1U7TA

Crystal structure of abad/hsd10 with a bound inhibitor
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
255
structure length
255
Chain Sequence
SVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVRNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human ABAD/HSD10 with a bound inhibitor: implications for design of Alzheimer's disease therapeutics
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 3-hydroxyacyl-CoA dehydrogenase type II
total genus 92
structure length 255
sequence length 255
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.178: 3-hydroxy-2-methylbutyryl-CoA dehydrogenase.
pdb deposition date 2004-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1u7tA00
5ILOA 2C0CA 1IOLA 4XIYA 1BMDA 3AY3A 2GR9A 3ONDA 5H82A 4XR4A 1LSOA 4QSMA 4DXHA 1B3BA 3Q2KA 4NPCA 1WDLA 4ZVVA 1T26A 1ZW1A 3FWNA 3GFGA 4BO2A 1DFHA 2BHLA 2X7HA 1M66A 2OZPA 2VUUA 5DDIP 5CP8A 3GF4A 4W7IA 1XHLA 2CDCA 5C7LO 1FF9A 4ONEA 3DOJA 3WJ7A 5JAIA 4L9RA 1KVQA 1XELA 1XU9A 1M6WA 4XJSA 5BSGA 3MOIA 4TRRA 1GYPA 1NHWA 4GX5A 2ZTUA 1XR3A 2D5AA 3EAGA 1KEVA 4H7PA 1KC3A 3U4HA 3SXPA 2PKRA 3PYXA 4WLOA 1X14A 5KCZA 1HE2A 1O94A 4W9NC 1PZFA 3VC7A 5U1PA 3JYQA 4HUJA 4XCVA 1H5QA 3TF5A 1RYDA 4M8SA 1CDOA 1Y9EA 4B8WA 1V8BA 4I5EA 2O7QA 4O63O 4BO5A 2A35A 2I5PO 2YUTA 4XEHA 2FRDA 4XX0A 1WDKA 3JQAB 3KTDA 1LNQA 3W4IA 4L74A 1D7OA 3L4SO 3I1JA 1ZK2A 4I1IA 1LLQA 2B83A 4Q3BA 4TQGA 4CM4A 4LSWA 4IQGA 3GR6A 4F6CA 1V35A 1BTOA 4A2CA 2ZB4A 1I10A 3I5MA 3QVTA 5IXYA 2ZTVA 2UAGA 3P7MA 1E3WA 1FJHA 4R1TA 4RF2A 2BFOA 3V2UA 2HRBA 1U4SA 1XLTA 2Y1CA 3I3OA 2YQ4A 4RZIA 4YT2A 1Z7BA 1EK5A 3PDJA 1K0UA 1EFKA 3HDYA 2Y66A 1I01A 1U2GA 1QG6A 1R4MA 5IN5A 1C1XB 4TKMA 5IF3A 2X9NA 3H3JA 1HF3A 1OC4A 3GFBA 2EF1A 4DQXA 5L45A 3NTOA 5G2OA 3MJVA 1DJNA 8ADHA 1O8CA 2NQTA 2SCUA 2FOIA 4IDCA 5THQA 3PI7A 4XYEA 1P74A 1TT5A 2EKQA 3OQ1A 3GC6A 3JYNA 5BSEA 1PJ3A 4KQWA 4RO0A 3ZHXA 5JY6A 1P9LA 3RUEA 3DTTA 1E3JA 4YEDA 3TOZA 3TPCA 3CZMA 4DYDA 4O59O 1NXQA 5L7WA 4ALNA 3ENKA 3TJRA 1Z82A 4BNMA 4BUCA 4CLOB 3W8DA 2NTJA 1QYDA 3RC9A 3PP8A 4ITUA 1C0PA 3MTGA 4FQ8A 5DNAA 1E7SA 1QLJA 4IINA 3AUUA 3UHAA 4DA9A 4PLCA 1Z74A 4OJNA 5A1TA 4NG5A 1UDCA 4Z3KA 4RZHA 3SC4A 2O3SA 2PZLA 3S2IA 3LT2A 2O3JA 1NX6A 4O0LA 4OSPA 4N5LA 1QMGA 2P9CA 5CHEA 4D3SA 1I33A 2WYUA 2Z95A 3DBHA 1NPYA 4CMEC 2P2SA 2ZB3A 3CMCO 2VTEA 4ZU3A 2QRJA 3N7UA 4PLYA 5JXWA 1GZ3A 9LDTA 2C7VA 1PJ4A 4KTTE 4UUMA 4ZRMA 1LSJA 2AQ8A 5HWSA 3ZNPA 4XIJA 3FI9A 1E7QA 4D7AA 4PLPA 3EDMA 1NQAO 1ZUD1 3VZQA 3LQFA 4Z0HO 4AJEA 3ZNOA 2GLXA 1HE3A 1PJQA 3COSA 4ALJA 1JDJA 1P44A 1R0KA 1S6YA 1W73A 3NGXA 4M86A 4M54A 3I9OA 1YKFA 4PVDA 4Q3DA 3GG2A 5LC1A 4ZGWA 3AW9A 4J9UE 4NBUA 5JE8A 3RD5A 1B8VA 4A73A 5G0UA 5JC8A 1ISJA 3ITDA 1PS0A 5JSFA 4U6QA 4BKRA 3ZWPA 1GEEA 2GZ1A 3B6ZA 4MDHA 3M1LA 2BF7A 4PZDA 4BO3A 1TA4A 5KVQA 1C0LA 1P45A 2PKQO 4TMFA 3I9KA 2LDBA 2PKQP 4N54A 1FDTA 1NFRA 5EERA 3UCEA 3ON5A 2E49A 4MVJP 2BGLA 3EVNA 1GQYA 3HZZA 5JMWA 3BMCA 1PJ2A 2IEBA 3EGOA 2DUUA 2O4CA 2WSBA 1W4ZA 2IXBA 4J0EA 1Z7EA 3PWZA 1K2WA 2BGMA 1UXJA 3E8XA 1SAYA 4L4SA 2UDPA 4GKVA 4OMUA 4PRKA 3WGOA 3DMYA 1TXGA 3NRCA 2VZ0A 5HS6A 1D3AA 1PL6A 4HX5A 5ILGA 4CLOA 2C20A 3BHMA 1ZCJA 5CEEA 3ZV3A 1FDSA 3JQFA 5BNIA 3GNSA 3PHLA 3H8VA 2WJPA 1PU2A 1LTHR 4PLZA 1AGNA 3VH1A 1QYXA 3E5MA 3IP3A 3INTA 1VRWA 3ROPA 3DL2A 1KYQA 4K28A 5ER9A 4XDYA 1WAMA 5B4VA 1A4IA 3UAGA 3Q0EA 3FNFA 2VTDA 3GHYA 4ZRNA 3AM5A 5A06A 1Y9AA 4L0QA 1E3SA 4BO0A 1LDNA 3UN1A 2IXAA 1WW8A 4QT0A 4RDHA 5JDCA 1HYHA 1WXDA 4EEZA 1KBZA 4QX6A 1F12A 3KLMX 3K30A 3KHUA 4XKJA 2I3AA 1OOEA 1LDMA 1MX3A 3WIEA 1C1DB 4UUOA 5KNLA 2AMFA 1I5RA 4R1SA 5EMHA 1PZEA 4GX2A 3DB2A 1FDVA 2D2IA 4NBTA 4NFSA 1VKOA 1PS9A 3BTUA 1HWYA 1GD1O 4CM4B 4EUFA 2BFPA 1MXFA 1PX0A 5L7TA 1YJQA 1F8FA 1BXGA 4S3MA 3UXYA 2JFFA 2W8ZA 2DTXA 4DVJA 4MVJG 1P33A 2PZJA 1B7GO 3IIEA 2O48X 2RHCA 1V3TA 5DBGA 1CERA 4FFNA 1DLIA 2X5KO 2YV1A 5TT0A 1O95A 3EMKA 5BR7A 4CM1A 4W82A 3FBGA 4XYMA 4ALKA 4CV3A 2V6GA 3WG9A 2WM3A 3QIVA 1E3IA 4GX0A 3RC7A 3BMQB 4CL8A 1RM3A 5HM8A 1SOWA 1U28A 3DBRA 2QG4A 3DHEA 3DZFA 3IS3A 4GSLA 5JAZA 1MGOA 4P4GA 4CMBA 1H6AA 4P4NA 3D4PA 3P2YA 2VWQA 3GVPA 1SEPA 2VYNA 1PQPA 3KVOA 2G76A 4I5FA 1E3EA 1T25A 3HN7A 2AE1A 2X0RA 4R9RA 3WSVA 3NAQA 4F45A 3OIFA 3RBVA 4KTVE 3U4DA 2V6BA 2AEJA 4EZBA 1BW9A 3C7DB 4RPJA 4ZQHA 1GQ2A 3WQQA 2E37A 2Q3EA 3CXRA 1NPDA 3ROKA 1G1AA 3L9WA 5G0TA 4R68A 5COAA 1ZEJA 4PLWA 4XGKA 5GZ6A 3BTVA 1JWAB 3TZHA 3JD4A 4M87A 3GLQA 4O5OA 1I2CA 2EP7A 1GU7A 2XOXA 3SEFA 2DT5A 1GUFA 4MVJE 4OM8A 1OFGA 2BI7A 2J3JA 4LRTB 1J0XO 1Q7CA 3DOOA 1YB4A 2Y0DA 3S2FA 2G0TA 1ZZEA 1DXYA 2C54A 2ZATA 2VHXA 4BGUA 3UKOA 4RVUA 3AM3A 1DHRA 3L4BA 1MG5A 4M55A 1PWXA 3QWIA 4PLHA 2HMSA 4QO7A 2AW5A 4GMGA 3KYDB 4A7PA 1EMDA 3ONFA 5HBRA 5KKCA 4TWRA 3EZLA 1G0NA 3JQ6A 4RCVA 2WD7B 2HAEA 4PCVA 5HRUA 2W98A 3HN2A 2GO1A 4YQZA 2W2LA 3HSKA 1ISIA 4YJGB 2GN6A 1DFIA 2QHXA 3PZBA 3G79A 3ULKA 3MJEA 5JCJD 4E3ZA 2Y99A 4RQUA 1CYDA 3A06A 1OBFO 4NQZA 1K6IA 2YQ5A 4QQRA 1Y8RB 1NR1A 1O5IA 3DFZA 2B69A 1YQGA 1PJBA 2IE0A 3TZKA 5CFZA 1LQUA 2VNSA 3BMOA 4JN6B 1SOVA 1HZZA 5EINA 1YL5A 2P68A 2FN7A 3WGHA 1WLYA 3MOGA 5FWNA 