1U7QA

The solution structure of the nucleotide binding domain of kdpb
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
136
structure length
136
Chain Sequence
b'NRQASEFIPAQGVDEKTLADAAQLASLADETPEGRSIVILAKQRFNLRERDVQSLHATFVPFTAQSRMSGINIDNRMIRKGSVDAIRRHVEANGGHFPTDVDQKVDQVARQGATPLVVVEGSRVLGVIALKDIVKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium-transporting ATPase B chain
publication title Inter-domain motions of the N-domain of the KdpFABC complex, a P-type ATPase, are not driven by ATP-induced conformational changes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 33
structure length 136
sequence length 136
ec nomenclature ec 7.2.2.6: P-type K(+) transporter.
pdb deposition date 2004-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1110.10 Alpha Beta 3-Layer(aba) Sandwich Calcium-transporting ATPase, cytoplasmic domain N Calcium-transporting ATPase, cytoplasmic domain N 1u7qA00
5AVSA 3W5AA 2KMVA 2BY4A 3GWIA 3AR4A 3TLMA 3W5BA 2B8EA 3WGUA 3SKXA 5AW1A 3FPBA 3FPSA 4BYGA 5AVYA 3BA6A 2ARFA 2ZBDA 4H1WA 1XP5A 3WGVA 3AR2A 1T5SA 5AW2A 5AVXA 5AVZA 3AR7A 3W5CA 4BEWA 2C8KA 4XOUA 3AR8A 2C9MA 5AW4A 5AW5A 4YCNA 2ZBGA 5AVRA 5AVQA 1IWOA 2A29A 2AGVA 4J2TA 2ZBFA 3NALA 4UU0A 1Q3IA 4Y3UA 4RESA 5AVWA 3A1CA 1U7QA 3A1DA 5AVTA 3SKYA 5AVUA 3J7TA 1T5TA 5AW3A 3B8EA 4RETA 5A3SA 4KYTA 2OA0A 3W5DA 3AR3A 3AR6A 2EARA 3B9BA 5A3RA 4YCMA 2EAUA 2A00A 3B9RA 1SU4A 2C88A 2IYEA 2YJ5A 3RFUA 5AW6A 3N5KA 4YCLA 2YJ3A 1SVJA 5A3QA 2O9JA 2DQSA 1WPGA 5AW9A 4NABA 1MO8A 2YJ6A 2ZBEA 4UU1A 3AR5A 4BEVA 1VFPA 3FGOA 3AR9A 5AW8A 2C8LA 5AW7A 5AW0A 2EATA 2YFYA 3NANA 4HYTA 2KMXA 1MO7A 2YJ4A 3NAMA 4XE5A 4UMVA 4BBJA 3N8GA 5AVVA 3A3YA 3A1EA 2ZXEA 3KDPA
chains in the Genus database with same CATH superfamily
5AVSA 3W5AA 2KMVA 2BY4A 3GWIA 3AR4A 3TLMA 3W5BA 2B8EA 3WGUA 3SKXA 5AW1A 3FPBA 3FPSA 4BYGA 5AVYA 3BA6A 2ARFA 2ZBDA 4H1WA 1XP5A 3WGVA 3AR2A 1T5SA 5AW2A 5AVXA 5AVZA 3AR7A 3W5CA 4BEWA 2C8KA 4XOUA 3AR8A 2C9MA 5AW4A 5AW5A 4YCNA 2ZBGA 5AVRA 5AVQA 1IWOA 2A29A 2AGVA 4J2TA 2ZBFA 3NALA 4UU0A 1Q3IA 4Y3UA 4RESA 5AVWA 3A1CA 1U7QA 3A1DA 5AVTA 3SKYA 5AVUA 3J7TA 1T5TA 5AW3A 3B8EA 4RETA 5A3SA 4KYTA 2OA0A 3W5DA 3AR3A 3AR6A 2EARA 3B9BA 5A3RA 4YCMA 2EAUA 2A00A 3B9RA 1SU4A 2C88A 2IYEA 2YJ5A 3RFUA 5AW6A 3N5KA 4YCLA 2YJ3A 1SVJA 5A3QA 2O9JA 2DQSA 1WPGA 5AW9A 4NABA 1MO8A 2YJ6A 2ZBEA 4UU1A 3AR5A 4BEVA 1VFPA 3FGOA 3AR9A 5AW8A 2C8LA 5AW7A 5AW0A 2EATA 2YFYA 3NANA 4HYTA 2KMXA 1MO7A 2YJ4A 3NAMA 4XE5A 4UMVA 4BBJA 3N8GA 5AVVA 3A3YA 3A1EA 2ZXEA 3KDPA
