1U7TA

Crystal structure of abad/hsd10 with a bound inhibitor
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
255
structure length
255
Chain Sequence
SVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVRNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human ABAD/HSD10 with a bound inhibitor: implications for design of Alzheimer's disease therapeutics
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 3-hydroxyacyl-CoA dehydrogenase type II
total genus 92
structure length 255
sequence length 255
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.178: 3-hydroxy-2-methylbutyryl-CoA dehydrogenase.
pdb deposition date 2004-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1u7tA00
4RJTA 1H6AA 4RL6A 5G4KA 3R0IA 5DP1A 3QVTA 5COBA 5EL0A 1A4UA 3GLQA 3OJ0A 4IQ0A 4J2OA 4GX0A 1DDOA 5DNAA 3PDUA 3R3SA 3NT5A 3IIEA 2HMWA 4RF3A 3W8EA 3BTSA 3ZU2A 3ZWPA 4CM9D 5JFOA 1XR3A 1DHRA 3L4BC 2BMAA 1WNTA 4N54A 4Z3KA 3GA0A 3ZHBA 3GHYA 1KVUA 3CMMA 1EUZA 2G1UA 4WASA 3ZWXA 2VYVA 1UZNA 3I4CA 4XB2A 4JJFA 2RCYA 3FSRA 1GUFA 3VDRA 2ZIZA 3GEDA 1Q1NA 1JU9A 4ZRMA 1UJMA 1LDBA 2O3UA 1H94A 2Q1UA 4FJ2A 5JDCA 4QFDA 3FBTA 4EITA 1SZJG 3B1JA 4L73A 4UVDA 2BFOA 3SXPA 4NIMA 1I33A 5B37A 4FFLA 4CM3A 1PQWA 1ADGA 3DMYA 1J5PA 1D3AA 3D0OA 1DHTA 1DRVA 1ZH8A 3PYMA 1W73A 2HO5A 4D42A 3DZHA 4OYRA 4GWKA 4FGWA 5FFFA 4EUFA 1EE9A 3WJAA 8LDHA 4L4XA 4J7CA 2E82A 3P7MA 4DRYA 1YQXA 3AK4A 4BNJA 4ZQBA 4PRKA 1HYGA 1NFQA 2PNFA 4JP2A 3OIFA 1Z45A 4K6CA 3F46A 4XRRA 4ESOA 5G4KB 4DLAA 1C14A 3P5SA 3F9IA 4RPJA 4ZD6A 2VHVA 5F5NA 1KOLA 1ZUD1 3C3XA 3QWAA 4QO8A 5L4SA 1UXKA 1E7RA 1V3TA 4DIOA 5KJ1A 2YJZA 3U4HA 4R01A 1F12A 5IJZA 4PVDA 1PJ3A 1VI2A 1XLTA 4OQYA 3UHAA 1SBYA 4B3JA 1OFGA 3LF1A 3KLPX 2CNBA 2GASA 2GCGA 1X15A 3VVBA 4BNHA 1HL3A 2O3QA 3PVZA 3STHA 1RM0A 4XGKA 3GVPA 3MJEA 4PLFA 4OAQA 3GUCA 1SNYA 3QVXA 4CMIA 5L40A 1CETA 3NT2A 2C82A 3LQFA 4XYBA 3H9GA 5THKA 3HDQA 4M49A 4J1TA 4KQWA 2ZJ0A 3INGA 2P91A 1YS4A 5BSHA 3BMQA 3DONA 2G76A 3HDYA 2FPGA 3UW3A 1YOVB 4M54A 3JCZA 2NTNA 3WGZA 4NZ9A 4FB5A 2W90A 4B4UA 3LLSA 1M75A 3EW7A 3ANMA 1L1FA 3PEFA 1CQIA 2DAPA 3RUEA 3WGOA 3TSCA 5B4VA 4FJ1A 1XWFA 4BGIA 3PWSA 4FOOA 3BMCB 4LRTB 3QY9A 3LT1A 4KZPA 4BNLA 4PFJA 2SCUA 2DQ4A 5C7IO 4IDEA 4A0SA 5L51A 3KTDA 2NTJA 4HUJA 3Q11A 2AHRA 2VNAA 4TRRA 2ILTA 1B2LA 2QYTA 3TZHA 1PTJA 3F47A 4ROSA 2B69A 2EJVA 3CUKA 2GZ3A 3GOHA 1CF2O 2J3JA 3LYLA 4LCJA 2DTEA 2GZ2A 1P9LA 4EI2A 4BMNA 4RORA 5BQFA 3KEOA 3MWEB 3ENNA 2FN7A 3GAFA 4IIVA 3WNQA 4NPCA 4WCFC 4HFRA 1FK8A 1NPYA 3WB9A 4NBVA 2QRLA 2QRKA 2GYYA 3QIVA 4F3YA 2BRUA 5I8WA 4FGSA 2O3RA 3HADA 5GZ1A 4DUPA 4BO8A 3LLVA 2VTDA 1N9GB 4R69A 1T4DA 4R4JA 5IF3A 3JD4A 4DA9A 3EY4A 5C7LO 4J1SA 1GV0A 3LZ6A 3AOEA 2BGLA 4XQEA 1O5IA 1LC0A 1WVGA 1PR3A 4IDBA 1DIGA 4NJMB 3RC7A 1AGNA 4EYEA 1IUKA 2TMGA 2EP7A 4XB1A 1N8KA 1E77A 4MP8A 4RLSA 3SLGA 3F5QA 4CL8A 4GMGA 3T4XA 2JD0A 1LTHR 2NU9A 3L07A 4K26A 3GN1A 2X0JA 4QXMA 2C2YA 3KRTA 1B0AA 2EKLA 4WNCA 3RC2A 1ISIA 2R00C 1N9GA 2FR8A 3MJVA 2A9FA 4D3SA 2Q99A 1Z74A 3QA9A 2HJRA 2NSDA 3A1NA 3I3OA 1JA9A 1QP8A 4TVOA 4YJFA 2PH3A 1NBOA 2RH4A 4CV1A 1E7MA 3I9LA 1I3NA 2PGDA 3X2FA 2YHIA 4ND1A 3ENKA 3UXYA 2YW9A 3EZYA 3NDJA 4EBFA 2GUGA 2NU6A 3Q2KA 5EMHA 4I08A 5JDCC 1PJTA 4R51A 4ZA2A 4YRBA 4OOEA 3E5RA 4J0FA 3DBLA 3IC5A 3VZRA 1AUPA 4HFMA 4QO7A 1WZIA 2C07A 1HEUA 1R0SA 1DLJA 5BNTA 4NBWA 1WZEA 3LC2O 3DBLB 1FF9A 5IG2A 1CQJA 4MVJA 2C5EA 4HFJA 1BHSA 2VHXA 4OQZA 1QORA 3JQBC 4YVFA 3W8FA 1H9BA 4AG3A 3TRIA 1YOVA 5T64A 4A2CA 2O7SA 1QRRA 4BL5A 3AY7A 4D79A 1Q0QA 5TIIA 4EDFA 5GZ3A 1M6WA 4FD3A 3I9OA 4BNYA 1EZ4A 1G0NA 4H3VA 3H2ZA 5IDWA 1CDOA 3CIFA 1ENOA 3C7DB 3EMKA 4Z3DA 1E6WA 4JK3A 2B35A 2C0CA 4U6SA 4YJHA 2GNAA 2DPHA 1PQPA 1U4SA 4H7PA 2BH9A 3HHPA 4JN6B 3TWOA 3DQPA 3OETA 3KM0A 4K28A 3ZCXA 2AG8A 4AVYA 3K73O 2AW5A 2V65A 4E33A 5FEUA 5FWNA 3WBFA 3ZNNA 3DTYA 5BSEA 2WD8A 5IN5A 3DZFA 4IDFA 4CODB 2XXBA 1B3BA 3K92A 5JY1A 3ZNQA 5FYDA 3NRCA 2FR1A 2W2LA 3AY3A 3PYXA 4ILKA 3UH1A 4A03A 3GZNB 3W6UA 4KOAA 2A4KA 3FPLA 3KEQA 5CHEA 4M8SA 1RM5A 1IPFA 2ZATA 2Y1FA 1D7OA 5DCYA 4GVXA 4XRGA 5TF4A 5IN4A 4PGFA 4B8WA 2PA3A 1UXGA 1WP4A 2Q46A 4PRLA 4XYGA 3UOGA 2WDZA 2A92A 1VL0A 3AI3A 2P9EA 4AJHA 1CERA 3ZNOA 4R5MA 3HFGA 2BGMA 2BFMA 2P5UA 1Z6ZA 4XEHA 1Z82A 4PLGA 4YRDA 1PX0A 3AFMA 2NU8A 1RYEA 2JCVA 1GZ3A 4O5OA 2J3IA 1Y9EA 1UAYA 2PWZA 4CM8B 1J4AA 1XA0A 4GVLA 1LDNA 4IIUA 4BO9A 5HS4A 4DYDA 3RJ9A 2FSVA 3W4IA 3AUUA 5JAZA 4FC6A 4PLPA 4TVBA 3JQ6A 2E37A 2CY0A 1PR9A 2PKQP 4K9DA 4RVDA 2CMDA 1XIVA 1ONPA 4CQLB 1LDMA 3C85A 4FOSA 5G2OA 1JKJA 1JWAB 1DC4A 3GEMA 1P1JA 1HKUA 1P0CA 2BELA 2EGHA 1EDZA 3H9QA 5T57A 5CDGA 1CYDA 1PJBA 1VJTA 5FF9A 2NVUB 2JAHA 4ZRNA 1DAOA 1N7GA 1BGVA 4S1VA 5GY7A 2OL4A 3G49A 4D41A 3GH3A 3PPIA 4PZDA 1E3EA 3OEYA 1YXMA 4XGIA 3GDOA 2PKRA 3B20A 4XYMA 2NNLD 3NX4A 2YDXA 1Y1PA 4MKZA 2DUUA 1J0XO 3X2EA 1V8BA 3NKLA 3AUAA 4J4HA 1PJ4A 1ISFA 2HAEA 4JJIA 1DBVO 2J3KA 3KYCA 4NK4A 3U62A 5TQVA 4XQ9A 3ZWOA 3EVNA 2HK9A 5KJ6A 2PH5A 3FF4A 3K30A 4JBIA 4E31A 2PZKA 4B7CA 3HSKA 2PZLA 3BAZA 4PLHA 5EINA 1E7SA 2OUIA 4ND5A 4LMPA 4L76A 2LDXA 3R1IA 5JBIA 4Q3DA 3JQ9A 4XA8A 4KTVE 4Q3BA 