4C4OA 2EG9A 3WQRA 1LUAA 4OQZA 4AJNA 4MP8A 2ZQYA 4GI2A 4PN3A 1NAHA 4C7KA 3E9MA 4BKQA 4GLLA 1ZJYA 1AHIA 4MVJI 4U0KA 3QJ5A 3AM4A 4E32A 1F14A 4KUGA 2BFAA 3JYPA 4WNCA 2YJZA 5KKAA 5JCJA 4N5MA 3DZBA 3F47A 1Y5RA 2E82A 3K2BA 3H3FA 4R69A 4E5PA 5C3MA 3V2GA 2C5AA 4FSHA 3OP4A 1A9ZA 1C0KA 2AG8A 3HHPA 2X4GA 3E03A 1H2BA 3PLNA 3MEQA 1K6JA 4F46A 1B14A 1BDBA 2NU9A 3KB6A 3WYCA 1YGYA 4MIOA 3GMDA 4TRNA 5IZ4A 3GG9A 3LC2O 5ES3A 3T4XA 4IIUA 2B35A 2J3KA 4ZD6A 5G0SA 4XR9A 3U5TA 2A9FA 1HYEA 4J2HA 2PGLA 4WASA 1DLJA 1X7HA 2LDXA 1RM4A 1I36A 1P1IA 4J1SA 3O8QB 2C59A 3JV7A 4FOSA 1YE3A 3MJCA 1I8TA 4EITA 3KSDO 1HEUA 1A27A 1ZH8A 3OSUA 4PFJA 2PZKA 5TT1A 4XYLA 4D42A 2VOEA 4YJHA 2Q1UA 4Q3EA 5L4NA 3FN4A 2VUTA 3DXFA 5G4LA 3VPXA 5A5FA 3OECA 4N7RA 2V6MA 2B5VA 1YXMA 3FSRA 4U8GA 3JQ7B 5T64A 5I9LA 2I6TA 2QYTA 3UUWA 3PWKA 4NIMA 5DCUA 2O3TA 3WGTA 1YB1A 4ZQFA 3C1TA 4K26A 5KWEA 5IZCC 5CDYA 4AVYA 2CDAA 2AG5A 3HDHA 2GF2A 4QFDA 5BQFA 1IPEA 2VRCD 3TZQA 4B4OA 3LVFO 5T8KC 3VH2A 3RBZA 2IYOA 4OXNA 4RPHA 2PA3A 2Y0CA 4HFMA 2YZ7A 1N7GA 1U5AA 1HZJA 3K96A 3U3XA 3DHNA 1X1EA 1DFGA 1RJWA 1N5DA 3L6EA 4BNTA 2P5YA 3JQ8A 2P9EA 5B12A 1ULSA 2JD1A 2RH8A 1MXHA 4XQGA 2ZTLA 4HFNA 2FR0A 3LT1A 3O8QA 4UVHA 1Y7TA 3GAFA 3TFOA 3OJFA 2FSVA 1HL3A 2H6EA 3PTZA 3FPLA 5DBFA 1T2CA 1GR0A 3D64A 1E3LA 4YB8A 4OKNA 2OORA 4FGWA 4AJJA 4PLVA 2C82A 2A92A 4FFMA 4BNJA 3D5TA 3PLRA 3RUCA 3RKRA 4CLXA 4BNYA 1ZSVA 3O26A 3V8BA 3SLGA 1PR9A 1A7KA 5T5QA 3K31A 3CKYA 3VZSA 4ZQGA 5DULA 1DIRA 4DMMA 5HTOA 3IL2A 1QV6A 3VDQA 1E6UA 3HQ4O 1VL6A 1LBEA 2NM0A 3I4FA 3M2PA 3RVDA 3UCFA 3OETA 3EY4A 5L3ZA 4WE3A 4DBZA 2VT2A 1RM5A 4INAA 3FR8A 3OIDA 2O50A 1ZKMA 2O3RA 2AQIA 4WLEA 4D0RA 4R5MA 1F8GA 3QWAA 1GYRA 3QLJA 2DPGA 1PGNA 1X7GA 3E6AA 1T4BA 5AVOA 3ZU5A 4CLDA 3GRKA 5A9TA 8LDHA 2UVDA 1QYVA 2EXXA 2CVQA 3F6YA 1CWUA 4Z9YA 1LSUA 9LDBA 1J5PA 3WSWA 4LMRA 3OJ0A 1VJ1A 3AFNA 3A1NA 2DFVA 3N74A 1NTOA 1PQUA 5CDGA 1EE9A 4ILKA 3CUKA 2O23A 4DRYA 3LT0A 1E1KA 3HUDA 3WGYA 4CR7A 1D1TA 4LW8A 3TZ6A 3OFSA 3RUHA 2DAPA 3PHIA 2G1UA 2JL1A 5C7OO 4EBFA 1ML3A 4PLFA 4W7HA 1UUFA 1U1IA 1GV1A 1F06A 4ZA2A 4QTZA 4G65A 1MUUA 4NJOA 1EVIA 3DQPA 3ASUA 3NEPX 4BNFA 4BQRA 1ID1A 4FFOA 5JMPA 1JTVA 1Q7BA 1MB4A 2NTNA 2Y1OA 3PQDA 3FD8A 3FNHA 4MIEA 1GDHA 1ZSNA 4B79A 2J3HA 4CM8B 3GY0A 1GEGA 1AUPA 1CETA 4YJHB 1YH3A 1ZK0A 4CMIA 2HLPA 3FTNA 3DHYA 4FD3A 3T7CA 3DMTC 3Q9UA 3WLEA 1EVYA 3KEOA 3V2HA 2V7PA 3NT4A 1ULUA 3WYEA 2FR8A 1JLLA 1VC2A 3DZIA 2GN8A 3W8EA 2WMDA 4UVEA 1GPJA 3S55A 4HNGA 1SZJG 3ITKA 1NP3A 3NKLA 4R1NA 4QFCA 3B1FA 1VM6A 2D3TA 1NYTA 2VZ9A 3PHGA 3GQVA 2AEMA 4XYGA 4KQXA 4RPKA 2FPGA 4Y9DA 1V3VA 2VHVA 5I7FA 4E12A 3GZNA 3IUPA 3UGKA 3MCVA 4IS2A 4ALIA 2JCXA 3FBTA 2FHSA 1X13A 2QYSA 4RQTA 1WZEA 4IZIA 2CSUA 1VL8A 3AUAA 3QHAA 3IUSA 3RC1A 1LDGA 2FSSA 3M1AA 4BNUA 3KYCB 4F6LA 4MKXA 1ORRA 1HDYA 2ZTMA 4TZKA 4IQ0A 5TNXA 3F3SA 1HETA 1DIAA 2JCYA 3UFXA 5DN9A 5T67A 1E1NA 3RBXA 3SJ7A 2Q2WA 3WS7A 3ZWXA 4BNGA 4CLRB 5DCYA 1YOVB 4YCAA 5DCWA 3JQEA 3BMNB 3WTCA 1GQQA 3PYMA 3VPHA 5ER6A 2X1HA 1E1MA 1WMAA 2WYWA 1HTBA 3D0OA 4EW6A 3R6DA 3GN1A 1T2AA 4BNVA 5F3RA 2WD7A 3ZU2A 2Q4EA 1VJ0A 1R0LA 3IMFA 2IRWA 1NFFA 1ADBA 2V6FA 4GWKA 2OGUA 4BHTA 3GDOA 1OAAA 1BXGB 3TOXA 4TKLA 2IDZA 1VKNA 1NASA 2OBYA 2PFGA 5KOIA 1H6CA 2DBZA 3BAZA 2OMEA 1QXSA 3B1JA 3WLFA 2XXBA 2NWQA 4J43A 5IZCA 1NVTA 5BNFA 4IMPA 3ROQA 1PS8A 3VPGA 5ADHA 3AOEA 3UCXA 1B0AA 1ISMA 2EKPA 3OA2A 2ZKLA 4Y6RA 1ZO8A 2W4QA 2Q49A 1ISHA 4DBVO 4AICA 3AOEC 1ONNA 3FNEA 1V9LA 3BMOB 4PZEA 1Z75A 3MWDB 4Z0PA 3I52A 2CVOA 4NBVA 4YVFA 1QYWA 2C5EA 3TSCA 1CRWG 4BNWA 4RV9A 4WK6A 3ABIA 3ZNQA 3UICA 2GERA 3I6IA 3MZ0A 4PLGA 1Y6JA 4TRJA 3TQHA 3E9QA 2Q2QA 4IUYA 4YBZA 3WR5A 5BSHA 1ZFNA 2YHUA 5I9MA 1NVMB 1G6KA 4IDDA 2GASA 5B1YA 1AN9A 1ONOA 1LDBA 1XA0A 2NVWA 1V6AA 3DFUA 3KO8A 3G49A 5AQ1A 5I7SA 4R3WA 1HDZA 5F1PA 5A3VA 1FMCA 2FZEA 2JCVA 3AFMA 4E2XA 4EJMA 2DTEA 5C7IO 1UAYA 3D1LA 3STHA 1A5ZA 1VLLA 2NQ8A 5ICSA 1DPGA 1DJQA 3HFSA 1E7RA 5A9SB 5ITWA 1I24A 2Q1WA 5DOVA 2D5CA 2ZCUA 1S7CA 4JJGA 4MVJM 4PZCA 4DIFA 5I7VA 4LCJA 1GL3A 2FPIA 5B4UA 1SMKA 1AXEA 3EW7A 1N1GA 2YV3A 1L7EA 1R15A 4Q9NA 1GY8A 1GV0A 4J3FA 4DPMA 4OHUA 2YHIA 4IXWA 2R00C 4A26A 1DAOA 1ENPA 2HDHA 1ADFA 3RU7A 1RPNA 4DIBA 4YT8A 1QLHA 4NZ9A 4DIOA 4YQYA 4HP8A 2X0JA 4GSKA 5THKA 1E7YA 4UVGA 3CSDA 2JD0A 1DEHA 1T24A 3RROA 2VYVA 1UXIA 1J6UA 3GVXA 2A94A 4YAIA 3E82A 3HWRA 4AJOA 3PIDA 1GCOA 3NT2A 4IBOA 1ZVMA 4JBIA 4CM8A 3GEGA 3I23A 1NWCA 2PH5A 3GHHA 2DTDA 1F0YA 3G0OA 4GLOA 4IDFA 2ZB8A 2DKNA 4CV0A 4YPOA 3DEYX 4B3JA 5L9AA 3V1UA 3I9LA 3JQ9A 3ZWVA 2WWRA 4A27A 1VPDA 4TROA 4R9SA 2QZZA 3PGXA 2PNFA 4CLRA 4NMHA 3Q9NA 5IXSA 4I5GA 4NJMB 3QRWA 4RLSA 5JBIA 4M1QA 1YL7A 3H9QA 4MOWA 3HADA 3PQEA 2I66A 1CQIA 3V5NA 1ZBQA 3KM0A 4DQUA 2IODA 3CTMA 4BQPA 1XSEA 2NLOA 2GD1O 4ZJUA 4J90A 1CEQA 1ADGA 1O0SA 2Y67A 1HT0A 4P4LA 3TZCA 2I65A 4IJVA 5AYVA 4DMLA 5A04A 5I8WA 1WVGA 4GVXA 2Q50A 5AXCA 1EVZA 1EFLA 1DC6A 4IQ8A 4BV8A 1P1JA 1ZJZA 2NVUB 3PGJA 4A5OA 4NI5A 2X23A 3W8FA 1T1RA 2Y0EA 3LU1A 4JXKA 4AJ4A 6ADHA 1LLDA 3ZWCA 2PZMA 4CJXA 1ADCA 2GGSA 3KXDA 2GCGA 1E6EA 1V3UA 4R41A 4FN4A 4GKBA 3WMXA 4L4XA 1L7DA 4OOEA 1I3MA 3F1KA 4KP7A 