1U7VA

Crystal structure of the phosphorylated smad2/smad4 heterotrimeric complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
197
structure length
196
Chain Sequence
EPAFWCSIAYYELNQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of heteromeric smad protein assembly in tgf-Beta signaling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Mothers against decapentaplegic homolog 2
total genus 54
structure length 196
sequence length 197
chains with identical sequence C
ec nomenclature
pdb deposition date 2004-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03166 MH2 MH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.10 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 1u7vA00
1MR1A 1J2FA 1U7FB 1G88A 1U7VA 1KHUA 3DITA 4R9PA 1MK2A 5BVIA 5JELA 3DSHA 1U7FA 5JEMA 5JERA 1U7VB 1YGSA 1MJSA 5JEKA 1KHXA 1DD1A 1DEVA 5C4VA 3A77A 3GMJA 5JEJA 5JEOA 1QWTA 1ZOQA
chains in the Genus database with same CATH superfamily
2BONA 2CSWA 4H87A 5E50A 3VZDA 1K3QA 2I2AA 1J4LA 5DHPA 1UJXA 1J4QA 3UNMA 4A4YA 2P1RA 4G2SA 2KFUA 2JQLA 2BRFA 1K3NA 5BVIA 3VPYA 3I0NA 4EGXA 3ELVA 5DJOA 4JONA 1Y3IA 2JPEA 1K2MA 1DMZA 2Q5FA 5DHSA 3UV0A 3GQSA 3GMJA 1U0RA 2KB4A 1MR1A 1J4OA 1UHTA 1FHRA 2XXSA 1YT5A 4EJQA 1LGPA 3KT9A 1KHUA 3DITA 1MK2A 1SUWA 3UNNA 1YJ5C 2EH0A 5JELA 2QVLA 5DHUA 3V7YA 2G1LA 3UOTA 3DSHA 3V7WA 1U7FA 2KB3A 3V8NA 1U7VB 3V8MA 1QU5A 1YJMA 5EJHA 3VA1A 5DHQA 1G6GA 1KHXA 1J4KA 3T5PA 5JEJA 5JEOA 3UN0A 3AFOA 3HX1A 3MDBA 2JKDA 3V7UA 2I2BA 4JIWD 5DHTA 1U7FB 1Z0UA 1WLNA 3I6UA 1G88A 1U7VA 4A0EA 2JQJA 3FM8A 4R9PA 1U0TA 4V24A 5DHRA 4D9VA 1K2NA 2AFFA 2A0TA 3HUEA 1LGQA 3S40A 2W3OA 3UMZA 1J4PA 1GXCA 5JERA 1K3JA 4JIVD 4KU0D 5EJFA 1YGSA 1MJSA 2I2CA 3VZCA 2FF4A 5JEKA 1DD1A 1DEVA 3PFNA 2KKLA 2FEZA 2QV7A 5A8IA 1QWTA 1ZOQA 1Y3HA 1WV3A 2I2DA 2I1WA 2JQIA 3I0MA 3V8QA 1Z0ZA 3V8PA 1J2FA 3V8RA 4QCJA 2PIEA 2XT9B 4DY6A 5EJGA 4WRRA 2I29A 3I6WA 1R21A 2JGRA 3HUFA 3POAA 3ELSA 3VZBA 5JEMA 1MZKA 4L02A 5EJIA 3VA4A 2LC1A 3OUNA 3PO8A 2I2FA 4HAOA 1Z0SA 4WERA 5C4VA 3A77A 1G3GA 1FHQA 3V80A 2AN1A
chains in the Genus database with same CATH topology
