1U7TA

Crystal structure of abad/hsd10 with a bound inhibitor
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
255
structure length
255
Chain Sequence
b'SVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVRNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-hydroxyacyl-CoA dehydrogenase type II
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Crystal structure of human ABAD/HSD10 with a bound inhibitor: implications for design of Alzheimer's disease therapeutics
pubmed doi rcsb
total genus 92
structure length 255
sequence length 255
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.178: 3-hydroxy-2-methylbutyryl-CoA dehydrogenase.
pdb deposition date 2004-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1u7tA00
4HNGA 2HUNA 1BMDA 4NBTA 3S1LA 1BW9A 1NPTO 4YQYA 3OIFA 1CYDA 4DQUA 1HSOA 7MDHA 3Q2IA 2IZ0A 2DBZA 2VRBA 2GF2A 2IZZA 1EBUA 4TVBA 3WSWA 5FWNA 2GO1A 3DL2A 5A03A 4EITA 3VDRA 3FBGA 2A92A 1FDTA 1VSVA 3STHA 3TOXA 1CF2O 3SXPA 4B3JA 1IY8A 1M66A 4NJMA 4J0FA 1D4FA 2H5LA 5DOVA 5A9TA 2EG9A 3GY0A 4CLOB 3D3WA 2GN9A 1I24A 3PWKA 2WYWA 1R6DA 2D1YA 3ZH2A 1HDXA 4M86A 1IB6A 1P74A 1TVEA 4U6QA 5ITVA 1KY5A 3QIVA 4NK5A 5G0WA 3RUHA 1K0UA 4CV2A 1F06A 4D45A 4XJTA 2OOSA 3NDRA 5JAMA 3KEQA 5COAA 3AY3A 4J1QA 1ENZA 5TQVA 4CLEA 4MP8A 1Q0HA 2FY8A 1IZ0A 3WGZA 4WUVA 2J5QA 3ANNA 3MWEB 4U8GA 2O3JA 3INRA 3S2GA 3EUWA 2QYTA 3TL3A 3ZWPA 3DOOA 4JP2A 1H6DA 1TEHA 1RWBA 5L53A 1D1TA 2BFMA 1FDWA 1YS4A 1Z7BA 2Y0DA 5KVCA 4NDNE 3Q1LA 2GN4A 3QA9A 2JCVA 2FPIA 3ICPA 3WFIA 4CUZA 2PKQP 3RFXA 1E3WB 3G3EA 5IDXA 1E5LA 1YDWA 5TS3A 4CV0A 3DMYA 3LSYA 3E9NA 1A71A 1AN9A 4KQXA 1ZK0A 2AQHA 3AFMA 4R54A 3JD0A 5IXYA 1ZK2A 1PZFA 2CFCA 4PLTA 3GAZA 4XDYA 1WDMA 3DMTA 1ZXLA 4ZQBA 3ZWAA 3PGXA 1KVTA 2HMWA 2BFOA 5JDCA 5FI5A 3LF1A 4XYBA 1V3TA 3DC2A 4YCAA 4B8WA 4XB2A 5I8ZA 1HWYA 2IEDA 3GZNA 4GKVA 1U2DA 2AEMA 3BTUA 4BO3A 2QRKA 4MPDA 3RKRA 1WNTA 1LXCA 3V1UA 1EVYA 1DIAA 2YQ4A 2YHIB 3C1TA 3H5NA 1R16A 5FF9A 1R0LA 1ZSNA 4YAJA 2FHSA 3WTBA 2JFFA 1NVMB 3D3EA 5AXAA 5A1TA 5HTOA 1KEWA 2JD1A 3OQBA 4HNHA 3DONA 1HRDA 3AOEA 3X2FA 3JQ7A 4FS3A 3MZ0A 3BZUA 1RYDA 4A5OA 4BO8A 5ER6A 3RROA 2WMDA 3LT1A 1BVUA 1HE3A 1UR5A 3T4XA 1Y81A 2AE2A 2E49A 1AXGA 1MLDA 2Y05A 2VWPA 3WMXA 3ENNA 4FOSA 2O2YA 3W6UA 4BVAA 4EUHA 5CDUA 1Z6ZA 2RH8A 3D0OA 1UXKA 3ZW9A 4ZQHA 2Q1SA 4AJHA 3QLJA 3AW9A 2XPCA 3C1AA 4RZIA 2R6JA 5G4LA 5L51A 4M87A 3QE3A 3ZI0A 2NM0A 1EUCA 4DBZA 1YB4A 3AUUA 3ETDA 1UDBA 2WSBA 3ZGYA 3EZYA 3V2UA 4F6LA 4CMJA 1NXQA 4NBWA 5DF1A 3SC6A 4PLHA 4Q3NA 4D7AA 3JQBC 2UVDA 2G17A 4PLFA 3RCBA 3WS7A 3WXBA 4H15A 2FR8A 2FSVA 5DP2A 3KSUA 1N9GA 1ZK4A 5FFFA 3L9WA 1BGVA 4OMUA 4DLLA 2OFPA 1MC4A 4EEZA 5EPOA 1ULUA 3W4KA 2VHWA 2ZKLA 2CF5A 3OIDA 4WCFC 3ZHBA 4KWIA 1KBZA 1VM6A 3VZQA 5A3VA 4CUJA 1K5HA 5C3MA 5FI3A 4EGFA 1C1XB 4W82A 2ZB4A 3WIEA 2O23A 1NWHA 4NPCA 3KBOA 3JYPA 2FOIA 2PLAA 3UVEA 3D1LA 1NFQA 3C7DB 4PLVA 1X0XA 4JJFA 3NRCA 2D0IA 1ADCA 4BGUA 1R4NB 2EXXA 3RASA 4CR7A 3GGPA 4XZ3A 3PYXA 1SPXA 1E1MA 5TIIA 2CMDA 3OA2A 1KY4A 3PHJA 4PG5A 5BR7A 1ZVMA 1K6IA 2C0CA 4G5HA 4PLWA 4XYMA 4A7PA 4EJMA 1ZSVA 5L40A 5F5NA 2AA3A 1HDRA 4PG4A 3VKVA 2NADA 3JSAA 4TRJA 5JC1A 4ZU3A 3OJEA 4J9UE 4WE3A 3GFBA 2UUOA 3LU1A 1H9AA 2C29D 3GGOA 1GL3A 2NTNA 3GG2A 1XHLA 3RUAA 5HBRA 2CD9A 1R0KA 2DBRA 5JMPA 3CTMA 2G1UA 1R4MB 1GYQA 3LLVA 1IHXA 5EINA 3PPIA 1PJBA 2X0RA 5EQDA 1B15A 1DPGA 3GEDA 4RVFA 3DDNA 3UXYA 2HK7A 3L9XA 3GGGA 2W4QA 1HKUA 3JCZA 3AFNA 3MOIA 3SLKA 3GPDG 3H9JA 1VJ0A 1WLYA 3UCFA 6LDHA 4QO7A 3A4VA 2NACA 3TN7A 1LSUA 1OBFO 2TMDA 1WZEA 1GZ6A 1DAOA 2G76A 2CVOA 4OH1A 1IZ9A 1GADO 2JFHA 4LMRA 4LW8A 1PGOA 4J91A 2O3RA 2UYYA 1Z45A 4YRDA 2DAPA 2BRUA 2HQ1A 3HN2A 3I9OA 4IMPA 1V6AA 3NT4A 5C7LO 4RF5A 3IQDB 1QYCA 1NQ5A 4KTTE 1LC3A 3K73O 4ZN6A 3TSCA 1FMCA 4CR6A 3VZSA 1F14A 4YRAA 5G0TA 2J5RA 3V5NA 3WB9A 4Z3KA 1O8CA 5A9SA 1I01A 1EK5A 2BKAA 3GVCA 2AQIA 1LRJA 1R37A 1QYWA 2IYPA 3BAZA 2VHZA 4WLUA 1R4MA 3PLRA 3WJ7A 1YQGA 3ZV5A 2GSDA 4GSLA 3RBVA 5AVOA 5B37A 3SJ7A 1YH3A 1XQ1A 2P4HX 4PN3A 1PGNA 3W8FA 5I7FA 4Q3CA 2D8AA 4K9DA 2X5JO 4ZQGA 3L4BC 4A0SA 3TL2A 4BNWA 1OC4A 4N5NA 1PZGA 2NQ8A 2QZZA 2O3UA 4H7PA 5GZ1A 4UVEA 3BHMA 3LDHA 4DBVO 5EQFA 3HZZA 4OIMA 4OGWA 2NVWA 3Q3CA 4ESOA 3GF4A 3R6DA 1E0DA 5KWEA 1E7MA 2J3IA 3AY6A 3K8ZA 1PJTA 1C3VA 4K1LA 4OHUA 3BTSA 5KCZA 5J23A 2ET6A 4R41A 1GPDG 2JHFA 4E31A 4IXWA 3IOYA 2CSUA 4FD3A 3AUAA 2PZMA 4PZCA 5A9SB 3ZDFA 2AE1A 5T64A 5HRUA 1X1TA 2J3HA 4JJIA 2G5CA 4UEJA 4JGBA 4E12A 3GAFA 1YQDA 1YL7A 2EW2A 2NWQA 4Q3DA 5EMHA 2IXBA 3LYLA 1OOEA 1YBMA 3BMOA 3HDJA 1QG6A 3OJOA 4BNGA 4G65A 1BXZA 3GT0A 4CUKA 1BXGA 1HDOA 3GHHA 5KJFA 1ORRA 2VWHA 3L07A 2IRWA 1Y8RB 4GX2A 5IN5A 1OFGA 3JQ9A 2VUTA 4E4YA 3RD5A 2EIHA 4YT5A 5DBFA 4I8XA 2V6MA 2SCUA 1CERA 4OYRA 3U4DA 5CPBA 1HE2A 4FBGA 1K2WA 1E3JA 5HWSA 4GX1A 5F1OA 2HCTA 3H8VA 4CQMD 1B7GO 2VNAA 1D3AA 4TKLA 4M1QA 1I5RA 3H2ZA 3PHIA 1AUPA 2J3JA 4Z3DA 3SEFA 2I5PO 3F46A 4CMCA 1JLLA 4NU6A 1YBAA 4LCJA 4MVJP 3DTTA 3WBBA 4NH4A 1YGYA 4QFDA 3S2FA 5CDTA 2EGGA 4XX0A 4B8ZA 4KTVE 4IY1A 3C1OA 4D3DA 3V2HA 4AJEA 4LISA 5T67A 4I5EA 4IJKA 1LUAA 3ABIA 3F4BA 2P9EA 2C20A 4BNTA 1GUFA 1PEDA 