJZA 2LR8A 1RR7A 1T6SA 3ZQQA 3N05A 1KZHA 3GLXA 3IP4B 1WH5A 3DTKA 3HOSA 2R7TA 4XBFA 3CLOA 4ZDOA 4EM0B 2R7UA 1FOKA 4LIVA 2K9MA 2CV0A 1TQIA 3FKJA 3WE2A 3OS0A 1HDPA 1BC7C 3ABMH 1YW8A 2L7MP 2YR2A 3DBRB 3W2VA 3FHZA 4Y4RA 3K4CA 4IRIA 5F64A 1W5TA 2F48A 1R5GA 2EK5A 3B02A 3LSPA 1S6LA 4C2TA 4WWCA 2L0KA 2X6OA 1GLNA 2JWTA 4EJWA 3N97A 1Z9CA 2MABA 1FOYA 5GPCA 1Z77A 3OYHA 2GQQA 1IXRC 3BZKA 3D1NI 3D5SC 4XLAA 2GLOA 2JRMA 3ZQFA 1P7IA 2DT7B 2RNJA 2NVQJ 2RVCA 3MKZA 3DKYA 4EJOA 5HS9A 2WV1A 2IGKA 3B6AA 3HKZA 1DP7P 3MVPA 2JSPA 4BY7J 4XLHA 1G3YA 2XKOA 3AG3H 4MFEA 3GFJA 5HLGA 4BE2A 1WJAA 1EKEA 5CLSA 2KP6A 1WFXA 1DGWY 3FXUA 3W2WA 5J3LA 4N9HA 5AIPA 1R7JA 2IGNA 1ZGWA 3IWZA 2NVUB 3CCRI 4A3GJ 5GAEJ 2PQ8A 3GEZA 1G59A 3DWLE 1VNDA 2NRAC 2BY3A 2O9LA 4G12A 2K4BA 4CCKA 3JRIA 2QQBA 4HAMA 1MMNA 1OR7C 2X85A 3V7RA 4LG0B 4HX4A 3RKWA 1QVUA 4AU7A 3SDBA 3H3UA 4I7HA 3GUDA 1DQUA 3SEZA 1YITI 1Y8RB 3LSTA 1ETXA 3HGYA 2XSJC 2LYCA 4XKBA 1GVDA 2FMYA 2WBMA 4NQWB 3J80Z 3CCQI 2D1HA 3ZRGA 2CRGA 1V5EA 4A2UA 2QEXI 4WXHA 3HZJA 2Q8KA 2FBHA 3MKWB 2LVSA 2EIJH 4FQGA 5K5OA 3DKXA 5E3NA 4RM2A 4GYIA 3CTAA 1HDDC 4LIUA 2XRNA 2EFWA 1USTA 4HW0A 4L5JA 5GTIC 2QM3A 1O3TA 4U0VA 4LLLA 2X51A 1YX5A 4OMZA 1IUYA 1BI3A 2KPMA 2IPQX 4M3FA 2JPBA 2K7LA 1YE9A 2VC0A 3G3ZA 4MLOA 2Q0OA 4A6DA 4DOZA 1HW5A 2M7BA 1EF4A 2ZJRF 4RAYA 2H27A 2ACJA 3S93A 3DBLB 1DU6A 3ZMUA 2MD5A 2LD5A 1T08B 4HV5A 2DJIA 1FYMA 1MW7A 4AIJA 3RTRA 5DM6F 2NNYA 4AYBN 1VQLI 2VJIA 2G7HA 1XGSA 4W1UA 3GTKJ 4BL0B 4IJAA 4ASNA 1O7LA 1OLTA 4GXOA 2R7DA 3T0YA 3RZDJ 1UAAA 2NOJB 3KP5A 3J7AY 3S14J 1BR4A 3L7WA 5CVUA 3S17J 1K61A 3ZQCA 3H92A 1OCOH 3K4LA 5DCMB 4UNOA 3F8CA 2D5VA 3EUHC 2DPUA 1YHQI 2OD5A 1HQCA 4BQOA 2BW3A 2XSDC 3L00A 1LVAA 1S8NA 5A2QK 3F21A 1UZCA 5JLWA 5HOOA 2ESHA 3L1PA 2TCTA 1YOVB 3QU6A 2LP0A 5DM7F 3WGIA 4AD9A 2K85A 4IX7A 4G9YA 1PUFA 2MGQA 3QP5A 3LAJA 2DA6A 3ZOBA 1EJ9A 3IC7A 2HNHA 4PCQA 3CO7C 1C0WA 1JGGA 1QPMA 2AQFA 2CUZA 2OA4A 2OQRA 4RLQA 1PJRA 3DLAA 2XPVA 3WU2C 1XGOA 1RNLA 3ZP5A 3EETA 