5IDQA 3VVBA 1L1FA 5AXAA 2Y1DA 3KV3O 4I5DA 2X22A 5JDIC 2GZ2A 4IJKA 1WNTA 4XGIA 1KEUA 1X7DA 1KIFA 2YYYA 3R3SA 3OQ6A 1MLDA 4KDFA 3KETA 4DC1A 5AXDA 1IY8A 3WGQA 2B0JA 1HDXA 4MO2A 4IGEA 5A4DA 2CDBA 1I3KA 2AEFA 3C7CB 5JS6A 3HDQA 3BTSA 1KOLA 2NV6A 4CQLB 4HFJA 1I3LA 3KZVA 4GQAA 3ZNNA 1GUYA 5TJHA 5IAAA 1LI4A 3RKUA 5JC1A 3ANMA 3ZWBA 3I9NA 4MINA 3LDHA 3X2FA 1DO8A 5EIOA 4ZQEA 3W6ZA 1XYGA 1Z45A 3HE3A 4RPGA 4BOYA 4XQCA 4B7UA 1SB8A 2OP1A 2DBRA 1PJCA 3GEMA 3GH3A 1TVEA 1JA9A 2ZK7A 3L77A 1JKFA 4YT5A 3HDJA 4JGBA 4CUJA 5K9ZA 4YTEA 5CPFA 3DWFA 4N18A 4NNJA 1HSOA 3WBBA 4BMSA 1JQBA 1C3VA 3PJGA 4GX1A 4P8RA 3PQFA 4FC7A 2X9GA 4KUEA 3JD3A 4R16A 4EUEA 2WEKA 1P1HA 4J7UA 2F00A 1B15A 2VNAA 4NU5A 3AUTA 4LCEA 2C2XA 2AXQA 2DLDA 3VKUA 4XQ9A 4CUKA 4R01A 1H0KA 2BGKA 1N2SA 1ZEMA 2NUAA 2PK3A 2OHXA 1PSDA 1Y5MA 1WPQA 4FCCA 4X54A 1YBMA 1Q1NA 1XQ1A 4CM5A 2IZ0A 5G0VA 4FW8A 4IY1A 2HMVA 2DFDA 3L6DA 4BNNA 1T2DA 5TRTA 4HV4A 3ETGA 3S1LA 3DBLA 2CMDA 3F1LA 4I9UA 2VYND 4DTIA 5CG2A 2AE2A 3W4KA 1C1DA 3D3EA 1NR7A 3LK7A 5A05A 1P3DA 5KJ1A 4S1VA 2ZYAA 1VJTA 4YA6A 3ZZNA 1K3TA 5DP1A 4BNIA 5BSFA 3TN7A 1UDAA 3EHEA 4CMGA 4WECA 1UH5A 1U7HA 2RIRA 2HK7A 5KJFA 3MWEB 2Q1SA 4J1TA 3AOGA 2YDYA 1B16A 4BGEA 4J9VA 4IPTA 3GK3A 4DYVA 4B8ZA 5DBIA 5B37A 4DUPA 4L76A 2I9PA 3OF2A 2Q1TA 1JN0A 3AY7A 1GTMA 1LRLA 1UXGA 4II3A 2P4HX 4BKPA 2ZJ0A 5KVSA 2H1SA 2XXJA 2WTBA 4PRLA 1Q0QA 3U0BA 1A4UA 3FPCA 3AI3A 3PPIA 2DQ4A 4FGSA 3WB9A 4RGBA 4FB5A 4RVGA 1HYGA 3ZHBA 3GVIA 4WEQA 3OICA 4AG3A 1BG6A 2WD8A 4BNHA 3H4VA 1PGQA 4JK3A 1GUZA 3ASVA 2YY7A 3WWYA 2EW2A 2EKLA 2NACA 1BRMA 3AWDA 4RLHA 1RYEA 1A7AA 3JQGB 5FI5A 3MJSA 4J49A 3QVSA 4RPLA 1U8XX 3PEFA 4LVCA 4YYZA 3AI2A 1BHSA 4PG6A 4G81A 4W4TA 1KERA 1R12A 3NT5A 2AQKA 3L9XA 2FP4A 4RVHA 4FFRA 5JO9A 4YRAA 3SC6A 2FMUA 3GGPA 4NFHA 3KYCA 1XKQA 4WEOA 3RASA 1NVGA 4BO4A 4YAKA 1U9JA 3NJ8A 2X6TA 3G3EA 4RVDA 3RFVA 3L6OO 2Y05A 2R2GA 4K9DA 1DRVA 3SLKA 3H9UA 4XZ3A 1H6DA 1TLTA 3X2EA 1HRDA 1LDYA 3WIDA 2PR2A 2B4TO 1UP6A 1I3NA 3DONA 3QWBA 1PZGA 3JQ9C 2EEZA 4DPKA 1KVSA 1XWFA 5IDXA 5KVCA 2NSDA 1IHYA 4E30A 3H9EO 3B1KA 2BRUA 3WJAA 4NU6A 4WJZA 3OMLA 1NQTA 4DL9A 1SEVA 3L4BC 4QXMA 4UVDA 4E0BA 2UUOA 5A9RA 3S2GA 3H6KA 2DC1A 2E6UX 2IYPA 3A28A 2QZ9A 3RCBA 1D4FA 2HJSA 1SCUA 5T57A 1NBOA 4BB5A 4D3DA 4JROA 3RFXA 4AL4A 5T6BA 2NU7A 1QRRA 2TMGA 5I7EA 1D1SA 1F17A 1FXSA 4WKGA 3E9NA 1IHXA 4IJWA 3H7AA 4NK4A 3C7AA 3W4JA 5COBA 4UUPA 5FFFA 4YRBA 1B26A 3GDGA 3RIHA 4LVUA 4R5HA 2H5LA 4AJ1A 5FI3A 3D7LA 3ZU4A 2GN9A 2HKIA 1ZXLA 3KSZO 1HE5A 2Q46A 3L07A 2X0NA 2RH4A 4E6PA 5KIAA 2EV9A 1UZNA 2RCYA 2HQ1A 2Z1MA 5MDHA 3LLVA 3E1KA 1P31A 4NFYA 4E4YA 2DVMA 3ZV6A 4EUHA 3JSAA 4LSMA 1BVRA 5TJ9A 3NTRA 2CF6A 4MKZA 2OFPA 3HJAA 1E7WA 3C8MA 3JYLA 4MVJD 4F3YA 1UAGA 3GPDG 4FIZA 2HUNA 5G4KB 4BV9A 2JAPA 3EUWA 5L51A 1O6ZA 1RKXA 4QEDA 2FR1A 2G5CA 3NV9A 4XB1A 3C1OA 5JPIA 3RWBA 3Q3CA 3WDSA 1EVJA 1H94A 3Q11A 4XWYA 3ZCXA 1E1LA 5JCXA 4Z9XA 1IPFA 2PD4A 1B3RA 4DGSA 5EJ2A 4PGFA 4YWJA 4WCFC 2CZCA 2FWMX 1G0OA 1UZLA 1EZ4A 4CODB 3PJEA 1KVRA 1I2ZA 3JTMA 3VOSA 2JHFA 1HSZA 4H15A 4BVAA 4WOJA 5CAEA 5CDUA 2YV2A 1WZIA 1VL0A 4FDAA 5ICMA 3DAPA 4HFRA 3TL3A 4M49A 1A72A 3RJ9A 4PLTA 1ARZA 3OBBA 3P19A 4E5YA 2NVBA 5JAQA 1Z73A 1P1RA 3TNLA 3RC2A 2IEDA 2B5WA 3JQFC 3V1YA 1LA2A 1C0IA 4E5KA 2G82A 5LDHA 4J4TA 4MJLA 3PFFA 5IDWA 1H9AA 1WMBA 4JJIA 5EN4A 3WYBA 1RM0A 3PIIA 3RU9A 3JCZA 3U09A 4UEOA 3Q2IA 4XA8A 3K5PA 3WX0A 2RBEA 3QE3A 4OL9A 2VRBA 3EZYA 1I2BA 4JJFA 2W2KA 3H2ZA 4G5HA 1W8DA 4HWKA 4L8VA 4BNLA 3PYLA 3PVZA 3TRIA 2X58A 4IM7A 4BIIA 3I4CA 4JCOA 3F4BA 3PJDA 4TVOA 3JD1A 2JHGA 5BNTA 3OIGA 3RAJA 2EGGA 2BD0A 3H65A 5JDCC 5KJCA 5T8KA 1JWBB 3OJEA 3NTQA 1U3WA 5J23A 3NUGA 3ZHZA 2NTVA 2CD9A 3D4OA 3JYOA 3M6IA 5AOVA 1VI2A 2XPCA 1P1KA 5MGBA 3I83A 1LLUA 4J7XA 3JD0A 3AY6A 1UP4A 1LDEA 4J4BA 1ENOA 4TZTA 1PEDA 2I67A 4ID9A 4UVIA 3QWFA 1X0XA 2VUSA 4YJFB 5KVVA 1NQOA 1LQTA 1Q0LA 1N1EA 3D5QA 4YJGA 2EP5A 1C14A 2IZ1A 4FJ2A 3SJUA 1IE3A 3ORFA 1KEPA 1ZNQO 3MTJA 3DC2A 4RF5A 3BXXA 5I8ZA 4Q3NA 4CQMD 1KEWA 2OP0A 2E48A 4FR5A 3GMSA 4IDEA 1H9BA 5LDGA 2OBNA 3JQGA 1SPXA 4WCFB 5COQA 3UW3A 3ZN2A 5U9CA 4MVJH 2FPPA 1E5LA 4AJIA 2EJVA 3GGOA 4CQLA 2WE8A 1E0DA 2V65A 3LF2A 1H2HA 3VAZA 4WNIA 1EBUA 4BO1A 3JQDA 2DU8A 2Z5LA 3IJRA 4ND3A 1LRJA 5U4QA 4D45A 3WNVA 3ZWWA 4GPD1 4BS9A 4FS3A 5K0ZA 3AUSA 4EJ0A 1ENZA 4YR9A 5L95A 4Y6PA 4HNHA 4XRRA 5LCXA 5C5IA 2QRKA 2O3UA 1Q0HA 3HB5X 4FFLA 1YS4A 2CUKA 3QY9A 3O03A 4PG5A 3T4EA 1EQ2A 1EQUA 4YAJA 4M89A 2VOJA 3SX2A 3VH3A 4UEKA 1T4DA 1A71A 4L73A 3FCOA 3ZV5A 5TQVA 2RAFA 1Y8QB 4R51A 3GNQA 1DBVO 1JU9A 2BELA 3VVCA 5F1KA 4R1UA 2GNAA 1KS9A 4JIGA 1EK6A 2O4UX 1YJ8A 1DSSG 4CM9A 1TT7A 1E77A 1TB4A 2YW9A 4JBHA 3L0DA 4CQMA 3H5AA 1BGVA 1WWKA 3S8MA 1PR3A 2A4KA 2NNLD 5G4KA 4DLBA 1VSVA 3SVTA 1Y8RA 1R4NA 2D4AA 3GOHA 3VH4A 2D59A 4IIVA 3ROMA 2C29D 4BNZA 3P2OA 2IZZA 3DTYA 2XF8A 4L75A 2D8AA 4ND2A 5AXBA 2X8LA 3ZH2A 3I9MA 4J2OA 3KSUA 2BKAA 4RF3A 4K1LA 1DIHA 3DBRB 3KYDA 1P0CA 1NAIA 4D79A 2CFCA 3AU9A 3ANLA 3LF1A 5EQDA 4QUKA 5H81A 4CM9D 1ISGA 3WXBA 4YDRA 4YAEA 4W99A 2HSDA 2O2YA 4HY3A 4ROSA 2DPHA 4KDEA 2R6JA 3F4LA 4IS3A 3JQBC 3GZNB 1NNUA 1PJSA 2EERA 2Y1EA 