2YHUA 1MFPA 1L1FA 4AJKA 2F00A 1MX3A 4KUHA 1CIVA 1ZO8A 2PH5A 3CH6A 3NJ4A 3EHEA 3LK7A 5KVVA 5EERA 3TZQA 4C7JA 1U2GA 1X13A 1XU7A 4BO5A 5TLSA 3BMCB 4J9VA 5JCJA 4IJVA 4ALNA 5L4SA 3V8BA 2JKVA 1HXHA 1DBVO 2EEZA 5JYEA 3ZWOA 1ID1A 4U7WA 4HFNA 3AUSA 3ROPA 3WGYA 3CIFA 5JDIA 2QIOA 5ILGA 3G1TA 1E7SA 2X8LA 3GDOA 3E03A 4IDDA 3UHAA 2JAPA 4CMHA 4WEOA 3OH8A 4MVJD 4R3NA 3GDFA 4IDCA 3HHPA 1VC2A 5DCYA 4OKIA 3W8EA 5MGBA 4AICA 1A7KA 2WM3A 4MKZA 4WPGA 4H16A 4RLSA 4OO3A 4NNJA 3A28A 4EBFA 1PJSA 1SO8A 1TT5A 3MWDB 2O4UX 3DBLA 3JD3A 3N74A 4R1SA 3CKYA 3K92A 3IJRA 4XRGA 4DMLA 1PSDA 3JQAD 1M75A 2W90A 4BO6A 4GLLA 1Y9EA 4ZVVA 5TF4A 4UVHA 1OI7A 2R2GA 1E7QA 3ONFA 1DOHA 5KKCA 1EMDA 4FB5A 4XEHA 2HMTA 4XIJA 3RC7A 3N7UA 4H3VA 3CMCO 3N58A 3F4LA 1NHWA 3L4SO 4FFPA 1IHYA 4MO2A 1KC3A 1YOVB 2JD2A 4YT8A 3TZCA 1AHIA 1FDSA 2BF7A 3FNFA 4X54A 2A9FA 1DHTA 3PVZA 4UUOA 3IJPA 4ND5A 4QX6A 4I9UA 1Q7GA 3DZGA 2D3TA 1A4UA 2A94A 4R4JA 3ITKA 1DJNA 4ZA2A 2DPHA 3IIEA 2VTDA 4M49A 4I9HA 4D43A 4HUJA 5L9AA 3KSZO 3FBTA 3G49A 4AJJA 4IDAA 1Y6JA 2PKRA 3H9QA 1ADFA 3WQQA 1XA0A 1MGOA 4WLEA 1LDMA 1X1EA 2DLDA 2H63A 4ID9A 2JD0A 3K31A 4UUPA 3HWRA 5IXSA 3TFQA 2XXBA 3FTNA 2CY0A 1I0ZA 4K26A 1YBVA 1Y8QA 3P2OA 1EZ4A 3KETA 1XGKA 1N7HA 4PLCA 3GEMA 1UH5A 1WMAA 4E33A 3RBXA 4UVGA 2QRJA 2E6UX 5EL0A 3EGOA 4XR9A 1R12A 4F45A 4NJMB 4E3ZA 2Y66A 3T7CA 1WWKA 3JQFA 3GNQA 3H65A 1P1KA 2QG4A 4OSOA 1ADGA 1B3RA 1HLDA 3QVOA 4RL6A 4B4WA 4DIFA 5IDQA 3PYMA 2AG8A 4W9NA 1YVEI 2BI8A 1OZAA 3ZWNA 1D1SA 2O50A 2X0JA 2OHXA 1LDEA 3AK4A 3HUDA 4NR0A 1H6AA 1GCUA 1LX6A 3O4RA 3M2TA 1NBOA 1PQWA 4QSMA 4YT4A 4WOJA 1PZHA 3EMKA 3INTA 4Y6RA 4CQLB 4IUYA 4HY3A 4M54A 2AQKA 3NDJA 4JJGA 2GPTA 4DA9A 4NQZA 4NZ9A 3MJEA 3LT2A 5IZCC 2ZB3A 1RM3A 1O6ZA 3QP9A 4XGKA 2DVMA 3B20A 1YL6A 1B16A 1E5QA 2PR2A 3RC9A 3NDIA 4WCFB 4OXKA 3JQGB 3Q9UA 1ZKMA 1T2DA 4Y67A 3U4IA 2H9IA 4CL8A 3OICA 2Y67A 2W8ZA 5IJZA 2IE0A 2QRLA 4P38A 3ROMA 3ADOA 5G2OA 3RUCA 1PGPA 3RWBA 4J1SA 1EDZA 2PY6A 3BTVA 3NTRA 1IL0A 3P5SA 4CM6A 2R00A 3GVXA 3COSA 2PKQO 1EFLA 4CM1A 5ICMA 1HYGA 3GNSA 3E9QA 4WK6A 3VH2A 4C4OA 1VL0A 3INGA 4DIOA 4WASA 4RPKA 4MKXA 4U5QA 1AXEA 1CQJA 2ZJ0A 1QKIA 3DQPA 1KVSA 3DHYA 1LBEA 2H1SA 2UV8A 5I7SA 1ZIDA 2BGMA 5A5FA 2HRBA 1QYXA 1HE4A 4BIIA 3S2EA 4FFRA 3FD8A 2ILTA 3DAPA 4BL5A 3JTMA 2GGSA 1DIRA 1G1AA 5K6AC 2BFAA 1PTJA 1EUDA 1IOLA 2Q2VA 1JVBA 2VZ8A 3JQGA 4E6PA 1KVUA 4WCDA 1LDBA 2BGKA 1A4IA 5LDGA 1DIBA 1PWXA 4IQ8A 2BD0A 5TSDA 4L4RA 1E7YA 1LC0A 3A9WA 7ADHA 2OBYA 1KEPA 3K2EA 1BWSA 2Q49A 2DBVO 3JQ7B 1PQPA 1KVQA 4PG7A 1EK6A 4MVJF 1SOWA 1KEUA 2CVQA 4GLOA 4CMEC 3ZNQA 3C7AA 1B14A 5K6AA 4DPMA 3DAGA 2Q2QA 4DL9A 1K6JA 1QSGA 1K89A 1A9ZA 1GFSA 1T2EA 4FN4A 4PZEA 4FFOA 2DQ4A 4GL4A 3QW2A 1O0SA 3DFZA 2VRCA 3ORFA 2DT5A 2ZATA 2FWMX 1DLJA 3G0OA 5I8WA 3FNGA 4OOFA 3E5MA 2NSDA 4OKNA 4M89A 3OECA 5G0UA 1ULSA 3P19A 4NBUA 3IC5A 1WMBA 2NUAA 1JAXA 2OGUA 4AL4A 1BXGB 1ISFA 3D4OA 2VTEA 3JYLA 4R1NA 1Y8RA 3ZW8A 1LNQA 4BB6A 3G17A 2VUUA 2WJPA 3ZU2A 4II2A 3GVPA 4JNKA 3ZNPA 1EVIA 4K6FA 3GLQA 2P91A 3I9LA 1HETA 1U7TA 4WJZA 1PWZA 2NQTA 3CSDA 4KMSA 3VVCA 1YB5A 1CWUA 4CMEA 3KSDO 4E5KA 1L7EA 3WG9A 4XKJA 2Y1OA 2VT3A 4M8SA 2PGJA 4HBGA 4R51A 1PZEA 3UW3A 4E2ZA 2V6GA 2JL1A 1H94A 3AM5A 4GX5A 4BO2A 5FEUA 3WLEA 4J1NA 5KIAA 3WX0A 4R5MA 3VPGA 2UDPA 1XQ6A 5K9ZA 4J7CA 5CAEA 5JW6A 1BXKA 4K28A 5JFOA 2ZB8A 4MVJM 4ZD6A 4YJHA 1NP3A 4DC1A 4BNLA 1TXGA 3KYDA 3PXXA 4AFNA 3T7EA 1Z74A 1WDLA 5GY7A 4AJIA 3Q0EA 4TRNA 4W9NC 4BNNA 3EVTA 2FN7A 4XQGA 4R01A 2X86A 1ISHA 2X9VA 1Q0LA 1KVRA 3IL2A 1JKJA 3PGJA 3I9NA 4FFNA 4DLBA 1UP6A 4MDHA 2RCYA 1UZLA 3EW7A 1BVRA 4WGGA 1ZUD1 2O2SA 4RJTA 4L74A 4E5YA 3DXFA 4NFSA 3WICA 2EW8A 1FF9A 5ICSA 2VQ3A 4N5MA 2R00C 2QX7A 1LDYA 4B3IA 2AXQA 4INAA 3FN4A 1LJ8A 1WPQA 4MP3A 2PWZA 4RORA 4BNIA 2FZEA 1NQTA 1Q0QA 5L4LA 2V65A 3QRWA 4RF2A 2NNLD 3CPSA 1H93A 1TT5B 5A5EA 1U3TA 2GCGA 1E77A 2ZJ1A 4RPLA 1QLHA 4FFLA 4Q3AA 3ZWMA 4EI2A 4MOWA 5IZ4A 2WD8A 4HV4A 3WYBA 4YXFA 1PS9A 4BO4A 2AG5A 1NVTA 5C37A 1GDHA 2B4RO 3PDUA 1OC2A 3F1LA 3EAGA 3L0DA 2ZQZA 1HDYA 1PJ3A 5B4VA 2Z1MA 3ZN2A 1PL8A 5TT1A 5JMWA 1ENYA 1GYPA 1I3NA 2JCYA 4ITUA 5CDSA 1JN0A 1HDGO 3BMNB 1Q7BA 4AG3A 1HT0A 5HS6A 3L77A 1XCBA 1JTVA 2E4AA 5JCXA 3JQBA 4MVJH 3RIHA 3O03A 2HKIA 2GN6A 4B4OA 5EESA 4YBZA 4IDEA 3MJ4A 4AVYA 4IDFA 4RCVA 1W73A 2B0JA 3AWDA 4E21A 2Z95A 1DRVA 3PEFA 3M1LA 3PHLA 2Q46A 5DCUA 5LDHA 2Y0CA 2ZIZA 3GMSA 3K2BA 1FDVA 4CV3A 1GV0A 2CZCA 3CZRA 3D5QA 4RGBA 2PZKA 1NHGA 3WGGA 1HYHA 4CQMB 1P0CA 1DFHA 3FHLA 4Y9DA 3GUYA 4I5FA 4XGNA 3I9JA 3MTJA 3OQ6A 5I7VA 3ANLA 1C0KA 3VPFA 5JDIC 3RQSA 2HMVA 1XR3A 4NI5A 4TRMA 1ARZA 3MJSA 2HDHA 4MIOA 3QWAA 4ZQEA 4EJ0A 4OSPA 2VWQA 2O4CA 1ZH8A 3JYNA 1G0NA 2NTVA 4ONEA 3NV9A 1MG0A 4GH5A 5F5LA 1P1IA 3UH1A 2YJZA 3RUIA 3TFOA 4UUNA 4RVSA 3WNQA 2DUUA 3KYCB 2BI7A 1CEQA 2I76A 5DP1A 1DJQA 2B83A 3UFXA 2IEBA 1SC6A 1MB4A 3BMOB 3EZLA 1PL7A 4KWHA 4CQLA 1GR0A 1YWGO 2NU7A 2E48A 5TJ9A 5HA5A 4CL3A 1X14A 2W2KA 4U0KA 4MP6A 3PTZA 2HJRA 3HN7A 4N7RA 2C7VA 5CPFA 3MJCA 1T24A 3CXRA 1T2CA 1PJLA 4CQMA 1BW9B 3VZPA 5I9MA 4FDAA 2P5YA 1HYEA 1PU2A 2ZCUA 2VCYA 4RPJA 5IDYA 3VKUA 2Q4EA 5C7IO 4UEKA 3C3XA 5DT9A 2OORA 4G81A 