2JRTA 1ZH5A 1ZGJA 5ICGA 2ELHA 4JK1X 2HGCA 4LK0F 1TWFJ 4ON0A 1G6NA 4LK1F 4KIGA 5DYMA 4I98B 1YX3A 2AXTC 4HX8A 3RYRA 1LFUP 4L0ZB 4BQQA 3K4MA 1G2HA 1YIJI 3M9AA 1FOXA 1QBJA 1X2NA 4Z6YA 3I54A 3K9TA 2QUFA 2DYSH 3EYIA 3C18A 3M8FA 2BEOA 3U21A 1V55H 1MNMC 3K0LA 2R7OA 3EYYA 5DTDA 2D45A 4W97A 2JVHA 1G3TA 3FMRA 1LJ9A 5HS8A 2DW4A 3DF8A 3GF2A 1U5TC 4ITVA 5FLMJ 2KISA 1QZYA 2M1BA 2WAQN 1X1AA 2JT1A 3CJRB 4A5NA 2MC4A 1VQOI 3MAJA 1ZARA 3H9QA 2Z2SB 2J5OA 5HNHA 4U0WA 2HVQA 2ID3A 3DLLF 1B8IA 1PP8F 4L9TA 4M6XA 5L3CA 3ZR8X 4G7OF 1OKRA 2R5YA 4XRFA 1OCZH 2ZMEA 2DTZA 3KP3A 3QU3A 1WCMJ 5IY5H 3BG5A 4BDYA 4CA0A 2E34A 4L18B 2Y9YA 2RC4A 4PJ0C 5F0CA 3S8PA 3WTWC 1IRGA 3SFZA 4UUSA 4XK4A 5GADJ 3L09A 4BXUA 3ELKA 1T0FA 1OISA 4HLXA 3FKIJ 4QSHA 3OSGA 2H1LA 2M0CA 2WY7Q 2XAHA 2EIKH 4KA4A 1BL0A 1EV7A 1R00A 1VTNC 2DMUA 5M5YJ 2OBPA 2DODA 3AG1H 3CUOA 3GCMA 2MG4A 3OYKA 3E0JB 4PFOA 2V6EA 1ON2A 3VOEA 3LQQA 4J19A 2MLGA 1R9TJ 4I99C 2FD5A 3OR1C 1GHCA 3JCUC 5IPAA 4ZYHA 3QQAA 5IOYA 3J81K 4P96A 2NVYJ 1W5CC 4FHTA 3RYPA 3GVAA 2OV7A 3DU6A 4FETA 5EZHA 2QVOA 5HS7A 4IRGA 2WC2A 1JXSA 2ZC2A 1A36A 2IEKA 1MKMA 3QP6A 1HXDA 3U2RA 4BE0A 1KQ9A 3H3VK 1LFBA 2FBIA 2VC1A 1WH7A 1U8BA 4RDUA 5HLHA 3RIRA 3P9CA 2L9NA 4CGZA 4I01A 2HDCA 2XAJA 3MCZA 5HLIA 3OWTA 3JRCA 5FLXZ 1ENHA 2HVSA 5EZGA 4DIQA 3L9FA 2GXAA 5K7ZA 2F5FA 5TRDA 5B3SH 2ZSHB 4LG3A 4CYDA 4HQEA 2QGUA 1IF1A 2YS9A 2VKDA 3GTPJ 3T8RA 5IYDJ 3BQYA 2E71A 5F04A 4ZZLA 1W5SA 3R61A 1Z7LA 4L5IA 4ZJZA 1V5FA 3I53A 2P8TA 5JLXA 2IRFG 4FT8A 2Y2ZA 4EGZA 3Q0VA 5ILSA 3G1MA 3ZXSA 5FB2A 1ZG5A 3DEWA 4FX4A 1YRNB 1IN4A 1JKOC 4A3MJ 5FKMA 3CCUI 1R5HA 2RREA 3C2HA 4RB1A 2GXGA 2NVXJ 1T2KA 1I27A 1IW7F 4C9YA 1I6XA 2L01A 4S04A 2QF7A 1J59A 4IVNA 3CC2I 1SANA 4M6YA 5DV5A 2J5PA 2WV0A 1ZK8A 3ZQHA 3ZQLA 4QPQA 1WGXA 2QENA 3I56I 3WTSC 1LFPA 3HHHA 4PJMA 3ZQIA 5FD6A 4AUXA 4HF1A 1BOAA 4JBAA 2DAOA 3ZCOA 5IYCJ 1S72I 4Y17A 3CJQB 2MH2A 2F5DA 1Z05A 3WE3A 1AKHA 3NRVA 1ETVA 2VT2A 3QOEA 2IXSA 2HYGD 3MZYA 3DPTA 4ETSA 4M9XA 2F6CA 1MBEA 1SD6A 