4CLEA 2VZ8A 2HMUA 3DR3A 5DZSA 2GRAA 4B4VA 4N5NA 1LX6A 2PTGA 4CLHA 1U8FO 4BNKA 3EVTA 4B4UA 4I08A 1ENYA 3EYWA 3PZRA 3WFJA 2EJWA 1Y81A 1UR5A 3WGZA 3IDSA 5KJ6A 2VYVD 4NDNE 1I30A 5A02A 1O9BA 1P0FA 2VHZA 4D3FA 3PK0A 4AJ2A 4Z9FA 3PHJA 1GZ6A 1EDZA 3GDFA 3UF0A 5JFOA 3WNQA 3PJFA 3LC1O 1ZXBA 2Y1FA 5CEFA 5TX7A 3O9ZA 1B8PA 4KMSA 3VHRA 4H3VA 2J6IA 3NDRA 2QIOA 3IJPA 3ZDFA 4CPDA 1YVEI 3M2TA 2WDZA 5JW6A 1UP7A 2PD6A 1SBYA 3DO5A 4HXYA 4XQEA 3WQSB 1XGKA 2PH3A 1SB9A 2ZYGA 3BMNA 4DLLA 4C7JA 3OJOA 2W90A 1WP4A 3VPSA 4DC0A 1EUZA 4YAGA 3OA0A 2B36A 1MC4A 4GGOA 3F46A 2CY0A 4WCFA 1PGJA 1LC0A 4CMHA 5EQFA 1VE9A 3B20A 1B8UA 3GNTA 3LC7O 4BMVA 4CM3A 1U3UA 4PG4A 2J8ZA 2I76A 4ZQBA 5K6AA 5IJZA 3ADPA 2X9VA 3D3WB 4UEJA 5A3JA 4RL6A 3QA9A 4XB2A 3ZW9A 3GVCA 3WMWA 2HRZA 4LRSB 1D8AA 1UZMA 1DRWA 3CEAA 3KEQA 1EBFA 1H6BA 2GZ3A 3FNGA 4OO3A 2VWPA 7ADHA 3HG7A 4YJDA 5IFLA 3INRA 2X5OA 4DWVA 1DC3A 1HDRA 1NWHA 1Y8QA 4MPDA 4XD2A 1N9GA 4JQCA 3WICA 4AFNA 5L40A 1PJTA 2BMAA 4W6ZA 2Q45A 3LZ6A 3QW2A 3K73O 2PY6A 3JD2A 1XU7A 2EWMA 2AQHA 1XEAA 3KBOA 3TWOA 3PDUA 4FJ1A 4Q3AA 5KTKA 4CV2A 2B4QA 1BSVA 2OUIA 1E7MA 2P5UA 2PGDA 3JQAA 1SNYA 4XJTA 3RQSA 4FJ0A 1HXHA 5CDTA 3KLPX 3ZGYA 3ZWAA 1N92A 3Q1LA 1UJMA 4BO8A 3D4NA 1IL0A 4E31A 4WOKA 4Y6SA 1MC5A 1CQJA 2Y68A 4GVLA 4Y98A 1I0ZA 1CJCA 4GH5A 3PFWO 1JKIA 5TC4A 3ST7A 4P38A 4CR6A 4MP6A 4E2ZA 3K6JA 4B7CA 5BT9A 2P4QA 4IJUA 2JFGA 1DRUA 1TEHA 2J5KA 2Z1NA 3R3JA 4IGFA 2YDXA 4IMRA 1AXGA 1Z6ZA 4I9NA 3ZWOA 3LYLA 3ICCA 1LU9A 2AHRA 4FBGA 1K89A 1IB6A 1MP0A 2EIHA 4D43A 4BMNA 1HE4A 2P9GA 4D44A 3WFIA 2RHRA 5TLSA 1KY4A 1KVTA 2HMWA 1QKIA 4IDGA 5FYDA 1Q7GA 5L4SA 4E2YA 4EEXA 1WDMA 2VN8A 1LEHA 1W6UA 3IKVA 3GVHA 4GGPA 4JP2A 4YJFA 4NHEA 4E5NA 4KOAA 1U3TA 1V0JA 2GDZA 5KJEA 1BWSA 2XAAA 1X0VA 1JVSA 1M2WA 3FWZA 3OEYA 4J4HA 3QVOA 3WWZA 1X15A 5JAMA 3JQAD 3K8ZA 4E5MA 4ZN6A 2C07A 5B4TA 4UAGA 2PV7A 3H9GA 3VPFA 3U9LA 3WGIA 4KWIA 1QV7A 1XG5A 3OHSX 3BMQA 3GEDA 3ADOA 4G2NA 1U7TA 4NBRA 4RORA 3K9QO 2GN4A 2JD2A 2JJYA 4BGVA 5CPBA 5TGDA 4OQYA 4A10A 4ZICA 1E92A 4CMAA 4HKTA 4CV1A 3Q6IA 5I9NA 2HK9A 3E18A 2ZB7A 1T2EA 3DZJA 1YDWA 2Q4BA 3NDJA 2Q99A 1MA0A 1IZ0A 1R66A 3CMMA 2FY8A 4TVBA 1R4MB 2EW8A 4QO8A 3ZV4A 4J7CA 2JFHA 2VHWA 1H93A 2GSDA 1BW9B 1E6WA 2OO5A 2DBQA 4ZHSA 3DZKA 1ZMTA 1K6XA 2F1KA 4Z3DA 2CVZA 3IOYA 1EUCA 2PLAA 1EE2A 4B3IA 4BO6A 3AK4A 3K92A 5F5NA 1ZIDA 5GMOA 3V1TC 5A5EA 3BIOA 3U4CA 5CEJA 4Q3CA 1PQWA 2QQ5A 1UXKA 2Y93A 5L4LA 3DDNA 2BI8A 4WLVA 2J5RA 1E5QA 1HDGO 3K2EA 1YQDA 3U49A 1E3WB 2WE7A 4Z6KA 2UUPA 4I9HA 3DMTA 1YONA 3IAHA 3MJTA 3GAZA 3I9JA 2VT3A 4WUVA 1GZ4A 4PG8A 4WLNA 3KUXA 1P77A 3CZRA 5TIIA 2D0IA 2GPTA 3H5RA 3PXXA 4CMEA 3QQPA 4WLUA 3A14A 4UUNA 3U62A 3GZ4A 3I6QA 2DUWA 1YOVA 1O89A 1BDMA 4O1MA 3ZWNA 1QYCA 2HU2A 1OMOA 2ET6A 1UDBA 1W0CA 3UVEA 5TSDA 3BA1A 3DAFA 3HFGA 3R1IA 2UYYA 4FC6A 5JDIA 2O2SA 3FTPA 1HLPA 4OXYA 4B3HA 3NYWA 5GZ1A 5IN4A 4J91A 3RI3A 3RUIA 1QP8A 4XYBA 4FOOA 3GA0A 1PZHA 3CIFA 2G17A 4OOFA 4XRGA 5HA5A 3ZW8A 3GT0A 4BGIA 2VWGA 1EDOA 4MIYA 3W6UA 2HJRA 3NDIA 4WGGA 1GCUA 3H2SA 4GMFA 3IC5A 2E4AA 3CE6A 1GAEO 3QVXA 3TL2A 4ND1A 4J1QA 4OGWA 1Y1PA 4R3NA 4Y67A 2VQ3A 1LSSA 1MFPA 3LSYA 2HK8A 4NH4A 4E2WA 3VDRA 4LK3A 1RWBA 4GWGA 4YACA 4EYEA 2P91A 1MG0A 4O6VA 3S2EA 4DREA 1AE1A 1NHGA 3DZHA 1YDEA 1K5HA 2NADA 3HNPA 5ENDA 4URFA 5L7YA 3JQ8B 4K6CA 4OIMA 5K6AC 1PGOA 1R37A 3G17A 5IDYA 2J5QA 1YQXA 3SBOA 1U4OA 5DOZA 2Y1GA 3RUFA 3G1UA 5GZ3A 3G1TA 3MJ4A 1ZMOA 3H9JA 1IULA 1N9GB 1HDCA 4P22A 3WGGA 3FRJA 4U7WA 1R6DA 2PWZA 4JNKA 1EEHA 3T7EA 1IYZA 3QV1A 1XIVA 1SO8A 5C37A 1YWGO 3WTBA 4DQVA 6LDHA 1PIWA 4Q39A 1GPDG 4FFPA 1PTJA 3D3WA 3PWSA 4BKUA 1ZK4A 1GADO 3RUAA 3LLSA 1CIVA 4ALMA 4DPLA 1LXCA 3IKTA 3BTOA 1KETA 1ZK1A 3RJ5A 1LC3A 4HBGA 3UH1A 1T2FA 4IDAA 4CL3A 2DBVO 5TF4A 1OC2A 3VZRA 1M6HA 3A4VA 1R4NB 5H83A 4I8XA 1J49A 1YRLA 4DLAA 1DB3A 1MFZA 4KUHA 2ZJ1A 1HLDA 2JKVA 3A9WA 1PJLA 5A03A 1HKUA 1PL8A 1T1SA 4Y8VA 2BH9A 4J6FA 1B2LA 1DC4A 1SC6A 3EK2A 4D41A 5CDSA 2YFQA 2X86A 4NJMA 4H16A 4A03A 3CPSA 1JAXA 2ILTA 2GYYA 3OM9A 1ZSYA 3DZGA 1U5CA 1M67A 1N8KA 4YT4A 4L4RA 4BO7A 1DDOA 4YRDA 4ALLA 2HCTA 3ZWMA 7MDHA 3ANNA 3C1AA 2BLLA 4CQMB 4CMKA 3N58A 1QR6A 4RJTA 4WPGA 5JY1A 2C2YA 3OEWA 4LISA 4OSOA 5F5LA 2ZCVA 4CMIB 4NBWA 3F5SA 3P5SA 4K6FA 2OXIA 3INGA 3NX4A 4NK5A 3AU8A 2POQX 3GRPA 3U4IA 1XDWA 1AHHA 4OKIA 4PG7A 4W9NA 4OYRA 5DF1A 3TDKA 3ZU3A 4A0SA 4U5QA 3HB4X 3VTZA 4XDZA 4U6SA 1XQ6A 2YFHA 2ZIZA 4J16A 4LMPA 4QECA 4AJPA 5JYDA 4RVSA 1TI7A 3UOGA 1YO6A 1ISFA 2H9IA 2TMDA 2EGHA 5L53A 4RVFA 1JW9B 2UV8A 2B4RO 2PGJA 3WBFA 1DC5A 1NM5A 4E13A 1MV8A 4CM7A 1YBAA 4NR0A 1A9YA 4JBGA 2I3GA 2CF5A 3GN2A 3ZHYA 2D1YA 3B70A 2QW8A 3BHJA 1UXHA 4CM6A 4XGNA 3BMCB 4GAEA 5JYEA 1N7HA 2QX7A 4WCDA 1JKJA 3F9IA 1J4AA 2R00A 4JLWA 4CMJA 1VSUA 1M76A 1X1TA 3AI1A 2C7GA 4FPXA 1DIBA 1U2DA 4AJHA 4BB6A 4KWHA 3FR7A 4AJKA 4UREA 1LLCA 3GUYA 4WLFA 1C1XA 3C24A 3GPIA 1BXZA 3OJLA 1JVBA 2VRCA 4YXFA 1P1FA 3VKVA 2W2KB 4BO9A 3BHIA 1KY5A 4JX8A 3NGLA 3ZI0A 3ONEA 3R0IA 5TS3A 1DHTA 1YBVA 2J3IA 1DIGA 1PWZA 1PGPA 3NJ4A 4TRMA 2OOSA 1IUKA 1GFSA 3CINA 2W2LD 4EGFA 4J1NA 3VTFA 4HADA 4J0FA 2WYVA 4ESOA 4IXTA 3JQBA 2X5JO 2B37A 3BZUA 4B7XA 