1U81A

Delta-17 human adp ribosylation factor 1 complexed with gdp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
164
structure length
164
Chain Sequence
MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor 1
publication title Conformational changes in human Arf1 on nucleotide exchange and deletion of membrane-binding elements.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 41
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2004-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1u81A00
1OSNA 3NXSA 4IDOA 4AK9A 1L7VC 3CBQA 1XPUA 4HB3A 4DSOA 2JLRA 2ZI4A 2J7PA 3UATA 2PLRA 4B2LA 3PENA 3P26A 3OFND 2H5EA 2ZRKA 4V02A 2IS4A 1EFUA 1BKDR 2X77A 3X1WA 4Z54A 2W2XA 3QEJA 1VHLA 1YZQA 3UKDA 4HZIA 4WXRA 3BK7A 3Q5EA 2PMKA 3QF4A 3GJ7A 4QHTA 3AVOA 4B2IA 2ZRAA 3QENA 4KSBA 5HE9A 2GVDC 2ZJBA 5CLQA 4JLPA 4ESVA 1W0KD 4KSCA 2OCYC 2IC5A 4XSGA 1JEDA 1ZIPA 1B23P 1G8YA 1KK1A 1DAKA 3K0EA 3ND9A 2QTFA 4WIAA 1DG3A 4OYHA 3TH5A 3IHLA 4V03A 2P3SA 5C46F 2DBYA 4Q7LA 1UPTA 2HEIA 3U61B 1N6OA 1YVDA 2BBTA 2CHGA 2EFGA 1SXJA 3VQTA 4YXWA 2F43A 3EPLA 4PSAA 2ZJZA 4GNKA 4P4UA 4C30A 4I1SA 2DFNA 3OE7A 4FXPA 4JLNA 1TQ2A 3W9YA 5FTNA 4BRUA 1G4AE 1HT1E 1TEVA 3KJGA 4G1UC 5EE3A 2DB3A 1XCGB 1R0XA 1W2HA 5JSZA 1OXTA 3CX8A 2ZM5A 4JYCA 1FW6A 1T8TA 2QM7A 1EWRA 2QI9C 3AF2A 4DIDA 2D2EA 1KDTA 1G18A 5G3YA 4OI4A 5EP3A 4B3GA 3E1SA 1NVXQ 2DY1A 2JLVA 3I73A 2CCKA 1S96A 1NG9A 3HU1A 1S4QA 2WJHA 4RKEA 3BFVA 4UNNA 5FPHA 5K8IA 4IOKA 2OFXA 5F9FA 3WMEA 5A4JA 1G5TA 1ZVQA 3ND8A 4HLDA 1NN5A 4IXMA 1M7HA 2YJTD 4UNSA 4WZ6A 4HAXA 1NKSA 2GKSA 3UG6A 3VU9B 2WWYA 1VG1A 3BFKA 4JBYA 1T3SA 3UANA 1FOEB 1KZGB 4CRWB 3PEWA 3R9IA 1DEKA 1D5CA 2QPAA 2NQ2C 4EUNA 5C4MA 5JBQA 4ZDJA 3K9GA 3IBGA 1N6HA 1T0JB 1T6NA 4JIMA 5A0FA 4EJSB 3W6PA 2O8BA 4DDTA 3IIJA 4LPKA 4KVAA 2J9RA 5JJLA 2YINC 1LS6A 1S8FA 2B7CA 2WKQA 4HDOB 4MYUA 1KO5A 2QE7D 4QXAA 5KSYA 2QL6A 3EIHA 3PUZA 1II9A 2MMCA 2FPKA 2QN6A 2J0UB 2WWHA 3QPUA 5DI3A 1R4AA 3TSWA 4DZZA 4DKXA 4JYBA 1YR9A 4NL4H 4QGGA 4DEXA 4ZCIA 3V00A 4D80A 2QP4A 3B9PA 2GAAA 2HCBA 1FUKA 2J46A 2JIZA 3K09C 1BS1A 3TQFA 5E3HA 4BLSA 5FTJA 1KSGA 4G5QA 4IDPA 3CLVA 2FDCA 1HA3A 1Z0DA 1ZNZA 1GOTA 1BH2A 1VTKA 3EC1A 4NTZA 1C1YA 4AWXA 4XWOA 1NIPA 4OJQA 3FOZA 3AUYA 3BJIC 1RYHA 3W3ZB 1GKYA 2NZJA 2JJ2D 4FMDB 4OHZA 4W5JA 2F9LA 4EDHA 