1U7KA

Structure of a hexameric n-terminal domain from murine leukemia virus capsid
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
131
structure length
131
Chain Sequence
PLRMGGNGQLQYWPFSSSDLYNWKNNNPSFSEDPGKLTALIESVLTTHQPTWDDCQQLLGTLLTGEEKQRVLLEARKAVRGNDGRPTQLPNEVDAAFPLERPDWDYTTQRGRNHLVLYRQLLLAGMQNAGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag polyprotein
publication title High-resolution structure of a retroviral capsid hexameric amino-terminal domain.
pubmed doi rcsb
source organism Akr (endogenous) murine leukemia virus
molecule tags Viral protein
total genus 42
structure length 131
sequence length 131
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1u7kA00
2XGUA 5HGNA 2V4XA 4QNBA 1L6NA 1AFVA 4HTWA 4XROA 2XDEA 3BP9A 2GOLB 4U0BA 2X82A 2LF4A 2JPRA 4U0FA 1M9XC 3MGEA 4PH3A 1EIAA 2WLVB 4U0EA 1D1DA 3H47A 4U0DA 2X83A 5HGKA 2X2DD 2Y4ZA 1GWPA 1QRJA 2PXRC 1M9CC 5HGLA 2WLVA 4PH2A 2M8LA 4DGEC 4LQWC 4XRQA 4INBA 2GONA 4E91A 4U0AA 1M9DC 1M9FC 2EIAA 2PWMA 2M8NA 1U7KA 4E92A 2M8PA 4B4NA 5HGOA 4WYMA 4XFYA 2XGVA 4NX4C 4PH0A 1AK4C 3H4EA 3NTEA 2XGYA 1EM9A 1M9EC 2PWOA 4XFZA 4U0CA 1M9YC 4DGAC 3P05A 1G03A 4XFXA 5JPAA 1P7NA 5HGMA 4J93A 2KGFA 1E6JP
chains in the Genus database with same CATH superfamily
2XGUA 5HGNA 2V4XA 4QNBA 1L6NA 1AFVA 4HTWA 4XROA 2XDEA 3BP9A 2GOLB 4U0BA 2X82A 2LF4A 2JPRA 4U0FA 1M9XC 3MGEA 4PH3A 1EIAA 2WLVB 4U0EA 1D1DA 3H47A 4U0DA 2X83A 5HGKA 2X2DD 2Y4ZA 1GWPA 1QRJA 2PXRC 1M9CC 5HGLA 2WLVA 4PH2A 2M8LA 4DGEC 4LQWC 4XRQA 4INBA 2GONA 4E91A 4U0AA 1M9DC 1M9FC 2EIAA 2PWMA 2M8NA 1U7KA 4E92A 2M8PA 4B4NA 5HGOA 4WYMA 4XFYA 2XGVA 4NX4C 4PH0A 1AK4C 3H4EA 3NTEA 2XGYA 1EM9A 1M9EC 2PWOA 4XFZA 4U0CA 1M9YC 4DGAC 3P05A 1G03A 4XFXA 5JPAA 1P7NA 5HGMA 4J93A 2KGFA 1E6JP
chains in the Genus database with same CATH topology
2XGUA 5HGNA 2V4XA 4QNBA 1L6NA 1AFVA 4HTWA 4XROA 2XDEA 3BP9A 2GOLB 4U0BA 2X82A 2LF4A 2JPRA 4U0FA 1M9XC 3MGEA 4PH3A 1EIAA 2WLVB 4U0EA 1D1DA 3H47A 4U0DA 2X83A 5HGKA 2X2DD 2Y4ZA 1GWPA 1QRJA 2PXRC 1M9CC 5HGLA 2WLVA 4PH2A 2M8LA 4DGEC 4LQWC 4XRQA 4INBA 2GONA 4E91A 4U0AA 1M9DC 1M9FC 2EIAA 2PWMA 2M8NA 1U7KA 4E92A 2M8PA 4B4NA 5HGOA 4WYMA 4XFYA 2XGVA 4NX4C 4PH0A 1AK4C 3H4EA 3NTEA 2XGYA 1EM9A 1M9EC 2PWOA 4XFZA 4U0CA 1M9YC 4DGAC 3P05A 1G03A 4XFXA 5JPAA 1P7NA 5HGMA 4J93A 2KGFA 1E6JP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XGU A;  