2F5CA 4UY8I 4P1WA 2R5ZB 1LEBA 2DA3A 2VKVA 3VFZA 4F92B 2XC7A 4L0YB 1P9QC 2VXZA 5C3EJ 3F8FA 1R1TA 3FXKA 2EIMH 4A69C 5DEQA 1MBGA 3IKTA 2G0EA 1LUJB 3BDDA 1U6GA 5EJCA 1WQ2A 2VJ4A 1YYVA 2BGCA 2ZNZA 2LY9A 4EJTA 3A1YA 3BR1A 2HOTA 2A3SA 2EV0A 2VJJA 4OMYA 2M8GX 2FMLA 2PMHA 4M71A 5ILVA 2DN0A 2PMUA 4PJJA 4GRIA 4TV7A 3LNQA 2BHYA 1RZ4A 3J7AO 3SHFA 1I6HJ 3E5QA 4U0YA 3A0HC 5ICCA 2O8KA 4Q47A 1P4WA 3S1MJ 1FT9A 1WVRA 2QYOA 1H8AC 4NNJA 3DPLC 2ECBA 4N4NB 3GTGJ 3WTTC 5GAHJ 2BHZA 2DT5A 1I3AA 2DI3A 4FE4A 1UG0A 2QKLB 2R7XA 1G3SA 1GV2A 2XAFA 3J7ZI 1J5YA 4KFCA 4XKWA 1BIAA 1YFHA 1AA7A 1XGNA 2BOLA 2OUMA 2HKOA 2L7ZA 5L3DA 1XGMA 3GTOJ 3QYFA 2Y69H 3RKYA 2KIUA 4YEJA 2NYXA 1JKPC 2DQLA 2KJCA 3ABKH 4G6QA 3G6EI 4KIFA 3OS2A 2W48A 1YLFA 2DA2A 3HOVJ 4G7HF 2CO5A 3BCBA 3WTUC 1I1SA 4X6AJ 1FWZA 3ZN1A 4OIPF 5TGTA 3DBHB 2DFIA 5L3FA 1IN7A 3OYDA 2ICWG 1UHSA 2M3AA 4JYKA 3JW4A 2OU2A 2XGCA 2F4MB 3ML6A 4IHVA 3OSFA 4BBRJ 1Y1VJ 2EV6A 3DEEA 4XRSA 2QBYB 2K9QA 2FOKA 5FFZA 2TRTA 5J4YA 1UG2A 2VT3A 1AOYA 4B44A 2DA5A 4HZFA 3WTYC 1G8XA 3LQRA 4HEA2 4BKXA 4KITB 3KE2A 3H5NA 5HNFA 2VBXA 5IP6A 1ZLJA 5ILUA 4ZC3A 2B7EA 4XMYA 5E8GA 1U9NA 1SFXA 2LDUA 4CICA 1D8KA 1O3SA 2O0YA 4B3XA 3ONQA 1YIOA 2F4OB 4XRMA 1FIAA 3W3CA 1WSUA 2CU7A 1FOWA 3H5AA 2HTJA 1Q1HA 2P5VA 4NB5A 2VBYA 1KONA 2FEZA 2PBIA 4ZYAA 4MTEA 4YG2F 2K86A 4PUSA 3BY6A 2QKMB 1I1GA 3IH4A 1KU9A 2GA1A 1TP4A 2KRHA 1I3QJ 2W1OA 2EA4A 1ULYA 2CFXA 2IA2A 4IXAA 4IHYA 3S2DJ 1EA3A 3LSJA 3VYRB 2YPRA 4H0EA 4B43A 5B1BH 1E3HA 4IPAA 4PDKA 4LG0A 2RQPA 4YELA 4B1RA 3M8JA 1RC9A 3QODA 2VB6A 3ISPA 4XKCA 3E3VA 4L9VA 3K4NA 5BS6A 3HC7A 4E7SA 4E7ZA 3JTHA 1X19A 4AIDA 2HPMA 3BQZA 4HNTA 2XIGA 4JQFA 2PEXA 3BCAA 1OYWA 3CMMA 2C6YA 4ESBA 1XMAA 2LBFA 4DZPA 4C2UA 1W1WE 4BJ5C 1K78B 1X4OA 2K5CA 2BY2A 3U9GA 2DK5A 1BI2A 4EEFG 2RDPA 1IZ1A 5DDGA 3R6SA 2WAQA 2R4GA 3SFIA 4BHPA 2CUEA 4XM3A 4XSZF 5J4VA 3LA2A 3V8JA 4F91B 1RRJA 4EVIA 2UXNA 1RI7A 1Q1VA 2HQRA 2DOAA 2UXXA 4BXFA 4WK8F 3F6VA 1YO5C 3K1NA 2KKOA 5EDNA 2L54A 2VKHA 3BTJA 