4WLVA 5AXBA 4P8RA 1Z7EA 4P4LA 4U6SA 2A4KA 4GI2A 3PWZA 5AXDA 1LRLA 3OEWA 1AGNA 2Q99A 1T1SA 1E3LA 4N18A 3BHIA 2RHCA 4JX8A 4PLZA 3SBOA 4OL9A 1JU9A 1YQXA 4W99A 2GLXA 3A14A 4XA8A 3PJFA 1B2LA 1E3IA 4MVJG 3WGHA 1XKQA 1U5AA 1LQUA 3GRKA 1F8FA 1Y7TA 4PLPA 2XAAA 5EIOA 3OQ1A 1GYRA 4YJGA 3JQEA 2Y1FA 4YJDA 1ADBA 3GK3A 4IS2A 5BSEA 1KEVA 2RBEA 1ISGA 1MFZA 4ND2A 1SMKA 2FP4A 2RAFA 2ZYDA 1JA9A 3GHYA 1PL6A 3ETGA 1NVGA 2P68A 3WJAA 1LDNA 3GUCA 1ML3A 1SBYA 1UP4A 3HQ4O 4DGSA 3EDMA 1LLDA 3B1KA 5CG2A 1XG5A 2X22A 5BSGA 2Y68A 2D5CA 4Y6SA 5ENVA 4EDFA 1LSOA 2VOEA 3Q9NA 5KOIA 3TOZA 5B4UA 4NK4A 2NTJA 4D46A 1LLUA 3I3OA 4DLAA 5LC1A 3TDKA 1PGJA 5L4NA 3O9ZA 2CVZA 4JN6B 1OMOA 3RU9A 2UUPA 5LCXA 4A73A 4BNXA 3L4BA 3DFUA 2O48X 4Q9NA 3ETEA 4D0SA 3BA1A 5JO9A 3H9UA 2DFVA 4CM8B 3EK2A 4GAEA 5I7EA 4R16A 4A2CA 2Y93A 4ILKA 5CEFA 4Z9FA 2B36A 1YE3A 1WXDA 3JQ9C 5DBGA 4CLDA 3ZU3A 4BKQA 1I3MA 4MVJE 5L7TA 3KTDA 1QP8A 2VNSA 4GVXA 2DC1A 3I4FA 4W4TA 5G4KB 3B70A 3GZNB 5A4DA 2CF6A 2LDBA 2VYND 3RU7A 3DZIA 1U3WA 3I9MA 3P7MA 4KOAA 3RFTA 5JC8A 3FNEA 2ZTLA 4D3FA 1PJQA 1HZJA 3HG7A 4E5PA 2EF1A 4JLWA 4L75A 4Q3EA 3HDHA 4TSKA 4WNIA 1KOLA 1E6EA 4PGFA 4PRKA 1DLIA 4HFJA 1U8FO 2W98A 1CQIA 3S8MA 3UCEA 3UCXA 4DMMA 1U3VA 1A7AA 2QQ5A 1N92A 4UVIA 3FPLA 4NFHA 3NAQA 4IGEA 1BSVA 2EKQA 1O5IA 3D4NA 4NMHA 3WQRA 4DRYA 4YWJA 4I9NA 1VSUA 2J5KA 4J3FA 3JYOA 3F3SA 3W8DA 3E1KA 1PJ4A 1O89A 3FR7A 4GPD1 1ZZEA 4L4SA 5DCWA 1Z73A 4GMFA 2PD4A 5G4KA 1Y8QB 4A03A 4D42A 4L8VA 4XQEA 3WLFA 1C14A 4FJ0A 2QZ9A 4JBGA 4CM7A 4YJHB 2PD3A 3KYDB 5L7YA 2WD7B 2GYYA 2X6TA 2I66A 2O7QA 4ZGWA 3IUSA 3DTYA 4D79A 1DDOA 2AMFA 4B4UA 4DYVA 3RAJA 4URFA 1RPNA 4YYZA 2PV7A 4FC6A 4UREA 5CDGA 1G0OA 3QWFA 2VN8A 2VT2A 4N54A 1EBFA 3WMWA 2HRZA 2OUIA 3K6JA 4K6CA 4RO0A 1LSSA 3D5TA 3L6EA 1I36A 5COQA 5JNLA 1NX6A 4J4TA 1PS0A 4F46A 5KJ1A 1ZBQA 3GN2A 4LN1A 3VOSA 4MINA 1A27A 1P1JA 2XXJA 1LLCA 4GGPA 5EJ2A 2VZ0A 4CM9A 1NYTA 3LQFA 2AQ8A 4AJ2A 3DOCA 3WYEA 3U9LA 4JBHA 3AY7A 1YXMA 1I2BA 3ASUA 1RM5A 1RM4A 2IDZA 5IZCA 3F5QA 1HTBA 1EFKA 1VKOA 1QV6A 4EUEA 5JAIA 3HE3A 2X5KO 4B79A 3AI2A 2UAGA 4P22A 5F21A 1SEPA 4WCFA 1JWBB 3WWYA 2Y1GA 4NBRA 1NNUA 4IJWA 4BGVA 4BNVA 4LK3A 3DZKA 1J5PA 5CG1A 3G79A 4O59O 3KO8A 2EKLA 3U4HA 5CEEA 3VTFA 3LC7O 2PGLA 1H5QA 3HDYA 3JQFC 3D3WB 3KLPX 3PLNA 4QXMA 4TZKA 3RUEA 4AJ1A 2O7SA 1NAHA 3WIDA 2DTXA 1ZJYA 2JJYA 4D3SA 4HXYA 1I33A 2HU2A 1Y9AA 2WE8A 1LRKA 1JQBA 5ES3A 2OMEA 3WDSA 4IINA 4ZQFA 3CEAA 4O0LA 3NTQA 5BNIA 3H6KA 3NTOA 5BNTA 4ZRMA 3VH3A 1P45A 2P2SA 3W1VA 4J16A 5TJHA 3DEYX 4RVGA 3ONEA 4NJOA 2AW5A 4E5MA 4CM5A 4QQRA 1LLQA 2X9GA 1HDZA 3FF4A 3DBVO 1H0KA 1EQUA 9LDTA 1Y5MA 4ALJA 5G0SA 2YV1A 3PFFA 3I52A 4XIYA 3KVOA 4A26A 5JPIA 1JKIA 4WOKA 4J4BA 2CDBA 3M6IA 2X0NA 3TJRA 3ROKA 1X7GA 5IFLA 1U9JA 1I2ZA 1IE3A 1MG5A 1BG6A 1W8DA 3DBRA 3JD1A 4CM4B 4OQYA 2D2IA 4TVOA 1XU9A 2OL4A 3I23A 2XF8A 2C5EA 2Y99A 4Z0HO 4XYLA 3V1YA 3R1IA 1DXYA 1EDOA 3O8QA 1WAMA 2CUKA 4FCCA 4HFRA 4PZDA 1B3BA 3DOJA 4BB5A 2G0TA 1QYDA 3OP4A 1PJ2A 3RJ5A 3PIIA 5BQFA 4MVJA 2OZPA 1S7CA 5U1PA 1MV8A 1H2HA 1RM0A 2RIRA 1ZNQO 1BTOA 1SAYA 4DPKA 4BNJA 5C5IA 4KUEA 1ZMTA 1C0LA 3VTZA 1B8UA 3UKOA 1EUZA 1PGQA 2Y1CA 3QV1A 3DMTC 1V8BA 3MOGA 1G6KA 1P1FA 3PJDA 1AHHA 4BOYA 1ZEMA 3BIOA 3GVIA 3UF0A 4IZIA 8LDHA 5G0VA 1I3LA 2ZYGA 5IG2A 1TA4A 2DKNA 4UUMA 3VPXA 1ZJZA 3KRTA 1UAGA 2D59A 1ZFNA 3C85A 2IODA 3QSGA 1P0FA 3ZNNA 3JQ6A 3M1AA 5F1KA 4BV8A 4J7XA 3OM9A 4XDZA 5JAZA 4QT0A 4FGSA 3SLGA 4CM4A 1V9LA 4GWGA 4P4NA 2BGLA 2Q1TA 2IZ1A 4J0EA 1H6BA 4FQ8A 2YYYA 3AOEC 2Z5LA 4IBOA 4YEDA 4IDBA 4PRLA 3ZWVA 4AJOA 4D44A 4EUFA 3ASVA 1I2CA 2O3SA 4IQ0A 5COBA 3H5RA 4RZHA 4ALKA 4AJ4A 3H3FA 3HDQA 2J3KA 1XDWA 1UAYA 1EVJA 1YB1A 5GZ3A 5HM8A 2WYUA 3E5RA 4NBVA 3ON5A 4I5DA 4BQRA 2X5OA 4U0JA 3WGIA 1MA0A 3BXXA 1EE2A 2P5UA 2WEKA 2B37A 3GDGA 2ZTMA 4OJNA 4NIMA 2X0IA 5L3ZA 3RC1A 3AJRA 4HX5A 1XEAA 4S3MA 1ONOA 3VDQA 1IULA 1TB4A 3FCOA 3FTPA 2X7HA 1UXJA 1NQAO 2GZ3A 1UXIA 4UULA 2Y1DA 4LRSB 2QYSA 1NR7A 3W6ZA 3WGQA 4IDGA 1VI2A 5JCJD 3R0IA 3U0BA 4PFJA 3ZHZA 3FI9A 3H7AA 1CRWG 3AUTA 1MP0A 1YO6A 3F9IA 1QMGA 3KB6A 4GBJA 1I10A 3JV7A 2VYVA 4FJ1A 5CHEA 4YAEA 1F12A 3W4IA 1C1XA 1VL8A 2C54A 5ENDA 4XCVA 4CMIB 1D7OA 5T57A 2POQX 3TRIA 1BDBA 1J49A 3E48A 3NUGA 4IGFA 2YW9A 1U28A 1XSEA 3LT4A 4Y6PA 3I6IA 4NFYA 2X9NA 1SEVA 3BMQB 1NM5A 3Q2KA 2ZK7A 1V3UA 3RVDA 5K0ZA 1HEUA 1ZW1A 4WLNA 3WQSB 5L95A 1HDCA 1W0CA 1DFIA 1L7DA 4NU5A 4RVDA 5JSFA 3S55A 1UDAA 4O6VA 1Q2XA 4YA6A 1NWCA 3CINA 1R66A 1VRWA 1DC3A 3ZWBA 3Q11A 2YQ5A 3SC4A 1K6XA 1P9LA 4JIGA 2EERA 4CMAA 2DM6A 3OHSX 4YAGA 4HKTA 1V35A 3QWIA 1YRLA 4BNKA 1P33A 1ISMA 3DO5A 4GQAA 2YV3A 2BMAA 1X7HA 3FWNA 4IZHA 4D0RA 1TLTA 4CMBA 2EHDA 1E1KA 1H9BA 3IS3A 4JQCA 1W6UA 2J6IA 1KC1A 2B4TO 4MVJI 3KV3O 1UDCA 1TI7A 4GWKA 3WOHA 3ZWWA 1SB9A 1WDKA 4DYDA 1E6WA 4E2XA 5DNAA 2NU9A 3DAFA 2VHYA 4R1UA 4L4XA 2B4QA 1NR1A 2J8ZA 5IN4A 4AJPA 1E3SA 3A1NA 1GZ4A 4MIEA 4DXHA 3ZWXA 3DBLB 2C2YA 4XYEA 1B0AA 3PYLA 1F8GA 4A27A 1A72A 4LGVA 4RDIA 4OQZA 4TROA 5DZSA 1KYQA 3O38A 4BUCA 1FK8A 4OM8A 1DC5A 4GGOA 4DVJA 1RKXA 1VE9A 3VC7A 1Y5RA 3GRPA 2X58A 5L45A 4WLOA 3H5AA 3RC2A 1DSSG 3ULKA 1YOVA 2WTBA 3DWFA 4II3A 5B12A 1V0JA 