chains in the Genus database with same CATH topology
5AVSA 3W5AA 2KMVA 2BY4A 3GWIA 3AR4A 3TLMA 3W5BA 2B8EA 3WGUA 3SKXA 5AW1A 3FPBA 3FPSA 4BYGA 5AVYA 3BA6A 2ARFA 2ZBDA 4H1WA 1XP5A 3WGVA 3AR2A 1T5SA 5AW2A 5AVXA 5AVZA 3AR7A 3W5CA 4BEWA 2C8KA 4XOUA 3AR8A 2C9MA 5AW4A 5AW5A 4YCNA 2ZBGA 5AVRA 5AVQA 1IWOA 2A29A 2AGVA 4J2TA 2ZBFA 3NALA 4UU0A 1Q3IA 4Y3UA 4RESA 5AVWA 3A1CA 1U7QA 3A1DA 5AVTA 3SKYA 5AVUA 3J7TA 1T5TA 5AW3A 3B8EA 4RETA 5A3SA 4KYTA 2OA0A 3W5DA 3AR3A 3AR6A 2EARA 3B9BA 5A3RA 4YCMA 2EAUA 2A00A 3B9RA 1SU4A 2C88A 2IYEA 2YJ5A 3RFUA 5AW6A 3N5KA 4YCLA 2YJ3A 1SVJA 5A3QA 2O9JA 2DQSA 1WPGA 5AW9A 4NABA 1MO8A 2YJ6A 2ZBEA 4UU1A 3AR5A 4BEVA 1VFPA 3FGOA 3AR9A 5AW8A 2C8LA 5AW7A 5AW0A 2EATA 2YFYA 3NANA 4HYTA 2KMXA 1MO7A 2YJ4A 3NAMA 4XE5A 4UMVA 4BBJA 3N8GA 5AVVA 3A3YA 3A1EA 2ZXEA 3KDPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVS A;  3W5A A;  2KMV A;  2BY4 A;  3GWI A;  3AR4 A;  3TLM A;  3W5B A;  2B8E A;  3WGU A;  3SKX A;  5AW1 A;  3FPB A;  3FPS A;  4BYG A;  5AVY A;  3BA6 A;  2ARF A;  2ZBD A;  4H1W A;  1XP5 A;  3WGV A;  3AR2 A;  1T5S A;  5AW2 A;  5AVX A;  5AVZ A;  3AR7 A;  3W5C A;  4BEW A;  2C8K A;  4XOU A;  3AR8 A;  2C9M A;  5AW4 A;  5AW5 A;  4YCN A;  2ZBG A;  5AVR A;  5AVQ A;  1IWO A;  2A29 A;  2AGV A;  4J2T A;  2ZBF A;  3NAL A;  4UU0 A;  1Q3I A;  4Y3U A;  4RES A;  5AVW A;  3A1C A;  1U7Q A;  3A1D A;  5AVT A;  3SKY A;  5AVU A;  3J7T A;  1T5T A;  5AW3 A;  3B8E A;  4RET A;  5A3S A;  4KYT A;  2OA0 A;  3W5D A;  3AR3 A;  3AR6 A;  2EAR A;  3B9B A;  5A3R A;  4YCM A;  2EAU A;  2A00 A;  3B9R A;  1SU4 A;  2C88 A;  2IYE A;  2YJ5 A;  3RFU A;  5AW6 A;  3N5K A;  4YCL A;  2YJ3 A;  1SVJ A;  5A3Q A;  2O9J A;  2DQS A;  1WPG A;  5AW9 A;  4NAB A;  1MO8 A;  2YJ6 A;  2ZBE A;  4UU1 A;  3AR5 A;  4BEV A;  1VFP A;  3FGO A;  3AR9 A;  5AW8 A;  2C8L A;  5AW7 A;  5AW0 A;  2EAT A;  2YFY A;  3NAN A;  4HYT A;  2KMX A;  1MO7 A;  2YJ4 A;  3NAM A;  4XE5 A;  4UMV A;  4BBJ A;  3N8G A;  5AVV A;  3A3Y A;  3A1E A;  2ZXE A;  3KDP A; 
#chains in the Genus database with same CATH topology