2MA3A 2NNNA 4II2A 2PJRB 2LG4A 1U3EM 2OCEA 3FXOA 1QPIA 1W7PB 2W25A 4AIKA 2JN6A 1U5TB 2FJ1A 4IEJA 2QSHX 2YX7A 1SFUA 1Y0NA 3PQKA 3WHCA 2OZ6A 2FOWA 3A03A 3GZ6A 1ETOA 2XB0X 2L3DA 3TBIA 5ICEA 4RGUA 1UMQA 5HDGA 3I4PA 2DTRA 4MHGA 3L2WA 1ZR4A 4UUVA 3DFGA 4BACA 5FKNA 4XLNF 1T33A 2ZXWH 1TZLA 3QYEA 5M5XJ 1MZBA 4G8XA 1HKSA 1Z1DA 2VBWA 5LBQA 2R7WA 3F3XA 2ZMEC 4B4CA 3MN2A 1BA5A 3GO5A 3TGNA 1A5JA 3G1OA 3G2BA 3FXRA 3KZYA 1AHDP 3BTCA 3R0JA 4B09A 5DCFA 1MBHA 4XIDA 5DCMA 5FRMA 2Z33A 1T0FC 3O8GA 4KT6A 2R3SA 1H9GA 1SFKA 3S3MA 1YG2A 2DA4A 3PNYA 1IGNA 4PFPA 3LSKA 4CZZA 3RKXA 4BGDA 2GWRA 3WG7H 3TOAA 2HVRA 3CC7I 2ECCA 3EDPA 3SZTA 2L5QA 3M1CA 2KDZA 2LC2A 4KUMA 4B3AA 3FDYA 1U78A 2MYSA 2STTA 1TQMA 2VJ5A 4NHJA 4Y52J 4BYYA 2MFZA 4L5EA 2GXBA 1IDYA 2M2EA 2V7FA 2O03A 3KYDB 4NUBA 4WXDA 4A3IJ 3I55I 4CO8A 2GM4A 2IA0A 1F9NA 2A5WA 4HSTA 4J00A 4C2MJ 2MD0A 2E1OA 1Z91A 2Q2EB 4XLFA 1R71A 1Z21A 1F43A 4LJZF 4LB6B 2JA5J 2K9NA 5JVTA 4MO7A 1REPC 5J1UA 4IOCF 2D1VA 2LBFB 5BQTA 2RQQA 4PGHA 4LFUA 4NC8A 3RPUD 2WWYA 4PK4A 1TL8A 3MZHA 4BJTA 2KZGA 2EINH 5IT9Z 2PFBA 4UVCA 2E1NA 2RNGA 2OCCH 2LRDA 1S9HA 3GWZA 1N75A 2GA2A 2KMUA 5LD2C 2ID6A 1TC3C 3ECHA 1TT5B 3CUQB 1XG1A 1T8IA 4IHSA 3CZ6A 3IUOA 5C44J 1ZRDA 3E6CC 2X6WA 1FNNA 5C4JJ 2DMQA 2KJBA 2RGVA 3KYCB 3TDZC 3H9GA 3AL0C 2CQNA 2JA7J 1H89C 2Y75A 2EQRA 5FJ8J 3VSKA 3BG6A 4BEHB 3CP8A 3PQJA 3VYSB 4CSWA 3ERED 1LQ1A 4AWXB 2OC6A 3Q3SA 5CQGA 3RPUA 2CUJA 3OYEA 4BS9A 3TO6A 2Y9ZA 2Y0SN 3X2QH 3KZIC 1D5YA 3ASNH 1VI0A 4QPOA 1Y0UA 4HG2A 2FE3A 1A31A 4ZYDA 1Z3YA 2UZKA 4D5CA 2P0WA 5DD4A 5DD8A 4OAYA 4CUGA 1P4XA 3TP3A 4MQ9F 3M7GA 3M1EA 4C3IJ 2IT0A 1LDDA 3RZOJ 3A2KA 4UUTA 2DU9A 4EV0A 1X3WB 1TLHB 2JTVA 3CCYA 5F0HA 1X3ZB 5HLTA 3F22A 3LFUA 1YS6A 1TNTA 3BROA 1RR8C 1IJWC 4F55A 1ZR2A 3HPHA 3HUGA 4PGGA 4LLNA 2COMA 4AVPA 1W36D 5HVQC 2W84A 3LAPA 2V4JC 1MBJA 2JMWA 2KIFA 4GO1A 1FYLA 2Y48A 2EZLA 2CFOA 1IRXA 2M34A 2L4AA 2H6CA 3CESA 3QAHA 1R1UA 2PMZA 1T39A 3VDXA 3E97A 3OYGA 1FBQA 3VEPA