4BGIA 2ZYAA 3PHHA 3QJ5A 1GY8A 1DC4A 1C0PA 5MDHA 5KVSA 1N2SA 1A5ZA 1B8PA 1QV7A 1YJ8A 1Z75A 2VYNA 2ZTVA 1XWFA 4M55A 3KYCA 3DB2A 4W7HA 3TZ6A 4J1TA 1GD1O 4L9RA 3GNTA 1O94A 1E6UA 1GEEA 2FPGA 3FSRA 1PIWA 4Q3BA 1DHRA 3JQAB 5B1YA 3GFGA 1U4OA 1ZEJA 4TRRA 2D5AA 3KEOA 2W2LA 4CODB 4YJFA 3L6OO 2FSSA 1QORA 3F6YA 4J2OA 4AJLA 1X15A 1HL3A 2X23A 1T2AA 3MJVA 4BNUA 4C7KA 4J49A 3V1TC 3QQPA 3WYCA 2B5VA 2VRCD 2AHRA 1TT7A 3FPCA 4XJSA 2GUGA 4L73A 4TQGA 1WVGA 3LC2O 3FRJA 4S1VA 5KNLA 2C82A 1E3EA 1M67A 3K96A 3BTOA 3HFSA 3TQHA 1DC6A 1SOVA 3IMFA 2DTEA 4B4VA 2O3QA 3K5PA 4G2NA 4IMRA 3ZHXA 5KJ6A 4KUGA 3C7CB 4FPXA 5JE8A 4PVCA 4BMNA 3IKVA 4LMPA 2GD1O 1EE9A 3C24A 4TMFA 1ENPA 3OJ0A 3VH4A 3GH3A 5C7OO 4YJGB 5ER9A 2HLPA 3PK0A 4XYGA 3WGTA 3OFSA 3KXDA 5KJEA 3R3SA 1T25A 4J90A 2F1KA 4BS9A 4GSKA 1CETA 1DB3A 1JDJA 4BNYA 3DZHA 3QY9A 2OP0A 1EQ2A 5JXWA 2GZ2A 2GRAA 3OSUA 3CE6A 5JS6A 5ITWA 1FXSA 3KM0A 4CLXA 5JLAA 3HSKA 4LSMA 2EWMA 4RVUA 4BGEA 4CLRB 1UZNA 1XIVA 2Y0EA 4J7UA 3BHJA 3RUDA 2HSDA 3S2IA 3HB4X 4XWYA 1KS9A 5A06A 2PGDA 2X1HA 3MCVA 4KDEA 4UEOA 1M6WA 4CLOA 3DBRB 4XR4A 2Q1WA 2NLOA 2FRDA 1NPYA 4IJUA 3GEGA 3LVFO 1KIFA 4CM8A 3ZU4A 3QVTA 1GQYA 4EZBA 3ITDA 2GZ1A 4YPOA 5JY6A 2PD6A 1DIGA 1MXFA 1F17A 3B1JA 1IUKA 1Q7CA 1UJMA 1VKNA 3JQCA 3PRJA 2GN8A 4XB1A 1YJQA 2NV6A 2CNBA 3E82A 1P77A 3BMCA 2EJWA 4YAKA 3MEQA 4PVDA 4YDRA 4YAIA 4WKGA 3U5TA 4PLGA 1SCUA 3HNPA 1OAAA 1UP7A 3ZNOA 3P2YA 1IYZA 1U1IA 1GCOA 3EC7A 1CDOA 2NVUB 4YVFA 4FJ2A 1ZK1A 4O5OA 3UAGA 4ZHSA 3Q6IA 4YB8A 3D4PA 5KJCA 4IQGA 3OIGA 3EY4A 1Q1NA 3BYZA 5CFZA 1XYGA 3WWZA 1ENOA 1VPDA 2PZJA 4WLFA 1MUUA 1LSJA 3VAZA 2G82A 1E7WA 1N8KA 2B5WA 4IIVA 5CEJA 4HADA 5FYDA 4BKRA 2Q1UA 2YFHA 1SNYA 2AEJA 4FFMA 4QO8A 3ROQA 3FNHA 3GOHA 1A9YA 3JQ8A 3OEYA 4DPLA 1T4DA 3PIDA 2VHVA 3WSVA 1WP4A 3GQVA 4JBIA 5EN4A 1LA2A 3QVXA 2AEFA 4DQXA 3HFGA 5AQ1A 2HAEA 3D7LA 1H2BA 5DULA 4BHTA 2X4GA 3E18A 4ALLA 5TGDA 1PX0A 4GVLA 3ZV4A 8ADHA 5JDCC 4EJ6A 1UUFA 3PP8A 4ND1A 5BNFA 3IP3A 4DREA 1IPEA 3E8XA 2FR1A 2YV2A 2DUWA 2V7PA 2YHIA 5DDIP 3PHGA 3R3JA 5THKA 3VPHA 2NVUA 1RYEA 3NGXA 1IPFA 3AOGA 2BELA 3H9GA 3WFJA 1HSZA 3OF2A 2Q45A 3K9QO 5H81A 4CMGA 1BDMA 4J4HA 3KUXA 3LZ6A 4R5HA 2A35A 1LU9A 2RH4A 4RVHA 4XD2A 3UGKA 4HWKA 4MKRA 2FZWA 4W6ZA 4BQPA 1H6CA 5THQA 3GC6A 4RPHA 4QTZA 4KQWA 2DTDA 4CV1A 1U8XX 1DIHA 1N5DA 1E92A 2HMSA 3CZMA 3PDJA 2IXAA 4D41A 2HK9A 3TZHA 1NTOA 3K30A 2C59A 2V6FA 4DC0A 2DBQA 4RQUA 3B6ZA 3IAHA 3ICCA 4BO0A 1DRUA 3JD4A 1SB8A 2RHRA 5DBIA 4CM9D 1P44A 2DFDA 1GUYA 3MTGA 2NU8A 1MC5A 3NJ8A 5TNXA 2YZ7A 3D64A 1Y1PA 3DZFA 4DWVA 1XLTA 1T1RA 2C07A 4ND4A 4XQ9A 3BMQA 4N5LA 2ZQYA 3I4CA 3RFVA 1GV1A 3PZRA 3CUKA 4R68A 4GMGA 1P31A 4DUPA 5U9CA 1WZIA 4E5NA 1JWAB 3WGOA 5DOZA 4KP7A 5A02A 5IF3A 3FR8A 3H3JA 3VH1A 1FJHA 4HP8A 1W4ZA 3TWOA 4DQVA 4I08A 1N9GB 2GDZA 3LF2A 3T4EA 3H9EO 5KKAA 5AYVA 3KHUA 3F5SA 4B7UA 4NG5A 2ZB7A 2E37A 3ZWYA 4QECA 2Q4BA 1RJWA 3ENKA 3ZU5A 4FW8A 4RQTA 4IPTA 4QUKA 1HE5A 2WWRA 1P1HA 3SJUA 3AU8A 4OXYA 4R9RA 2HK8A 4CJXA 3LC1O 4B7CA 3HADA 2YDYA 5B4TA 3HJAA 2YY7A 4YTEA 1HF3A 4JP3A 3DZJA 5IAAA 4RLHA 3H2SA 2ZTUA 1NFFA 3QVWA 1SZJG 1VJ1A 5JY1A 2EKPA 3I83A 1PR9A 3PFWO 3G1UA 2Q3EA 1N1EA 4GKBA 5TC4A 1ZMOA 1JKFA 3IP1A 4PIVA 1R4NA 4BKUA 3AI3A 1DO8A 2EP5A 3GMDA 2DU8A 3GN1A 1B8VA 3CMMA 1QXSA 3PWSA 4BNZA 4OOEA 3PQFA 4BO1A 3NEPX 2Q50A 2I6TA 3AM4A 4YACA 4P4GA 4FSHA 4UAGA 3PI7A 4RPGA 2FR0A 3PJEA 1U4SA 3ADPA 3O8QB 1MXHA 4MJLA 2V6BA 1YL5A 5T5QA 2PFGA 2TMGA 1N7GA 1PJCA 4EYEA 2HJSA 2VWGA 5U4QA 1HLPA 1M2WA 3TF5A 3QWHA 2QHXA 3E6AA 1QLJA 2P9CA 5JO0A 4QEDA 4E32A 4O1MA 5BT9A 3ONDA 1WW8A 3VZRA 1O95A 2I3GA 1JAYA 3QWBA 4IS3A 3WBFA 4EW6A 3UOGA 3U09A 4Z0TA 2NU6A 3NT5A 4BMSA 4WEQA 5TX7A 4Z9XA 2JFGA 3OETA 3ZHYA 1T26A 3F47A 1E3WA 4I1IA 2HMUA 4PLYA 3JD2A 3GPIA 1P3DA 2VHXA 4W7IA 5T8KA 3PJGA 5KVQA 2BLLA 4BKOA 2JAHA 3RJ9A 4R3WA 3KZVA 4RV9A 4B7XA 1DFGA 4CPDA 1E7RA 4PG8A 3ZWCA 2EGHA 4ZJUA 3WNVA 3PZBA 3I5MA 3KYBA 4CMKA 1P1RA 3I6QA 3OJFA 4FIZA 5AXCA 4J43A 4TWRA 4E2WA 1E1NA 1U5CA 4LRTB 3U4CA 1I8TA 4LVCA 5CP8A 3SX2A 1C0IA 1J4AA 4E0BA 4TKMA 1K3TA 2I3AA 4CM3A 2LDXA 3EVNA 2YDXA 3OA0A 4BMVA 2B69A 1R0SA 1NPDA 3IUPA 4E30A 1YONA 4Z6KA 3NT2A 3AM3A 4IIUA 3RSHA 1GPJA 3ZZNA 1LEHA 2GR9A 3GA0A 5F1PA 1E1LA 4ZICA 2PNFA 4BNHA 1NFRA 4YQZA 2P9GA 4L76A 1LQTA 1DRWA 3IDSA 2VZ9A 3C8MA 5BSHA 3I9KA 3LLSA 3WTCA 1GZ3A 2VYVD 2GNAA 3OBBA 4B3HA 1UXGA 3HB5X 1DAPA 3I1JA 3KLMX 3QHAA 5A04A 4CLRA 4FOOA 4BNFA 4FC7A 4EEXA 5IDWA 3L6DA 1LDGA 5A9RA 4WNCA 4Y8VA 4RF4A 4CR8A 2OO5A 2OXIA 2Y1EA 4DTIA 4OAQA 4A10A 1GQQA 1VJTA 5HS4A 1LTHR 1QRRA 3TNLA 4CMIA 3DR3A 2VOJA 1JVSA 5H83A 3QVSA 1T4BA 5ADHA 2E82A 2Z1NA 1S6YA 4KZPA 3DBHB 5TRTA 2CDCA 2QW8A 4JROA 5JBIA 4UVDA 5JAQA 4LVUA 1ONPA 2I65A 3EYWA 1UXHA 2WDZA 2O3TA 1C1DB 2B35A 3H4VA 3V2GA 3LT0A 1I32A 4ALMA 1T2FA 1ZXBA 4XQCA 3W4JA 1F0YA 5A05A 2YFQA 2BFPA 6ADHA 1BRMA 4JK3A 4ALIA 3VVBA 3ANMA 3NYWA 3DHEA 4BNMA 4I5GA 1ISJA 2IYOA 3U3XA 1PQUA 1X7DA 1HZZA 1Z82A 1UZMA 4J6FA 1GEGA 1VL6A 1ZK3A 1QYVA 3OJLA 2D4AA 4LSWA 5BSFA 3JYQA 5I9NA 2YUTA 2ZCVA 3RKUA 5ILOA 2CDAA 1GQ2A 2I9PA 4FGWA 3X2EA 4RF3A 4NHEA 4YT2A 2Q2WA 2C5AA 3UICA 4ZRNA 3OMLA 1BHSA 2WE7A 5CDYA 2C7GA 