1M75A 2OL4A 2NU8A 5HS4A 4II2A 3FHLA 1BXKA 3CH6A 5JO0A 3W1VA 4RDIA 4LGVA 3QP9A 1NFQA 2VWHA 3QWHA 4TSKA 1EUDA 2HO5A 1HDOA 3C85A 1R0SA 1FK8A 1LRKA 3LT4A 4IZHA 4ND5A 1YB5A 1NPTO 3OH8A 5EPOA 3DOCA 3PHHA 3ETEA 4JP3A 1R16A 5EESA 4E21A 2NVUA 1Q2XA 3KOUA 4D46A 2GUGA 3KRTA 5JLAA 3DBHB 1DAPA 1OZAA 3ETDA 1ONPA 4UULA 1KVUA 4AJLA 5G0WA 2HMTA 5ENVA 5ITVA 4E33A 4RF4A 3QVWA 1JAYA 3RSHA 2O3QA 3ENNA 2ZQZA 3C3XA 5JNLA 5CG1A 4BKOA 2VCYA 3ICPA 4KZPA 4BNXA 4U0JA 1IZ9A 2O7SA 1BVUA 3TFQA 1FDUA 4CUZA 4ND4A 2H63A 3IQDB 4MVJF 4BL5A 3JQ7A 2FZWA 2VHYA 1OI7A 3GUCA 4PIVA 4MP3A 2EHDA 2I99A 3PRJA 4R54A 3DBVO 5EL0A 5FF9A 3GGGA 2DM6A 2JAHA 1ZK3A 1TT5B 3RUDA 1QORA 3AJRA 3KYBA 3OQBA 2Q2VA 1U3VA 3O38A 5IG2A 4GL4A 5FEUA 3EC7A 1PL7A 4D0SA 2PD3A 4CMCA 4EDFA 4PVCA 1NQ5A 4EJ6A 1CF2O 1QSGA 3JQCA 4Z0TA 4CR8A 1YL6A 3VZPA 3BYZA 2AA3A 2YHIB 3DAGA 4R4JA 5DP2A 3IP1A 4B4WA 5A9SA 2ZYDA 3H5NA 3ZWYA 4OXKA 5GY7A 1FDWA 1XCBA 2NU6A 4IDBA 4LN1A 4MVJA 3RFTA 1DOHA 3FF4A 1I32A 5DT9A 1KC1A 3F5QA 5F21A 2BFMA 4MKRA 2CNBA 1LJ8A 5F1OA 4OH1A 3E48A 2QRLA 3E5RA 3WOHA 2X0IA 3DBLB 3QSGA 4EI2A 4GBJA 3O4RA 4OAQA 1GYQA
chains in the Genus database with same CATH superfamily
1M5TA 1VL2A 2C0CA 4DT1B 2PUAA 5H82A 1XP5A 3KSRA 4LXYA 4XR4A 2QVLA 2N47A 5HVNA 2PJRA 1NBEA 4I14A 1BCSB 3PNMA 5AK4A 4NPCA 4C4YA 1WDLA 3OWOA 3LXRA 4EIWA 2VTBB 2YNMA 4EARA 4KHPB 1QAOA 1DFHA 1UJNA 1Y1TA 1M66A 2VSOA 1W5TA 5KWSA 5DSXA 3FXAA 4BJ6A 5JD4A 1R74A 1XHLA 4XB6B 1FF9A 4HQLA 4OD0A 1DU4A 1TX4B 1Z2PX 3KJFA 3MRVA 1KVQA 3GMIA 3PBKA 1XU9A 4RF5A 1M6WA 1EVLA 1XZFA 1QHXA 1ZCBA 2XSZA 3PENA 4UBNA 4XLTA 5DHQA 3VR4D 1N5KA 2VH5R 1LWNA 1XRRA 1YUNA 2YN2A 4H7PA 4NBSA 4R0VA 3SXPA 2PKRA 3PYXA 3WLHA 5HGXA 5KCZA 1HE2A 4W9NC 2GX6A 1Q3KA 3GFRA 4Q15A 5ARDA 1UWKA 5C1BA 3PJRA 2QTTA 3BRWA 3EPKA 1H5QA 2HC9A 3TF5A 2W2OA 3Q7RA 3R9XA 3A32A 3QM1A 4HGRA 4HWRA 1Y9EA 2IS6A 4B8WA 4TQAA 1XXLA 4O63O 1P2FA 3W9YA 3ISVA 1ZMXA 2F55A 1Y82A 1W4CA 4G0NA 4WZZA 5EFOA 3GLHA 1Z5GA 2I5PO 1R50A 3FPEA 2I2DA 2QMOA 2YR0A 2GK3A 4KXXA 4BFCA 3A31A 4BLVA 5H59A 3NPMA 7REQA 3QVGB 4IJ6A 3I5XA 3F6SA 4JELA 4OI2A 2ZSUA 4L74A 1D7OA 4MB0A 5G02A 4YFVA 1SR8A 4WACA 1PDVA 1C1HA 2II6A 3GLIE 3KJZA 1WUTA 2H00A 2H1FA 4X20A 3SOPA 2HJWA 3WZ2A 4H08A 3GR6A 4QTXA 1V35A 1IZ7A 2QM0A 1AKMA 3HMQA 3IPLA 4QFBA 2ZB4A 3NLLA 3I5MA 5T6MA 2ZTVA 4DVGA 2UAGA 3P7MA 5IXYA 5LQCA 4XSGA 4ER6A 2Z58A 2JIRA 2CXHA 3HBNA 2CDRA 4DR7B 2FQQA 1F0NA 1ECLA 3BIJA 1DO2A 3RVNA 1GKKA 4HNAA 4CDGA 5AIAA 4Z4CA 2X0KA 4OQXA 4O2BF 4XAQA 3E58A 1ESEA 1J2UA 1QG6A 1R4MA 3BQ9A 1JHYA 2CUNA 5IN5A 5TQ0A 4YRMA 4XWTA 4TKMA 1GDDA 3MBKA 2X9NA 4WY5A 3ZKAA 1MVOA 5HDBB 3RWOA 3EOZA 2ZZKA 2QLTA 4KKXB 1T1IA 1E1YA 3ZXXA 4D8VA 8ADHA 2HW8A 1T15A 3ZY2A 4W5OA 1Z0KA 3WGNA 4IDCA 4XYEA 5F52A 1P74A 3OQ1A 2XCRB 1IBRA 2IU3A 3I04M 1MJFA 1DZ3A 3IPXA 5KYGA 5LKRA 1OPXA 1Y9JA 5AVKA 5AFSA 2ZXEA 2P40A 1L4KA 3RUEA 1TK2A 1SJ9A 1ZGAA 2YXDA 3ER6A 4K03A 4YEDA 4HWTA 2Y3IA 2EHJA 4AMBA 4DYDA 1LJUA 2GS9A 1MPXA 3C74A 4IV5A 5CLHA 4ALNA 4GLFA 5L7WA 3HJCA 4EW1A 4CLOB 4KAFA 5H1YA 1E4EA 5K8TA 4LRUA 1MKYA 3ZXIA 4ITUA 2CT8A 2YMMA 4LI3X 2GKSA 1R6UA 3MTGA 4HN2A 5H3HA 1QLJA 4IINA 4NZMA 1WQ3A 3ZDYB 1UCFA 1T4CB 2AN5A 2WUFA 4OJNA 1AK2A 4Q19A 4D74A 1MJGA 3R6LA 1MT0A 3H86A 4HPJB 5IW8A 3A6FA 1HI9A 1F20A 4K46A 1N2IA 2I2XB 5FP0A 3IE2A 4EHDA 1BFKA 1CR6A 3LECA 2L19A 3S2IA 3ZHTA 5BNZA 5K4GA 2O3JA 1N1MA 1Q0UA 1UDXA 4O0LA 1QUFA 4NRDA 1H1TA 4TTTS 2I7TA 1N3BA 1QMGA 1N2XA 1RLMA 2LXNA 2XWBF 3CEHA 4BLUA 5E4JA 3IE1A 3UV6A 2BV3A 1G7CA 4JLNA 2Z0MA 3G85A 4PSDA 2Z95A 3DBHA 3V2IA 3IUEA 4UM5A 2BY4A 2J3LA 4X0EA 3WC4A 1CX9B 1JMYA 1WOYA 3N7UA 1C3EA 1MABA 5JXWA 1FTSA 1JG4A 5HK9A 4YGYA 3D6JA 3IDOA 4I1OA 1V6SA 2FB9A 3AGPA 3NHKA 4WKNA 4AMGA 5KNBA 4AF8A 3RABA 1E2HA 4WN9B 1OLOA 2MMCA 2OHIA 4TSFD 3RYCA 2CEAA 5CA1A 4PLPA 2R7AA 5LQSA 3EDMA 2O8EB 4ZEWA 4AJEA 1ZUD1 2QXUA 3G0GA 2YWXA 1K4MA 2GLXA 1B1CA 1XDDA 4ALJA 2XLCA 4FKMA 1R0KA 4PZZA 3BQNB 3SOZA 1GNPA 2QT1A 4UHHA 1C7IA 2QRUA 4PVDA 3AEQB 2YASA 4Q3DA 1NW8A 1GZDA 3BGDA 3LQ4A 2OAQ1 5LB2A 4ZGGA 1GWNA 2BM9A 3FYCA 3AR7A 3BSFA 5ALIA 4BP1A 4LMAA 1X7XA 3LE8A 1CZKA 2QX6A 3NBUA 4JI6B 2Q5FA 3KVNA 1I1HA 5JSFA 1NMZA 3RS5A 3B6ZA 2D62A 5GIOE 2CBZA 3F4KA 1V39A 3HJTA 4GXRA 1JH8A 3O73A 5IKOA 3W06A 4E03A 2F9LA 1E9RA 4YLGA 3ADCA 2BEWA 3I9KA 3A9SA 3PVCA 4GECA 2JARA 4N54A 3O75A 2FP3A 5C1PA 4H4CA 2JI6A 4QDTA 3MB5A 3ON5A 5AOCA 1ZD9A 3WADA 3U60B 2UXBB 3H2GA 3HZZA 2W70A 1JLMA 1FU7A 1VCOA 1IM2A 3BWMA 7REQB 5E2AA 1T9AA 1P5HA 3IEVA 1PJ2A 3EA0A 5KREA 2IEBA 3D8SA 3EGOA 3U44A 4BE9A 3B9QA 3MJRA 3ZXUB 3RYHA 3BORA 3O2JA 4GKKB 4G26A 3PWZA 2BGMA 2A5JA 2Z8YA 3AF0A 1UXJA 1F2UA 1TO6A 4KBGA 4GKVA 4OMUA 3DMGA 4RE6A 1K1EA 4MW9A 8ATCA 1TXGA 3J80A 3RJMA 5BVHA 3H84A 5ILGA 2PLFA 3DOHA 5GPBA 3LP6A 1VPWA 1MB0A 3T7IA 2DFNA 2QT0A 3KK0A 3HXLA 3LL7A 4I3HA 1Y4DE 2MR6A 1IK4A 1P4HA 4UARA 4G1EB 1HGXA 2WJPA 2NU7B 1D5WA 2PZAA 4YCNA 4Q9LA 4AQ7A 2E1PA 2C1ZA 2IA5A 3O7WA 3VRHA 5IKXA 2XZDA 3GH1A 1HV8A 3OBIA 2LPMA 3LM8A 4ML3A 1Q57A 3UPTA 1QP7A 1AN0A 1FRVA 1D03A 1WY5A 2AOTA 3O3NB 2OHFA 4K28A 4QWWA 4QZVA 4TTAA 5L3SB 3D7MA 3HBFA 3IERA 5CFNA 5I3CA 5I8PA 3WRYC 1U7XA 1Q20A 