4XQGA 2B36A 2XF8A 1IOLA 3OJFA 2UV8A 4AJEA 4INAA 3GN2A 3NDIA 3EZLA 2J5KA 4CM4A 1I24A 4Y9DA 3I6QA 5L4LA 3ROQA 3ABIA 3WBBA 4E5YA 4E5MA 4UUPA 1P31A 4MIEA 4BVAA 2IZ0A 2Q1WA 4CMIB 3U5TA 5L4NA 1HETA 2EG9A 2FZEA 2XXJA 4WKGA 1VJ1A 2OBYA 4E2WA 1PL7A 5JAQA 2PD6A 3JQDA 1YL6A 1MG0A 2B4QA 1EFLA 1E1NA 3PFWO 1QYDA 3RC9A 3SJUA 4ZQHA 9LDTA 1X1TA 2R00A 4N7RA 1S6YA 5ILOA 4RDIA 4ZJUA 1X7DA 2ZTVA 3ICCA 2NTVA 4CMBA 2JJYA 1C1DB 1Y81A 3NTQA 4UUOA 3FNHA 2VRCA 3CMCO 3ZU4A 3U9LA 2BI8A 3WQRA 4E6PA 1WDLA 3IS3A 4EZBA 1W8DA 4Y6RA 4NHEA 4J43A 2DBQA 1N5DA 1T4BA 5TT0A 4GWGA 1BW9A 4LVUA 2O50A 1JAXA 2QG4A 4XJSA 1PIWA 5F21A 2VOJA 1EVJA 5KKCA 2EERA 4ALKA 1NHGA 2CD9A 3E9MA 3H65A 1ZXLA 2D0IA 3NGXA 2XAAA 1K6JA 4QTZA 1A71A 5CG1A 2O4CA 4AJ4A 3ANNA 4Z9XA 3EK2A 3FRJA 4GPD1 1GZ4A 4CM9A 1WAMA 1U5AA 1YJQA 3H7AA 2VWHA 1YJ8A 5MGBA 1U28A 5CP8A 2DKNA 2B83A 1R4NB 4FC7A 1K3TA 3Q2IA 4MVJH 4W9NC 2DFDA 4YDRA 3I23A 3I9NA 1HZJA 3KYDA 4CV3A 5KVVA 4D44A 4JGBA 4W7IA 1JW9B 2BLLA 3D4OA 3NTOA 3TOZA 3DHEA 3TJRA 3IP3A 4CMHA 1ISGA 3FD8A 4WCFA 4WLEA 4TWRA 3VPXA 1ISJA 3QWBA 4BHTA 3GDFA 5EJ2A 2WYWA 4J3FA 4EJ6A 2Y0DA 3S2FA 3T7CA 2FP4A 4F46A 1K89A 1SC6A 4GX2A 1N1EA 3LVFO 1YBVA 4M55A 5A1TA 2JD1A 1H9AA 1KY4A 4RVUA 3M6IA 3F1KA 1ID1A 1NR7A 4QEDA 1GQQA 1UDCA 2Y68A 4M89A 2ZYGA 5IDYA 4E5PA 3WQSB 5DBGA 4FFNA 1H6DA 2HRZA 3L77A 4LRSB 5L9AA 1NNUA 3KZVA 1K5HA 4P4GA 2EJWA 1DOHA 2NWQA 1EEHA 1N7HA 1Z7BA 1H2HA 2P4QA 3VHRA 1YH3A 2Q3EA 1UH5A 3L9XA 3FN4A 1JKFA 3ZWCA 2FRDA 5JYDA 3NTRA 2Y99A 2VQ3A 1Z73A 4TRMA 5JY6A 1GYPA 3JYPA 4OJNA 2CF5A 4QQRA 2VRCD 4EGFA 5C37A 5BNIA 3I5MA 1ZXBA 3WMWA 1SOWA 5JLAA 4R54A 3EC7A 3ASVA 3GNSA 4G2NA 4D45A 4KUHA 5A5FA 1L7DA 3TZQA 1TLTA 2AEFA 4URFA 2JKVA 4Z6KA 3QSGA 2BI7A 3GT0A 2ZTLA 1NM5A 2J8ZA 1NWHA 1YE3A 3OQ1A 3PJDA 4FW8A 1M76A 4ZHSA 5KCZA 4IJVA 1E1LA 1BXGB 4BO1A 4NH4A 4OSOA 3JYLA 1GYRA 1U3VA 3F6YA 3EHEA 1IE3A 4R9RA 4CMCA 4YRAA 2UVDA 4BQPA 4NU5A 3WTBA 2Q4EA 3TZCA 1OC2A 3GNQA 2PZJA 4NI5A 1I3LA 2DTXA 4I9HA 4YJFB 3N7UA 4R1UA 2P68A 2FPIA 4JQCA 2ZB7A 2JAPA 4HV4A 1X13A 3JYQA 3JYNA 2HMVA 3GZNA 3HZZA 3OM9A 5G0VA 3FCOA 3I1JA 2D1YA 2O3TA 1N2SA 2X8LA 3FTNA 3H9UA 4II2A 1U3UA 4BNWA 1LEHA 4IQ8A 2B37A 2H5LA 4P38A 3C24A 1UZMA 3G3EA 2X5OA 4E3ZA 2LDBA 1GDHA 4DBVO 5TJHA 4E12A 4I5FA 2Y0EA 2RHCA 1E3IA 4XD2A 4E21A 3QWIA 4BO4A 4D0SA 2DM6A 3GK3A 4AJIA 5JO0A 1RKXA 1UP4A 4O63O 1VL6A 1LU9A 2FR0A 4RV9A 1AE1A 2CZCA 1XQ1A 2V6BA 4GQAA 4OKNA 4YT8A 1R12A 2RIRA 1OBFO 4E2XA 3UICA 5ER9A 1VKNA 3C7AA 1MC4A 2GZ1A 5C3MA 3P19A 2YHUA 2I76A 3ST7A 4CLXA 2CSUA 2EWMA 3QVSA 3ADOA 4BKPA 1E3SA 3HNPA 4P8RA 1I30A 2GRAA 4QFCA 2ZYAA 4NFSA 1XELA 2VWQA 5A5EA 2IRWA 1LI4A 4ZGWA 2C54A 2YQ4A 3ON5A 4D7AA 2WM3A 3H9JA 4NG5A 1YB1A 3H2SA 4IBOA 1HTBA 3KYCB 2HU2A 3G1TA 1LA2A 2HK7A 4YJGA 5B1YA 3TL2A 5HM8A 4GI2A 3C7CB 3E18A 3WNVA 5KIAA 1HT0A 4Y67A 2OP0A 3ZWNA 4ND4A 3WGTA 2CF6A 3H5AA 1X7HA 3JD0A 4FR5A 1LNQA 1X7GA 2P5YA 1H93A 1UXIA 1BVUA 2VNSA 2PLAA 2QHXA 3GGGA 1U7TA 5BSFA 4BB5A 4DQUA 3W8DA 1WDKA 4CLRA 4RVGA 4ITUA 1ENPA 3GC6A 3KUXA 4EEXA 4BNTA 4E32A 3RUFA 4QX6A 1DC5A 2OGUA 1MFPA 5ILGA 2H63A 1T2CA 3H4VA 1NFRA 4CLHA 1FDVA 3K2BA 3V1TC 3KV3O 5ITVA 4E0BA 2AG5A 4W9NA 1WWKA 2RAFA 1LX6A 1E6EA 3KVOA 2ZB8A 5DOVA 1ZVMA 5DT9A 1GTMA 3TF5A 2G17A 1P74A 2VYVD 3I9JA 3VKUA 3UCXA 2C20A 5JO9A 3NV9A 4CMGA 3TQHA 2EHDA 1NXQA 5JDIA 1Q7BA 2VZ0A 1U2GA 1V3VA 1J49A 1QV7A 3TPCA 3ZWAA 1ULSA 2FZWA 2GN4A 5COQA 2YYYA 2OOSA 8ADHA 3RIHA 4O59O 3DWFA 3ROKA 1F0YA 1QYCA 3SVTA 4J9VA 2HDHA 4L4RA 1JLLA 1SPXA 3M1AA 2VHYA 4L4SA 3E48A 1E7YA 3DZGA 1WMBA 4XJTA 3JQEA 4OO3A 1ZSYA 2GN8A 4HADA 5G0SA 3PTZA 4NU6A 3FTPA 1VSVA 4P4LA 4IMRA 2EKQA 3WS7A 4BNKA 1NVTA 4AJLA 3GGPA 4A5OA 3JD2A 1A9YA 2XOXA 1T1SA 5JAIA 3NUGA 1HE4A 4TZTA 5TX7A 1HWYA 1ZBQA 3WFJA 1NVMB 4YYZA 3CPSA 3F5SA 2GDZA 3AU9A 5JDIC 2QRJA 2FY8A 5T6BA 3H9EO 4IY1A 5ADHA 1XU7A 5HA5A 1YL7A 3H5NA 4D3DA 3O26A 4OKIA 1FJHA 4MO2A 5ENDA 1C1DA 4YACA 3WTCA 3JQ9C 4ALNA 4YAGA 3RUAA 3C8MA 3CEAA 1RWBA 4CL3A 1E0DA 1E3JA 1Y8RA 5IXSA 2IXAA 3RUHA 1XHLA 3EAGA 4WLFA 4U7WA 2G0TA 4UAGA 1AXGA 1EVIA 1DAPA 3FPCA 4QUKA 3ULKA 4GSLA 5B4UA 3ZW8A 1IHXA 4JBGA 3VH1A 2PGLA 2CFCA 3CE6A 3PGJA 1BSVA 2WTBA 4WLUA 3U0BA 4MOWA 3L0DA 3LU1A 2FMUA 3BMOA 4IQGA 4E4YA 2EW8A 1T2DA 3SBOA 2D59A 4CLOA 3I83A 3ZH2A 4YB8A 1O8CA 1RM3A 4RPKA 3NEPX 5TC4A 2UUOA 3NYWA 3PDJA 3NJ8A 3Q0EA 3GFBA 3MWDB 4DYVA 4IDGA 2JFHA 5B12A 2I9PA 1P1HA 3M2TA 3S55A 3ITKA 4P4NA 3ZHYA 3E6AA 2ZJ1A 5JYEA 1DEHA 3ZU3A 1P1IA 3PK0A 5CPBA 4CQMB 1BG6A 3C1TA 3TN7A 3ASUA 3E8XA 3OQBA 4R1NA 5KWEA 2VHWA 3WLFA 4I9NA 4OGWA 4LGVA 1KIFA 3GAZA 1EK5A 1WPQA 1LLUA 1OMOA 2WD7B 3GVIA 3PZRA 4KTTE 4YXFA 3M1LA 1HDYA 1QYVA 1Y6JA 2B4TO 4CJXA 3BMNB 2CDBA 2B4RO 2VUTA 1Y7TA 1GY8A 2DFVA 3KB6A 2GD1O 2Y1GA 1SEPA 4PVCA 5A05A 1TT5A 2ZQZA 3DOCA 1I2ZA 4J7UA 3D5QA 4XX0A 1GAEO 4Q39A 1FXSA 1GQ2A 1UUFA 1ZJYA 4MVJE 4BV9A 4YWJA 3KO8A 4MPDA 1HE3A 3BA1A 1LDGA 3LC7O 3MJTA 2YZ7A 3MTJA 3V1UA 3WGHA 5BT9A 4UEKA 4PLCA 5KVSA 4LVCA 3RU7A 1KEVA 1OC4A 1Y8QA 3WR5A 4CR7A 3KHUA 5A9SA 3ZHZA 4W4TA 5KJCA 3QWHA 4WLVA 1XCBA 3RBVA 2Y1DA 4RF4A 3BHJA 1ENYA 1LLQA 3RJ5A 3WGQA 3DFUA 1Q2XA 1QG6A 2FWMX 2NU7A 5BNFA 4ZN6A 1GYQA 