2BONA 2CSWA 4H87A 5E50A 3VZDA 1K3QA 1J4LA 1UJXA 1J4QA 3UNMA 4A4YA 2P1RA 4G2SA 2KFUA 2JQLA 2BRFA 1K3NA 5BVIA 3VPYA 3I0NA 4EGXA 3ELVA 5DJOA 4JONA 2JPEA 1K2MA 1DMZA 3UV0A 3GQSA 3GMJA 2KB4A 1MR1A 1J4OA 1UHTA 1FHRA 2XXSA 4EJQA 1LGPA 3KT9A 1KHUA 3DITA 1MK2A 3UNNA 1YJ5C 2EH0A 5JELA 2QVLA 2G1LA 3UOTA 3DSHA 1U7FA 2KB3A 1U7VB 1QU5A 1YJMA 3VA1A 1G6GA 1KHXA 1J4KA 3T5PA 5JEJA 5JEOA 3UN0A 3HX1A 3MDBA 2JKDA 4JIWD 1U7FB 1WLNA 3I6UA 1G88A 1U7VA 4A0EA 2JQJA 3FM8A 4R9PA 4V24A 4D9VA 1K2NA 2AFFA 2A0TA 3HUEA 1LGQA 3S40A 2W3OA 3UMZA 1J4PA 1GXCA 5JERA 1K3JA 4JIVD 4KU0D 1YGSA 1MJSA 3VZCA 5JEKA 2FF4A 1DD1A 1DEVA 2KKLA 2FEZA 2QV7A 5A8IA 1QWTA 1ZOQA 1WV3A 3I0MA 2JQIA 1J2FA 4QCJA 2PIEA 2XT9B 4WRRA 3I6WA 1R21A 2JGRA 3HUFA 3POAA 3ELSA 3VZBA 5JEMA 1MZKA 4L02A 3VA4A 2LC1A 3PO8A 3OUNA 4WERA 5C4VA 3A77A 1G3GA 1FHQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MR1 A;  1J2F A;  1U7F B;  1G88 A;  1U7V A;  1KHU A;  3DIT A;  4R9P A;  1MK2 A;  5BVI A;  5JEL A;  3DSH A;  1U7F A;  5JEM A;  5JER A;  1U7V B;  1YGS A;  1MJS A;  5JEK A;  1KHX A;  1DD1 A;  1DEV A;  5C4V A;  3A77 A;  3GMJ A;  5JEJ A;  5JEO A;  1QWT A;  1ZOQ A; 
#chains in the Genus database with same CATH topology
 2BON A;  2CSW A;  4H87 A;  5E50 A;  3VZD A;  1K3Q A;  2I2A A;  1J4L A;  5DHP A;  1UJX A;  1J4Q A;  3UNM A;  4A4Y A;  2P1R A;  4G2S A;  2KFU A;  2JQL A;  2BRF A;  1K3N A;  5BVI A;  3VPY A;  3I0N A;  4EGX A;  3ELV A;  5DJO A;  4JON A;  1Y3I A;  2JPE A;  1K2M A;  1DMZ A;  2Q5F A;  5DHS A;  3UV0 A;  3GQS A;  3GMJ A;  1U0R A;  2KB4 A;  1MR1 A;  1J4O A;  1UHT A;  1FHR A;  2XXS A;  1YT5 A;  4EJQ A;  1LGP A;  3KT9 A;  1KHU A;  3DIT A;  1MK2 A;  1SUW A;  3UNN A;  1YJ5 C;  2EH0 A;  5JEL A;  2QVL A;  5DHU A;  3V7Y A;  2G1L A;  3UOT A;  3DSH A;  3V7W A;  1U7F A;  2KB3 A;  3V8N A;  1U7V B;  3V8M A;  1QU5 A;  1YJM A;  5EJH A;  3VA1 A;  5DHQ A;  1G6G A;  1KHX A;  1J4K A;  3T5P A;  5JEJ A;  5JEO A;  3UN0 A;  3AFO A;  3HX1 A;  3MDB A;  2JKD A;  3V7U A;  2I2B A;  4JIW D;  5DHT A;  1U7F B;  1Z0U A;  1WLN A;  3I6U A;  1G88 A;  1U7V A;  4A0E A;  