2W6MA 1WS6A 4FWTA 3D31A 2Q6IA 3AM5A 3U7EB 2FSHA 2AEEA 4XCXA 2RGNC 4L0QA 4E4TA 3ESBA 4FYMA 1A9XA 4ZI5A 3N8GA 1ESDA 3TX2A 4BO0A 3UN1A 1VSQA 2RC5A 1JEYB 1WW8A 4YP6A 4OMCA 3UMCA 4QT0A 5JDCA 1HYHA 1NIJA 1S2MA 3WV4A 1NGSA 4J2TA 1KBZA 2D2XA 1QHNA 3B60A 4QX6A 1UOEA 1C41A 2ZUTA 4JU9A 3KLMX 4HLUA 5DXFA 3K30A 5J59A 2QE7D 3EH2A 3HR8A 1NC3A 2ZQ5A 4ME6A 4XKJA 2H8GA 4V0MA 2DPMA 1HTTA 1JJAA 1MX3A 2EEPA 1C1DB 2GTPA 4ID3A 4LWQA 1NI4B 3FKSD 4UUOA 4A4DA 5L3QB 3MCZA 5KNLA 2O2XA 4NHOA 4GX2A 3RANA 1FDVA 2GYWA 3KT0A 4NFSA 4QRHA 4QJIA 3UV3A 1SCIA 1GD1O 3P2KA 3TTVA 1MW8X 3J7AC 2Z3VA 2WJGA 2VRWA 3ESXA 5LJLA 5F2EA 2X40A 3U1TA 1BXGA 3UXYA 2POCA 1CUVA 1VECA 4U7DA 4MVJG 5CTJA 2IV7A 2XITA 3QI7A 1NG9A 2P67A 3CBQA 5F73A 2RHCA 4BBZA 5DBGA 1UBUS 3NNNA 5ALZA 1SG9A 3BJRA 4Q34A 1W2HA 2VH2A 4F0JA 3P8ZA 1EFRA 1CULC 2YV1A 2X5KO 4JKIA 1YQQA 1W5BA 3K1TA 4QELA 3I2IA 3LO5A 4YJKA 4B7ZA 2ODNA 1SHTX 2ZPUA 4CM1A 2QBYA 3FBGA 1KI6B 3D6UA 4WXRA 4Y1EA 2B3DA 2MJLA 3MWGA 3R74A 3T3NA 1M0EA 1PQ4A 2WM3A 3VNBA 4QTYA 3VO9A 3G8AA 2WQZA 3BMQB 2QK4A 3B3AA 3KVYA 4V03A 5B53A 4CL8A 4NPAA 1SOWA 2J5XA 1U28A 3CA8A 3FVVA 3VR2D 4U7GA 3DHEA 4D98A 3KQNA 3MRSA 4H17A 3U4MA 1C4WA 1A9QA 1C9DB 3DGEC 3IXMA 3T8YA 5AVZA 3DZFA 4RTNA 1MGOA 3FETA 3ONVA 1AK9A 3Q10A 1C7ZA 2F9FA 1LVGA 2FK8A 1H6AA 4P4NA 2C42A 3P2YA 5ALVA 5L40A 2HPVA 2VYNA 4I5FA 3P2JA 1E3EA 1QE0A 2PTHA 3HN7A 2JGEA 4AWBA 3WGJA 2XTNA 4NMXB 5BR8B 3K9WA 1ZISA 4KTVE 3QUCA 3CEPB 2AEJA 5CJ2A 1BE1A 1BW9A 3FYDA 4YS6A 3GLGB 3D8HA 3RYIB 4CKCB 2AJBA 4P3XA 4LDPA 1JH9A 5INTA 1H1DA 2E37A 1EUCB 2ZUBA 4URWR 3UT0A 4Q6BA 4ZAGA 3ML1A 5ALFA 3IAEA 4FDVA 1GTZA 3UJPA 5G0TA 4R68A 1DMSA 3W3AD 2C95A 1JWAB 1QJ4A 4YIKA 4GZLA 4M87A 4PZUA 4WUTA 2I7DA 4PQRA 3UMJA 2C3YA 3KKEA 4O5OA 4WK4B 2EP7A 2R85A 1IWPB 2ZJ8A 1CQJB 1NBMA 2DT5A 3LSTA 3N8IA 5D86A 1GUFA 1W35A 3T34A 3KPJA 3UA4A 3E1SA 4XWAA 1N75A 2O7NA 3I39X 4LF6B 4LRTB 3DOOA 3V7UA 4LE0A 3SR3A 3GRYA 2G0TA 2BMEA 1F2VA 4AO7A 4RIIA 2VHXA 3AUXA 3D7NA 1NBHA 4BGUA 2FZGA 1QTRA 1DHRA 4HJRA 3OLCX 2XUHA 2FDCA 5EIBD 4PLHA 2APJA 5HFAA 1FFWA 2B5OA 3ONFA 2WJWA 5HBRA 4DWJA 4TWRA 3PX7A 2IOFK 1WHSA 1CJSA 3AL2A 3EZLA 1ZC3A 2FZ5A 2FFQA 3G1WA 5E9JA 1IG3A 4RCVA 3R7WA 4OFBA 4OHKA 3KJXA 2W2LA 1A5AB 4FT2A 2PVPA 3EIHA 4RS3A 2QHXA 5FPHA 4FP9A 3ULKA 2QRVB 3CLKA 3PNYA 5HQJA 1P4SA 2H31A 5I7RA 4RENA 5AJHA 3VJLA 2WTNA 4W9MC 3A06A 1OBFO 1K6IA 3OOYA 1E79A 1Y8RB 4HX2A 1EGMB 2DFPA 1J0EA 2AC7A 1O5IA 5BWMA 2B69A 1PFGA 1PJBA 2OO3A 2VKTA 1OX6A 2ZRIA 3UHFA 4B6QA 3EYAA 4QARA 1I7LA 3ESQA 1JQEA 3G8CA 4F3NA 4H7HA 2QD3A 4S1WA 4JN6B 5JJBA 1HZZA 2BFDA 2GEKA 4MJ7A 1G5IA 3OZGA 1ST2A 2NW6A 2H1RA 2X15A 4N47A 1BS2A 1V4BA 1K8ZB 1FNSA 1S7GA 1UQUA 2P35A 4HLNA 1IWOA 4LHYA 4ZPXA 3WQRA 4WY2A 1AU9A 3G2LA 2EBFX 1CP3A 4MP8A 2ZQYA 2HL6A 4Z7JA 1AGYA 3E3NA 2VDPB 1Y42X 4RMGA 4GI2A 4O2AB 1NAHA 3U4QA 4QPCA 1GARA 1U11A 5KHAA 1HK7A 4H7KA 4E32A 1FFSA 3AM4A 4HUQA 4KUGA 5M29A 2BFAA 1H2EA 4ZOQI 1GHTA 1Z2CA 1NU6A 1QANA 3NBAA 2JGNA 3DZBA 3G68A 2YZMA 3HUEA 1KMHB 2V03A 1ULBA 2BTQB 4LRYA 3NGMA 4GKAA 5E95A 3P0RA 4YHBA 1LNSA 4E5PA 5AK5A 4YIHA 1ORDA 1IY2A 3ODGA 3OLQA 2FMXA 5IM4A 1ZR2A 1F0PA 1K6JA 5FRDA 5C1DA 1SH7A 4KFSA 1B14A 3ZBUA 3DPSA 2DP4E 3JWEA 5DHPA 4EJMA 2OBXA 1A76A 2XVAA 3KB6A 1W6RA 4LTDA 3WYCA 5D1HA 1EGAA 3ZD9A 1E8DA 3DZCA 1P0IA 3EZGA 3GEIA 3G9TA 5HF9A 2FPLA 5D1NA 1FTWA 4QEZA 4RK0A 3C2QA 2J3KA 3LGSA 5G0SA 2G70A 1JQ3A 4D5GA 3G23A 4NENA 3LIPA 4R8KA 1FQKA 2FLWA 3U5TA 3FOCA 4YREA 1SK9A 1JFRA 2JLBA 3EHDA 2JGMA 4J2HA 3KL2A 3R6WA 4ZT7A 1M6NA 5GQSA 3T3EA 4EX7A 3SEAA 3EX7C 1XRLA 1BROA 5EY5B 2MDTA 4KR7A 3F78A 4RKEA 3S0JA 3ISJA 2PWPA 2R79A 2B2NA 4X93A 1I8TA 4EITA 3LOQA 1A7UA 3ELUA 3MMZA 1HYBA 2XRFA 2QGFA 3NVMB 3OSUA 4QL3A 4AT1A 4ASUA 2PZKA 5TT1A 1RACA 4K9MA 5FOSA 4YJHA 3PPXA 4CKWA 4H9GA 2BKUA 4Q3EA 4HMQA 5KYWA 4EVRA 5FLXA 5A5FA 4RNCA 1KDYA 1GFWA 1YQWA 1BGXT 5GIPE 4GZ3A 3TD6A 1Y7PA 5FYQA 3GU3A 5T64A 2I6TA 4WFQA 2JH3A 1JFVA 4MCIA 3CXUA 5BYAA 4NIMA 1EFPB 3WGTA 5GGYA 3NM5A 4PYMA 1NMYA 5EXPA 1ZQ1A 5KWEA 3DCJA 5CDYA 3KR9A 4H1VA 2CDAA 2X4LA 2A1UB 4REQB 4AVYA 2AG5A 3W5IA 3DR5A 3HKDA 1F9EA 2ZYHA 4JBWA 1DTEA 1FC0A 4QFDA 4X60A 5AW1A 2VRCD 4C4TA 2E5WA 4YMSA 1FLVA 1P2UA 5T8KC 2AL7A 3VH2A 2F43A 2DCMA 1TVKA 4J7AA 5FUWA 2P0EA 3RVJA 3V4OA 3L7OA 3X44A 3O91A 3OZUA 4HAVA 1QH8B 3DHNA 4JY7A 1X1EA 1DFGA 2QT9A 3B82A 1SUCA 3BICA 3FCUB 3P9XA 4KMRA 3BQMB 4PNHA 4Q7EA 4R81A 4QG3A 3EZNA 4F2PA 3JATA 2GPAA 2FH5B 1G8JA 4I3GA 3RU3A 5BYJA 3TUZC 5LXTF 4J1TC 3U13A 2ZTLA 4MWTA 3A0RB 4LQDA 1YF3A 2FR0A 1WX1A 1WUYA 2DJ5A 2CYBA 2JJ8A 1KJYA 4BLSA 1PR2A 3KR0A 4OREX 3TFOA 4R9NA 5IKMA 4BBPA 3HV0A 3FDZB 2DWUA 5FBLB 5I9IA 1BVYF 4K6KA 3EZXA 1VCHA 3KPVA 1EM8B 2YXBA 1T2CA 1TM5E 1P1CA 3B51X 2AR0A 4XSVA 2WQ6A 2QAGA 3FGPA 1R8QA 2A33A 4OKNA 4QGBA 2LUOA 1UDWA 2R751 3GEPA 3O82A 4FGWA 5K3BA 1JALA 2ETXA 2XH8A 2XNJA 1PYGA 4ASUD 4LECA 2CJXA 3PLRA 4BNJA 1NM5C 3F2VA 1W2GA 3IP5A 3R4CA 3V8BA 4B6JA 1TA9A 2CKMA 2O05A 4EMTA 1A7KA 4XM1A 5M34A 4LJ8A 4M1ZA 1M1YA 2ZUUA 4B45A 3CKYA 3VZSA 2CMHA 4UFOA 4WKPA 4M9XA 1RRKA 4ZQGA 2AI2A 2PSHA 3K9BA 2DUJA 4U2GA 1T5OA 2G80A 5B2ZA 3FM9A 1FNCA 3BJIC 1F5SA 1QV6A 3O95A 1RXEA 