2WYUA 3GY0A 5HS6A 2RH8A 4G81A 4R1TA 5LDHA 4CMEC 7ADHA 1DLIA 1E3WB 1B16A 4GAEA 4BNUA 4DPLA 3DR3A 2I65A 5HWSA 3JQFA 2IYOA 3TL3A 4GMFA 1JN0A 1LJ8A 2X0IA 3AY6A 1E3WA 2P9GA 1X14A 3O8QA 3S1LA 1UAGA 2EV9A 2PV7A 4IUYA 1E1KA 4UVIA 5DF1A 2JCYA 3I9MA 4AJNA 4BO7A 3N74A 1R4MB 1PZHA 2PTGA 5DN9A 3WYCA 1LQTA 5A9SB 3PHIA 4DC1A 3WGIA 4YA6A 4EUHA 2J5QA 1HZZA 1PGNA 5JSFA 5TRTA 2ZKLA 3DHNA 5KNLA 3ITDA 4HY3A 1UP7A 4PCVA 2DBVO 3ADPA 1B15A 1Q7GA 4GKBA 1DRUA 5AXDA 1U8FO 3D5TA 1I2CA 1N1GA 2J5RA 4CM6A 4PLVA 4GLOA 3SLKA 3PWKA 3DAGA 1NX6A 4MVJD 1IZ9A 4DLBA 4CM8A 3TZ6A 5DBIA 4AL4A 4C7KA 4YT4A 3D3WA 3V5NA 3HJAA 3IUPA 2Q1TA 3MJSA 5F1OA 1DFGA 1PGJA 1B8PA 5AXAA 1PWZA 2VT2A 4D3FA 4H15A 1B3RA 1I32A 5A4DA 3B6ZA 4FN4A 4GX5A 1DB3A 1I3MA 3IQDB 4IMPA 3RUDA 1R66A 4GKVA 1YRLA 3HDHA 3RKUA 3WGYA 2Y05A 3RC1A 1YDWA 2C59A 3P2OA 4KUGA 4DVJA 4RLHA 5KJEA 3LK7A 9LDBA 3Q9NA 2QZZA 5ENVA 3B1FA 3WX0A 3WIEA 1JKIA 3U49A 4BIIA 2EIHA 4NBTA 4OXNA 4CV2A 3L6EA 1QSGA 3WSVA 4TMFA 3ORFA 4MJLA 3LT4A 4J1NA 4R3WA 1M2WA 2Q2VA 3I6IA 3GFGA 4RVFA 4B3IA 4XWYA 2C7VA 3HE3A 5FI5A 4BB6A 1KEWA 1MLDA 2CUKA 3G0OA 2H6EA 3WDSA 1D1SA 1H2BA 3MJ4A 2WD7A 3RKRA 5JC8A 2DBRA 3BTUA 1IZ0A 4J90A 4WK6A 3VOSA 4CLOB 2PGJA 4YR9A 4Y8VA 3JQAA 1J6UA 3VTZA 3AUTA 3ZWWA 4YBZA 1ENZA 4IGEA 4WCFB 2ZB3A 5A03A 3LSYA 5F1KA 1ZK1A 4CLEA 4YCAA 4DC0A 4BNNA 1DFIA 1RM4A 4TZKA 3WFIA 3ZWBA 2IE0A 4I1IA 3JQFC 3KSZO 1ONOA 3OJLA 2NUAA 3NDRA 4K6FA 4J0EA 1O6ZA 2VCYA 5IFLA 4Z0PA 4R5HA 4YPOA 5G0UA 2NACA 2PFGA 3P2YA 2FSSA 4WCDA 1KYQA 1EUCA 4J91A 4IGFA 3PWZA 2GERA 3FBGA 4E30A 1PJSA 1VLLA 3E9QA 3UN1A 3INTA 3S2GA 3ONEA 3UUWA 1IPEA 3RVDA 3NT4A 4ONEA 4WECA 1V9LA 3C1OA 4ZQFA 2PD4A 2OMEA 3O4RA 4JJGA 4FQ8A 2UYYA 3GHHA 2PK3A 1D8AA 4BNMA 5JMPA 2EF1A 3VPSA 3U09A 2ET6A 2TMDA 3GQVA 1UXHA 3HB5X 5A04A 2P4HX 4DMLA 2O4UX 1HF3A 5A3JA 4XYEA 5C5IA 2X22A 2POQX 4B8ZA 5H82A 4JX8A 3ZW9A 2X9GA 3JQ8A 4MDHA 4FS3A 5U4QA 1JTVA 2OBNA 3FNEA 4WOKA 4R3NA 4PIVA 4BO0A 3DBHB 4FCCA 1BDMA 3ETEA 4GGOA 1YBAA 1Y8QB 3HG7A 1NTOA 3COSA 2VRBA 4PG4A 5AOVA 3TFQA 1LSOA 1U3TA 2HK8A 3KYDB 4NDNE 3RCBA 2O2YA 1I01A 2VWPA 1E92A 2CVZA 2Y0CA 2GF2A 3QVWA 1FDSA 1DXYA 4R9SA 5L53A 3E03A 1GZ6A 2AXQA 1KC3A 3WJ7A 4G65A 4CLRB 3JD1A 4YT5A 1GU7A 1E5LA 2IYPA 4A7PA 4D46A 1LUAA 2B5VA 4L74A 1ADCA 1I0ZA 4S3MA 1VM6A 3K6JA 3CINA 2C29D 1LRJA 4OHUA 3CXRA 5G0TA 2I6TA 2B5WA 2Y1OA 1JVBA 4BKRA 2V6GA 4OM8A 2ZYDA 5JNLA 4MVJI 1GV1A 1ZCJA 4BMSA 1BMDA 1PJCA 5KVCA 2HMUA 4YAJA 4O6VA 4YQZA 3JQGB 3OJEA 4GGPA 1NPTO 4U0KA 2DT5A 4MIYA 3BTOA 3RQSA 3PHHA 5TNXA 1EE2A 1TEHA 2EXXA 4Y98A 1QV6A 2QQ5A 1M66A 2Y1CA 4N18A 5A3VA 1HLPA 4HWKA 5LCXA 3QHAA 2V7PA 2V6MA 1ZMOA 3OA0A 4BS9A 1PJLA 3AOGA 1DJQA 2AMFA 2JD2A 3QP9A 3IMFA 5HBRA 2FOIA 2GR9A 1B8VA 1RJWA 3DFZA 3V1YA 2CDAA 3L4SO 4FFMA 4LISA 1LSUA 5TSDA 4RVHA 3JQ7A 3RUIA 4E2ZA 1JAYA 1BTOA 3AM5A 3RI3A 1GADO 2D2IA 3B70A 1R6DA 2D5CA 3HWRA 4IJKA 5L7TA 5A06A 4P22A 3LF2A 2EW2A 3GVCA 1SB9A 5JCXA 1VPDA 3W4JA 2OHXA 3WICA 1ZEMA 3BMQB 1ZJZA 3PHGA 4JP3A 1EBFA 4OXYA 3FNGA 1YWGO 3VH2A 4CMJA 5CEFA 1YB4A 3EVTA 3KSUA 3AFNA 4WLOA 1MUUA 2ZK7A 4K1LA 5L7WA 1EVZA 1A7KA 2CVQA 2X9VA 3K31A 4RF5A 3IKTA 3FR7A 3ZV5A 1NQ5A 2HRBA 4MKXA 2IXBA 3IAHA 2D4AA 1ZKMA 1H6BA 2IEBA 3BXXA 4ZQGA 4FFRA 1U5CA 1MV8A 4JXKA 1ZFNA 3S2EA 1P1RA 4HP8A 2XPCA 4XCVA 4E2YA 1U4OA 3OFSA 4XGNA 3DBRA 3GPIA 2RBEA 5KOIA 3GRPA 1R0LA 2D3TA 3BMOB 1A4IA 5EPOA 4E5NA 1EK6A 3WYBA 2I99A 3CSDA 1WXDA 3DZKA 4Z9FA 1ISMA 3GVXA 1C1XA 3K96A 1LBEA 1TT5B 5FI3A 1NVGA 1VC2A 4OMUA 4B4WA 3VDQA 4CR8A 3IP1A 4HNHA 2BHLA 1ZK4A 3DHYA 3RD5A 1C0LA 2O3JA 2ZCUA 4J16A 2O23A 1OZAA 2OZPA 1IL0A 1TXGA 1A7AA 1JQBA 1YQDA 4HNGA 4IS2A 3VVCA 4DL9A 1KVQA 2PZMA 1UZLA 1QKIA 2DC1A 2VOEA 1GQYA 1PU2A 4GBJA 4BKOA 3OSUA 1NQAO 5A9TA 2Q50A 3OH8A 3KYBA 3HB4X 2YUTA 3H3JA 1VSUA 1HRDA 2R2GA 3DOOA 1XQ6A 3W1VA 4PZCA 4ZQEA 3ZV4A 1CWUA 1MXHA 4J49A 1QYXA 3HN7A 4U0JA 2IZZA 3IUSA 4BGEA 4DREA 4CMKA 1C0PA 4J7XA 4I8XA 1YO6A 3UKOA 2VWGA 3GG2A 4TKMA 3PYLA 3OBBA 4JCOA 4UULA 1ML3A 3R3JA 3GG9A 4UVGA 3U4DA 1I3KA 3O9ZA 3ZZNA 3ZGYA 4CUJA 3RSHA 3AJRA 4IXWA 4DPMA 2W8ZA 3MCVA 1K6IA 4JROA 3L6OO 1VL8A 1ADFA 3PJFA 4J4TA 3QLJA 1UXJA 4JNKA 5GMOA 2WE8A 3Q6IA 3VC7A 1WDMA 1ZIDA 2YV2A 1GD1O 1B7GO 3K9QO 3VPFA 3VH3A 4OIMA 2YDYA 3AOEC 3Q1LA 1HDRA 2PKQO 3BZUA 3PJEA 1SAYA 2A94A 3DDNA 3RBZA 2JL1A 4NBRA 3WXBA 5T8KC 3OECA 2ZCVA 1IYZA 1T1RA 1AN9A 3AW9A 3DB2A 5I9LA 5CEJA 2YHIB 1T26A 1YKFA 5CDUA 1P33A 1X0XA 4IJWA 1HSZA 4MVJM 3NGLA 2NV6A 3F3SA 1E7WA 3D3WB 4JLWA 5I7SA 2Z1NA 4N5LA 1WMAA 4RVSA 6LDHA 4HFNA 1E1MA 4YAIA 3F4LA 4I5DA 3RROA 2Y93A 4CLDA 3GF4A 4XYLA 1MXFA 2VUUA 2IDZA 4KDFA 4CM7A 4RPGA 1TB4A 3R6DA 4XQCA 1BRMA 4BNIA 1PEDA 2BF7A 3OA2A 4U6QA 4PN3A 2I5PO 3FWZA 3IKVA 1D1TA 2F00A 4IM7A 4LK3A 1KVTA 4EUEA 1W0CA 1LC3A 3GUYA 3QRWA 3TNLA 1KERA 3G17A 4J9UE 5IDXA 4ZICA 5DOZA 1DJNA 1R37A 1QLHA 4U5QA 4GLLA 1MX3A 4BO2A 3Q3CA 3O8QB 1VKOA 5L3ZA 4CMAA 5EQFA 2W2LD 1PS0A 2O2SA 1H5QA 1Q0LA 2X5JO 1K6XA 2GN9A 2IZ1A 1BXZA 1JVSA 3HN2A 3VTFA 3LT2A 3NJ4A 2WYVA 1HLDA 2DBZA 1PL6A 2VN8A 4R41A 1HE2A 1R4NA 4NJOA 1ZK0A 1U9JA 2X1HA 1A72A 1BXKA 1I10A 3QJ5A 1GPDG 3UGKA 4CQMD 3RASA 1YL5A 2WEKA 1KEPA 4I9UA 2X23A 