3SVTA 2BHLA 3RBZA 2JHGA 3ST7A 3DBHA 4FR5A 2OBNA 3JQ8B 2PTGA 2XOXA 4OXNA 2I67A 2FPPA 3B1FA 1C1DA 1VLLA 3F1KA 2FMUA 2NVBA 2EP7A 1GTMA 1NAIA 4Z0PA 1GUZA 4LCEA 1V3VA 2EV9A 3U49A 3GR6A 4R9SA 4Y98A 1I30A 3M2PA 5GMOA 5KTKA 1O9BA 3KOUA 5JYDA 3RUFA 1JW9B 2P4QA 1U7HA 2PK3A 1GU7A 4F6CA 4F3YA 2H6EA 4J2HA 4BO9A 5T8KC 5L7WA 2HO5A 3BMNA 2WYVA 5A3JA 3NKLA 1I3KA 4XGIA 1X0VA 3RI3A 3AU9A 1KERA 4PCVA 5I9LA 5H82A 4JXKA 2VUSA 1YDEA 3IKTA 3PQEA 1GAEO 4O63O 4DIBA 4YR9A 3JQAA 3DZBA 4L0QA 4PG6A 1DEHA 4HFMA 3TPCA 5AOVA 1CJCA 5TT0A 4YJFB 2DPGA 4Z9YA 1AE1A 4YRBA 1KETA 2EJVA 3GZ4A 3VHRA 3FWZA 3A06A 1ISIA 4R1TA 3U62A 4BO7A 1XELA 2GASA 3PQDA 5GZ6A 3VPSA 3ZV3A 1PS8A 3NGLA 1LI4A 1B26A 1U3UA 1ZSYA 1EEHA 5F3RA 1ZCJA 1ONNA 3GVHA 3UN1A 2I99A 1M6HA 2C2XA 4QFCA 1M76A 1YKFA 4R69A 2PA3A 2WD7A 4IM7A 3MJTA 1J6UA 3TZKA 4JCOA 2GERA 9LDBA 2BH9A 4WECA 4KDFA 4MIYA 4BKPA 1D8AA 5DN9A 4E2YA 3ZV6A 3UUWA 4CLHA 4ND3A 3O26A 2JCXA 4XRRA 1EVZA 1PR3A 4E13A 4Q39A 3NX4A 3GG9A 4AJNA 1QR6A 1R15A 1FDUA 5T6BA 3E9MA 4GX0A 1N1GA 1NQOA 4ROSA 3WR5A 4BV9A 3ZCXA 2OP1A 3JQDA 2W2LD 4IXTA 4TZTA 1NASA 2W2KB 3DHNA 4RDHA 2PH3A 2PZLA 1J0XO 3AI1A
chains in the Genus database with same CATH superfamily
2ZSIA 2WTXA 1SXJB 2SKDA 3EXEA 3GLSA 2DHCA 4HLDA 3REFA 5LOVA 2ODQA 4BQOA 3WHIA 5CFMA 4YQYA 1CYDA 5C81A 1BGXT 5ARBA 3FSJX 1J24A 4X20B 7MDHA 2BGGA 3CRVA 3IBCA 4HQ6A 1ULTA 3UY4A 2QI9F 2IZ0A 4TVBA 1S1CA 1JBKA 1KAGA 2FSIA 2D2FA 3JWJA 1M1NB 3L8YA 2A92A 2D5LA 3WK6A 1FDTA 1JHUA 1VSVA 2GBLC 3LE8A 3TOXA 2WC1A 3IGFA 1TCVA 5D3ZA 1SBQA 1D4FA 4RMHA 2H5LA 1CE8B 1CUBA 3RK4A 3GY0A 2I2BA 2JIDA 1SG9A 3TEJA 1UK8A 1LLFA 1QK4A 2GN9A 2PANA 4FR0A 4P3YA 3TCNA 3TQQA 5C9ZA 1G8KA 2ECOA 1H0SA 2D1YA 2ZYHA 3MERA 1X6VA 1XEFA 2OLEA 3NETA 4LTMA 3BS4A 4M86A 2A0KA 2O1XA 5ITVA 1UFRA 3G2MA 3RUHA 1PNRA 2CL6X 2C58A 1K0UA 2OCLA 5EAIA 4BNDA 4CV2A 4RSRA 2YVKA 4XJTA 3NDRA 1NVWQ 3KEQA 3X1ZA 1NXSA 4KYVA 1CJBA 1ENZA 2DSTA 3FH0A 4WZAA 3CVWA 3LYAA 2Y0BA 2P2NA 1SZDA 3QGMA 1HO3A 4NX2A 5LL6P 3QEJA 3QPWA 1GG2A 1J2JA 1IH8A 2F4VB 2Q0QA 4NS1A 4ON9A 1GSIA 3WGZA 4C1BA 3MWEB 4KV9A 4RZXA 1R27A 1U1GA 2PO7A 5JSHA 3DOOA 2GMWA 4FYMA 1UC5B 2AFIE 3WYDA 3MSXA 3RT9A 5L53A 3UFBA 1E1QA 1W6RA 5AVSA 3W5HA 2IJGX 4B3FX 1XJCA 3IA2A 1FDWA 2DGDA 3A1TA 3FYTA 2XB6A 1DKNA 1M1NA 3P20A 4NDNE 1QTNA 4NE9A 4Z9AA 4HF7A 2RIPA 1C4WA 3QA9A 4UU8A 5E4TA 4CUZA 2CMKA 3E3MA 5C1PA 5DTEA 1C7EA 3G3EA 4B32A 1E2LA 1HORA 4DSOA 2G28A 5LDDC 2IK8A 3DMYA 3MBKA 4KQXA 4QTYA 1I4LD 4HAVA 1KOJA 4R54A 4DY6A 2ZUBA 1PZFA 3PF9A 2K87A 4PLTA 4CEJB 2NYAA 2R3SA 2VSYA 4JKIA 1BGWA 3CG4A 1YVRA 1ZXLA 4UZEA 1J2TA 1TO1E 1KVTA 2HMWA 3CT4A 2R1ZA 4QODA 1J00A 1RCFA 4EKDA 3AV0B 5JDCA 3K70B 1ZISA 5FI5A 3RLIA 3LF1A 3RU2A 3DC2A 1HA3A 3W78A 1XYYA 4KJXA 4XB2A 3GUHA 5EXPA 4D9FA 3SVLA 1VGQA 2IEDA 3GZNA 4Q9DA 4BO3A 2R25B 1JR4A 5LU8A 4DCUA 1QH0A 2CLOB 5BPFA 2YHIB 4ZKEA 5KYYA 2XCRB 3H5NA 4ZO4A 1R16A 5FF9A 3EVGA 2VXBA 4J0QA 3DPIA 3GYBA 5KKNB 2JFFA 2CLLB 1K8RA 1W88B 5HTOA 1KEWA 3P4YA 3OQBA 3PSAA 2VAWA 4FT2A 5EXEA 3JVEA 2UZIR 3AOEA 4MQEA 1TU0A 2MR5A 2QXTA 2VNKA 3JQ7A 4QDTA 4TKUB 3MZ0A 3KR0A 3UJ8A 1XMXA 1XZMA 4H1TA 3ZR4B 1TIBA 1VP9A 5ER6A 1A8UA 2OLJA 3PGKA 2HD4A 3QUCA 1UR5A 3SC2B 3T4XA 3BK1A 2XDAA 1X42A 1SBHA 5K0LA 3ENNA 3CLSC 4FOSA 2O2YA 4G5FA 3WAKA 4EUHA 1JFLA 5CDUA 1U81A 4FYKA 4MMYB 3C5VA 4WX2B 2DFNA 3C1AA 4U6NA 4J16C 5BT8A 4YASA 2MSLA 4DMRA 4FEEA 1VE3A 5F2KA 4KQ6A 3HCRA 3H0KA 2AHOA 3TQFA 4G0XA 3ZI0A 1NW8A 1UKVY 5FPYA 2NM0A 4CDMA 4MARA 1UT5A 1GL9B 1GCGA 1FUUA 3VAYA 4LJ4A 1KAEA 2CKMA 2WK1A 1YB4A 2G09A 3AUUA 3ETDA 3I9V1 4K8RB 4M1ZA 1JDBB 4R40A 1NXQA 3FOBA 1JG2A 3U7QA 3EPPA 3L0OA 4MRSA 4WA8A 1NXPA 1E4VA 2C88A 1SUAA 3QNWA 4Q1CA 5LMUB 2E85A 1TIPA 3TW8B 4L08A 4QQKA 1BKSB 3WXBA 2WFAA 4O3MA 1NDQA 1J5EB 2CNDA 3KSUA 3RYCB 1QCZA 1IOZA 3ANYB 2EFEB 4L4UA 3TQSA 2IUTA 3SCZA 3L9WA 1J1IA 1ZIPA 1RLJA 3ESBA 4XJXA 3MMPA 4JYBA 2OZLB 2PO5A 2E1PA 2WDPA 4O4JF 5AI5A 2HTEA 1EX6A 3H0CA 4IJQA 1S2GA 3QXHA 4P2BA 3WLNA 1N77A 2CF5A 3GRYA 1FFBA 3RYHA 1KBZA 3VZQA 4PNPA 1U94A 2HA7A 1BEZA 5J3JA 5C3MA 3LCMA 1WCIA 2VG8A 2ZR7A 1EQAA 5FWAA 5H80A 2ZB4A 3WIEA 1GP2A 1XZDA 1TEVA 2EU8A 2YN0A 4HTFB 3L7IA 1V43A 4I81A 2IDKA 2PLAA 2Z6VA 3DUFA 3UVEA 4ER0A 5D1NA 1NFQA 2IEYA 3S1AA 5KYUB 1JSCA 4PLVA 1X0XA 4Z4CA 4JJFA 2WUWE 1R8XA 3NRCA 5EPEA 3E9DA 2FPPB 3IRUA 1R8JA 3UPTA 5EHQA 4P54A 3PQ2A 1C80A 2ACKA 5DN6D 1KI9A 1OV6A 3H2HA 3T95A 3W79A 3AF2A 4PXSA 1D6NA 3A1CA 3NONA 1ITZA 1VIMA 1XNQB 1BVHA 4BQIA 4JR2A 1KY4A 4PG5A 5BR7A 5B2FA 5HJ5A 3IRVA 2C0CA 4G5HA 5B5SA 4XTCS 1WQ3A 2VNIA 3U1TA 5L40A 5IJAA 1HDRA 1NRJB 3RJTA 2NADA 4RK5A 3RS5A 2WA1A 3VKVA 3LKVA 3OJEA 1KP2A 5LIPA 3N28A 2JLQA 3FNBA 4WE3A 1N0WA 2W2NA 2FSUA 3RSGA 2GK4A 3P52A 1H9AA 1VJ5A 1CUWA 2C29D 2ZUVA 3GGOA 1K75A 3G0GA 1CKEA 3N2NA 3NNSA 4O4IF 2UZ4A 5BOVA 1XHLA 2JGIA 3LQ2A 5HBRA 2CD9A 1OLXA 2QMHA 1FQOA 4L2IB 2QQFA 5JMPA 3QU9A 1GYQA 2IIPA 3LLVA 4N7BA 5EINA 4ZO7A 2X0RA 1J09A 4G9GA 2AG6A 3PQ6A 4RVFA 1YIOA 4M0UA 3RARA 3LTNC 4I19A 1JQ5A 3EBOA 2ZVPX 4JSYA 5K0SA 4M53A 4MKGA 1SKYE 4I1VA 2I87A 4EHJA 1TMGE 3PRHA 3R5HA 2V55B 3UWOA 1I1NA 4XFJA 2BKVA 4I50F 2ZBEA 4MW9A 5CYFA 4QXAA 4QO7A 