1U7KA

Structure of a hexameric n-terminal domain from murine leukemia virus capsid
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
131
structure length
131
Chain Sequence
b'PLRMGGNGQLQYWPFSSSDLYNWKNNNPSFSEDPGKLTALIESVLTTHQPTWDDCQQLLGTLLTGEEKQRVLLEARKAVRGNDGRPTQLPNEVDAAFPLERPDWDYTTQRGRNHLVLYRQLLLAGMQNAGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag polyprotein
publication title High-resolution structure of a retroviral capsid hexameric amino-terminal domain.
pubmed doi rcsb
source organism Akr (endogenous) murine leukemia virus
molecule tags Viral protein
total genus 42
structure length 131
sequence length 131
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1u7kA00
3NTEA 1EM9A 2KGFA 4HTWA 1M9EC 3BP9A 2XGUA 4U0DA 2XDEA 3MGEA 4E92A 1EIAA 4WYMA 1M9YC 3H47A 4LQWC 4J93A 1M9DC 2XGYA 2X83A 2M8LA 4PH3A 1L6NA 2LF4A 4U0BA 2PWOA 2GOLB 4PH0A 1GWPA 4XROA 1AK4C 4U0AA 3P05A 4XFZA 3H4EA 5JPAA 2JPRA 4NX4C 2M8PA 1E6JP 5HGOA 2PXRC 4E91A 5HGLA 4INBA 5HGNA 1M9XC 4PH2A 2EIAA 1G03A 5HGKA 2X82A 4U0EA 4U0CA 2WLVA 4QNBA 2V4XA 4XRQA 1M9CC 1M9FC 4B4NA 5HGMA 1QRJA 1U7KA 2PWMA 4DGAC 1P7NA 2M8NA 2WLVB 4U0FA 2GONA 1D1DA 4XFXA 1AFVA 4DGEC 2Y4ZA 2X2DD 2XGVA 4XFYA
chains in the Genus database with same CATH superfamily
3NTEA 1EM9A 2KGFA 4HTWA 1M9EC 3BP9A 2XGUA 4U0DA 2XDEA 3MGEA 4E92A 1EIAA 4WYMA 1M9YC 3H47A 4LQWC 4J93A 1M9DC 2XGYA 2X83A 2M8LA 4PH3A 1L6NA 2LF4A 4U0BA 2PWOA 2GOLB 4PH0A 1GWPA 4XROA 1AK4C 4U0AA 3P05A 4XFZA 3H4EA 5JPAA 2JPRA 4NX4C 2M8PA 1E6JP 5HGOA 2PXRC 4E91A 5HGLA 4INBA 5HGNA 1M9XC 4PH2A 2EIAA 1G03A 5HGKA 2X82A 4U0EA 4U0CA 2WLVA 4QNBA 2V4XA 4XRQA 1M9CC 1M9FC 4B4NA 5HGMA 1QRJA 1U7KA 2PWMA 4DGAC 1P7NA 2M8NA 2WLVB 4U0FA 2GONA 1D1DA 4XFXA 1AFVA 4DGEC 2Y4ZA 2X2DD 2XGVA 4XFYA
chains in the Genus database with same CATH topology
3NTEA 1EM9A 2KGFA 4HTWA 1M9EC 3BP9A 2XGUA 4U0DA 2XDEA 3MGEA 4E92A 1EIAA 4WYMA 1M9YC 3H47A 4LQWC 4J93A 1M9DC 2XGYA 2X83A 2M8LA 4PH3A 1L6NA 2LF4A 4U0BA 2PWOA 2GOLB 4PH0A 1GWPA 4XROA 1AK4C 4U0AA 3P05A 4XFZA 3H4EA 5JPAA 2JPRA 4NX4C 2M8PA 1E6JP 5HGOA 2PXRC 4E91A 5HGLA 4INBA 5HGNA 1M9XC 4PH2A 2EIAA 1G03A 5HGKA 2X82A 4U0EA 4U0CA 2WLVA 4QNBA 2V4XA 4XRQA 1M9CC 1M9FC 4B4NA 5HGMA 1QRJA 1U7KA 2PWMA 4DGAC 1P7NA 2M8NA 2WLVB 4U0FA 2GONA 1D1DA 4XFXA 1AFVA 4DGEC 2Y4ZA 2X2DD 2XGVA 4XFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NTE A;  