3RU9A 4RPHA 3QVOA 3WLEA 2NVBA 2Q49A 1XGKA 4E13A 2PY6A 1YVEI 5CDSA 1U7HA 2O48X 3DOJA 1WLYA 4PZEA 1XYGA 3RUCA 4BNXA 1SB8A 3H6KA 1GUZA 5B4TA 3A06A 4BNFA 1UP6A 4MVJF 3EDMA 4H16A 1RYDA 5T5QA 1EBUA 1P3DA 1M6HA 4YEDA 4ZU3A 2P9CA 2Z1MA 4EJMA 1FDTA 2DUWA 3KSDO 4FFOA 4M1QA 4F6LA 4J6FA 2DU8A 1E7QA 3PGXA 1VJ0A 2HMTA 1AHHA 1FDWA 1DIBA 4HX5A 3GGOA 4QT0A 2X9NA 1E5QA 1NP3A 1LRKA 1PL8A 2I3AA 2AE2A 4J4BA 1ONNA 3C1AA 3ANLA 1K2WA 2FPPA 4MIOA 3KXDA 1ZK3A 3RWBA 4Y6SA 2Z95A 3GR6A 3V2GA 2AEJA 3JQ8B 3PP8A 1X0VA 2V6FA 3F4BA 4G5HA 4IDCA 1MC5A 1DIAA 5L7YA 1XG5A 1P45A 3OEWA 4B7XA 1G6KA 3BTVA 3EGOA 3QE3A 4RO0A 3VH4A 1KEUA 3UCFA 1BDBA 3RBXA 3S8MA 1U2DA 7MDHA 3PFFA 4WUVA 1BWSA 1HXHA 1RPNA 4L75A 4M87A 3L9WA 4UREA 1Y9AA 4IS3A 3ZI0A 5KJFA 3OF2A 4W99A 3MOGA 3U4CA 1DFHA 3MTGA 1TVEA 1LRLA 2WMDA 3PLRA 4IJUA 4J2HA 1KETA 1QR6A 2RHRA 2VYND 5JW6A 1IULA 1F14A 1HDXA 4RDHA 4WGGA 1YGYA 4MP3A 2EGGA 1NFFA 2HKIA 1HYHA 3SX2A 4IZIA 4O0LA 4KQXA 4DPKA 5KTKA 4W7HA 3GZ4A 5I7VA 1C3VA 3VZQA 5DDIP 1KY5A 2NADA 4ALMA 1H6CA 1Y5MA 3S2IA 4FIZA 2Y66A 5AXBA 1WW8A 2AQKA 1BXGA 1NAHA 1XSEA 4W82A 4PG8A 4II3A 1LDEA 2J6IA 3AU8A 4AJ1A 3IJPA 4UEOA 2CDCA 1DC3A 3LDHA 2HJSA 5JXWA 3PZBA 2HSDA 2ZB4A 1PWXA 3MJCA 3I9KA 4RQUA 5JE8A 4C7JA 2QW8A 1ZO8A 2AA3A 3ROPA 5TS3A 2C2XA 4WLNA 1B8UA 5BSGA 4B3HA 4HXYA 4ALLA 1MGOA 1T25A 2EKPA 3ZWMA 3VZSA 5F1PA 2YY7A 3KLMX 5K9ZA 1TA4A 2O3SA 5U9CA 2HQ1A 3CZRA 3JQAB 3ROMA 1O94A 2E6UX 3FR8A 5AYVA 1LDYA 4GL4A 1NAIA 1HE5A 1C0IA 1GCOA 3DAFA 4RQTA 4A73A 4FPXA 4E5KA 1XDWA 4DXHA 1QYWA 2I3GA 5G4LA 1ISHA 1W4ZA 2BD0A 4XDYA 2VZ9A 5IZCA 4YJDA 2WSBA 3T7EA 3DBRB 3IL2A 4LW8A 5JMWA 1I8TA 1QXSA 3DMTC 2JFGA 3D7LA 4HBGA 1SO8A 1O0SA 5C7OO 5KKAA 2Y67A 3TOXA 3DXFA 4IXTA 1ZNQO 4IDAA 5F3RA 1U1IA 4UUMA 5CEEA 5K6AC 1I2BA 1A5ZA 1GR0A 1YBMA 3JD3A 1R16A 2PD3A 3KOUA 5LC1A 3WWZA 4OOFA 3V8BA 2AQ8A 4A27A 4HKTA 4J1QA 2X58A 5IAAA 4DQVA 1LSJA 1F06A 1Z7EA 2AQIA 3JQCA 2C5AA 2YV3A 1Y5RA 2NLOA 1B14A 2UAGA 2IODA 3V2HA 1ZMTA 3MOIA 1ARZA 3PHLA 3ZHXA 5AXCA 4FJ0A 3ZWYA 2NQ8A 1FDUA 4DQXA 4KDEA 1SEVA 4RZIA 3ZNPA 3I4FA 5HRUA 2GSDA 3E82A 1EQ2A 3ONFA 1GPJA 4YT2A 2D8AA 3WG9A 2O7QA 2GLXA 2UDPA 1P44A 4IDDA 3Q9UA 4NQZA 4EEZA 4XIYA 4WE3A 2A35A 3LC1O 4WNIA 3OQ6A 3SC4A 4TQGA 3IDSA 1ZK2A 1JWBB 4BO6A 1IHYA 4CQLA 2W2KB 3JQ7B 1KS9A 1IB6A 4AJPA 2HLPA 3QW2A 4IPTA 3RFVA 3DZBA 4NJMA 4YQYA 1PGPA 1NYTA 3I52A 3MEQA 4EW6A 2Q45A 5EQDA 4YTEA 4OL9A 4CR6A 3V2UA 1P0FA 2YV1A 3OICA 1P1KA 3HQ4O 1PS8A 2F1KA 3FWNA 1PJ2A 3DMTA 3OP4A 3PHJA 5F5LA 2QX7A 1MG5A 4PG6A 3ZWVA 2DTDA 3A28A 1EDOA 3VKVA 4CM5A 2BGKA 1S7CA 4XR9A 1N92A 3AUSA 5I9MA 4O1MA 4OXKA 1DSSG 2AEMA 1PGOA 4ALJA 2I66A 4KWHA 4Q3CA 5H83A 1EVYA 5CG2A 4ALIA 4XZ3A 1UR5A 4LN1A 5AVOA 1SOVA 3SJ7A 4MVJP 4BGVA 2QYSA 5TLSA 4TSKA 1EQUA 4TRNA 1FMCA 1ZW1A 3GDGA 4JIGA 1HDZA 1CJCA 1K0UA 5T67A 3NAQA 2PR2A 4MP6A 3HFSA 4BO5A 2YFQA 3JQGA 2OORA 3VPGA 3GPDG 1GEEA 5DULA 1NASA 1DPGA 4JBHA 4I5GA 2NVWA 5JS6A 1TT7A 2R6JA 3E5MA 3T4EA 5H81A 1A27A 3O38A 4IZHA 4YJGB 4AJKA 1SMKA 2EEZA 3WOHA 5DP2A 4B7UA 2EP5A 1NR1A 5THQA 3H3FA 1EMDA 5JAMA 4YAEA 3PQEA 4UVHA 1JDJA 2OP1A 1QMGA 1ADBA 4R1SA 2Z5LA 2Q2WA 1EUDA 2DPGA 4GSKA 4N5NA 4W6ZA 2W2KA 3JQBA 2C7GA 1T2AA 1V3UA 5IDQA 4RPLA 5ITWA 4CM4B 2X7HA 4B79A 5CDYA 1ZSNA 1PZFA 2X0RA 3WIDA 2H1SA 3ZU5A 4CUKA 5I7FA 3A14A 4OH1A 3EUWA 4RGBA 5L45A 1VRWA 5CDTA 4UVEA 3DC2A 3OJOA 2H9IA 3OMLA 1OOEA 3UVEA 1O9BA 1PS9A 1CRWG 4DTIA 3D3EA 3DBHA 4TROA 4RCVA 5DCWA 4DBZA 2E49A 1ZSVA 3FI9A 2DVMA 3GRKA 3HUDA 3SEFA 2W4QA 4BO3A 3DBVO 4CUZA 4M86A 4D43A 1E3LA 2AE1A 1DIRA 3VZPA 3LT0A 4WEQA 4EJ0A 1EFKA 4R68A 3AI1A 3DZJA 3IJRA 4NFHA 3D4PA 3JYOA 4MINA 5I7EA 1SCUA 3O03A 3G1UA 1OAAA 4Q9NA 4GH5A 1ULUA 2X86A 5I8ZA 4GX1A 3WWYA 4F6CA 4CMEA 3AI2A 4DMMA 3A4VA 3F1LA 1H0KA 4BUCA 4BOYA 4BGUA 1KC1A 1YB5A 3D64A 4UUNA 4AFNA 5L95A 2DLDA 1CEQA 4KMSA 1I36A 4WOJA 1NQOA 5TJ9A 3BHIA 5IZ4A 1BVRA 1F17A 2WE7A 1PGQA 2ZTMA 4YAKA 4IINA 3INRA 3DL2A 1PSDA 1UDBA 3ZV3A 4KP7A 3D1LA 5HTOA 2OXIA 3CH6A 4BQRA 4TKLA 4DWVA 1NWCA 1XU9A 3PLNA 1GCUA 4KWIA 4KUEA 1XEAA 5ER6A 5KVQA 4DIFA 2Q2QA 2QIOA 2HMSA 4R16A 3AM4A 1KVSA 2VYNA 3DO5A 2BKAA 1C1XB 2VHZA 3ICPA 4FBGA 4BKQA 3G79A 1MA0A 3UAGA 3UFXA 3JSAA 2X0NA 5DCUA 3TDKA 3JTMA 2Y1EA 3CZMA 5A02A 3PRJA 3VPHA 1G0OA 1DIHA 1ZEJA 1HDOA 2G82A 2AQHA 2FHSA 1OI7A 2BFPA 5I9NA 3AWDA 4LSWA 3VAZA 2GN6A 4OSPA 5JCJD 1V6AA 1VE9A 3RFXA 5JPIA 1T24A 5CPFA 2WJPA 1D4FA 2OO5A 4NK5A 4MKRA 4NR0A 5EIOA 1KBZA 4AICA 4XDZA 5ICMA 3SC6A 1DO8A 1HSOA 2I67A 3AM3A 2E4AA 3BIOA 1V0JA 3ETDA 2D5AA 5DZSA 1T2FA 4YJHB 3QV1A 1U3WA 3BHMA 1R15A 2E48A 5A9RA 4L0QA 3GVHA 2GO1A 2JHFA 1YDEA 1F8FA 2GGSA 1X1EA 1L7EA 3K2EA 3PJGA 3E9NA 4PLZA 3ETGA 3IOYA 4BV8A 4CV0A 3TFOA 4C4OA 4BNGA 4PG5A 1UDAA 1KVRA 5AQ1A 5ICSA 5K6AA 1GFSA 4F45A 1E6UA 4NFYA 4Y6PA 2X6TA 1DRWA 3PQDA 3B1KA 1GL3A 3GMSA 1NQTA 4XKJA 1B26A 5LDGA 4A10A 2ZTUA 4LCEA 4CPDA 2GPTA 4PG7A 2W98A 1YONA 3PXXA 5IZCC 2X4GA 1I5RA 3DEYX 4ND2A 4FDAA 4DGSA 1O89A 3DTTA 1LSSA 5MDHA 2Q4BA 3UF0A 2UUPA 4I5EA 4NNJA 5IXYA 5ES3A 4FFPA 2HUNA 3KBOA 3FNFA 5G0WA 4WJZA 2J3HA 1Q0HA 3W4KA 4NMHA 2YQ5A 3WMXA 3U3XA 1ZZEA 2QZ9A 4UEJA 3JV7A 4BKUA 4AJOA 4QECA 4Z9YA 1QLJA 2OFPA 