4CL2A 2ZXUA 1LSUA 3HO8A 4UTZA 2TMDA 1OF1A 1WZEA 1FTWA 1JEOA 1MD9A 4RU1A 3W7AA 2J0UA 1DXHA 4V1CB 1DRKA 4S35A 5JAMA 1VRVA 2P3QA 1IZ9A 4B83A 4K6KA 3A3YA 2P2YA 1QH8B 2I6QA 3H2KA 4HGYA 4J91A 5CJPA 3W06A 4C78A 3I9OA 4IO0A 4LMBA 1FDRA 1TUIA 2M2IA 3NT4A 4RF5A 1N0HA 1Q7RA 4K46A 5C7LO 4X64B 2HNBA 1JR6A 2A9RA 4NKRA 1NQ5A 3HLKA 2N42A 3A4NA 1FMCA 2IBMA 4XJVA 3TSCA 1H0RA 4CR6A 4FS8A 4NONA 2ZUDA 1P4RA 4PSVA 3Q3EA 4HGNA 3ABSB 1LZLA 1T0BA 3QEBZ 4WKOA 4RIIA 4JKYA 4B45A 1A7JA 3V8NA 1ZJ6A 1PWYE 1LRJA 5CVEA 4F2PA 1QYWA 1U6KA 3IV7A 3PCTA 3WJ7A 2J3QA 2J4CA 1K2VN 2DKFA 3CH7A 1GPMA 2ISQA 2PV0A 3IBTA 2J46A 3K9GA 2Q7DA 1OE0A 2EF0A 3SJ7A 3T1QA 3U3RA 4S1WA 1QAOA 4PN3A 5CYOA 3KXPA 3KE8A 4K9MA 3KSMA 5BN3A 1GOTA 3OAAD 1RBMA 4Q3CA 1H23A 1JJ7A 1NVFA 5BRNA 4K9DA 1YB7A 2C3OA 1WR8A 2X5JO 1QV9A 1SC4A 4A36A 2Z8YA 1SVUA 3P2IA 2NO9A 2PT7A 4N5NA 4C14A 1MQSA 1U9CA 1XK6A 4CKWB 4TWIA 4B3GA 2R8BA 4H7PA 4DMHA 1T13A 1G7CA 3BHMA 3DM9B 4DBVO 1JE0A 2CXOA 3FVWA 4OIMA 2HHHB 2APJA 1E0DA 3MELA 1E7MA 3AB8A 4A2PA 4B44A 2W6OA 4TM7A 3K8ZA 1PJTA 2PNJA 4PXAA 3C43A 3BTSA 3F96A 3VISA 3AF1A 1GPDG 2FEXA 2Y92A 4FOTA 2VO1A 1Y8CA 2JK1A 4Q1BA 5NULA 1O54A 4IIHA 3V8VA 1H3EA 3DDHA 2IL1A 1MOSA 2CSUA 3NAMA 3AUAA 4IAOA 4JR0A 2C00A 5EE1A 5BMVA 5GM2A 4QHYA 4AMGA 5IMSA 2OMKA 2QJWA 3KQPA 2WT9A 2XBLA 1XDZA 1IHPA 2I8AA 2WIBA 1XZLA 4B6GA 1RMQA 4IKPA 1JIUA 1I0IA 1QGED 2OM6A 5EMHA 2IXBA 1ZH6A 4N8SA 4ZDJA 3OU2A 4CIBA 1OOEA 2J30A 1UMDB 1SR8A 1KSGA 1F9AA 3T12A 3P1JA 3BMOA 3HDJA 1QG6A 1GCAA 3W5BA 2N46A 3BFKA 2ZZMA 3X1DA 1KMHB 1CX9B 2YYZA 1HDOA 1QBGA 4LECA 4RLFA 4XGRA 3HI6A 2IRWA 1Y8RB 1G5QA 4IKOA 2B2CA 2I22A 3WGNA 1XTSA 4W9RA 1DADA 3LBYA 1BMFA 1TM3E 3MIZA 3EEQA 4YRFA 4BNDB 1KY3A 1T91A 2V6MA 3PC3A 4BN0A 2IS2A 1N5IA 2WY2D 3U4DA 4Q4CA 1HE2A 3PSHA 4YJ2B 1SCIA 4PPNA 4O2RA 1E3JA 1PTKA 3TTXA 4HHEA 3OZGA 4PSUA 3VR5H 5HWSA 4DC9A 2HCTA 4B82A 3IKJA 1B7GO 4KGXA 1D3AA 1I2MA 3UNXA 2HK6A 1YZFA 4A6XA 1AUPA 2I5PO 1MNQA 1UPUA 2ONKA 4ZOBA 1C41A 2H8GA 1MAVA 3HN6A 1UBJS 3IURA 3UHFA 5BMVB 1FVFA 1N5LA 1PBNA 3H19A 3IE2A 4D5GA 1VCHA 1RJ9A 1LZKA 3EUEA 4O29A 3S2FA 2EGGA 2MYTA 3AHCA 4IUBS 4PGGA 5AJWA 1TO6A 3RYFB 5CDTA 3EQZA 4EYSA 1N7JA 5IBRA 2EFJA 1DKUA 3T5AA 2WZQA 3L7KA 1OAKA 2PZGA 1IQPA 3LCRA 4FINA 5C8XA 1NU8A 2AKYA 3C3KA 2C9YA 1BEEA 1E2GA 3F4BA 4LNHA 2P9EA 1LPPA 1BQ4A 5LQAA 3WNCA 1ZO8A 4HEA6 3ROEA 1QWOA 3OMWA 1X13A 5LQMA 2XRFA 1Z39A 3EVCA 4QDUA 3THWB 2ZRIA 2JC3A 4OGLA 3AMVA 4HLUC 3ZY2A 5ICGA 5L4SA 2QLNA 3HWWA 4HVCA 4U39A 2RB5A 4DXDA 4E15A 5DMXA 4QTTB 1HXHA 4X1OA 2P67A 4WNYA 3BXGA 3TXYA 5ICCA 4PYQA 1BO6A 4U7WA 4M38A 1G7RA 2SKCA 2P4EA 1VG1A 2A0XA 4MW5A 3CIFA 4GXTA 4TKVA 2ZAGA 1Y9DA 1D2AA 1ZM2A 2TMKA 3MUEA 4IDDA 4PGHA 5DM0A 5A7HA 3A1DA 3UHAA 2JAPA 4CXMA 2F43B 3NO4A 1IIRA 1CUUA 5BSRA 3I1FA 4OKIA 5DCYA 3W8EA 2YBEA 2NXJA 1P39A 2OCXA 4MKZA 4L5AA 3BB4A 4WPGA 2E18A 4RLSA 3V2IA 1JRLA 2WHEA 3A7DA 3UAVA 4EUKA 4B6PA 1CDDA 3MJFA 3K0AB 3OFVA 3DBLA 2MMGA 3E27A 3JD3A 4P31A 3ZD9A 3W2FA 5JRZA 5K99A 3CKYA 5ALGA 4TMXA 3IJRA 1MA3A 4IFIA 2PMKA 3Q7RA 2W90A 4BO6A 2GF0A 2FZVA 4GLLA 4Z2AA 5I3ZA 3C6KA 5FOXA 1EU1A 2ONCA 1JFVA 3UA3A 2HSGA 2RI1A 4UVHA 5IUJC 1E7QA 2XD9A 1NI4A 1EMDA 3GEEA 3E8MA 4PGMA 4TMWA 3NPMA 4HAXA 1EFUA 4XEHA 2CHFA 1AX9A 3HR4A 3N7UA 3THOA 3DM5A 3FMVA 5IASA 3EIUA 4LDRA 1AKQA 1NHWA 2DKOA 3L4SO 1DQRA 4FFPA 4IKEA 4LOHA 5I9TA 3ZKWA 5A4IS 4X24A 2WM8A 2JD2A 4ZOLB 3CYFA 3CSUA 4C3ZA 4BECA 2XT0A 3IKLA 2WTMA 3ESYA 1RXIA 2BF7A 2OV3A 2RC6A 1TM5E 3VHLB 4D99A 3UJNA 2O2GA 3FNFA 1IAVA 2EQ5A 4YXWA 2H11A 1AQYA 3S2SA 2V7QA 1VMAA 1FTSA 1KKLA 2R8PA 4QX6A 2WB2A 3WLAA 3MB8A 4FEGA 4EG8A 2PQMA 1BWQA 3BIXA 3D8RA 3ITKA 5K0EA 4Y2TA 3IIEA 5L9AA 2VTDA 4D43A 2M1XA 4AKEA 3EXIA 4XOIA 2JIQA 4Q02A 1ULAA 3SQXA 3A70A 3LQQA 3WQQA 2XADA 5E9WA 1XA0A 4RK4A 3M7IA 2EG5A 1WF3A 2NT3A 4UDNA 3TQOA 1JQEA 5TF0A 1HTWA 4ZT7A 4E08A 2JD0A 5FFNA 2BFDB 3LRXA 2BGWA 5LSAA 5BSKA 3UAYA 4JC0A 3MS7A 2XB4A 2XXBA 1SKQA 4E4RA 2FTKE 4MTCA 2AXNA 3WL5A 4E03A 3KKEA 1Z4KA 2V6IA 1Y8QA 3KPJA 3P2OA 5SYMA 2WR8A 3KB2A 4BRUA 5JH7F 3KETA 5ALMA 4JB0A 3LIIA 1LBTA 1XGKA 2CFSA 1ZH4A 4PLCA 4X20A 5LVAA 2VDVE 3PXDA 4OQLA 1XTKA 3T7SA 2X8AA 4EVIA 5SYNA 4CIVA 3V8EA 1E0JA 4ZFNA 2XUJA 3EF0A 3PDIB 5EWLB 5I51A 3ZJ5A 1JSLA 3DPSA 3RS8A 5J2TB 1RCTE 3FMFA 2XUIA 3EGOA 1R12A 1H69A 3CCFA 3O74A 3QOWA 4E3ZA 3AKCA 2B78A 2NO5A 3T7CA 1ECGA 3JQFA 3GNQA 3H65A 3V8QA 4EF6A 1P1KA 2QK4A 2CXNA 2HX1A 3RPEA 1B3RA 3O0DA 3SKXA 4CN8A 4RL6A 1LPOA 3R75A 3KSAC 5ALQA 3LWDA 1A4RA 3BH6A 1YVEI 4W9NA 4IQ4A 3ZWNA 2WICA 2WIJA 1D1SA 5CX1B 1LDEA 2I2FA 3K16A 2QAGC 3HUDA 5H4HA 2IA5A 5BVHB 2CWWA 4UEWA 5K1ZA 1Q11A 4YT4A 4QSMA 3IAFA 4TXMA 1WF6A 3EMKA 2GNOA 3AHFA 4TTRA 4Y6RA 5AJHA 5I7WA 4M54A 1OLXB 1GZ5A 2C8JA 3GRVA 3D7RA 3IQEA 3SHQA 1K8QA 2AQKA 3K6KA 4DMGA 2FPLA 2HIAA 2SNIE 2GPTA 4JJGA 3BG5A 4NQZA 1QK3A 4N3NA 5EXSA 4FEAA 3TD6A 3MJEA 4F9EA 3U7IA 4DSZA 1HQKA 5LUBA 2C5BA 2CFOA 2YWCA 3I62A 3JRWA 3PDCA 4DR4B 1HFEL 1VKHA 4B09A 4AY4A 1AS3A 4WCFB 3JQGB 2GKGA 4BFSA 5KMGB 1K5PA 3Q9UA 1CU1A 4QTXA 4YYEA 1H4SA 1R5JA 1YDHA 4CL8A 1NJ8A 4HAYA 4QHTA 4F8EA 4M1EA 3AHEA 1RZRA 2QRLA 5LXTF 4AJNA 4BJ6A 5G2OA 1PUXA 1T9KA 4XSHA 