1U7KA

Structure of a hexameric n-terminal domain from murine leukemia virus capsid
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
131
structure length
131
Chain Sequence
PLRMGGNGQLQYWPFSSSDLYNWKNNNPSFSEDPGKLTALIESVLTTHQPTWDDCQQLLGTLLTGEEKQRVLLEARKAVRGNDGRPTQLPNEVDAAFPLERPDWDYTTQRGRNHLVLYRQLLLAGMQNAGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structure of a retroviral capsid hexameric amino-terminal domain.
pubmed doi rcsb
source organism Akr (endogenous) murine leukemia virus
molecule tags Viral protein
molecule keywords Gag polyprotein
total genus 42
structure length 131
sequence length 131
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1u7kA00
2LF4A 4QNBA 2JPRA 1M9CC 1P7NA 4INBA 5JPAA 2V4XA 1AK4C 4U0FA 3H4EA 2M8LA 4J93A 1U7KA 2KGFA 1QRJA 2EIAA 3MGEA 2X83A 5HGOA 4PH3A 2X2DD 4DGEC 4B4NA 4E91A 4U0AA 2XGYA 4PH0A 1D1DA 5HGLA 1EM9A 5HGNA 2XDEA 2GOLB 4U0DA 4XROA 3H47A 1M9FC 4HTWA 4U0EA 1M9EC 2XGVA 4XFYA 1M9YC 2M8PA 4PH2A 4DGAC 4WYMA 4E92A 4U0BA 4NX4C 1E6JP 2XGUA 3NTEA 1GWPA 2WLVB 2Y4ZA 4LQWC 1G03A 2PWMA 3P05A 2GONA 4XFXA 1L6NA 4XFZA 1AFVA 1M9DC 1EIAA 2WLVA 2PXRC 5HGMA 4XRQA 5HGKA 4U0CA 2X82A 3BP9A 1M9XC 2M8NA 2PWOA
chains in the Genus database with same CATH superfamily
2LF4A 4QNBA 2JPRA 1M9CC 1P7NA 4INBA 5JPAA 2V4XA 1AK4C 4U0FA 3H4EA 2M8LA 4J93A 1U7KA 2KGFA 1QRJA 2EIAA 3MGEA 2X83A 5HGOA 4PH3A 2X2DD 4DGEC 4B4NA 4E91A 4U0AA 2XGYA 4PH0A 1D1DA 5HGLA 1EM9A 5HGNA 2XDEA 2GOLB 4U0DA 4XROA 3H47A 1M9FC 4HTWA 4U0EA 1M9EC 2XGVA 4XFYA 1M9YC 2M8PA 4PH2A 4DGAC 4WYMA 4E92A 4U0BA 4NX4C 1E6JP 2XGUA 3NTEA 1GWPA 2WLVB 2Y4ZA 4LQWC 1G03A 2PWMA 3P05A 2GONA 4XFXA 1L6NA 4XFZA 1AFVA 1M9DC 1EIAA 2WLVA 2PXRC 5HGMA 4XRQA 5HGKA 4U0CA 2X82A 3BP9A 1M9XC 2M8NA 2PWOA
chains in the Genus database with same CATH topology
2LF4A 4QNBA 2JPRA 1M9CC 1P7NA 4INBA 5JPAA 2V4XA 1AK4C 4U0FA 3H4EA 2M8LA 4J93A 1U7KA 2KGFA 1QRJA 2EIAA 3MGEA 2X83A 5HGOA 4PH3A 2X2DD 4DGEC 4B4NA 4E91A 4U0AA 2XGYA 4PH0A 1D1DA 5HGLA 1EM9A 5HGNA 2XDEA 2GOLB 4U0DA 4XROA 3H47A 1M9FC 4HTWA 4U0EA 1M9EC 2XGVA 4XFYA 1M9YC 2M8PA 4PH2A 4DGAC 4WYMA 4E92A 4U0BA 4NX4C 1E6JP 2XGUA 3NTEA 1GWPA 2WLVB 2Y4ZA 4LQWC 1G03A 2PWMA 3P05A 2GONA 4XFXA 1L6NA 4XFZA 1AFVA 1M9DC 1EIAA 2WLVA 2PXRC 5HGMA 4XRQA 5HGKA 4U0CA 2X82A 3BP9A 1M9XC 2M8NA 2PWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LF4 A;  4QNB A;  