5T8KA 3RFTA 5EN4A 4Z0TA 4LMRA 1R0KA 1NHWA 3UCEA 4U8GA 1F8GA 3E1KA 4PLWA 3BYZA 3PI7A 1R4MA 1PZGA 1T2EA 2X5KO 2B0JA 4Z0HO 4ID9A 2JCXA 5CAEA 2VT3A 3PQFA 2VZ8A 4DLLA 3ZN2A 3MZ0A 3ZV6A 4BNZA 3H8VA 3DAPA 5EESA 3N58A 3CTMA 3OHSX 3QQPA 4WPGA 1AXEA 2ZQYA 3PIDA 3K8ZA 1PQUA 5JCJA 1G1AA 5TT1A 1PZEA 1LXCA 1P1FA 1MFZA 4L8VA 1MP0A 4X54A 4ZVVA 1Q7CA 6ADHA 4B4VA 3QWFA 1LQUA 1HDCA 3OIGA 1P77A 3CKYA 1YQGA 2CVOA 3K5PA 1M67A 1GEGA 1HDGO 4XIJA 4TRJA 3KETA 4RF2A 1DC6A 5CFZA 1CIVA 4CM1A 3W6ZA 5BR7A 2IEDA 4QSMA 5U1PA 4N5MA 3JQAD 1Z75A 4PLTA 1W6UA 4NBUA 3TZKA 1BW9B 1O95A 5K0ZA 2VUSA 4Q3EA 1MB4A 3WGGA 2NQTA 4CQMA 4DIBA 5TGDA 4AJJA 2WWRA 2YFHA 4B4OA 3BMCA 4Q3NA 1IY8A 1PJQA 5DBFA 3GNTA 1AHIA 1HYEA 3H5RA 3U4IA 3L4BA 2JFFA 1LLCA 3WYEA 4PLYA 3RAJA 4FSHA 1A9ZA 4ND3A 1TI7A 2G5CA 4D0RA 3WSWA 2Q1SA 4XR4A 1XKQA 3ZDFA 3EYWA 2P2SA 2HCTA 2JHGA 5EERA 3L6DA 4BNVA 1C0KA 5GZ6A 3ONDA 1U8XX 2VTEA 3WQQA 2BFAA 4BMVA 3M2PA 5JC1A 5J23A 1GUYA 3HDJA 1V35A 3PIIA 3BMNA 3DZIA 4WEOA 4Q3AA 1ORRA 1NPDA 3OIDA 4MVJG 3GMDA 2NM0A 3A9WA 4L9RA 3D4NA 4A26A 1Y8RB 2NVUA 4LSMA 5COAA 1LLDA 4AJ2A 3GEGA 3FHLA 4RZHA
chains in the Genus database with same CATH superfamily
3PDIB 2CFOA 3KKPA 4RL6A 2VSYA 3QVTA 2H5EA 4MI9A 3UC9A 3L06A 2VBGA 3Q3VA 2ADOA 2R8EA 3R09A 4GX0A 4IQ0A 2GM9A 4KO8A 4L85A 1NU6A 5CH5A 3R3SA 1ZQ9A 4R0NA 2HMWA 1WG8A 2G06A 4RF3A 3TRHA 3BTSA 3ZWPA 2OBBA 5J4LA 4ZYTA 4X84A 4FSXA 3EXFA 4QG3A 4B6JA 2JBAA 3ORHA 4CIBA 5KTNA 1FFXB 1DHRA 2JBHA 3L4BC 3QYAA 2BMAA 4JU9A 1WNTA 2QV0A 4N54A 2BWJA 3EIFA 1HC7A 1G291 3FRHA 3GHYA 1KVUA 4QGSA 1N77A 2G1UA 1M73E 4WASA 3I05A 2ECKA 2VYVA 5HE9A 1XQXA 3I4CA 3FSRA 3VDRA 3KQHA 4LQLA 4YP6A 3NM6B 1JHMA 4B74A 2Q1XA 5HR5A 3FE2A 2D7CA 3PT5A 4IH1A 5HGJA 2Z8ZA 3O84A 3OZWA 2O3UA 1AZSC 4P93A 1UKCA 4QFDA 3K9WA 3FBTA 4CI0B 5HIIA 3ZHVA 4D9KA 2VP9A 3ZHQA 1FQJA 3S68A 1Z4KA 3HWSA 3O7WA 4FMPA 1H2EA 2CGEA 1L3IA 4JFAA 4UBLA 4AP6A 3K2QA 3FOZA 2JAOA 1V1RA 3R3XA 4MKGA 3DMYA 1IATA 1EUYA 3E3OA 5EFZA 2F8TA 2NPIA 4FYPA 1ORWA 2Y4NA 3PYMA 4L5CA 4D42A 4OYRA 4TX1A 2ADMA 5JALA 4MWBA 2E4VA 3SY8A 3QE2A 1K8RA 3SHWA 1EE9A 4KXFB 3T06B 3GLRA 1UPTA 2CYAA 8LDHA 2PM8A 3RSLA 3MK31 5BNZA 3B6JA 4QYMA 1YQXA 2R2AA 4QDUA 4BNJA 2CBZA 2LKDA 3G5LA 2ZBRA 4PANA 2ZIGA 1HYGA 1Z45A 3HUUA 5AHXA 1FJ2A 2Z2IA 3M6UA 4LZJA 3SM3A 1XTBA 1U8EA 1E9AA 2XB8A 3L8ZA 4M0EA 1R6UA 5DM2A 3UM9A 3O4IA 1YZNA 1UEXC 4NV0A 1A8PA 1UBHS 2IK8A 2HOQA 4FGLA 5K7SA 4WJLA 1ZUD1 5FP0A 4A2QA 1ES9A 4FQ7A 4DR1B 3QVVA 3UK0A 3SMVA 1UL1X 5KJ1A 4ZEOA 3U4AA 3K8QA 3W77A 5K2OA 3K6RA 1LBHA 4EH1A 1JYFA 1PJ3A 1XLTA 3R3UA 4JFRA 4UTRA 3UHAA 2WF6A 4RULA 4IMJB 3U44A 2O1SA 4LHSA 5M5BA 1VIAA 4JDUA 3T54A 2AOUA 3LMKA 3MJEA 3ZTYA 5LVAA 1R6BX 4AY6A 1UOQA 2ZETA 1Z2AA 3Q40A 1SNYA 3IDZA 2J30A 4CMIA 1WUHS 1BHQ1 1CETA 1Q1EA 3NT2A 5GVRA 3JASA 3HPRA 2C82A 1GZ7A 3N8HA 2X2FA 4I50A 4YGYA 3RH0A 4LAFA 2DPMA 4ASUD 3OX2A 2CXOA 2XRMA 4KAFA 4LKRA 1Y7PA 4GPZA 2EJTA 4P58A 4J1TA 3ZS9A 1HQKA 4CTOA 4M4SA 3LYUA 3GRUA 4OHCA 1YB2A 1RABA 4J75A 1II0A 3C4QA 3HDYA 3O9MA 1FZQA 3UW3A 1WB4A 1YOVB 3OZUA 1G16A 1NKTA 1PUJA 3FLEA 3HXPA 3N87A 4WDRA 1LQ2A 3GUZA 4ZV9A 5KC9A 5ICCA 5KYNA 1C4KA 1SIOA 1YB6A 3NQ41 4AM8A 1F1JA 1X8XA 3G13A 2W90A 4EO9A 4HT3B 2OYCA 1O9HA 3T8YA 5KOYA 2JATA 4C89A 1HE8B 1WBDA 3ANMA 2DAPA 5B4VA 1BZYA 2I22A 1QE3A 3CU5A 2VDVE 3DEZA 1JU4A 3COZA 2XGMA 3T1NA 3LT1A 5LZ8A 3LH5A 4A8JC 3ZJVA 2ONYA 1PLLA 4S0XA 3IIIA 3QZUA 3C3MA 1UC5B 1GR1A 1IONA 2CNKA 1EA7A 2Q29A 5KQPA 3PQ4A 1VHDA 4ZDKA 4GC5A 2EQBA 4A0SA 3OPXA 4EF5A 5L51A 3L04A 3KTDA 3PRYA 2ZR9A 4HUJA 1XNRB 3PKJA 3Q11A 4TWJA 3KPJA 3N7TA 5BRNA 1EHYA 1MZVA 2QYTA 4WZAA 3TZHA 1ZOOA 5C8VA 3ER8A 3GOHA 4HYTA 2GZ3A 4DMLA 4ZEWA 3BE8A 5BQFA 4BMNA 4J16C 3EXAA 4IDHA 1M8KA 1BCRA 3A2NA 3ZDXB 2FFQA 3F8TA 4X8HA 2WBLC 1OASA 4WCFC 4HFRA 4HQLA 2D1SA 3UG6A 3X1JA 3R2JA 2YYSA 3RADC 1P18A 3DF9A 1ODLA 3WB9A 4ZKDA 2QMQA 4NBVA 1JFVA 4U9IS 5E1OA 4YY3B 1WXEA 4CFSA 4EL0A 2CV2A 4OHRA 1KQPA 4TZ6A 4C6RA 5AKHA 5I8WA 4RGVA 4W1SA 1GU0A 1EXDA 1VYVA 1Z12A 1G5HA 2RDMA 4IL5A 1XXHA 3LLVA 5C18A 3QOFA 1WUYA 4OUDB 3W7VA 1ZNWA 3E61A 4R4JA 3T7SA 5IF3A 3R0QA 3JD4A 2WQ6A 2IHNA 2I4OA 4HX2A 4J1SA 1TU0A 3AOEA 4AZ0B 4JKIA 2ZIFA 4X1KB 4C5CA 4CNQA 2F8MA 1O5IA 3ABOB 2JZOA 1WVGA 5B7NA 2GPJA 4XIFA 1XP5A 3KOMA 2BGWA 1NVVQ 3L8HA 3WSTA 1KH1A 3VR5A 4C6TB 2I71A 2C2WA 2FSHA 2PUAA 5E2BA 1AGNA 4P33A 4HX9A 3P4YA 2TMGA 2EP7A 3D4BA 5J2TF 2HIHA 4RD6A 4QU9A 1KWKA 3N2KA 4BU1A 3KFVA 4Q16A 3S70A 2KQUA 4GMGA 3VQTA 2JD0A 1I1HA 3F9RA 1LTHR 2I4RA 3QPDA 1NUUA 2PPLA 2VH1A 4ZZ2A 1JR4A 4MQMA 3DAYA 1FYVA 1V4BA 3RC2A 1ISIA 1CUFA 1PK9A 2R00C 1XPJA 3BORA 3KD3A 4N9WA 4LGYA 3CISA 3HCOA 3THSA 4PS0A 3RR2A 3UMBA 4D3SA 5E1MA 3S0JA 1W30A 4C2AA 4V02A 4BRZA 1WUKS 1XMOB 1V11A 1YZKA 2W2XA 3NP7A 5KX5A 4LBZA 4HDNA 1VL5A 4YUVA 1OZ0A 1XZFA 1LNSA 1IY2A 3I9LA 1I4LD 1I3NA 1T10A 1TO2E 2YW9A 5FO0A 5DTEA 1TKAA 1KNQA 3FPSA 1CW2B 4OQDA 3EPLA 4R51A 4E4RA 5FBLB 1A04A 1WSBA 5FKJA 3V1MA 1B2RA 4LI0A 2C97A 3DBLA 4J0KA 5EWMA 2ZCJA 3IC5A 4OLHA 3CR7A 2NSJA 4JGGA 3H2GA 2QU7A 4QO7A 1C29B 2V55B 4DANA 3U5ZB 1V48A 2XQIA 5CJ2A 1R8XA 5DLYA 3O1LA 3ISVA 1Q1BA 2FSPA 3R3HA 4F5EA 5LLDA 