2JQJ A;  3FM8 A;  4R9P A;  1U0T A;  4V24 A;  5DHR A;  4D9V A;  1K2N A;  2AFF A;  2A0T A;  3HUE A;  1LGQ A;  3S40 A;  2W3O A;  3UMZ A;  1J4P A;  1GXC A;  5JER A;  1K3J A;  4JIV D;  4KU0 D;  5EJF A;  1YGS A;  1MJS A;  2I2C A;  3VZC A;  2FF4 A;  5JEK A;  1DD1 A;  1DEV A;  3PFN A;  2KKL A;  2FEZ A;  2QV7 A;  5A8I A;  1QWT A;  1ZOQ A;  1Y3H A;  1WV3 A;  2I2D A;  2I1W A;  2JQI A;  3I0M A;  3V8Q A;  1Z0Z A;  3V8P A;  1J2F A;  3V8R A;  4QCJ A;  2PIE A;  2XT9 B;  4DY6 A;  5EJG A;  4WRR A;  2I29 A;  3I6W A;  1R21 A;  2JGR A;  3HUF A;  3POA A;  3ELS A;  3VZB A;  5JEM A;  1MZK A;  4L02 A;  5EJI A;  3VA4 A;  2LC1 A;  3OUN A;  3PO8 A;  2I2F A;  4HAO A;  1Z0S A;  4WER A;  5C4V A;  3A77 A;  1G3G A;  1FHQ A;  3V80 A;  2AN1 A; 
#chains in the Genus database with same CATH homology
 2BON A;  2CSW A;  4H87 A;  5E50 A;  3VZD A;  1K3Q A;  1J4L A;  1UJX A;  1J4Q A;  3UNM A;  4A4Y A;  2P1R A;  4G2S A;  2KFU A;  2JQL A;  2BRF A;  1K3N A;  5BVI A;  3VPY A;  3I0N A;  4EGX A;  3ELV A;  5DJO A;  4JON A;  2JPE A;  1K2M A;  1DMZ A;  3UV0 A;  3GQS A;  3GMJ A;  2KB4 A;  1MR1 A;  1J4O A;  1UHT A;  1FHR A;  2XXS A;  4EJQ A;  1LGP A;  3KT9 A;  1KHU A;  3DIT A;  1MK2 A;  3UNN A;  1YJ5 C;  2EH0 A;  5JEL A;  2QVL A;  2G1L A;  3UOT A;  3DSH A;  1U7F A;  2KB3 A;  1U7V B;  1QU5 A;  1YJM A;  3VA1 A;  1G6G A;  1KHX A;  1J4K A;  3T5P A;  5JEJ A;  5JEO A;  3UN0 A;  3HX1 A;  3MDB A;  2JKD A;  4JIW D;  1U7F B;  1WLN A;  3I6U A;  1G88 A;  1U7V A;  4A0E A;  2JQJ A;  3FM8 A;  4R9P A;  4V24 A;  4D9V A;  1K2N A;  2AFF A;  2A0T A;  3HUE A;  1LGQ A;  3S40 A;  2W3O A;  3UMZ A;  1J4P A;  1GXC A;  5JER A;  1K3J A;  4JIV D;  4KU0 D;  1YGS A;  1MJS A;  3VZC A;  5JEK A;  2FF4 A;  1DD1 A;  1DEV A;  2KKL A;  2FEZ A;  2QV7 A;  5A8I A;  1QWT A;  1ZOQ A;  1WV3 A;  3I0M A;  2JQI A;  1J2F A;  4QCJ A;  2PIE A;  2XT9 B;  4WRR A;  3I6W A;  1R21 A;  2JGR A;  3HUF A;  3POA A;  3ELS A;  3VZB A;  5JEM A;  1MZK A;  4L02 A;  3VA4 A;  2LC1 A;  3PO8 A;  3OUN A;  4WER A;  5C4V A;  3A77 A;  1G3G A;  1FHQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...