4MWBA 3V46A 1LBEA 3QBVA 4U2KA 1P3Y1 3FCSB 1YZLA 4ACBA 3UMYA 2AR9A 2ZM5A 3GBVA 1XZ8A 1YCHA 3OUZA 2DE0X 3I2FA 1RM5A 4F3KA 4EF6A 5JD5A 3P9YA 2XHEA 1FTYA 2O7VA 3FR8A 4MGHA 3KQKA 3GARA 1ZKMA 4ZIRB 3CPJB 2UUCB 4D0RA 1AKQA 5IYZF 4O2AA 1K92A 3BIFA 1CRZA 3QWAA 1PGNA 4UBLA 3KTAB 1NBIA 3GRKA 2Z04A 3O1JC 5P21A 2DHQA 2EXXA 2VQFB 2GEFA 3VC2A 9LDBA 1OF1A 2O2IA 2W2PA 3UNXA 1L8XA 1ZIYA 3NDPA 1DUSA 1VJ1A 4E70A 5LVAA 2WJ6A 1FDOA 4XVHA 1NTOA 4F4FA 1FTQA 4M99A 4C6TB 3LT0A 4YAOA 5G41A 3WGYA 2I4IA 5SZHB 4LW8A 3TZ6A 1EK1A 3R7DA 3OFSA 3NETA 3IDFA 1IJKA 3RE1A 4ZYUA 3R75A 1I80A 3C16C 4RD3A 2EG5A 4F7WA 3RTBA 2A59A 4PLFA 4W7HA 5HCUA 1GV1A 5AI6A 5MFZA 2W2MA 4QTZA 1M33A 4CNQA 1W36D 4HYYA 4ZVQA 4NJOA 4ZI3A 1EVIA 1X1AA 4FR0A 3DQPA 1GG8A 3ASUA 3TW4A 4TUYA 3H97A 3A36A 5IARA 3SD7A 4FFOA 1VYUA 3SF8B 1SXQA 1AC5A 1CUXA 2XUOA 4LZJA 3AF5A 2QSZA 3Q0IA 3TNYA 1EXDA 1SHJA 3VUFA 4A0GA 3HMKA 4MYUA 1XNGA 5GOTA 3OPVA 4JLJA 3GJXC 1DAKA 4MIEA 5EWJA 1ZSNA 3C87A 4B79A 2J3HA 2BMWA 3K7EA 4M3NA 3GLIA 4O2BB 1CETA 4FT4A 1XZAA 2YWJA 4TL8A 1U2RA 3FIUA 4YJHB 3TIXB 3UB2A 4CKWB 3TTYA 1JXMA 4I1RA 3ABRB 4QXOA 5LSAA 4OB7A 4MRMA 1EVYA 3EOAI 5F12A 3WWEA 5CBKA 2A14A 3FNBA 1GG9A 2BYTA 1L2TA 1ULZA 1XZEA 3IMEA 1PWEA 1ULUA 5AM3A 3R7FA 3M33A 3DZIA 4C0KA 1XRPA 3W8EA 1W4RA 3WKEA 3BXGA 1Z62A 5JAUA 2WMDA 4H1TA 4RWEA 5J5VA 1T5BA 4M1EA 2WTAA 4WT7A 5DNVA 2ZJ5A 2IYNA 3PC7A 3SHFA 3C8ZA 1SZJG 1H85A 1NP3A 2AB0A 2QN7A 2OV1A 3ITKA 3L1JA 4L5JA 2EOAA 2YWEA 4QFCA 1VM6A 2AXPA 4PZ0A 3RVOA 3D7SA 3GO4A 4ED9A 2F43B 2L18A 3PHGA 4IFEA 2ORWA 3MTQA 2VJMB 4V38A 1CQWA 5AW3A 1YULA 2VHVA 4FNGA 1N6OA 3R6TA 3TS1A 3IUPA 1VOTA 1ZY2A 4BB9A 3UGKA 5KNCD 4KGVA 3LLUA 3CPHA 3FZEA 5DTIA 1PEKE 2QYSA 2QKYA 4MMYB 2F17A 1WZEA 1UBMS 4IZIA 1VRVA 2OCLA 3RK1A 3PPVA 4L85A 3M1AA 3K5HA 5BQOA 3KYCB 4OHBA 1CF4A 1KRWA 1MU0A 2JIZA 1R27A 2RGEA 1LS6A 4RD6A 2NPIA 1T9BA 4TZKA 2WKSA 4IQ0A 5TNXA 2OVBA 1SXJB 2B78A 2P6PA 3LXMA 1FNDA 3PXAA 3MMPA 5EIHA 2GEVA 3EIOA 3R5KA 3WB2A 2JGDA 5T67A 5C31A 3RBXA 4DNPA 2OCIA 3BD7A 4IJMA 5KNBH 1WMFA 2XDYA 3GDHA 3ZPXA 2IZOA 4EY3A 3TAXA 2RHLA 3BMNB 3K1AA 1TCCA 4WVLA 1YHYA 1YDMA 2FQYA 3TLAA 4DHEA 3HU5A 2CNNA 3CONA 4MYTA 1WMAA 1CRQA 2X8BA 1HTBA 5J40A 4G0XA 3D0OA 1WUHS 4DDHA 3BRCA 4E46A 3LY9A 3GJYA 2EP8A 4UW9A 3R6DA 4LSGA 4DQLA 1IN7A 4FHEA 4HC4A 4Z1MD 5JYBA 5K8VA 1EA7A 1R2QA 5T7BA 3I9FA 3G2OA 1R0LA 5BV1A 2WM8A 3BWXA 3NIWA 1ADBA 3TRDA 3DE2X 1HY3A 3HB7A 1H0SA 1BXGB 5IAKA 2D1RA 1OH6A 1QU3A 4TKLA 2BKXA 1VKNA 2KQUA 2WWVD 2E6KA 4IJQA 4Q48A 2HPZA 1K98A 1YRYE 1BIFA 2BEUA 2OMEA 2V4ZA 3IMKA 3IX7A 1ZGJA 4Q9KA 1GGHA 2J0VA 1MMFB 1XD8A 3M4NA 3P97A 5CIWA 1B1AA 1NVTA 5BUZA 5IZCA 2OHOA 2Z5GA 1ODLA 2C8VA 2V58A 5DWVA 3ROQA 3S6JA 3B7WA 1FDIA 4PZYA 3A2KA 4EKEA 1DQZA 3DVRX 1E20A 4HVLA 4KX3A 5KX5B 1A69A 5EJFA 7AT1A 2I4OA 4ZC8A 4K9NA 221PA 1OI3A 4RH1A 1WB6A 1ISMA 2EKPA 3KVRA 3OA2A 4Y6RA 4WL0A 1ZO8A 5BN4A 5K8UA 3JVUA 2W4QA 1J97A 2EYQA 4I1UA 3AOEC 3FNEA 1RJ9A 5J2TF 3OZCA 3PD7A 3I52A 1JDBB 2ID8A 5LQDA 2VT6A 3TNJA 3B1ZA 4MW0A 1CRWG 1A1SA 1Q1ZA 5H80A 4BNWA 4AY5A 5BURA 1OFUX 1F4LA 2B4AA 2FAXA 3FHCB 4UAUA 4MUKA 2E2WA 3NUQA 3TB6A 3VPDA 2FPPB 2AOUA 1OPRA 1Y6JA 3E7WA 1CHNA 3KFVA 1YJBA 2FKAA 1R8XA 3E9QA 4YBZA 2V9PA 3EBLA 4IUYA 2UKDA 3S2UA 5B36A 4RULA 2C4TA 3U3DA 1ZFNA 5DHSA 3GLGA 2YHUA 4ZOLB 4ZU6X 2BUBA 4IDDA 3V48A 3L4JA 1T5DX 1XQ9A 2JIBA 2NVWA 2XQVA 3W8RA 3DFUA 1KYTA 1QH1B 3V33A 4R3WA 2PDAA 2O0HA 4RA6B 2VR1A 3EGXA 3PSHA 2WU4A 5LZ5A 1SUAA 4MS3B 3G88A 2O8DB 2ZR0A 4ZTUB 3VAYA 3G7NA 5EJ6A 5JXIA 1XF9A 4V24A 1N1DA 1A5ZA 1PK9A 4DSOA 3MLEA 2NQ8A 4U7TB 3L0SA 3MK31 5ICSA 1DPGA 1DJQA 2LD4A 2QNIA 3ITEA 1CIPA 2WHPA 4G5GA 4KJZA 1ZI8A 4KLNA 4AX8A 1W581 5CLGA 5ITWA 1PFYA 2RBGA 1NT4A 5HX7A 2XF2A 4OLAA 4PYJA 5IT0A 4JJGA 1IBSA 1S9HA 1GNQA 2C84A 4LCJA 2BL4A 2FPIA 1U1GA 1G9XA 2IEGA 3UWKA 3ZIAA 2VP6A 1N1GA 2PWYA 5BW4A 2ODEA 4A82A 4DA0A 4P4SA 4OHUA 4GOND 1LS1A 1L5NA 4L28A 2P9QA 4EG3A 4LX8A 2VPQA 1UT6A 1ENPA 4V0RA 4EA6A 3RU7A 1TDJA 2QTNA 3O5AA 4MTLA 2BGJA 1R00A 2Y27A 4OHFA 3NIBA 2GT1A 3EXHC 2WI8A 3I9V1 4TXMA 3ZD6A 1XLTC 2X0JA 4HP8A 3DEKA 3STUA 3NBYC 3DDWA 2JHAA 1DEHA 1T24A 5FX2A 4KW7A 1QQ6A 2QVBA 2VYVA 3RROA 2GXSA 1E9AA 2A94A 3RS9A 5KQGA 4DA4A 1T4CA 1ZN9A 4BEWA 5JANA 2O7RA 5IVIA 2AOTB 3RF6A 2R25B 3JVEA 4BIMA 5FO1A 3I23A 4CM8A 1NWCA 1ZH2A 1ZIOA 2PH5A 3ZDAA 1F0YA 3IPCA 1QOPB 3K09C 4GLOA 4KJXA 1OX5A 3EIFA 4JI0B 2YVAA 3KLBA 2WJZB 3OFJA 4ZT3A 4P7KA 4CV0A 4GOMD 4S2EA 1IN8A 1X8XA 4GL2A 1X94A 3UAZA 1XZIA 3JQ9A 3OCZA 2WHPB 5NULA 3VDMA 1M34A 4QHTA 1G5QA 2JANA 1VPDA 4TROA 4NH0A 3GIWA 1XZLA 3L7DA 3LY5A 1NXWA 2RGXA 2OV2A 3HABA 4NMHA 4I5GA 3LFHA 4E5VA 4DSAA 5LU8A 4XD7A 4EG0A 3K0SA 5JBIA 5AVRA 2AN1A 1NRIA 3AG5A 5EUCA 4EOGA 3LHFA 2ZUWA 4PO8A 1EZ1A 1NN3A 4MOWA 3F7MA 2CNWD 5MFPA 1CDEA 1CQIA 3EMVA 3MWFA 1KK0A 2QZSA 1YZYA 4MQEB 3Q3EA 3V5NA 3KM0A 4YCSA 4W5QA 4BQPA 2O0LA 1DKQA 1SK8A 1XSEA 2LIPA 2ST1A 5DEOA 2TYSB 4J90A 4MAMA 2DPLA 3RPEA 1J1ZA 3H13A 4GQBA 5I8WA 2Q50A 5FHRA 5GJWC 1RJGA 1BD3A 3PC6A 4G4IA 1D2RA 4IQ8A 1OLSB 4ANFA 1BHJA 1KFCB 1P1JA 1JIXA 1BE0A 1ZJZA 3GFTA 4TWZA 5D00A 3IOCA 2NVUB 2O2EA 3WK8A 2X23A 3B89A 4CCYA 2RHMA 1VHJA 