1EDZA 4BMXA 5K0CA 1IN6A 1RZVA 3GMIA 3GVXA 4ENUA 2DSNA 2EZ4A 4LE2A 4L85A 4F6RA 3VHXA 1YB2A 2XCUA 4WK6A 2Y27A 1VL1A 3NHFA 5LIRA 3INGA 1R18A 3QEMA 4HQRA 5JXHA 4OHVA 2A88A 4MCAA 3LXMA 1WPRA 2BVNA 4TYWA 4DDHA 2Q27A 1AXEA 4QT4A 3QPUA 3KHSA 2MIIA 1CQJA 2C0PA 2HJVA 1JG4A 2JGRA 2ZJ0A 4UFPA 4I9GA 3U0VA 3SNHA 4F97A 5ALOA 2QR2A 2UV8A 4LYJA 2NSLA 2WJZB 1OWMA 2XIQA 3A4TA 3G5TA 5CJJA 1C3OB 2HRBA 3TKAA 5DHPA 3OHMA 3V4OA 4LDQA 1P6UA 2XNHA 4FFRA 1R6BX 2FZ4A 6AT1A 1COWD 4B75A 1Z4QA 2YWFA 3FD8A 1CZRA 1GFIA 3L0BA 2V5VA 4GZ5A 1JFTA 3KQUA 3ESRA 2ILTA 2V8BA 4ZCSA 4A1OA 4BL5A 2GGSA 5AFSA 1II8A 3EC2A 4QJBA 1EUDA 1IOLA 2D00A 2Q2VA 1JVBA 2VZ8A 3JQGA 3LGSA 3OOJA 3U9SA 4E6PA 4WCDA 1P4JA 3OE7D 2R6AA 5IJWA 4NARA 5C7YA 4HYYA 5LDGA 2DLCX 1H8ED 1RADA 4CI0B 4HVLA 4PX5A 1LC0A 2W42A 5F76A 3S40A 2CJYA 2QTVA 2VP2A 3LM8A 1BWSA 2ZAYA 4LC1A 2W83A 3JQ7B 2X15A 3U26A 4F6RB 5CT6A 2BV3A 1WULS 1EFRA 1V5FA 4QDKA 2ZT7A 4CVNA 4FTWA 1UFQA 4UBLA 4QQFA 4TSFD 1QSGA 1T2EA 3IUEA 1GFSA 2CNLA 2YJ4A 3WBJA 3FHCB 1MQAA 1JZTA 1QG2A 2OEPA 2ZULA 4GL4A 3QW2A 3V1MA 1O0SA 3LKDA 2LP4Y 3ORFA 2DT5A 2FWMX 2M9MA 2E4YA 3G0OA 1JAHA 1THZA 1J0CA 3E9CA 3FNGA 2D6FA 4IJMA 4XM1A 1TUGA 1HQYE 4YQFA 3THYA 3C8DA 3QE2A 4QXRA 4RZQA 1HDIA 1ABFA 1J8QA 1NUAA 5E4YA 1KI3A 1E61A 1P6QA 3D6VA 3I9FA 2IHJA 4FR2A 3IC5A 1WMBA 2GZDA 5FUBA 3U7QB 2HFKA 2OGUA 1ISFA 3D4OA 1Q3KA 3BGDA 3ZW8A 2LCFA 3M83A 5A0FA 4BB6A 4DNXA 2YZ2A 3T3EA 1RMYA 2KBFA 4II2A 3LUFA 3UXMA 1EVIA 1DVRA 1R10A 3ZNPA 3GLQA 4GKKB 5DK6A 1XZNA 1HETA 4KJZA 3CRRA 1EJ2A 4QASA 3JR3A 2OUKA 3ZDRA 4EB6B 1JV2B 5FI1B 1TYCA 4QATA 1U8EA 4CMEA 4EA8A 1YASA 3BREA 5EOVA 4QYTA 4E5KA 1L7EA 3WG9A 1Y3BE 3FAZA 1U3CA 2Y1OA 5B1IA 4OLJA 4EHDA 2PBZA 3MT9A 4RTSA 3PQ3A 3ELUA 2QVZX 4HBGA 1IY2A 5DHQA 4MS3B 2O2CA 4E2ZA 1BX0A 1G8YA 2EW1A 5JFTA 3DKRA 1GJRA 3D4LA 4KXNA 7REQB 4WXYB 2V5UA 2Q3JA 1PZMA 1RQ2A 5KIAA 1PJAA 3OD1A 4YX9A 4V0MA 1Y6ZA 1VYVA 1U0TA 1J0BA 1SUWA 4GXNA 7AT1A 3WJ1A 1XQ6A 1KRWA 1W36B 3ND5A 5KQSA 1ORIA 5CAEA 1TC1A 4RELA 3VR5D 4X7BA 1TUEA 2FWIA 2MSNA 2WAMA 4K28A 5KQLA 2AFHE 1FU7A 1OHHA 4YJHA 1NP3A 4BNLA 4D41A 3MINB 2ETVA 2P90A 3KYDA 6REQA 1VCOA 2JIRA 1DQNA 2YASA 4TSFA 1FUYB 4KPFC 3ZC3A 4TRNA 4AFNA 3WGVA 1XZFA 1Y1LA 3EVTA 1ESEA 1SCJA 3U6BA 2Z2XA 4OLAA 1T3ZA 2R6DA 4I8IA 1KMQA 3MXOA 2BE7A 4W1PA 2GKSA 5BYBA 2X9VA 3ZS8A 1NP7A 9MHTA 5JD3A 3PGJA 1QVWA 1PVOA 4IIBA 2QXUA 4LC0A 2IPOA 1BIFA 1UZLA 3EW7A 3NXSA 4WGGA 4KREA 2GCOB 5LD2B 3DTVD 3PV0A 4RJTA 4BXOA 4E5YA 3DXFA 5JUWA 1O9HA 2JASA 3AJ9A 2GI4A 3F73A 4JVLA 2R00C 2QX7A 3AP2A 2QTCA 4FFDA 1K97A 1L3IA 4INAA 2WJ6A 4JYMA 4BNIA 2FN9A 4R8LA 2PWZA 3UQZA 2M6RA 2ZJ6A 1IWOA 4U7FA 1FSSA 3HR8A 1PVVA 3CHYA 2PGXA 3IQIX 3OY2A 4EY8A 4MW1A 2NNLD 4HS4A 4DEXA 4GRIA 2W6JD 4L7VA 3NIFB 2OCAA 4XM2A 5A5EA 3R0VA 2GTPA 2ZJ1A 3G2JA 4L07A 4N0PA 3KB1A 1P29A 1QLHA 2V98A 2FMTA 1J1UA 1WUKS 1JDUA 1NXTA 4GPAA 4MWOA 4P58A 4TMKA 4EI2A 2QJFA 4MOWA 1JNYA 4QGBA 3EIEA 1ZN7A 4G0OA 3KWMA 5TY0A 4HV4A 4BO4A 1YR3A 4AF6A 2QM7A 1NUSA 1OD6A 3OT1B 3GGJA 3KTAB 2B4RO 1HE8B 4YQEA 2AOTB 3AVUA 1U6JA 4WKPA 1OC2A 1Z34A 4BYGA 2FFHA 1U63A 4ZZIA 1PL8A 3HEMA 1T4MA 4DM7A 3A1UA 1HDGO 2VJDA 3BD6A 3HZHA 3OZBA 4WKNA 3AUXA 5JD6A 1QRTA 3ICOA 3L77A 1QO7A 4NJEB 4F3CA 1YULA 1SVWA 1JTVA 2CDRA 3BWXA 3NHAA 1LPSA 2E4AA 2QS9A 3FFWA 3QLTA 3R77A 4Q7KA 3SKYA 3WRYA 2G63A 5JCXA 3ZY6A 4QC2A 3DD1A 4MVCA 4ZVSA 3VGPA 5EHZA 2Q5OA 3O1JC 3KTOA 3QMMA 1RZ3A 4RGVA 1JU4A 4NCJA 2Y1XA 5A1JA 5KNDD 1WM1A 1W73A 1L5YA 2VEOA 3GLRA 1V3QE 2WAAA 4E21A 1BXRA 4EWLA 2Q46A 1KEZA 3FCEA 1TADA 5DCUA 1ZONA 5EIXA 3QLEA 1KI2A 1M1UA 3GMSA 1FDVA 3I39X 4CV3A 3FLMA 4IICA 2GJKA 3F7NA 3WRYC 1UKYA 1QH9A 1J06A 1DKMA 3L8EA 3PNYA 1WHTB 2PKCA 4KE8A 3AFOA 3C7TA 3NVDA 1C0KA 3VPFA 5JDIC 1QTQA 3K4HA 3LWNA 3NTUA 1U3GA 1NIPA 4U02A 3DL0A 2HMVA 3A9CA 4M21A 2RJOA 4NI5A 4TRMA 1OWLA 4MIOA 2ATEA 1AY0A 3MJSA 4FMDF 1FP7A 1X7YB 2GPYA 2YINC 4X6YA 4YJ3F 5HF8A 5J4LA 4OSPA 2R6GA 2ODPA 4C0SA 3L4BA 5EEGA 2RC5A 4NV3A 2JLAA 1G0NA 1W0KD 2NTVA 3LQKA 2D74A 1M1YB 2WTNA 2GAIA 1MG0A 3K20A 4N41A 1P1IA 3RUIA 2JRCA 4MGZR 2F7SA 4A3SA 2JFOA 4PGAA 4K9QA 3KYCB 4ZV9A 1CEQA 4PZPA 2YOHA 1JLMA 1K68A 2VR1A 3M6UA 3K53A 5FQOA 1SC6A 4B87A 5J58A 4QYXA 1PL7A 2H54A 4G25A 1KE2A 1YZKA 3NUQA 3C0KA 3MMSA 1WSDA 1GR0A 1QDEA 2P0AA 3B82A 3DULA 2QX9A 2WM9B 4HZGA 4IIYA 4P6VF 1L5KA 3VU9B 1AK2A 5TJ9A 3G5AA 4FU0A 5HA5A 5AIBA 4OFZA 3ZHVA 4ZJPA 1S02A 5JNSA 2BTQB 2HJRA 3HN7A 4M1YA 4EYQA 5GVSA 4TQAA 5CPFA 5LZ4A 3GYGA 3CXRA 1TPYA 1UPAA 3VZPA 1J70A 5I9MA 2DHDA 4MEBA 1TLLA 3MNFA 5D00A 2VQEB 3RSSA 5KMGA 2P2DA 4K6MA 5K5EA 2JANA 3G0HA 3VKUA 1OJLA 2Q8PA 1XAGA 1YZTA 4DLUA 4H08A 4OHBA 2ZBUA 2QV7A 2OORA 2IHKA 4G81A 4V0QA 5AXBA 1TD1A 1Z7EA 4P8RA 5EIHA 3TLXA 1RJDA 5JJLA 4QU5A 5HK9A 4DSNA 1BVYF 3HYLA 4IIGA 5EIAA 5F4ZA 5BQ3A 3AERA 3MGCA 1CE8A 3IT1A 3C3EA 3BHIA 2RHCA 1N7IA 4PLZA 2KB0A 3THRA 3MMZA 2AG1A 1E0KA 3DT9A 1KAQA 2ALJA 3A14A 4LTNA 4QBGB 3FXAA 3FA2A 2PU7A 1KZ9A 1B2LA 2UZAA 1XF1A 2ZFUA 3WGHA 4JUFA 3QE4A 3ESQA 1U5AA 2PFKA 1WW2A 2GVDC 1J9EA 2OC4A 4EHKA 4YPVA 5EJIA 2JLZA 4PC2A 3NQ41 4RH3A 4YJGA 3JQEA 1ZP6A 4IDHA 2B4KA 4ZQCB 3GK3A 1AHPA 1P8AA 5GJVC 5BSEA 1GGHA 1FJ2A 