1U7QA

The solution structure of the nucleotide binding domain of kdpb
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
136
structure length
136
Chain Sequence
NRQASEFIPAQGVDEKTLADAAQLASLADETPEGRSIVILAKQRFNLRERDVQSLHATFVPFTAQSRMSGINIDNRMIRKGSVDAIRRHVEANGGHFPTDVDQKVDQVARQGATPLVVVEGSRVLGVIALKDIVKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Inter-domain motions of the N-domain of the KdpFABC complex, a P-type ATPase, are not driven by ATP-induced conformational changes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Potassium-transporting ATPase B chain
total genus 33
structure length 136
sequence length 136
ec nomenclature ec 7.2.2.6: P-type K(+) transporter.
pdb deposition date 2004-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1110.10 Alpha Beta 3-Layer(aba) Sandwich Calcium-transporting ATPase, cytoplasmic domain N Calcium-transporting ATPase, cytoplasmic domain N 1u7qA00
2YJ3A 3B9RA 5AVUA 1SVJA 2IYEA 4J2TA 5AW5A 3WGUA 3WGVA 3AR2A 4Y3UA 2C8LA 3A1EA 5AW4A 2ZBEA 1XP5A 3NANA 5AVWA 5AVTA 3TLMA 2BY4A 4YCMA 4YCNA 2OA0A 3AR6A 1T5TA 3A3YA 5AW6A 3AR7A 1IWOA 2B8EA 3NAMA 5AVSA 5AW2A 2KMXA 4UU0A 4UMVA 3FPBA 2YJ5A 3W5AA 3FPSA 3SKYA 1U7QA 3A1DA 5AW7A 2EATA 2ARFA 2ZBFA 4H1WA 5AW9A 4RESA 3AR8A 4BBJA 2ZXEA 2C9MA 3W5CA 5AVZA 2O9JA 3AR9A 3SKXA 1MO7A 2ZBDA 3N5KA 4UU1A 5A3RA 1Q3IA 1MO8A 3A1CA 2DQSA 2ZBGA 4KYTA 1VFPA 5AW3A 1T5SA 4BEWA 2A00A 4RETA 2YJ4A 5AVQA 2KMVA 4XOUA 3FGOA 3RFUA 4XE5A 4YCLA 5AW1A 3AR5A 3AR3A 3BA6A 1WPGA 5AW8A 5AVXA 2EAUA 2C8KA 1SU4A 2EARA 4HYTA 2YJ6A 2A29A 5A3QA 5AW0A 3W5BA 3J7TA 5A3SA 3B9BA 5AVRA 2AGVA 3KDPA 3W5DA 3GWIA 5AVVA 3B8EA 4BEVA 5AVYA 3N8GA 2YFYA 3AR4A 4NABA 4BYGA 2C88A 3NALA
chains in the Genus database with same CATH superfamily
2YJ3A 3B9RA 5AVUA 1SVJA 2IYEA 4J2TA 5AW5A 3WGUA 3WGVA 3AR2A 4Y3UA 2C8LA 3A1EA 5AW4A 2ZBEA 1XP5A 3NANA 5AVWA 5AVTA 3TLMA 2BY4A 4YCMA 4YCNA 2OA0A 3AR6A 1T5TA 3A3YA 5AW6A 3AR7A 1IWOA 2B8EA 3NAMA 5AVSA 5AW2A 2KMXA 4UU0A 4UMVA 3FPBA 2YJ5A 3W5AA 3FPSA 3SKYA 1U7QA 3A1DA 5AW7A 2EATA 2ARFA 2ZBFA 4H1WA 5AW9A 4RESA 3AR8A 4BBJA 2ZXEA 2C9MA 3W5CA 5AVZA 2O9JA 3AR9A 3SKXA 1MO7A 2ZBDA 3N5KA 4UU1A 5A3RA 1Q3IA 1MO8A 3A1CA 2DQSA 2ZBGA 4KYTA 1VFPA 5AW3A 1T5SA 4BEWA 2A00A 4RETA 2YJ4A 5AVQA 2KMVA 4XOUA 3FGOA 3RFUA 4XE5A 4YCLA 5AW1A 3AR5A 3AR3A 3BA6A 1WPGA 5AW8A 5AVXA 2EAUA 2C8KA 1SU4A 2EARA 4HYTA 2YJ6A 2A29A 5A3QA 5AW0A 3W5BA 3J7TA 5A3SA 3B9BA 5AVRA 2AGVA 3KDPA 3W5DA 3GWIA 5AVVA 3B8EA 4BEVA 5AVYA 3N8GA 2YFYA 3AR4A 4NABA 4BYGA 2C88A 3NALA