2JPR A;  1M9C C;  1P7N A;  4INB A;  5JPA A;  2V4X A;  1AK4 C;  4U0F A;  3H4E A;  2M8L A;  4J93 A;  1U7K A;  2KGF A;  1QRJ A;  2EIA A;  3MGE A;  2X83 A;  5HGO A;  4PH3 A;  2X2D D;  4DGE C;  4B4N A;  4E91 A;  4U0A A;  2XGY A;  4PH0 A;  1D1D A;  5HGL A;  1EM9 A;  5HGN A;  2XDE A;  2GOL B;  4U0D A;  4XRO A;  3H47 A;  1M9F C;  4HTW A;  4U0E A;  1M9E C;  2XGV A;  4XFY A;  1M9Y C;  2M8P A;  4PH2 A;  4DGA C;  4WYM A;  4E92 A;  4U0B A;  4NX4 C;  1E6J P;  2XGU A;  3NTE A;  1GWP A;  2WLV B;  2Y4Z A;  4LQW C;  1G03 A;  2PWM A;  3P05 A;  2GON A;  4XFX A;  1L6N A;  4XFZ A;  1AFV A;  1M9D C;  1EIA A;  2WLV A;  2PXR C;  5HGM A;  4XRQ A;  5HGK A;  4U0C A;  2X82 A;  3BP9 A;  1M9X C;  2M8N A;  2PWO A; 
#chains in the Genus database with same CATH topology
 2LF4 A;  4QNB A;  2JPR A;  1M9C C;  1P7N A;  4INB A;  5JPA A;  2V4X A;  1AK4 C;  4U0F A;  3H4E A;  2M8L A;  4J93 A;  1U7K A;  2KGF A;  1QRJ A;  2EIA A;  3MGE A;  2X83 A;  5HGO A;  4PH3 A;  2X2D D;  4DGE C;  4B4N A;  4E91 A;  4U0A A;  2XGY A;  4PH0 A;  1D1D A;  5HGL A;  1EM9 A;  5HGN A;  2XDE A;  2GOL B;  4U0D A;  4XRO A;  3H47 A;  1M9F C;  4HTW A;  4U0E A;  1M9E C;  2XGV A;  4XFY A;  1M9Y C;  2M8P A;  4PH2 A;  4DGA C;  4WYM A;  4E92 A;  4U0B A;  4NX4 C;  1E6J P;  2XGU A;  3NTE A;  1GWP A;  2WLV B;  2Y4Z A;  4LQW C;  1G03 A;  2PWM A;  3P05 A;  2GON A;  4XFX A;  1L6N A;  4XFZ A;  1AFV A;  1M9D C;  1EIA A;  2WLV A;  2PXR C;  5HGM A;  4XRQ A;  5HGK A;  4U0C A;  2X82 A;  3BP9 A;  1M9X C;  2M8N A;  2PWO A; 
#chains in the Genus database with same CATH homology
 2LF4 A;  4QNB A;  2JPR A;  1M9C C;  1P7N A;  4INB A;  5JPA A;  2V4X A;  1AK4 C;  4U0F A;  3H4E A;  2M8L A;  4J93 A;  1U7K A;  2KGF A;  1QRJ A;  2EIA A;  3MGE A;  2X83 A;  5HGO A;  4PH3 A;  2X2D D;  4DGE C;  4B4N A;  4E91 A;  4U0A A;  2XGY A;  4PH0 A;  1D1D A;  5HGL A;  1EM9 A;  5HGN A;  2XDE A;  2GOL B;  4U0D A;  4XRO A;  3H47 A;  1M9F C;  4HTW A;  4U0E A;  1M9E C;  2XGV A;  4XFY A;  1M9Y C;  2M8P A;  4PH2 A;  4DGA C;  4WYM A;  4E92 A;  4U0B A;  4NX4 C;  1E6J P;  2XGU A;  3NTE A;  1GWP A;  2WLV B;  2Y4Z A;  4LQW C;  1G03 A;  2PWM A;  3P05 A;  2GON A;  4XFX A;  1L6N A;  4XFZ A;  1AFV A;  1M9D C;  1EIA A;  2WLV A;  2PXR C;  5HGM A;  4XRQ A;  5HGK A;  4U0C A;  2X82 A;  3BP9 A;  1M9X C;  2M8N A;  2PWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...