chains in the Genus database with same CATH topology
2JA6J 1UHWA 3HTUA 3TQNA 1J0RA 2DA7A 1S29A 2ZJ2A 1F5TA 4HNVA 2TDXA 3M3YJ 3IWFA 1GXPA 3T5XA 3NEUA 1XCBA 1RPWA 2HS5A 2Z3YA 4IHTA 4M3BA 2D2WA 3JRGA 3ZMDA 1B4AA 4RGSA 1USSA 2XB5A 1MSEC 2DLLA 2L4MA 2OPTA 1JT0A 1JTXA 3NARA 3FZVA 4N0BA 1YRNA 4XSXF 3QPHA 1POGA 1OYYA 4M72A 2LF8A 2E1CA 2A5YB 1MD0A 2HQNA 4KDPA 1P6RA 3CDLA 2EA2A 4DQ2A 2FRHA 1IV6A 3BT9A 3HRMA 5E1XA 1K6OA 1NHAA 2GIVA 1AWCA 1A6IA 5FGMA 2DO7A 5EEGA 1OCPA 3VODA 3GYHX 3WHBA 2DQRA 2A6EF 3WG9A 1MDMB 1FTZA 2R0QC 2EFOA 1DU0A 4DNCA 4LD5A 5FO5A 5LGTA 5J8CA 4M6VA 3WTVC 3F0CA 3SQNA 2R5ZA 4BXXJ 2XV4S 1HKTA 2BBYA 3BG9A 1YTYA 3DP7A 4ZYEA 2Z5UA 5BPDA 2R92J 2MBFA 1ETQA 1XD7A 5E18F 2FXAA 2HFHA 1JTYA 5CVJA 5FD5A 1UFMA 5L3BA 3GX4X 3HGGA 3S1RJ 1P7JA 3QPTA 4HF0A 4IF4A 4L9JA 1J9IA 1ZAOA 3I4MJ 2STWA 4I6ZA 1R23A 5D6FA 6PAXA 4M73A 3LSGA 2MH9A 3K2ZA 2A68F 2QQ9A 4IRHA 2HKXA 2NS8A 3MKLA 1SD4A 5TJJA 4JX5A 2XVCA 1ZREA 3FMSA 3TO9A 2XUBA 2VKEA 3S16J 1EH7A 3W6JB 2V1DA 1ONVA 1CQTA 1OYIA 2G7UA 2NS0A 1FIPA 2HOAA 1FZPB 3Q5FA 3FK7A 3ZN0A 2VODA 1FY7A 1W0TA 3TW7A 3CQZJ 2H1KA 3F6OA 2JZYA 3WTXC 1BI0A 5CJ9A 5J1RA 2WB1N 4HX7A 1T98A 4XLPF 2DMPA 5M3MJ 3U1DA 3HSFA 5EG0B 1CGPA 2O7OA 4N9IA 1ZGAA 2EFNA 3K69A 2QBYA 1MGTA 2H8RA 1JGSA 3GBGA 2H6BA 3HM5A 1S3JA 4MTDA 3GW2A 2XGXA 9ANTA 4FX0A 3BJ6A 2HI3A 1ZKGA 2IAIA 2YUSA 3E6DA 3ZQGA 3ABUA 5EGOA 3S1QJ 1FP2A 1L3LA 1TWGJ 3GFLA 4A3BJ 1DPRA 3F8MA 5FFXA 2LTPA 3GTJJ 2OF7A 3IV5A 2FQ4A 3C2BA 1JUMA 3P7NA 3VPRA 2LNBA 5E1ZB 1IN6A 2LFBA 1SFOJ 4MFDA 5E8IA 2COBA 4KYWA 4R1HA 4A0XA 1LEAA 3ABTA 5D4RA 1UHMA 3S1NJ 5LHGA 4Q5SF 4DW6A 2G9WA 4LB5A 2E2JJ 1BIBA 1PUEE 1LE8B 4YFXF 3F23A 2MLKA 4CHUA 3ULQB 2KIMA 2KRFA 3WGGA 1D8JA 2QCOA 3ZMVA 2X9DA 1WI9A 1VF9A 3A01A 1W0UA 4K2EA 5IOZA 2Y0MA 4A5MA 2YSRA 1W7PD 5AONA 5E3OA 3JR9A 1DUXC 2LF7A 4WF2A 1RUNA 4LMYA 5ERIA 1YW7A 2DPDA 3BR5A 1GVJA 1K78A 5EEAA 3R0AA 5F27A 2L9RA 4V2FA 2XPUA 1MBKA 1KYZA 3WODF 3PFIA 2HQ5A 2XRLA 3LOCA 3N4MA 2ZB9A 2MSYA 3SJMA 3O6BB 2WTEA 4C3JJ 1W4MA 3EQLF 