1N78A 3CUSA 2FP4A 2IW1A 4HAIA 1CUAA 2ZYDA 3KOYA 2COEA 1GAXA 1EFAA 2FFRA 3GHYA 3ETGA 3Q5DA 3BCUA 3ZGXA 1NY5A 2P68A 4MR9A 4UAJA 5KDLA 4NCXA 3WJAA 1M0WA 1GAWA 4YRIA 1A9QA 1UP4A 5LMNB 4JWKA 3EDMA 4LA4A 4G2TA 2XKBA 3IJ5A 4H3SA 2X22A 4K81B 2Y68A 2O8CB 1X38A 3HU3A 2EL9A 1POWA 3ZJYA 2CNWD 3IP5A 4ZT5A 3IEIA 2NTJA 2C7OA 1LLUA 1I7NA 5LC1A 2A78A 3AERB 5IAGA 5L4NA 2FE4A 2HSEA 3CRMA 4JN6B 2K4MA 1OMOA 4B9AA 2UUAB 1B73A 4L3WA 1F2TA 1WP9A 3G6WA 1TM7E 1KK2A 5CH3A 4FD2A 5JO9A 3QPBA 3UG6A 4D96A 1F48A 3F6RA 5P21A 1TU3A 3FMIA 3PUHA 4NHOA 4O4LF 3WIVA 2VQFB 5SY6A 2PS0A 3RRBA 3S27A 4A2CA 3K0AA 3KZKA 5AKHA 4I66A 4FP9A 1MO5A 1J0XO 1KJNA 1GFZA 3ZUGA 1FP6A 4WBNB 5BVGB 4COKA 3KKPA 5IBPA 1I3MA 5L7TA 3KTDA 1X1QA 4NSNA 4B6OA 2DC1A 4W4TA 1QIFA 2ZVJA 3B70A 4V03A 5D6OA 2VYND 5KTTA 1PVDA 3DZIA 1GPAA 5CM2Z 3N75A 1JTFA 1RW4A 1Z2DA 3RFTA 3M49A 4C22A 4KXFB 1KH3A 2ZTLA 3P2EA 1LD3A 3NBFA 4MV1A 4UBOA 4EHIA 2E4ZA 4PO9A 4ZOLF 1QNLA 1ZRHA 2YC2C 4AM8A 3OIWA 1I1HA 1NYQA 2EF1A 5ALEA 4E5PA 4Q3EA 4HNVA 4TSKA 1L4KA 2IGTA 2GZAA 5BSUA 4BRWA 1TK2A 3TLZA 1P3JA 1KOLA 5BURA 3BIJA 1DLIA 4QRIA 1U8FO 2DPXA 4G26A 1W0JD 2DWCA 3S8MA 3ZHCA 5CBPB 1JJVA 4O4JA 4JJ6A 4QOEA 1J9GA 1MF7A 1JQJC 1U3VA 1N92A 2QQ5A 3EZFA 4M1TA 4ENSA 5JNRA 4IUDS 4UVIA 1K0FA 4AY6A 3TI7A 3MRTA 2VH2A 3H17A 4NFHA 3D4NA 1O5IA 2H29A 4K9RA 4DRYA 1W581 4EPXA 1BOOA 3ESDA 3EYAA 3DMNA 3KJFA 3LCJA 4FB4A 1FS6A 1TJ4A 1Z6GA 2JA1A 3HFRA 5KTPA 1AQIA 3D7SA 2B94A 3FR7A 3VA7A 3D54D 4ESHA 4L4SA 2F2TA 5EIEA 3COYA 3L6RA 4D42A 1Y8QB 2XCSB 4CG2A 1EA5A 1IMJA 1WMSA 4L9SA 4M7RA 5A3SA 3HP4A 3TGPA 1OT5A 1NT4A 4CM7A 3ZE7A 3ICQB 2HJ9A 4RV5A 2E21A 3KYDB 6REQB 3IIKA 5LQUA 2GCPA 3WLPA 1DDOA 1NLMA 1Z0ZA 2AMFA 4MYHA 1OFUX 1RPNA 4URFA 5FEMA 3PF8A 1EFTA 5AKKA 4BE7B 4DT1B 2HBRA 2W6PA 4JS0A 1QIGA 4FC6A 3UC9A 5FUYA 1G0OA 1XZAA 5CDGA 1RHQA 2FW8A 2WSSA 1EBFA 3GT7A 1U2QA 1TYAE 2F1HA 3L8CA 4ZP1A 1K86A 3WMWA 2I4MA 2WU8A 4K6CA 4MITA 5FWYA 5HMMA 4PANA 5DSXA 4DZTA 2IX3A 1NX6A 1E79A 2Q5IA 1BKDR 2E5LB 3FRHA 3STUA 1W52X 5DGCA 5EJ2A 1LLCA 2FUCA 1G5TA 3FX2A 3PHCA 3SZLA 2JGAA 4DJEC 3HVKA 1NYTA 2AOVA 2AQ8A 3EF1A 4PFQA 3VYVA 3U9LA 4AJ2A 4JBHA 4DIUA 1M8KA 4BB9A 1JR3E 1YBHA 4NABA 5LLSA 4S04A 3GLHB 1RM5A 2WIKA 2IDZA 1KI1A 3A0RB 3EFOA 2ZS7A 1O57A 3EZGA 5BSMA 4EG3A 5EFOA 2DULA 5IABA 5JAIA 4GOKA 3U4GA 2X5KO 3HDTA 3C5EA 1Y5IA 3AI2A 5HBGA 2UAGA 2YS6A 4OHWA 3QVVA 3S70A 4HTFA 3W05A 1MABB 2DCMA 4O4HA 5D3MA 4MPTA 5MFPA 3DE6X 3NU1A 4X61A 4ZAVA 4F8JA 4GYJA 1DUSA 3MTBA 3B7GA 4UW9A 1GNTA 4YV2A 2Y1GA 3DDZX 1QAMA 3A6HA 4IJWA 4H7IA 3G0IA 3IMCA 4BGVA 4AJ9A 4LK3A 1YFZA 5JD5A 3AEXA 3DZKA 3GPCA 3P71T 4CDNA 3QMWA 2Z56A 5DYYA 4BB0A 5CG1A 3CVVA 4D3ZA 4O59O 3U4HA 3IHKA 5CEEA 1HURA 4FSXA 2G3YA 3W5UA 3W5SA 3VU3A 5C32A 3ETLA 3VTFA 3UWMA 1GCIA 2PGLA 2VRWA 3BCRA 3DA8A 1E3TA 3FCUB 3LLCA 3PC2A 3PLNA 4MULA 3HA7A 2I2AA 4TZKA 4XVHA 2RGRA 5C52B 3QJYA 3KSBC 5EZ5A 3WL7A 3AG5A 4P84A 2CJPA 1RC1A 4GMHA 3EVFA 4PSCA 1GT6A 2OK7A 4E2FA 1PK9A 5HMLA 4NZYA 3CH4B 3JVUA 3IR5A 3PT5A 3CEAA 1GPUA 4IINA 4O2AB 4AU1A 3E5HA 5E7MA 3FOZA 2QE7D 3H6KA 4IIXA 4MNTA 1HH4A 2OGWA 4CT0A 3ZVNA 1UL1X 4ZAFA 4ZRMA 3VH3A 1NNEA 1SCKA 3BL6A 1X7XB 2H07A 1DEKA 3KS9A 1Y1SA 3SM3A 4Z7QB 1C9KA 3ADBA 4W8GA 2VP0A 1GTZA 2NSHA 5HF5A 4V2UA 1KAMA 4CHTA 1F0PA 1N6RA 4MLCA 2X9GA 4G0VA 3B9PA 3BCHA 3R3HA 5KZMB 2CXXA 3IUJA 3DBVO 4IDPA 1H0KA 4FWBA 4JLDA 1GR1A 2VJBA 3N76A 5G0SA 4DLSA 2BGIA 1OI3A 4DIMA 5CA1F 2QVBA 5C1DA 3GLFB 4ARVA 1XWIA 4MW4A 4HG2A 5IK2D 2Z57A 2FZKA 3M6IA 4HGPA 3DEZA 5K51A 5A4KA 1YB6A 1XCPA 1ZMXA 3AKEA 1M2KA 4J0CA 3N2KA 1DKOA 5BWNA 2XVAA 1I2ZA 4TV9F 1MG5A 1T8WA 3GBSA 5AOCA 1W8DA 2B2XA 3JD1A 1V1MA 5AWFC 3QYPA 1ZN2A 4DA7A 1AB6A 1Q19A 3NASA 4UNRA 3D4IA 1TYZA 4E88A 2OVBA 4NVRA 1QHGA 1VQ1A 1KE1A 3R1IA 1VCMA 1DXYA 4PZDA 4MZDA 4DC1A 2V3CC 1X19A 3DOJA 2HYDA 3OURA 4ISBA 2G0TA 1QIHA 1U2DC 3WXMA 1PJ2A 1N5KA 2X6QA 2Y0PA 3D3QA 5IYZF 1PX2A 2D1RA 3T6KA 3N9IA 2VXYA 1NVEA 3L7NA 3V3KA 5FA6A 3CVYA 5K8VA 1BTOA 2WHXA 3CX7A 3UWDA 5F3DA 2EZUA 2Q5FA 2XUPA 1NW7A 2XUQA 1B8UA 3VTZA 1Z0UA 3CLTD 1V7PC 4HEA1 5JTTA 4BOYA 4LZNA 4NNPA 4WBNF 3BIOA 3R9KA 5JJCA 3GIDA 4IZIA 5AUPB 4HNQA 1G38A 1I3LA 5FTWA 4ER3A 1FRZA 4HDNB 3VPXA 4ZZ3A 4G0WA 1QQAA 2VI5A 2X1VA 4DA8A 1S8FA 1MJ5A 3BVPA 1UAGA 2JH9A 3ITEA 1O95D 4G5OA 3C85A 5DCLA 5KOJA 3BX1A 2IODA 2KI5A 1Z17A 3L7DA 5H3CA 2A0YA 4JYZA 1TL7C 4QT0A 1U2TA 1S2NA 3ND9A 4JQOA 4J07A 4CM4A 1X1DA 3OTOB 2BMJA 1WW3A 3LA8A 1LS6A 2K6GA 13PKA 2B0CA 2BGLA 3EVDA 1J1ZA 4L7QA 4MUEA 3NKFA 1U0NA 3I5XA 1H6BA 1DZIA 4IBOA 2Y4NA 4PRLA 1XLVA 4D44A 4MEJA 3HYTA 2RGWA 3RVQA 3AUFA 3D7KA 3OQHA 2XSZD 1GHTA 2ODEA 1AQ6A 4RZHA 1UJ6A 5AK3A 4AJ4A 1CY8A 2J3KA 5BO5A 4ZIRB 1H8HA 3DHWC 2ODNA 1UAYA 3H4MA 4IZOA 3RTAA 2G9NA 2ERXA 2E9SA 4BQRA 3LXUX 2X5OA 5C1BA 1LQ2A 2XGMA 3BXXA 2JAUA 3ABQB 1DCKA 1EE2A 2BDEA 2OD2A 1YHZA 2WEKA 3MINA 5FR2A 4LZLA 2ZTMA 3ICEA 2OG2A 2D54A 2EX0A 4NIMA 2OFXA 5LR6A 4BC1A 1E9EA 3VKGA 1BFDA 1DXQA 1U5BA 2Q2NA 3OX4A 4S3MA 1DRJA 3KKMA 1FU4A 1IULA 4FFVA 2ATXA 3FCOA 4YAFA 5E9QA 5IKPA 4D26A 4FHGA 1UXJA 2ROQA 3R40A 1UXIA 3A31A 4PAGA 2Y1DA 4JI2B 3HU2A 4B8YA 4B47A 4YMUA 2YWHA 3E3AA 3PA8A 4UBJA 1V6SA 4QUGA