2NXEA 3FTFA 4CW7A 2ZRMA 3N0XA 5IM4F 1LLDA 3BE6A 3ZWCA 1HO3A 4EJSA 4CJXA 1H8HA 3I32A 1YSCA 1GPH1 3PUKA 4H2DA 2AD1A 3KXDA 4DM3A 2GCGA 1TAUA 1B8OA 5FBRB 5JFTA 3NIFB 4HI0E 4DZRA 1S3IA 1ZLYA 2C0PA 3VNUA 4KP7A 3VVBA 2G7ZA 1ZL0A 3FSJX 3KV3O 4I5DA 3TVYA 1GXSB 2GJSA 4M53A 5BQXA 1E1CB 2JG3A 2Z2XA 1WNTA 2J0UA 2BJWA 3GJ3A 1KEUA 1X7DA 3T7JA 2NP7A 1ISPA 2RONA 2YYYA 4G2TA 2HDWA 3KETA 3UMVA 3OO0A 3BMXA 4DC1A 1FW8A 5IVKA 3EWAA 3QPVA 2A1TR 2PCLA 3KALA 3F7TA 2FPKA 1I3KA 1UBRS 4H3HB 4GPZA 2Q7DA 4CCAA 4QGSA 3ICQB 4IEEA 1NW5A 3LUFA 1W46A 2NV6A 4IHKA 1AZSC 2TMYA 4CQLB 2XTJA 4HFJA 2QRQA 1I3LA 2B9VA 5FT9A 3T94A 2CUTA 4GQAA 4YRNA 3HHEA 3E7XA 5TJHA 2XBUA 3ZH9B 1LI4A 1TQ2A 1YS2X 3D6NB 3PGVA 4W1RA 1I7QB 5E2IA 4G1MB 3ANMA 1SVSA 3JQRA 2W2NA 3E9CA 2G36A 5LYJB 1QO7A 1LCIA 4H1HA 3LDHA 4Z0NA 1JFTA 1MJNA 2ODWA 4DM4A 1QV9A 3B53X 4QPJC 3W6ZA 4X1OA 5CH8A 3PCRB 4BOYA 4JQOA 1TMOA 3ZJYA 4DR5B 1VTKA 1SB8A 2H08A 2OP1A 1PJCA 3FTQA 1OWMA 3EEIA 3O92A 3OU7A 4G0ZA 4MGKR 4O2LA 3GH3A 4US1R 3W2FA 1FPMA 1EXNA 3BXPA 5AI4A 1OLUB 3GYGA 4V2UA 3PQ3A 3PX2A 1Y37A 5C5EA 3O8NA 1AUQA 3KAQA 5B7PA 4B3CA 4X6UA 2QMQA 1R1DA 1ZCZA 4EUEA 2O5EA 4QRIA 1MC8A 1RYYA 2Y1WA 3HA3A 4DLNA 4JLSA 4ZODA 4M1SA 1DAIA 2Q5LA 2ECFA 2RKWA 2C92A 2CFOA 4EF5A 4I8IA 1B15A 1IHDA 2VJOA 1E5TA 1CUGA 2RHHA 2HA2A 1ZD5A 3RHSA 5CA0B 3A7DA 2CXTA 2OPBA 4C7OB 4QU5A 1IRXA 1RPAA 2ROQA 3VKUA 2WWFA 4R01A 3KOXA 1H0KA 4YYEA 2V3WA 2OHXA 4UCXA 1OT5A 1PSDA 1Y5MA 2OAEA 2QORA 2VJMA 4LZWA 1Q1NA 5TARA 3TVDA 2IZ0A 4MGZR 3DL0A 4OHRA 1QK5A 1JEDA 1WBJB 3P20A 4LZLA 2JGFA 1T2DA 3EDCA 2YN4A 4HV4A 2O59A 5U4XA 4UNRA 4DTIA 7ABPA 2YFKA 1G6OA 3LK7A 4PS0A 4TV8B 3VGJA 1PWYE 5DM70 4S1VA 3ZQUA 1U7UA 4EB3A 4YA6A 1J42A 2DPXA 2FSUA 2OV3A 2Y92A 1K3TA 3CZCA 3HL0A 3QVVA 3SZLA 1X9HA 3HXTA 4RJKA 3WQBA 5BSFA 1UDAA 3COJA 5KJFA 1PUXA 1JLKA 3CJTA 5LQUA 1VHWA 3D2AA 4QTTB 3I1IA 4GOKA 2G8LA 5AIBA 3GWZA 1B16A 1XCLA 2KW5A 3TO5A 4RLQA 1II8A 4B8ZA 2X77A 4PC3A 5FTMA 2GKOA 4BKPA 6PFKA 5KVSA 4QYWA 1YA4A 4NULA 3JZFA 2XXJA 3HDVA 2CNOA 3MBIA 1KF0A 9ABPA 1XTRA 4PRLA 1Q0QA 2P27A 4IH1A 1NE2A 1CUBA 1DKLA 4Y30A 2ZAOA 2WT8A 2FEOA 3D1JA 3H99A 3WB9A 4BTEA 3GT3A 4IG9A 5B57C 3R0XA 2A9RA 3WSTA 3Q8WA 3R9KA 1CUCA 4WESA 1VMDA 2QLFA 3PV0A 4RVGA 3UMMA 4ZEMA 5DLQC 5DGCA 3STYA 3ZHBA 2WHRA 3GVIA 2QXYA 2XTMA 2VTVA 2WV7A 4AF6A 3H4VA 2ZBGA 1S2IA 3R0ZA 3ASVA 4FKBA 4QIHA 4TMKA 3WWYA 2NACA 2IK8A 2OUKA 4ZAWA 3G0DA 5JZBA 1QIDA 2QX8A 4HN9A 2QTGA 1KORA 4TV8A 4NWIA 4CIDA 1KEEA 5HOEA 1MEEA 3K6KA 1KS2A 3O74A 3WL3A 5ERYA 4JLBA 3QHPA 3QYAA 5LZ7A 2C8KA 4Y6GB 1BHSA 2WSSA 4G81A 4EGSA 4C1BA 1KERA 4R2LA 4Z54A 5DTRA 3I8SA 4MCJA 4YRAA 3SC6A 1WQ4A 4U8HA 3D3QA 1E5XA 4H3KB 1R6AA 4NFHA 5EGNA 1IU9A 3LCMA 1XJ5A 4DARA 5EPUA 2I71A 5HUJA 3OFNA 4BO4A 5D5HA 1TMYA 2X6TA 3F6RA 4NENB 4WFJA 3RRYA 1LPBB 3G3EA 3V6MA 3RFVA 3CYFA 1HQCA 2WICA 1C8KA 1DRVA 1G20E 3LGXA 4K9DA 4WFKA 4ILEA 1K9VF 4YP7A 1W9MA 2PQ0A 2DB3A 3KXLA 5AK0A 1H6DA 4P5PA 5ELXA 4JXZA 2VXOA 4OMDA 4JYMA 2PR2A 1U2GC 1Q16A 1I3NA 5DPMA 5ESWA 3JQ9C 2Z5FA 3NOVA 5HE9A 1XTJA 2WV9A 1BEUB 3E3MA 4B17A 4YX9A 2HWUA 3MTIA 5CXQA 2PCJA 3VSAA 3AZOA 3ANXA 3FUVA 3N5KA 5K0GA 4CWAA 1G21B 1P3JA 4NU6A 1QG0A 3WJAA 4I19A 3OMLA 4IXMA 5KDLA 1NQTA 3BFJA 1SEVA 3L4BC 4V0SA 1P2GA 4UVDA 1MIOA 1PNRA 3NYIA 3UKJA 2WU1A 3LQKA 2DC1A 2E6UX 2IYPA 4RJ2A 3WFZA 2HJSA 2ZAGA 3UJAA 2Q5IA 2MINB 2H1OA 1WV1A 1K75A 1X39A 1OUMA 2ODPA 4PSAA 2TMGA 4JYPA 3REQA 2Z2YA 1D1SA 4E88A 1T2VA 3N9IA 1K8RA 5JBQA 3E9NA 1IHXA 4NK4A 3IESA 5TPZD 1QVAA 5LDDC 1A8HA 5COBA 3NALA 3P32A 1XVIA 3QPWA 1L4MA 4AJ1A 2H5LA 5AMXA 1U0TA 3AMVA 4BMDA 1ZQ9A 4W5WA 3U5ZB 1H2FA 3ZBQA 4U02A 4F4JA 5I3ZA 1QGUB 3KSZO 3HCPA 2QTHA 4PNEA 2CJYA 4OA5A 2BGIA 2X0NA 3MHTA 3LQRA 5KIAA 1KYWA 2AMYA 2RCYA 3N3AC 4L8WB 5IPFA 1W2WB 4NFYA 3WYNA 2DVMA 2O5RA 3NFYA 3JSAA 1V5GA 3NXSA 5CW1A 3ZV6A 4QUGA 3JAKA 4BCDA 3BD9A 2CHVA 3EUAA 4JB0A 2NUAB 2VUIB 4OXRA 2XIQA 4M7RA 3IQZA 1NW7A 3A6ZA 4P32A 4URXR 4DRXB 2Q9BA 3ELDA 1D6JA 4JX9A 2Q6TA 3IT1A 1WKBA 2HUNA 4FIZA 3R5TA 4N3GA 5G4KB 1BWRA 3L2OB 1WKVA 2JAPA 4YALA 3GOQA 5IKPA 5CK5A 1RKXA 3DT9A 1F2TB 3C1OA 1SXJA 1U80A 1OJ7A 2EZUA 3K2IA 3Q3CA 1QHHB 5LA6A 1EVJA 2CNKA 2FPUA 4XWYA 3WDSA 1E1LA 1EINA 3KNZA 5JCXA 3ZE6A 3D43A 4DGSA 1JWLA 2VDKB 4PGFA 4PYRA 1Y7IA 5AOAA 1P8JA 1Y6RA 1G0OA 2JAOA 4IILA 3PJEA 1KVRA 1FNNA 3TNFA 1QIFA 1UPTA 5BYBA 1NF3A 4F9EA 2WAAA 1D6MA 4LDRA 4C30A 1IUOA 2JHFA 4OJMX 2JJ2D 3WHKA 1GGVA 3A3KA 4QLBA 5CAEA 2YV2A 4F4IA 4K0RA 3UT6A 1VL0A 2JH8A 3MT0A 2Q3DA 3IBSA 1RT9A 4IRUB 1IY0A 1IK6A 4IYJA 4PLTA 4E5YA 3H2BA 2CLKB 1X7ZB 5FH9A 1N5MA 1US8A 1ONSA 2H4ZA 3U3ZA 1P0PA 1S8NA 2HNKA 4I4TF 3KXPA 1O6BA 4N3AA 4H6XA 1SQ5A 4B6GA 1B00A 3OCCA 4FE3A 2ECKA 3CVYA 3N0VA 5HIIA 4ZYWA 1L1QA 1GT6A 2BDUA 2C9MA 3VSDA 4NNOA 2LWIA 3PFFA 1H9AA 4NAHA 5IDWA 1CUEA 3IBFA 5BWLA 1X9GA 2JEZA 4A0RA 2OGZA 4JZKA 4BJ1A 4UEOA 2OBBA 4E22A 1VZ2A 3PG5A 4OL9A 2VRBA 1E6MA 1I4LD 3UANA 5EZ5A 4G5HA 3WB1A 3ETHA 4DWOA 1RPZA 3ZGZA 2HQBA 3S70A 4O2BA 1PFKA 2H4WA 2J09A 3AUJB 1U1FA 3C8HA 4TMZA 2V4MA 4MS3A 4DR6B 3TRIA 4IM7A 4RMNA 1A2BA 4TYMA 4MHTA 4IKPA 4MWGA 1PYOA 2H0QA 2I4RA 2EGGA 3WIVA 1B0UA 1JFFB 3NTQA 1ORTA 5FBWB<