1EM9 A;  2KGF A;  4HTW A;  1M9E C;  3BP9 A;  2XGU A;  4U0D A;  2XDE A;  3MGE A;  4E92 A;  1EIA A;  4WYM A;  1M9Y C;  3H47 A;  4LQW C;  4J93 A;  1M9D C;  2XGY A;  2X83 A;  2M8L A;  4PH3 A;  1L6N A;  2LF4 A;  4U0B A;  2PWO A;  2GOL B;  4PH0 A;  1GWP A;  4XRO A;  1AK4 C;  4U0A A;  3P05 A;  4XFZ A;  3H4E A;  5JPA A;  2JPR A;  4NX4 C;  2M8P A;  1E6J P;  5HGO A;  2PXR C;  4E91 A;  5HGL A;  4INB A;  5HGN A;  1M9X C;  4PH2 A;  2EIA A;  1G03 A;  5HGK A;  2X82 A;  4U0E A;  4U0C A;  2WLV A;  4QNB A;  2V4X A;  4XRQ A;  1M9C C;  1M9F C;  4B4N A;  5HGM A;  1QRJ A;  1U7K A;  2PWM A;  4DGA C;  1P7N A;  2M8N A;  2WLV B;  4U0F A;  2GON A;  1D1D A;  4XFX A;  1AFV A;  4DGE C;  2Y4Z A;  2X2D D;  2XGV A;  4XFY A; 
#chains in the Genus database with same CATH topology
 3NTE A;  1EM9 A;  2KGF A;  4HTW A;  1M9E C;  3BP9 A;  2XGU A;  4U0D A;  2XDE A;  3MGE A;  4E92 A;  1EIA A;  4WYM A;  1M9Y C;  3H47 A;  4LQW C;  4J93 A;  1M9D C;  2XGY A;  2X83 A;  2M8L A;  4PH3 A;  1L6N A;  2LF4 A;  4U0B A;  2PWO A;  2GOL B;  4PH0 A;  1GWP A;  4XRO A;  1AK4 C;  4U0A A;  3P05 A;  4XFZ A;  3H4E A;  5JPA A;  2JPR A;  4NX4 C;  2M8P A;  1E6J P;  5HGO A;  2PXR C;  4E91 A;  5HGL A;  4INB A;  5HGN A;  1M9X C;  4PH2 A;  2EIA A;  1G03 A;  5HGK A;  2X82 A;  4U0E A;  4U0C A;  2WLV A;  4QNB A;  2V4X A;  4XRQ A;  1M9C C;  1M9F C;  4B4N A;  5HGM A;  1QRJ A;  1U7K A;  2PWM A;  4DGA C;  1P7N A;  2M8N A;  2WLV B;  4U0F A;  2GON A;  1D1D A;  4XFX A;  1AFV A;  4DGE C;  2Y4Z A;  2X2D D;  2XGV A;  4XFY A; 
#chains in the Genus database with same CATH homology
 3NTE A;  1EM9 A;  2KGF A;  4HTW A;  1M9E C;  3BP9 A;  2XGU A;  4U0D A;  2XDE A;  3MGE A;  4E92 A;  1EIA A;  4WYM A;  1M9Y C;  3H47 A;  4LQW C;  4J93 A;  1M9D C;  2XGY A;  2X83 A;  2M8L A;  4PH3 A;  1L6N A;  2LF4 A;  4U0B A;  2PWO A;  2GOL B;  4PH0 A;  1GWP A;  4XRO A;  1AK4 C;  4U0A A;  3P05 A;  4XFZ A;  3H4E A;  5JPA A;  2JPR A;  4NX4 C;  2M8P A;  1E6J P;  5HGO A;  2PXR C;  4E91 A;  5HGL A;  4INB A;  5HGN A;  1M9X C;  4PH2 A;  2EIA A;  1G03 A;  5HGK A;  2X82 A;  4U0E A;  4U0C A;  2WLV A;  4QNB A;  2V4X A;  4XRQ A;  1M9C C;  1M9F C;  4B4N A;  5HGM A;  1QRJ A;  1U7K A;  2PWM A;  4DGA C;  1P7N A;  2M8N A;  2WLV B;  4U0F A;  2GON A;  1D1D A;  4XFX A;  1AFV A;  4DGE C;  2Y4Z A;  2X2D D;  2XGV A;  4XFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...