3COAC 1K7AA 2Y30A 3FM5A 4ZZDA 4A3LJ 3HRTA 2BV6A 3BOQA 1HW1A 1KA8A 4ZYGA 3J81Z 4ENMA 3TP0A 1JHHA 2NVTJ 2VONA 1B72A 4MQVA 1E3OC 2HTSA 4M74A 3IH2A 1W7PA 4BHCA 1U5TA 1FLIA 4KMFA 5BNGA 2V79A 3OV8A 2AXLA 3KETA 3W6VA 3GTQJ 3BTIA 3FISA 3JAMZ 4HA8A 1QVTA 3WGHA 2I10A 1HF0A 2W57A 1U9OA 2B0LA 3K1MA 2F5EA 3DQVC 3M8EA 4HOBA 1RETA 5EGOB 2XPWA 3FF5A 3AAFA 1YW9A 1UCRA 3TKYA 5AIQA 1BW6A 1F4KA 1MBFA 3HYIA 2ESNA 3Q9VA 2JPCA 3C1DA 3D0SA 5JFRA 2ME6A 3O2PE 5F6FA 1O7FA 1PDNC 1WPKA 1V4RA 2ZNYA 2BE5F 2HZTA 2X0LA 1XSXA 3UKGA 3QRFF 4QWQA 4UV9A 4Y7NJ 4Y13A 2DA1A 2R7ZJ 2R7FA 3J80K 1GV5A 3I5UA 1NK3P 4O3MA 4HDUA 5IT9K 1ZN2A 3WTZA 2VBZA 1WI3A 1R36A 1R22A 1XB4A 1ON1A 3KEOA 4EGYA 2VN2A 2NAZA 5BPIA 2X4HA 1IUFA 4FE7A 2DK8A 2L02A 3A01B 1ORKA 4IHWA 4C3HJ 4BQAA 4P5OA 3GFMA 2Q2EA 4UVAA 2JSCA 5EEHA 5D6EA 4EQQA 4F7ZA 2XAQA 2HWVA 1U8RA 1IN5A 4D0PA 3HIFA 1FEXA 2CW0F 3QPLA 5D5VB 2EZIA 4LLGF 2RKHA 2P5LC 2ME0A 1O3RA 1MH3A 1DDNA 4BY1J 1ZYRF 2HXIA 5FKLA 3ROUA 3CJNA 1NK2P 1E17A 2PG4A 3CUQA 1EH8A 5DS9A 3I64A 4A3EJ 1B72B 5KK1A 1ZLKA 2RN7A 1B6AA 2E2IJ 2FBKA 1XDUA 3HTSB 4RS8A 2IVMA 3Q0WA 4ENNA 2EZKA 1O4XA 3K1PA 3B73A 1RKWA 1B59A 5LEKA 3C3WA 5C4XJ 1MH4A 4DYQA 3DCFA 5CVIA 3FK6A 2K02A 3F8NA 1SD7A 1FP1D 1JJ8C 1IC8A 4P9UA 1OMIA 1HKQA 4Q48A 2IJLA 5CYVA 3K7AJ 4KT5C 2M87A 1Z0XA 2HDDA 1Y1WJ 3IRRA 4MNUA 1O57A 1H0MA 1XDSA 2EFQA 2XAGA 2HYJA 2ETHA 4P55A 4R8HA 4I02A 3CO6C 2OAZA 4I09A 1JHFA 2AHQA 3HOTA 2XGDA 3JRAA 5H6QA 4O5VA 5CVRA 5ICFA 3FX3A 2GBYA 3WU0A 3D5LA 4U88A 3R60A 4YFKF 3BWGA 4CYCA 4AIHA 2VE9A 4EJUA 1SFEA 2ADUA 1WWXA 2FSWA 1IRZA 2EFPA 1LNWA 5D4SA 2M30A 2VOOA 1FYKA 1J2XA 2RAEA 4B8XA 4OINF 1KU7A 1BBYA 2Z9OA 5GP9A 4LGWA 3O3KA 4I0BA 5D5UB 4RB0A 3TEDA 4WX9A 1BJAA 1FPQA 4A3CJ 4OIRF 4E70A 3HRSA 3JTGA 3NAUA 3ZMSA 3KLNA 4DZJA 5K7HA 3H3ZA 2NOGA 4M9SA 3DEUA 3NQOA 2N8GA 3BTLA 3RJPA 2CG4A 3E6BA 2UWMA 2XROA 4ENKA 2O61A 1S7EA 1UB9A 2MC3A 2ZFWA 2ISZA 1QGPA 2YU9J 1YQAA 1B9MA 5LRSA 4XICA 2VI6A 4G94A 4RB2C 3LFKA 4RGXA 3F72A 3HOXJ 2CYYA 1IDZA 