2DUNA 3OJCA 3E22A 4AROA 5AW2A 3EJ6A 5C5CA 4YVFA 5CXUA 4OF4A 3U7RA 3P9PA 1IZZA 1WV1A 5BV2P 3TRIA 3GLHA 5HCNA 3U48A 2O7SA 4KRGA 3DEJA 2ZSHA 3T35A 3N7AA 4AUMA 3U7HB 1M6WA 4FD3A 5DLQC 3GRAA 1YU9A 4JBYA 4R8VA 1G0NA 5TVGA 1PBTA 2AC7A 3C7DB 3EMKA 3V7WA 4A5SA 4TQAA 1YRQA 2IY8A 3ZE0B 1LPBB 1E6WA 4JK3A 2I78A 5CVVA 2C0CA 4U6SA 1KFKB 1L4EA 1JNYA 4QBGB 5TE9A 2NO6A 3OWXA 4OB8A 2D0DA 4CG2A 2BH9A 2J45A 5AUNB 4OBXA 2FQXA 3WKEA 3KM0A 2W48A 1Q21A 2AG8A 2NO9A 3EVAA 3MW8A 2V65A 4GI7A 4H4EA 4K28A 4ZXFA 4E33A 1UBKS 1UFKA 4NYMQ 2R7MA 4PYIA 5FEUA 4WK0B 4WJKB 1JIIA 2GAJA 2ISCA 4CWAA 1P7ZA 3IQHX 3EARA 3FKSA 2GTPA 2XXBA 4IDFA 3DMPA 3R5KA 4Q19A 5AM1A 4C30A 5A2QA 3PYXA 3UH1A 2XXAA 4A03A 3W6UA 1NN3A 3KEQA 3I01M 5H8WA 1QX4A 3T7TA 4LI3X 1IPFA 2ZPTX 3DEIA 5KI6A 2Y1FA 1UKVY 1L7PA 1IZ8A 1D7OA 5J1SB 4W8HA 1MD9A 1RHUA 3ZVNA 1BE0A 1J97A 1BA3A 1OA1A 2CJYA 4TT8A 4XFKA 3MWEA 3IV9A 4PGFA 4UNNA 5ALUA 1SXIA 4A6PA 4PRLA 3UOGA 4Q37A 2Q6LA 4KNWA 2WYIA 1ZM9A 5ULLA 5JS2A 3QA3E 3AI3A 1C9MA 1HA3A 5JEDA 2AFHB 3EXG1 3D7MA 4UAUA 5D1HA 1GPYA 4HRAA 2BGMA 4YUYA 4F2GA 2VAVA 2KBEA 5CB4A 2VBFA 1LWNA 3L4EA 4XCXA 1PX0A 1TJ4A 1ZC4A 1XQ9A 4DNXA 2NU8A 4QOEA 2QG9A 5HX7A 1N2BA 1RYEA 5DT2A 4CCWA 3KQWA 2Q3CA 4UUBA 5KYUA 1B1AA 2J3IA 2PWZA 2L69A 4CM8B 1CKEA 2J3EA 4CIXA 1L9XA 2XUZA 4YREA 3PFIA 3G85A 4DYDA 5C4IA 3EVFA 3KPYA 4M6WA 2G63A 3VYSB 3RPEA 3GI1A 3IAXA 2W2TA 3ZHRA 4XLLA 3JQ6A 3SXUA 1LV8A 2GEDA 1X7YB 1AA9A 1WQ3A 4RMHA 4B46A 3W5CA 2CMDA 1XIVA 3AHEA 3ZCUA 1LDMA 3TB6A 3AZPA 4QUBA 2EJBA 3THYA 1RXVA 1E0KA 3VHLB 2QI9C 3NEAA 4QG7A 6CHYA 3HWWA 1AKEA 1XTPA 3HY6A 3GRZA 2GK4A 2H1RA 3PUWA 1I7PA 3Q4GA 3BD7A 1YQUA 1UBEA 1VJTA 2G5TA 2MOKA 2JAHA 4YP1A 4TLEA 4S1VA 4IVQA 3M6MD 2CJWA 4OGFA 3SSMA 2OL4A 4URUR 4RTNA 5CIQA 1Y1TA 2H9YA 3PPIA 1PG2A 2OG2A 3L0ZA 2C00A 2BFCB 3RVJA 2HADA 5KNBH 3FJYA 4FDTA 3K0KA 4GNRA 4OHPA 4JHLA 4GICA 2QWXA 2OTCA 1G5PA 2H3EA 1O87A 3NX4A 1VPWA 1P9NA 1ZM7A 2HWKA 5DHTA 4J3JA 1YRHA 1JEAA 1Y4UA 1V8BA 4BIMA 4J4HA 2WTUA 2YN0A 1ISFA 3LHFA 1PP4A 4KR9A 1Z22A 1O5OA 4EVQA 2J3KA 5HG0A 3PNKA 4NK4A 2DWUA 2XQJA 4MZXA 4TN1A 5HJEA 2AN1A 3VSDA 2VIIA 1C4OA 2G04A 4Y2UA 4ETNA 4ZZ0A 2VXOA 5FAXA 3GA7A 1YQWA 4RD1A 5KJ6A 4TXMA 2M1XA 1A98A 4DQDA 5DNWA 2GPWA 2PZKA 3P0HA 3T1QA 3TNJA 3VR1A 4JT8A 5JBNA 2V5UA 1NKVA 1RE1A 2R47A 3BAZA 5DHRA 3WE7A 4BFXA 3FNQA 1YC2A 5K3FA 4O2AF 2OUIA 4ND5A 4QBTA 5EY5B 1UODA 4B43A 4L76A 1YKGA 2LDXA 3R1IA 2PDAA 5K3OA 5KYWB 2I2FA 2GJAA 4KTVE 4GL2A 3KFLA 1RWPA 1IOLA 3LY9A 4C0KA 1TF5A 1P0MA 2NZUG 2D7JA 3RFUA 3PX7A 1TJ3A 4ZXPA 2HSJA 4N0PA 4DHWA 5I4IA 3GN2A 2A5JA 2B82A 3NWBA 1IIRA 1I24A 1IUOA 1RQNA 2RI1A 2VPYA 4HQKA 2LV8A 3ABIA 3WBBA 1ZJWA 4E5MA 2BT4A 4YMIA 2NUTB 3SLRA 2IHJA 2AKEA 2EARA 1P31A 4MIEA 4LC1A 3W7AA 2IZ0A 1ZOPA 4EECA 1Z4MA 4AU1A 4DCNA 1N33B 3IQGX 5AKJA 1XZLA 5CIWA 5L4NA 1HETA 4B83A 1BRTA 2W58A 3KAJA 1JSCA 2C99A 1M1YE 1PL7A 5AI6A 2PD6A 4BCCA 4PYJA 5B2EA 1MG0A 1N5KA 1WTCA 2H4ZA 3I45A 2Y1KA 1L1RA 4RIFA 4MVYA 1G20E 2AL7A 2HU7A 2I2DA 2WWIA 1Y1LA 1M7HA 1N2GA 3DKRA 4MVCA 3SJUA 1KAMA 3H8JA 2WA1A 4ZJUA 9LDTA 2C4TA 3SZGA 3D7KA 2X8JA 4HGPA 1C1DB 3U60B 2QVGA 2JFOA 3CLSC 4UUOA 1H8HA 2VRCA 3K5HA 2DFKB 2YOHA 1CRPA 5ALMA 3WQRA 1CYEA 3BDAA 1HMPA 1X3SA 4EZBA 3L05A 5FUBA 5CBKA 1U0JA 3WDLA 4N76A 3B7GA 1QRTA 3BX1A 3JRWA 1RP1A 1N5DA 2QLMA 5B64A 5TT0A 4K9RA 2E89A 2W6IA 1BW9A 4LVUA 2QG4A 1JAXA 3KEGA 4XJSA 1PIWA 2JLSA 1BVHA 2C1EA 2XB4A 3O8DA 4HD8A 1XDBA 3E9MA 2Z8XA 2AF3C 1DUSA 3H65A 4AZWA 4HDOB 3NGXA 4MYCA 1ZAYA 2XAAA 1P2VA 1A71A 1Y4AE 2Q4OA 1V4NA 2E7ZA 3ANNA 3KEMA 3EK2A 4PRZA 4QPJC 2PZEA 4WRRA 3G2PA 1GZ4A 1UJ2A 4Z9XA 1JAIA 3SKYA 1U5AA 3H7AA 4WZBB 2AOTB 1ZNXA 1U28A 5DCLA 5CP8A 4FDLA 2B83A 2C8JA 2HXGA 4HAUA 2PJRA 4MVJH 3I9NA 2FZCA 1HZJA 3BFJA 1JW9B 3D4OA 5FUVA 4ZOCA 1IUNA 2Z3ZA 4W1RA 1W46A 3SOZA 1SQ5A 2F43B 4CMHA 3PXBA 4JI3B 2ZM5A 3GGSA 1VJGA 1SKYB 3ROXA 2V3WA 1RJGA 3P2JA 3VPXA 1S2IA 3E05A 2QX8A 1ISJA 1AXRA 2CXQA 3A4NA 4FKZA 2XVYA 4BHTA 1NUQA 3GXOA 1AHNA 2XHZA 1PR5A 5EJ2A 1J9EA 4X7MA 4EJ6A 1BWQA 4OQXA 3TDMA 2FP4A 4F46A 1N0VC 3TLMA 4GX2A 3TE7A 1KZHA 3KKEA 5A1TA 4XX0B 3WLNA 3ICEA 1NJSA 4KVFA 4RVUA 3COJA 3IKMB 4O0MA 3R0ZA 1ID1A 1NR7A 3KJZA 4QLAA 2R97A 4Q3KA 4QGGA 4YAWA 2AC2A 5IDYA 1UBGA 1X8JA 5FA8A 4W5NA 2NZVG 3KE8A 4JLMA 3Q8WA 3ZU6A 2CXXA 4M8LA 4N5HX 1ULHA 4C7XA 1PSZA 3KPWA 4ENSA 1GUBA 3FZGA 1L5GB 3L77A 4LRSB 1AMUA 1NNUA 3QUAA 2OC9A 4M1ZA 1K5HA 5HXAA 3BIXA 1WMEA 3CSUA 1EEHA 3I53A 1HM5A 2C3MA 2MMGA 2W6ZA 1N7HA 4ZYZA 3T15A 3DP7A 5JYEA 1Z63A 3RWOA 3VHRA 1EA5A 1FS5A 3FN4A 3ZWCA 1V5WA 4X65B 5LM3A 3OD1A 2P8SA 3SU8A 2GPSA 5C81A 3BEOA 5JYDA 1S8OA 1QJ4A 2GEKA 1X9GA 2JIPA 1U65A 2OHFA 4KQMA 4X20A 5BNIA 4HQNA 3I5MA 1ZXBA 3WMWA 1XALA 4Q93A 1MAVA 3VSAA 1WUIS 4D45A 3WWOA 3F78A 5GM1A 3G88A 2AEFA 2YJ5A 4PQFA 4Z6KA 3T7DA 3MM4A 3BKXA 1YBFA 3CA8A 1D2AA 1YDGA 3GRFA 5SY6A 3IQXA 4L4UA 3VPAA 5HRCA 1SC1A 1JHQA 5JZMA 2RE8A 3TR5A 3VFDA 2O19A 4JP8A 2PJUA 4FW8A 5AW3A 2XZOA 2H2IA 3UJBA 4PFKA 1FP4B 3DW3X 4G97A 5FPYA 1WEKA 3F0TA 3LXMA 4CIWA 4A15A 1IHOA 2QNIA 3ADCA 1FNCA 2CXSA 4YASA 2C83A 5EPUA 5IW8A 2WTXA 1XDDA 4UNIA 1IE3A 5HMMA 1S2DA 2IU4A 1N6RA 1YRYE 3WXMA 2XODA 4NU5A 