5HGN A;  2V4X A;  4QNB A;  1L6N A;  1AFV A;  4HTW A;  4XRO A;  2XDE A;  3BP9 A;  2GOL B;  4U0B A;  2X82 A;  2LF4 A;  2JPR A;  4U0F A;  1M9X C;  3MGE A;  4PH3 A;  1EIA A;  2WLV B;  4U0E A;  1D1D A;  3H47 A;  4U0D A;  2X83 A;  5HGK A;  2X2D D;  2Y4Z A;  1GWP A;  1QRJ A;  2PXR C;  1M9C C;  5HGL A;  2WLV A;  4PH2 A;  2M8L A;  4DGE C;  4LQW C;  4XRQ A;  4INB A;  2GON A;  4E91 A;  4U0A A;  1M9D C;  1M9F C;  2EIA A;  2PWM A;  2M8N A;  1U7K A;  4E92 A;  2M8P A;  4B4N A;  5HGO A;  4WYM A;  4XFY A;  2XGV A;  4NX4 C;  4PH0 A;  1AK4 C;  3H4E A;  3NTE A;  2XGY A;  1EM9 A;  1M9E C;  2PWO A;  4XFZ A;  4U0C A;  1M9Y C;  4DGA C;  3P05 A;  1G03 A;  4XFX A;  5JPA A;  1P7N A;  5HGM A;  4J93 A;  2KGF A;  1E6J P; 
#chains in the Genus database with same CATH topology
 2XGU A;  5HGN A;  2V4X A;  4QNB A;  1L6N A;  1AFV A;  4HTW A;  4XRO A;  2XDE A;  3BP9 A;  2GOL B;  4U0B A;  2X82 A;  2LF4 A;  2JPR A;  4U0F A;  1M9X C;  3MGE A;  4PH3 A;  1EIA A;  2WLV B;  4U0E A;  1D1D A;  3H47 A;  4U0D A;  2X83 A;  5HGK A;  2X2D D;  2Y4Z A;  1GWP A;  1QRJ A;  2PXR C;  1M9C C;  5HGL A;  2WLV A;  4PH2 A;  2M8L A;  4DGE C;  4LQW C;  4XRQ A;  4INB A;  2GON A;  4E91 A;  4U0A A;  1M9D C;  1M9F C;  2EIA A;  2PWM A;  2M8N A;  1U7K A;  4E92 A;  2M8P A;  4B4N A;  5HGO A;  4WYM A;  4XFY A;  2XGV A;  4NX4 C;  4PH0 A;  1AK4 C;  3H4E A;  3NTE A;  2XGY A;  1EM9 A;  1M9E C;  2PWO A;  4XFZ A;  4U0C A;  1M9Y C;  4DGA C;  3P05 A;  1G03 A;  4XFX A;  5JPA A;  1P7N A;  5HGM A;  4J93 A;  2KGF A;  1E6J P; 
#chains in the Genus database with same CATH homology
 2XGU A;  5HGN A;  2V4X A;  4QNB A;  1L6N A;  1AFV A;  4HTW A;  4XRO A;  2XDE A;  3BP9 A;  2GOL B;  4U0B A;  2X82 A;  2LF4 A;  2JPR A;  4U0F A;  1M9X C;  3MGE A;  4PH3 A;  1EIA A;  2WLV B;  4U0E A;  1D1D A;  3H47 A;  4U0D A;  2X83 A;  5HGK A;  2X2D D;  2Y4Z A;  1GWP A;  1QRJ A;  2PXR C;  1M9C C;  5HGL A;  2WLV A;  4PH2 A;  2M8L A;  4DGE C;  4LQW C;  4XRQ A;  4INB A;  2GON A;  4E91 A;  4U0A A;  1M9D C;  1M9F C;  2EIA A;  2PWM A;  2M8N A;  1U7K A;  4E92 A;  2M8P A;  4B4N A;  5HGO A;  4WYM A;  4XFY A;  2XGV A;  4NX4 C;  4PH0 A;  1AK4 C;  3H4E A;  3NTE A;  2XGY A;  1EM9 A;  1M9E C;  2PWO A;  4XFZ A;  4U0C A;  1M9Y C;  4DGA C;  3P05 A;  1G03 A;  4XFX A;  5JPA A;  1P7N A;  5HGM A;  4J93 A;  2KGF A;  1E6J P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...