1ZG3A 1SD5A 1GT0C 4ESJA 2M45A 3JRDA 3LWFA 1KQ8A 2CQXA 2XHKA 4JP0A 3HSRA 2MW8A 1SMYF 1TNSA 3SDGA 4BH9A 1MDMA 1XCVA 1Z7UA 1HW2A 4G6DA 3DXJF 1OPCA 4KMUX 1JT6A 4QIWN 1NTCA 5FLXK 5K7FA 2P6SA 1D3YA 2LLKA 4AC0A 4UVBA 4A12A 3JSOA 3BPVA 1R58A 2CWEA 1P4AA 4MEYF 1TQPA 3MEXA 5LLQA 5LEJA 3HHGA 3KP7A 3FXQA 2V6CA 3BR0A 4UV8A 4CYCB 1ZRFA 1FBUA 2JA8J 3TW6A 4I0AA 2X48A 2K40A 2E7XA 1U2WA 2FNPA 3RQIA 4LOCA 2ZKZA 1E2XA 2PN6A 4A93J 3HRUA 2FX0A 2RV8A 4Q4ZF 1H88C 2PLYA 1RESA 5J1YA 3SXYA 2P6TA 3JSPA 2NS7A 2AO9A 5L3EA 4BAYA 3F8BA 3ECOA 4HBLA 1J7KA 3LA3A 1H9TA 3ZMTA 2CSOA 4BHBA 2EV5A 1IG7A 5EF6A 2EBIA 4HLYA 2YU3A 1I5ZA 3ZPLA 1TTYA 5EG0A 5E20A 5DUKA 2A61A 2IA1A 5LRRA 5J6XA 4FTHA 2CQQA 1WRJA 4DYRA 1DPUA 5LGNA 4X1EA 1RKTA 1SAXA 5FKKA 2YX4A 4ZH4F 2P81A 2O6GE 1SMTA 4MIMA 1OFCX 1XSVA 1JKRC 4S0HB 4HV6A 4ABZA 3JREA 1ETWA 3JRFA 3KFWX 3T1BA 1MJ9A 5JI6A 1B9NA 1FSEA 2AS5F 5E1WA 2K9SA 4L9NA 2EB7A 3IRQA 3LSRA 3FM3A 3R4KA 3E6MA 3E7LA 1XN7A 1K79A 1XMKA 2LKXA 3KP6A 3OOPA 1KYWA 1T38A 4DYCA 2W85A 1J75A 4OIOF 2VOPA 3G73A 4EM2A 1QO0D 2VE8A 4RB3C 4A3DJ 3T8TA 1ITYA 1X3UA 1BJZA 1LE8A 1X58A 1D5VA 3V8LA 3O8HA 2ZBKA 4EJVA 2CQKA 4CDGA 2DMTA 3HSEA 1S7AA 3ZQ7A 3SZPA 3FMQA 3M4OJ 3HDDA 4D5FA 4CXFA 1LDKB 5FLVA 3RDIA 4OIQF 5CVVA 1OR7A 5F0FA 4RAZA 2M5WA 4GGGA 1BN5A 5F1RA 3KEQA 3A02A 3HKZN 3V8KA 1RUOA 4MGRA 3B6CA 4KIBA 2GZWA 1S7OA 3BG3A 4YFNF 3GTMJ 3JAMK 1PUFB 2IP2A 1X2MA 2KT0A 2ZXJA 1P2FA 2A07F 3HB9A 1Z6TA 4M9ZA 1FSHA 2DMNA 3QOPA 2P7CB 3LA7A 2FU4A 1V3FA 2FNAA 3GFIA 5E17F 5K1YA 1IXCA 2QLZA 2VPRA 5A2QZ 1LB2A 2ISYA 3GXOA 5H20A 1Z6RA 2EWNA 2V1UA 4FCYA 4U7DA 3DV8A 2OQGA 3TOBA 1FX7A 3CUQC 3I0TA 3HEFA 5D5XB 4QLCU 1GDTA 4EMSA 1QRYA 2K4JA 2O8XA 1QNTA 3E5UA 4M3GA 3C7JA 4IHXA 2ZO4A 3BJOA 3KLOA 3BJAA 2FQ3A 1KU3A 5KVRA 1BM9A 4HQMA 4P9FA 2EZHA 3KZZA 2IBDA 1FBSA 3BR3A 1LDJA 2P4WA 2XASA 2QQAA 2PJPA 3ZMZA 4EM1A 1XC5A 3BZ6A 1B8IB 1TWAJ 1AU7A 3HBLA 4A0ZA 1K83J 3FWEA 4WXCA 2R5YB 2BYVE 1FTTA 4HYEA 2ZMEB 3H0GJ 1BI1A 2H94A 3V7CA 4GYGA 5JHUA 4BBSJ 4KNYA 