chains in the Genus database with same CATH topology
2YJ3A 3B9RA 5AVUA 1SVJA 2IYEA 4J2TA 5AW5A 3WGUA 3WGVA 3AR2A 4Y3UA 2C8LA 3A1EA 5AW4A 2ZBEA 1XP5A 3NANA 5AVWA 5AVTA 3TLMA 2BY4A 4YCMA 4YCNA 2OA0A 3AR6A 1T5TA 3A3YA 5AW6A 3AR7A 1IWOA 2B8EA 3NAMA 5AVSA 5AW2A 2KMXA 4UU0A 4UMVA 3FPBA 2YJ5A 3W5AA 3FPSA 3SKYA 1U7QA 3A1DA 5AW7A 2EATA 2ARFA 2ZBFA 4H1WA 5AW9A 4RESA 3AR8A 4BBJA 2ZXEA 2C9MA 3W5CA 5AVZA 2O9JA 3AR9A 3SKXA 1MO7A 2ZBDA 3N5KA 4UU1A 5A3RA 1Q3IA 1MO8A 3A1CA 2DQSA 2ZBGA 4KYTA 1VFPA 5AW3A 1T5SA 4BEWA 2A00A 4RETA 2YJ4A 5AVQA 2KMVA 4XOUA 3FGOA 3RFUA 4XE5A 4YCLA 5AW1A 3AR5A 3AR3A 3BA6A 1WPGA 5AW8A 5AVXA 2EAUA 2C8KA 1SU4A 2EARA 4HYTA 2YJ6A 2A29A 5A3QA 5AW0A 3W5BA 3J7TA 5A3SA 3B9BA 5AVRA 2AGVA 3KDPA 3W5DA 3GWIA 5AVVA 3B8EA 4BEVA 5AVYA 3N8GA 2YFYA 3AR4A 4NABA 4BYGA 2C88A 3NALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YJ3 A;  3B9R A;  5AVU A;  1SVJ A;  2IYE A;  4J2T A;  5AW5 A;  3WGU A;  3WGV A;  3AR2 A;  4Y3U A;  2C8L A;  3A1E A;  5AW4 A;  2ZBE A;  1XP5 A;  3NAN A;  5AVW A;  5AVT A;  3TLM A;  2BY4 A;  4YCM A;  4YCN A;  2OA0 A;  3AR6 A;  1T5T A;  3A3Y A;  5AW6 A;  3AR7 A;  1IWO A;  2B8E A;  3NAM A;  5AVS A;  5AW2 A;  2KMX A;  4UU0 A;  4UMV A;  3FPB A;  2YJ5 A;  3W5A A;  3FPS A;  3SKY A;  1U7Q A;  3A1D A;  5AW7 A;  2EAT A;  2ARF A;  2ZBF A;  4H1W A;  5AW9 A;  4RES A;  3AR8 A;  4BBJ A;  2ZXE A;  2C9M A;  3W5C A;  5AVZ A;  2O9J A;  3AR9 A;  3SKX A;  1MO7 A;  2ZBD A;  3N5K A;  4UU1 A;  5A3R A;  1Q3I A;  1MO8 A;  3A1C A;  2DQS A;  2ZBG A;  4KYT A;  1VFP A;  5AW3 A;  1T5S A;  4BEW A;  2A00 A;  4RET A;  2YJ4 A;  5AVQ A;  2KMV A;  4XOU A;  3FGO A;  3RFU A;  4XE5 A;  4YCL A;  5AW1 A;  3AR5 A;  3AR3 A;  3BA6 A;  1WPG A;  5AW8 A;  5AVX A;  2EAU A;  2C8K A;  1SU4 A;  2EAR A;  4HYT A;  2YJ6 A;  2A29 A;  5A3Q A;  5AW0 A;  3W5B A;  3J7T A;  5A3S A;  3B9B A;  5AVR A;  2AGV A;  3KDP A;  3W5D A;  3GWI A;  5AVV A;  3B8E A;  4BEV A;  5AVY A;  3N8G A;  2YFY A;  3AR4 A;  4NAB A;  4BYG A;  2C88 A;  3NAL A; 
#chains in the Genus database with same CATH topology