1WCXA 2GEJA 1JFFA 3TZCA 1HQDA 4O4HB 5L3QA 2H2FA 4P7FA 2X0EA 2AG0A 2GRJA 1SXHA 3GUVA 5E0KB 1NVDA 1I3LA 4YJFB 4BN0A 3OTHA 3M4XA 1QF9A 1YQEA 4Y6LA 1R0BA 1QE0A 1TGVA 1T4CA 2FPIA 2P68A 3FPHA 2ZB7A 3OJXA 2PZGA 2TSYB 4ZAWA 5G3ZA 4X62B 1YJXA 1VB5A 2E1PA 2W6ID 3ZVLA 4MCHA 3M7IA 1RXUA 4CEIB 1ODIA 4HOYA 4OMDA 2O3TA 5LKRA 5IP5A 4F5WA 2YVQA 1M6VB 2ZE7A 1H2RS 1VGQA 4ID3A 1GIAA 5EZYB 1DWOA 3P94A 4Q7LA 4PGHA 1TTQB 2X5OA 4E3ZA 3THWB 1Y9JA 2Y0PA 4DBVO 3UC5A 5TJHA 3TS1A 2VJMA 2YMQA 1YV9A 2B21A 3I34X 3PF8A 5H3HA 3CYFA 3QWIA 1LJLA 2X4DA 2JFNA 3HVJA 2DM6A 4AMYA 2CJXA 1RRGA 5JJLA 3QX3A 3GK3A 5JO0A 5AQEA 2GT1A 4YMVA 5FWYB 5FTMA 4CL0A 4AI6A 4KSBA 2E4YA 1AE1A 4MS4B 2V6BA 1DNPA 4R2IA 1OT3A 1NRXA 3VYVA 4RPCA 5FWXA 1T9AA 4J3NA 4ITVA 5DWDA 4OX9B 1O95D 1OFIA 3ECAA 1ZAKA 2WHPB 4HH0A 2J7PA 5H9VA 4D9GA 2YHUA 3EJWA 4RX1A 3Q9SA 1HT2E 1KMCA 3FZQA 2P3QA 3QVSA 2EWMA 1Z2EA 2HCFA 2ONKA 3ADOA 1E3SA 2J6HA 3PPWA 3V1KA 3HU1A 3HNPA 5FT9A 2RHOA 4WXHA 4U7JA 1KP2A 1T36B 1XELA 5BUQA 1VIVA 5A5EA 1C8VB 1IQ0A 4WZAE 3TKLA 2IRWA 4YQEA 4MRMB 1KSHA 2E3JA 1IMJA 3WO0A 5DGDA 1WTAA 3ON5A 2QMOA 4WV3A 5CLGA 3H9JA 4IIJB 3A6ZA 4G84A 1L3BA 1R9NA 3DL0A 3MRTA 1MDFA 3PNMA 4NG5A 3T7KA 5EJ7A 2HHAA 3KG2A 1K7XB 1VHJA 2QR5A 3H0EA 1DUIA 2ZVQX 5T4HA 5K0NA 4ENQA 5BP7A 3V8NA 3KXLA 1LA2A 2HK7A 4MUXA 4UTNA 4AN4A 5B1YA 1CULC 3VZBA 1JFSA 5HM8A 5LQCA 1N5IA 3GEHA 5F2KA 3E18A 3WNVA 5CNMA 1ACJA 4I1SA 1EFRA 1VG9B 1XZKA 3AL2A 3FDFA 4KDCA 2JIRA 4GRIA 3AYXB 3H5AA 4ND4A 5KHAA 1QS0B 3Q87B 4FR5A 2OHHA 1P4HA 3N76A 2Z2JA 3EDCA 3OCWA 4U7DA 3K15A 1Y3BE 1BVUA 2Z2KA 3INYA 4JJEA 1FU7A 3GGGA 2GKGA 3AF3A 1OHHA 1PF7E 2ZIEA 3P9SA 4ITUA 5SYNA 5FOQA 3IPXA 3QFSA 4XI9A 2M9MA 1J0EA 3GJSA 3PDCA 4E32A 3OKFA 1E20A 1I1QB 1W49A 4LXTA 4NE9A 2BBOA 4NH0A 3QSYA 3N5KA 1MFPA 5F3DA 2I2WA 4O2LA 4EB6A 3EH1A 4MKFA 1LH0A 2H2GA 4QNRA 2VDJA 2JGEA 3A9SA 4K6HA 3EZ9A 4YAFA 1QZXA 1Q0RA 2C8LA 4FYXA 3KV3O 4KWTA 4E0BA 2IZ5A 4ARVA 4BMZA 3RYHA 2GCEA 121PA 3U13A 1IN7A 1HY3A 1ULZA 5IJAA 5DGXA 4US2R 3C6MA 1E6EA 2AYXA 1PDVA 1IXRC 3FX2A 4QOJA 1GTMA 4BRWA 3IHLA 1DQRA 2VYVD 5ALJA 3I9JA 1H4VB 3CUVA 6REQB 1ZGJA 2H1LA 2X8BA 5LA6F 5HIAA 3FMVA 4Y0VA 5KWVA 1UBSB 4XIIA 2XADA 3WGNA 4IJQA 3W3AA 4PYKA 2F17A 2VZ0A 2PSHA 1V3VA 2F6RA 1TD1A 2A0KA 1KMHA 1J49A 1QV7A 1XKXA 2V03A 2WKWA 3B1VA 3HM2A 3NTLA 2QX9A 1ULSA 2GN4A 1KXJA 3M6LA 1MEJA 2YYYA 2MSEB 2CBGA 2O6LA 5COQA 3TSAA 2AZXA 1NNEA 1PYDA 2ZT5A 4YMGA 2AXNA 2ZI9A 2REBA 4F38A 4HS4A 4NZPA 1J8DA 5IEBA 1L4MA 4RMIA 3DWFA 3REFA 2FEXA 1NI3A 4HGNA 1D2CA 4P2GA 5AJVB 1QYCA 1WHSB 3DTVA 3ROKA 4EA9A 3LKZA 3AQIA 4DE5A 2HDHA 2VAMA 1BE6A 1JLLA 2VHYA 3OMWA 4D9MA 5I7RA 1C0EA 1E7YA 3DZGA 3O5AA 5AJXA 2QX6A 1PNQA 1WMBA 2NAPA 3WKDA 1KI2A 1RWQA 5JU6A 2PMKA 2GXAA 4LPSA 5I4CA 4OO3A 1ZSYA 2GN8A 2DYKA 4B3MB 3S4YA 1G38A 2QD4A 4LYYA 1ODCA 4NU6A 4DV1B 4LHXA 2WG0A 3RYCA 3U7FB 1JG7A 1BE1A 2ZBGA 3Q3IA 4Y2XA 3AJAA 4TUYB 3ODGA 4B6FA 1M34B 2VAXA 3GGPA 3JD2A 3KUKA 1A9YA 3N2IA 4WW0A 5FFNA 5GONF 3O31A 1ACLA 2Y77A 3GT4A 2HF9A 3IUJA 2F1JA 3WDMA 2I4MA 4BJ6A 2B98A 1BGWA 5LZ5A 3I72A 2QRJA 7MHTA 1O96A 4IY1A 5ADHA 5DPMA 1QC5B 4WUTA 4DRXA 1OZGA 2TRSB 3EASA 1Q0PA 4O2BF 3TMAA 3UWKA 4G1MB 1JMKC 3WTCA 1Y98A 2R11A 2VO1A 1JR3A 1ZHHA 2TECE 1RWBA 2J5BA 4RFSA 1GRNA 1KDRA 1E2MA 2JBWA 2XUOA 1MEEA 4PSUA 1ODTC 2R6FA 5IBCA 3EAGA 2ISQA 2G0TA 3X1KA 1JH9A 1AXGA 3NM5A 4QUKA 1WJGA 5EJ9A 3PBKA 3ZW8A 4FINA 1IHXA 3PDHA 1F6DA 3V6MA 4CF4A 5KYYB 1XCGB 2PGLA 3HCWA 3CE6A 2XB2A 1BSVA 4GR9A 5K3BA 3UENA 3FKJA 1FXWF 2WDPA 2C58A 1ACMA 3IVAA 4WQMA 3B1ZA 2FFAA 4ECEA 4KV7A 5IHPA 2XD9A 3MC1A 4IQGA 3B1XA 1GPH1 1EFDN 2RKOA 3ZG6A 1P4AA 4D57A 3VNAA 5L3RA 5SY9A 4YB8A 5CXQA 3MT9A 1DKPA 1TVKB 1O8CA 1J2YA 1V11B 2AUTA 4RPKA 5E8JA 3V1LA 5FPSA 5JMWA 4BVGA 2HDOA 2QTAA 5DMXA 3EEFA 1E69A 5BUZA 3MWDB 3P45A 2HGSA 4ODIA 3OX3A 3L49A 2QTTA 2Q9BA 5EKDA 3VYUB 3O21A 2NSLA 3E4CA 1J2RA 2GDJA 3S55A 3P2IA 3ITKA 2PZ8A 3ZHYA 2QD2A 3E6AA 4WK2B 1KH2A 1OVGA 5T41A 1YRAA 1DEHA 1KYXA 2P2ZA 2Q3HA 4RGQA 3VU0A 2XJ4A 5EHQA 4ENUA 5JJCA 1YA4A 3PK0A 1RDFA 3BH6A 2OD9A 5CPBA 3T1TA 4C04A 1G21A 1D6SA 5BN5B 3CB2A 4B7AA 1YT5A 4IWYA 3VNBA 4R1NA 3KQTA 2E1RA 4D5EA 5CA1F 1XK7A 3K71B 1LTQA 1H42A 1NBAA 3C97A 3MOSA 4UXIA 2GLTA 4LGVA 1KIFA 3ML1A 4MQ4A 4DLTA 5JTTA 1Y33E 3FW1A 1NBEA 3SQXA 3GVIA 1SG0A 3ODPA 4LY9A 3KK0A 4YXFA 2XRFA 4UHJA 1HDYA 4Q9KA 1G42A 1X1CA 4B34A 5I3CA 1RFGE 3LKBA 3U3OA 3MUFA 3KTOA 4C2BA 3U16A 3OFVA 5JZOA 1OLXB 4MUKA 5FXMA 5KNCH 1GY8A 2VLIA 5FR1A 4YV0A 3K2IA 2IHUA 3KYIB 1QOPB 5ALIA 3DOCA 1EFVA 1LKZA 3LS2A 4QJ5A 4XX0A 1FYXA 1B73A 1CXZA 4RJKA 1N9ZA 1EESA 3RIXA 1UUFA 4TXNA 1JKMA 4MVJE 1MX5A 3KO8A 3BA1A 4C08A 3C14C 5LWQA 2ZUVA 4ZAGA 2WIAA 2PCJA 5E1DA 3WGHA 5BT9A 5EHIA 4DA0A 4DMKA 3EDRA 1D09A 1Y4ZA 1NNLA 4LVCA 3RU7A 2FKAA 1KEVA 5DSZA 3IMGA 4NFLA 1FP6A 4GW3A 3WR5A 1IBLB 5EYPA 1DKNA 1GUDA 4ZO8A 1T29A 4V38A 2P1RA 1RSZA 2A9RA 3A1TA 3F3YA 2J09A 3C98A 3QWHA 1XCBA 2VRWA 2XBMA 2A2ZA 1U11A 3BHJA 1LLQA 3RJ5A 5J59A 3DFUA 2XUAA 1QG6A 4ZN6A 3VGJA 1ZN2A 2WYUA 4UQLA 3GY0A 1E5TA 3L5OA 4OQLA 5HS6A 2RH8A 2V4MA 4R1TA 2G9VA 3THWA 1DLIA 1E3WB 2JVIA 3R3WA 2MR5A 3T3IA 2IYOA 4S12A 1EX9A 1TADA 3OZFA 