2B63J 1JKQC 4HDVA 4UUSB 4I76A 4A3FJ 3G1LA 3EUHA 1MSFC 4Y15A 1JUPA 1ZQ3P 3DKWA 1JUSA 1JJ6C 2E7WA 2O3FA 2IW5A 4M3EA 1TWHJ 4GCVA 3CMYA 2CGPA 1CF7A 1MJBA 1RIOH 2FF4A 3I4NJ 1XS9A 3W6KB 5EYRA 3Q9SA 3RI4A 5HDKA 2JK3A 4A0YA 4A6EA 2CJJA 1HOMA 1IAWA 1T56A 1KQ0A 5E3LA 3IHUA 3GTLJ 3BR6A 4YIFA 4OU0A 3K2AA 3KP4A 5K5QA 5D8KB 2HYFA 2LK2A 4M3DA 1TWCJ 5F08A 3S15J 1EH6A 3S2WA 1FC3A 4D7NA 4UHTA 3PM1A 4XRSG 2OZUA 4R79A 2H09A 2XKPA 4G7ZF 3P9KA 1FJLA 3MFKA 4KN7X 2HOEA 2P7VB 3CDHA 2E2HJ 4I2OA 1F1ZA 4JX4A 1ZHFA 4JX6A 4NDLA 2HOSA 4D7MA 2XGEA 1IXSB 1L0OC 4S05A 3QPSA 3IKVA 3TO7A 2PMZN 3VB2A 4ESFA 2V1XA 3BR2A 2Y31A 3I59A 4PZJA 2EH3A 2VUMJ 5DUIA 5L3GA 1TW2A 2V9VA 1OJLA 1ZRCA 5IT3A 1GXQA 3GZ5A 4U7BA 1KU2A 1IRFA 4UXNA 3L2CA 2QWWA 1KGSA 4YIIA 2A6HF 1ETYA 2R93J 5J8FA 4RBOA 2HXOA 3KP2A 3JRHA 4MEXF 4A3JJ 1ODDA 2F2EA 2HEOA 1QZZA 3HOWJ 1PP7U 2Z99A 3V4GA 1ETKA 1HLVA 2E19A 1O3QA 5M3FJ 1XSDA 3RKQA 3BPXA 5E3MA 1R1VA 1HCRA 4QTRA 1I50J 4BNCA 2JJ7A 1QQIA 3I58A 2K27A 1F36A 2CUFA 1ZTRA 3PO2J 1AKHB 3BP8A 1IN8A 5ED4A 1TBXA 5K5RA 1YS7A 1STZA 1WKMA 1MJAA 1HSTA 1HBXG 5IP7J 2M8EA 2A69F 2LKPA 5D5WB 3HOYJ 1CF7B 3MWMA 2ELKA 5HDNA 2PI0A 3S2HJ 1JE8A 2L7FP 5IYBJ 2FA5A 1ZG1A 2EJRA 4A3KJ 1P92A 3Q0UA 3I71A 4GFBA 2ZCWA 3RPQA 2M9HA 3E5XA 4HF2A 1G4DA 4WCGA 5LHHA 3HOZJ 1TW3A 1APLC 4RGRA 1BW5A 5M5WJ 5JR3A 3REOA 3MQ0A 3KCCA 1GUUA 2DJNA 3JRBA 3P9IA 3OOUA 5BOXA 1B1BA 1G3WA 2GAUA 4Z2YA 1VFCA 3IH3A 4FISA 3FIWA 5LHIA 5F1JA 5BMZA 4KICA 1HSJA 2P5KA 4NQWA 3OIOA 4KN4X 4V2GA 3TDUC 5FKOA 3IL2A 3WU1B 5GPAA 2W24A 4OOIA 4ENJA 1OCTC 1A04A 3V7SA 5H6RA 2QZ8A 5D8LB 2HR3A 2LSOA 1BC8C 2DBBA 4O6JA 5LGUA 5IP9J 3HOUJ 3I59B 3PO3J 5HODA 2LR8A 1RR7A 1T6SA 3HOSA 3GLXA 1WH5A 4XBFA 3CLOA 4EM0B 1FOKA 1TQIA 3WE2A 1HDPA 1BC7C 1YW8A 2L7MP 2YR2A 3FHZA 4IRIA 5F64A 1W5TA 1R5GA 2EK5A 3B02A 3LSPA 1S6LA 4WWCA 2L0KA 2X6OA 3N97A 4EJWA 1Z9CA 2JWTA 5GPCA 1Z77A 2GQQA 1IXRC 3D1NI 2GLOA 3ZQFA 1P7IA 2RNJA 2NVQJ 2RVCA 4EJOA 5HS9A 2WV1A 3B6AA 1DP7P 3MVPA 4BY7J 1G3YA 2XKOA 4MFEA