 2YJ3 A;  3B9R A;  5AVU A;  1SVJ A;  2IYE A;  4J2T A;  5AW5 A;  3WGU A;  3WGV A;  3AR2 A;  4Y3U A;  2C8L A;  3A1E A;  5AW4 A;  2ZBE A;  1XP5 A;  3NAN A;  5AVW A;  5AVT A;  3TLM A;  2BY4 A;  4YCM A;  4YCN A;  2OA0 A;  3AR6 A;  1T5T A;  3A3Y A;  5AW6 A;  3AR7 A;  1IWO A;  2B8E A;  3NAM A;  5AVS A;  5AW2 A;  2KMX A;  4UU0 A;  4UMV A;  3FPB A;  2YJ5 A;  3W5A A;  3FPS A;  3SKY A;  1U7Q A;  3A1D A;  5AW7 A;  2EAT A;  2ARF A;  2ZBF A;  4H1W A;  5AW9 A;  4RES A;  3AR8 A;  4BBJ A;  2ZXE A;  2C9M A;  3W5C A;  5AVZ A;  2O9J A;  3AR9 A;  3SKX A;  1MO7 A;  2ZBD A;  3N5K A;  4UU1 A;  5A3R A;  1Q3I A;  1MO8 A;  3A1C A;  2DQS A;  2ZBG A;  4KYT A;  1VFP A;  5AW3 A;  1T5S A;  4BEW A;  2A00 A;  4RET A;  2YJ4 A;  5AVQ A;  2KMV A;  4XOU A;  3FGO A;  3RFU A;  4XE5 A;  4YCL A;  5AW1 A;  3AR5 A;  3AR3 A;  3BA6 A;  1WPG A;  5AW8 A;  5AVX A;  2EAU A;  2C8K A;  1SU4 A;  2EAR A;  4HYT A;  2YJ6 A;  2A29 A;  5A3Q A;  5AW0 A;  3W5B A;  3J7T A;  5A3S A;  3B9B A;  5AVR A;  2AGV A;  3KDP A;  3W5D A;  3GWI A;  5AVV A;  3B8E A;  4BEV A;  5AVY A;  3N8G A;  2YFY A;  3AR4 A;  4NAB A;  4BYG A;  2C88 A;  3NAL A; 
#chains in the Genus database with same CATH homology
 2YJ3 A;  3B9R A;  5AVU A;  1SVJ A;  2IYE A;  4J2T A;  5AW5 A;  3WGU A;  3WGV A;  3AR2 A;  4Y3U A;  2C8L A;  3A1E A;  5AW4 A;  2ZBE A;  1XP5 A;  3NAN A;  5AVW A;  5AVT A;  3TLM A;  2BY4 A;  4YCM A;  4YCN A;  2OA0 A;  3AR6 A;  1T5T A;  3A3Y A;  5AW6 A;  3AR7 A;  1IWO A;  2B8E A;  3NAM A;  5AVS A;  5AW2 A;  2KMX A;  4UU0 A;  4UMV A;  3FPB A;  2YJ5 A;  3W5A A;  3FPS A;  3SKY A;  1U7Q A;  3A1D A;  5AW7 A;  2EAT A;  2ARF A;  2ZBF A;  4H1W A;  5AW9 A;  4RES A;  3AR8 A;  4BBJ A;  2ZXE A;  2C9M A;  3W5C A;  5AVZ A;  2O9J A;  3AR9 A;  3SKX A;  1MO7 A;  2ZBD A;  3N5K A;  4UU1 A;  5A3R A;  1Q3I A;  1MO8 A;  3A1C A;  2DQS A;  2ZBG A;  4KYT A;  1VFP A;  5AW3 A;  1T5S A;  4BEW A;  2A00 A;  4RET A;  2YJ4 A;  5AVQ A;  2KMV A;  4XOU A;  3FGO A;  3RFU A;  4XE5 A;  4YCL A;  5AW1 A;  3AR5 A;  3AR3 A;  3BA6 A;  1WPG A;  5AW8 A;  5AVX A;  2EAU A;  2C8K A;  1SU4 A;  2EAR A;  4HYT A;  2YJ6 A;  2A29 A;  5A3Q A;  5AW0 A;  3W5B A;  3J7T A;  5A3S A;  3B9B A;  5AVR A;  2AGV A;  3KDP A;  3W5D A;  3GWI A;  5AVV A;  3B8E A;  4BEV A;  5AVY A;  3N8G A;  2YFY A;  3AR4 A;  4NAB A;  4BYG A;  2C88 A;  3NAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...