4UMEA 4YP5A 5HTKA 2HLHA 3VU9A 1JPNA 4R8KA 4Z4QA 4LF9B 2C9ZA 2P9GA 3F5DA 3KHTA 1X14A 2SICE 1PG5A 2IBMA 3FTCA 3DE1X 1C3EA 1UAGA 2EV9A 3K53A 4DMGA 5BORA 3FNIA 3WL7A 1QX3A 4GPAA 5DF1A 4PZ0A 4KO1S 3MPOA 1Z16A 2GTIA 2I8AA 3EXHA 4OGLA 1PZHA 2CCGA 3WYCA 2BGUA 3M3DA 1JQ3A 3ROFA 3L7CA 4QQKA 4KI7A 4DC1A 5LU9A 3WGIA 3PQ3A 4GBGA 4YA6A 2J5QA 2WK1A 1XQVA 2GN2A 1FLAA 4V0RA 3OI7A 3QKIA 1EWQA 5LQNA 3AGQA 3FPEA 5CLHA 1E2JA 3ITDA 4KFUA 2NO7A 4URWR 3P0JA 1T0UA 5ALZA 1RRKA 3MWLA 3ADPA 1B15A 2P77A 1XZAA 3DF7A 1Z8FA 4KJXA 1OFVA 4XW2A 2ASVA 4F3KA 4YN3A 4LFAB 1Z5UA 3NWOA 4OU5A 1V7QA 4GLOA 5ERGB 4EJSC 1J8MF 4IKPA 4ZGBA 1YVPA 3C15C 1J0CA 2P2LA 4Q15A 4CM8A 1P1CA 4LQCA 1JALA 5ICMA 1V41E 2A30A 1GNVA 3QITA 1DJOA 4Z49A 3IT1A 4HR7A 4PY2A 2VS1A 3AF4A 1ZUIA 1MJHA 3IUPA 2JFZA 1GPAA 3KS9A 3MCWA 1YCGA 2CNNA 3MJSA 3NH6A 4HZUB 4NCJA 4RHEA 3IERA 4OA8A 2VH2A 5KHOC 2GCNA 3WP1B 2C96A 1T1IA 4MWTA 1IY1A 2FZ5A 2PUHA 2XWJI 4MUNA 5IU6A 3ZD6A 1DBQA 3T9AA 1CZLA 1I3MA 3M5WA 4IMPA 4KBFA 1GZHB 1R66A 2G88A 4UBJA 3U7JA 4BAGA 4BFUA 2V96A 4IOJA 3DMNA 4ZCPA 3WGYA 1R5BA 4PAOA 2YYZA 3ZXUB 3FGZA 1YDWA 5IWAB 4F8YA 4DR3B 3OD5A 4BMDA 9LDBA 1RPAA 2QZZA 5TMDA 4QOIA 3L41A 2HHCA 2OR3A 1JKIA 3U49A 3JZMA 1KHHA 2XMRA 4KKVA 5KQLA 4RHFA 3JZFA 4Q24A 1I94B 3WSVA 3ORFA 2ZTHA 1M2WA 4RVFA 4B73A 1NT2A 2IW1A 3I76A 4URYR 1RJ9A 3G0OA 3WDSA 3I5YA 1H2BA 4C0WA 1FFBA 4WD3A 4LC9A 3OLWA 1K8XB 2B8NA 1NJ5A 2DBRA 1IZ0A 3D6HA 1K5GA 1WP9A 4WK6A 5EKSA 3VOSA 1VKJA 2GJ9A 2I4LA 4CLOB 4KFRA 3B8EA 4L8GA 1D9XA 2WUFA 4FGKA 4D3ZA 1SGWA 3F6RA 2R6CA 5A03A 1XFDA 4M9ZA 2DG2A 2V4UA 2XDQB 4KPUB 4BNNA 1U7UA 4ARIA 1RM4A 4TZKA 4BAZA 3EQZA 1UEIA 4I1IA 4BJ3A 3NDRA 5K6RA 2ZBVA 5G41A 3P2KA 2VATA 2KB0A 4X1YB 3THXB 1KRXA 2NACA 4MXDA 4K5QA 2N47A 2QPAA 3WBKA 1XCOA 2JH8A 2JK1A 3T5BA 3TNFA 1EUQA 3KBBA 3PFGA 3UK2A 1XT6A 3H6HA 2BHNA 4J91A 1ONBA 4IGFA 1AM4D 4E30A 1AV6A 4RK7A 1W76A 2VSOA 4QTXA 3INTA 2Z5VA 3UB3A 3UN1A 3CW8X 2GZAA 1IPEA 2DHDA 4QGBA 2EW1A 3ZDZB 1GCIA 4MLPA 1RMQA 4XARA 5F9MA 2XECA 3RVDA 5GP1A 4ZQFA 5AKKA 3OQOA 1SURA 1RU3A 2PD4A 2OMEA 2NN3C 5EIEA 3O6VA 5IS2A 3L2OB 2ZQ5A 2O8FB 4G4IA 2IYEA 4BNMA 1KMHB 4JYMA 1AGYA 1OILA 2J1LA 4GQBA 3HB5X 3U7GA 5A04A 4ADSG 2O4UX 4K9KA 3P5BA 5CK4A 2ZWAA 4R1LA 3CX4A 2X22A 2POQX 3RIGA 3FROA 4L8LA 1J9ZA 1WZCA 4B8ZA 4AUNA 3QX9A 5DBHX 4KAJA 3W90A 4JX8A 3MIZA 4Q1BA 4WIAA 1KA9H 2GEBA 3JQ8A 5JWOA 2B2NA 3JVIA 2HN9A 2EX1A 4OU4A 1RYZA 4WOKA 4O33A 1T5IA 4PIVA 4R3NA 3G9XA 1DQSA 5H80A 1LBIA 1CQXA 3K0AB 3TXYA 2WWYA 1N36B 4GGOA 1YBAA 2XZLA 1ZM2A 3TFQA 3COSA 3FUXA 2MINA 3TCNA 4BLPA 2X2OA 1U3TA 4NDNE 1RI1A 4EELA 4WOPA 1W9MA 4J1TC 2Y0CA 3FOWA 4BVEA 1OIXA 1BX0A 2BGTA 5FAKA 3W1WA 3X1XA 1XNQB 3NHMA 1NRIA 4Q1AA 4L5BA 5HF8A 5D3MB 2VL7A 1T34A 1TKBA 1FC0A 3BWXA 4HQOA 4CLRB 4CF7A 5LZ4A 2MSCB 2WJVA 2ZT7A 1GGMA 1E2NA 3HKEA 5KAPA 3QUBA 5AO9A 3RRZA 4E5VA 3QK7A 1JF8A 3IE2A 3O95A 3P9XA 4QDKA 1I0ZA 1X38A 1DTSA 3GYGA 4S3MA 2IV3A 2FPOA 2ODQA 1FZTA 3CINA 2C29D 1Y5NA 4YRLA 1UKAA 2PMCA 4OB6A 3EMBA 3D6MA 3CXRA 3QHPA 4TYMA 1C1YA 1N6LA 2YXLA 1KK3A 4ARSA 2C7QA 1CJKC 1KJJA 2C2OA 3JZAA 3V4PB 5FUWA 5JJBA 4LHEA 4DV5B 3C3CA 4JBXA 3LP6A 2G6BA 4PYOA 2HA2A 4X64B 4BMSA 2B5OA 1THZA 2R9VA 2OCGA 4KK3A 4YAJA 3JQGB 3D7RA 4NZOA 3AXSA 5K3SA 3JALB 3RRYA 2CJFA 3C70A 3SHFA 3T7IA 4US1R 3WOVA 1VZ2A 1O08A 4ZTBA 2HA3A 3ENVA 2Q8NA 2RKWA 2YYAA 1OBOA 1T5HX 2P2YA 2YV5A 3BTOA 1VIYA 5KKNB 1QRAA 4JUAA 1MC1A 4PXAA 5E9AA 5TNXA 5F2NA 3NTVA 1MAWA 1SN7A 4EM6A 4HWKA 2FVXA 5E6RA 3D6AA 5DIFA 2V7PA 2R87A 3R0VA 4QYWA 5DWQA 2O8BB 2I29A 3AOGA 1DJQA 2G08A 2AMFA 1SCAA 1H8HD 4NV3A 4BU0A 2ZI4A 3AILA 4QXPA 4BC0A 3TTTA 3ZBTA 4BVKA 5CA1B 1RRPA 1Y7LA 3EEQA 2HNAA 4J03A 1WXQA 5A62A 1UBFA 5IFKA 3VR2A 1CY2A 4P3YA 4GNKA 5HBRA 3SM9A 4BB9A 3NATA 3L0YA 5GJVC 1Z5PA 1XXHE 3DFZA 4YWHA 5KNDH 2CDAA 4LISA 4OD0A 5TSDA 1W44A 4XD7D 2QUIA 1U81A 2FX3A 1HE1C 1NN5A 2JEZA 3QLVA 4E2ZA 1II8B 1LK7A 2V6JA 3DT8A 3GRRA 3UB4A 2CLMB 2WHEA 1TIPA 3IHTA 4UU7A 2D2IA 2YX1A 4DGQA 3B70A 1R6DA 2D5CA 1VJRA 3HWRA 4RTKA 4X61A 2E21A 1NLFA 2ZUFA 5A06A 5I5EA 4AT1A 3UGJA 3AHHA 5JCXA 2OHXA 1X7ZA 3KTAA 3BMQB 2OSVA 1ZJZA 3B2QA 1FCJA 5E6UA 5IM4A 2YH2A 1EBFA 1O97C 1SC9A 3AR6A 4C43A 2VDMB 1S2GA 2YY6A 1IXSB 3LPMA 3T5GA 2QYOA 1YWGO 3FZNA 3T7AA 3PE4A 2Q9UA 3EFOA 4YIHA 5HGXA 3Q8KA 3OOWA 3VDXA 1J70A 2Y9PB 4HMQA 2HA7A 3SHQA 2FHPA 1IM8A 2A8YA 4A1OA 4YJ2A 3GLFE 2AXPA 4M8KA 4K1LA 4PGAA 4NJEB 4MR7B 4TTJA 1N78A 1A7KA 2X9VA 1VL2A 4RF5A 1M6VA 3KAQA 4Q1CA 2QL9A 3KJEA 2EKDA 1ZYUA 1DV1A 4MKXA 4R31A 1E1YA 3RVOA 5LZ9A 2Z43A 1JXMA 3MJFA 3K0BA 4EUSA 3H5WA 4LF7B 1RAGA 3FYUB 3ZIAA 4ZQGA 1W0KA 4FFRA 4DCMA 2GHIA 3FPBA 2CNWD 4BX9A 4D4LA 2DSNA 4TL6A 3FCUB 3S2EA 1P1RA 1A7JA 3K09C 3VKGA 1EDEA 2P6UA 3MTBA 2FWPA 4BFCA 2G70A 3PFCA 2O59A 4PYQA 4XGNA 3EVEA 3KDSE 3VAYA 5BXQC 1R0LA 3BMOB 5K3AA 5J40A 1NBWB 4MR9A 5GINE 3Q5GA 3EQ8A 2A5YB 4BFZA 3CSDA 1KU6A 4NOLA 2ZJZA 2DMRA 3GIDA 1CR1A 3GVXA 4Z86A 4DWWA 3K96A 5LXTB 2WUGA 4Q82A 4RIHA 1ILWA 1LBEA 5F12A 2JI4A 3EG5A 4TWZA 3U3ZA 4YCNA 3WGKA 3IP6A 2W0MA 3DDUA 3QMPA 3VOBA 2HV9A 2QJRA 4CR8A 3WGVA 4L8WB 1SCJA 1ZD9A 3FUVA 3O91A 4AX4A 3RD5A 1MABA 4HDAA 4DCSA 3QEKA 1S89A<