 5AVS A;  3W5A A;  2KMV A;  2BY4 A;  3GWI A;  3AR4 A;  3TLM A;  3W5B A;  2B8E A;  3WGU A;  3SKX A;  5AW1 A;  3FPB A;  3FPS A;  4BYG A;  5AVY A;  3BA6 A;  2ARF A;  2ZBD A;  4H1W A;  1XP5 A;  3WGV A;  3AR2 A;  1T5S A;  5AW2 A;  5AVX A;  5AVZ A;  3AR7 A;  3W5C A;  4BEW A;  2C8K A;  4XOU A;  3AR8 A;  2C9M A;  5AW4 A;  5AW5 A;  4YCN A;  2ZBG A;  5AVR A;  5AVQ A;  1IWO A;  2A29 A;  2AGV A;  4J2T A;  2ZBF A;  3NAL A;  4UU0 A;  1Q3I A;  4Y3U A;  4RES A;  5AVW A;  3A1C A;  1U7Q A;  3A1D A;  5AVT A;  3SKY A;  5AVU A;  3J7T A;  1T5T A;  5AW3 A;  3B8E A;  4RET A;  5A3S A;  4KYT A;  2OA0 A;  3W5D A;  3AR3 A;  3AR6 A;  2EAR A;  3B9B A;  5A3R A;  4YCM A;  2EAU A;  2A00 A;  3B9R A;  1SU4 A;  2C88 A;  2IYE A;  2YJ5 A;  3RFU A;  5AW6 A;  3N5K A;  4YCL A;  2YJ3 A;  1SVJ A;  5A3Q A;  2O9J A;  2DQS A;  1WPG A;  5AW9 A;  4NAB A;  1MO8 A;  2YJ6 A;  2ZBE A;  4UU1 A;  3AR5 A;  4BEV A;  1VFP A;  3FGO A;  3AR9 A;  5AW8 A;  2C8L A;  5AW7 A;  5AW0 A;  2EAT A;  2YFY A;  3NAN A;  4HYT A;  2KMX A;  1MO7 A;  2YJ4 A;  3NAM A;  4XE5 A;  4UMV A;  4BBJ A;  3N8G A;  5AVV A;  3A3Y A;  3A1E A;  2ZXE A;  3KDP A; 
#chains in the Genus database with same CATH homology
 5AVS A;  3W5A A;  2KMV A;  2BY4 A;  3GWI A;  3AR4 A;  3TLM A;  3W5B A;  2B8E A;  3WGU A;  3SKX A;  5AW1 A;  3FPB A;  3FPS A;  4BYG A;  5AVY A;  3BA6 A;  2ARF A;  2ZBD A;  4H1W A;  1XP5 A;  3WGV A;  3AR2 A;  1T5S A;  5AW2 A;  5AVX A;  5AVZ A;  3AR7 A;  3W5C A;  4BEW A;  2C8K A;  4XOU A;  3AR8 A;  2C9M A;  5AW4 A;  5AW5 A;  4YCN A;  2ZBG A;  5AVR A;  5AVQ A;  1IWO A;  2A29 A;  2AGV A;  4J2T A;  2ZBF A;  3NAL A;  4UU0 A;  1Q3I A;  4Y3U A;  4RES A;  5AVW A;  3A1C A;  1U7Q A;  3A1D A;  5AVT A;  3SKY A;  5AVU A;  3J7T A;  1T5T A;  5AW3 A;  3B8E A;  4RET A;  5A3S A;  4KYT A;  2OA0 A;  3W5D A;  3AR3 A;  3AR6 A;  2EAR A;  3B9B A;  5A3R A;  4YCM A;  2EAU A;  2A00 A;  3B9R A;  1SU4 A;  2C88 A;  2IYE A;  2YJ5 A;  3RFU A;  5AW6 A;  3N5K A;  4YCL A;  2YJ3 A;  1SVJ A;  5A3Q A;  2O9J A;  2DQS A;  1WPG A;  5AW9 A;  4NAB A;  1MO8 A;  2YJ6 A;  2ZBE A;  4UU1 A;  3AR5 A;  4BEV A;  1VFP A;  3FGO A;  3AR9 A;  5AW8 A;  2C8L A;  5AW7 A;  5AW0 A;  2EAT A;  2YFY A;  3NAN A;  4HYT A;  2KMX A;  1MO7 A;  2YJ4 A;  3NAM A;  4XE5 A;  4UMV A;  4BBJ A;  3N8G A;  5AVV A;  3A3Y A;  3A1E A;  2ZXE A;  3KDP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...