4TLEA 1Q44A 3IPYA 2C96A 3AEZA 4A0RA 3KB1A 1QVAA 3WNBA 4ZDKA 4KITB 4JZKA 1XMSA 2ZRIA 5FTMA 5AR1A 4B47A 4LV5B 3LVRE 4NCIA 4BFYA 3LX8A 5A5GA 4NCNA 1KSJA 1Z3IX 4MDEA 3VFDA 1D2NA 5L3SB 2F3RA 2F1RA 1C4OA 2CLCX 3PITA 5BYKA 3Q7PA 2NPFA 1J70A 4XIGS 421PA 4JVMA 1W47A 2C04A 2HYIC 5JI3E 4WBSA 3WP0A 4Y0VA 5DHAA 3C41J 1IY1A 2LCFA 4JT4A 4TLAA 4PC7A 2IYWA 4C0QC 2BOVA 1AKEA 1SVMA 3PV0A 1YQTA 2O0KA 1R0WA 4YC7A 2V3CC 2VP2A 2QE7A 1UBCA 3DOFA 2RMKA 5JFGA 4BFZA 3TR0A 3VX4A 2VEDA 2FPMA 4TL8A 3BOSA 1NVUQ 3EA0A 4TMWA 1E9FA 1GNRA 1M2OB 4K81B 1II8A 4JLMA 1G6OA 1H65A 4AKEA 3IDQA 4TMTA 4AG5A 4HZUB 1NN0A 4IKEA 1PLJA 4TYPA 4GOKA 2UVQA 5ANRB 3T35A 1NN1A 3REGA 5HKKD 2QAGB 1IN8A 1G7SA 3GCGA 3SJCA 5GJVC 1N6NA 3CH5A 4D25A 3GP8A 4EFLA 1TF7A 1E32A 1YZTA 2JGNA 1D9ZA 2QEQA 3CR7A 1TQ6A 2C2HA 1COWA 4Q1FA 1TQDA 2B6HA 2WOJA 2VSOA 5C2JB 4WZBE 3SQXA 4M9SA 5FL3A 5JZVA 5BN5A 4IOMA 1CR2A 3NDBB 1SHZA 5DI9A 3ZYCA 4D81A 2OO7A 3U3RA 3EIEA 3OIUA 4JL5A 5KHOC 1KKMA 1XZQA 1SQ5A 2XXAB 3T15A 5FI0B 4US0R 4GT1A 3RS7A 4BFXA 1KO1A 3LO5A 3SU8A 1P2UA 2PH1A 4JLVA 4QKQA 3LDAA 3EASA 3TSOA 1AA9A 4EQ6B 1NN3A 2Q0HA 3VR1A 2PL3A 2R6AA 3TK1A 1G6HA 2JAQA 4ZCMA 4Z51A 4ACAA 1GRNA 3ECCA 3QXSA 2JLZA 2E1RA 3O8BA 2V7QA 4QFMA 1Z0JA 1JR3D 4HUQB 3HPQA 3B1ZA 2XZOA 4IDNA 3QPWA 2QMEA 2IXGA 3KJEA 4Q48A 4QJ5A 4MH0R 1W1WA 2CJWB 2GBLC 2REOA 3QKRB 4V0NA 3K70C 1EXMA 2P5TB 4D0LB 3D7MA 2GJ8A 2OE2A 3MJHA 2QU8A 3SFVA 3U7EB 1U8YA 3THWA 3ZZ0A 3WXMA 1JR6A 4BPBA 4CEIA 2PZEA 2NTYC 3TAUA 5HKKA 1G3IA 1OH6A 3A4LA 3LW8A 3MLEA 2V6IA 5FUYA 1EG7A 3K1JA 4DSUA 1KI8A 3M6AA 4PXAA 2VP4A 3OHMA 5IK2A 1BO6A 4PZZA 3AKYA 4TQUS 4IVPA 4TQAA 4ZIRB 2GVZC 2G0NA 5AUNB 3UPUA 3KQUA 1E0JA 3TUJC 4A2PA 4LDJA 1OXSC 2VHUA 2EWVA 2QROA 5DH9A 5F3WB 2QP9X 3LWNA 1K6MA 1F60A 5J4VA 5FOUA 1IXRC 1FTNA 3MAAC 2A78A 1PUIA 4NP6A 1W49A 4DHEA 1GL6A 3ADDA 4M1YA 4OK5A 1VIYA 3SN6A 1AS2A 1IJFA 3MD0A 5EP2A 4A8JC 5CB8A 5E4FA 4C7OA 1IHUA 2HJVA 1CJVC 1E2FA 3K0FB 1T3LA 4PAMA 4LYFA 3I72A 2PZFA 3C5CA 4LJ7A 4A1FA 2B92A 4GPTA 1ZCBA 2OUKA 3BH0A 3UWOA 3FVQA 1JXMA 4PZYA 5JHGB 4LHVA 4RCYA 4AYTA 4HLUC 4KV9A 5KSPA 4IEIA 4B6FA 3H84A 4P4SA 3E5HA 1NLYA 4U00A 2C9CA 4KBGA 1R7RA 2I1VB 2GEVA 1MABB 2NGRA 3ICQB 4BWYA 4LJ9A 3D3QA 2P67A 1QHHA 1M74A 3BORA 4AI6A 3F0TA 1GRRA 2BMFA 2P0EA 1VYTA 1TTTA 5FPKA 1Z0KA 1PLKA 4YONB 1DAGA 1U0JA 2FZLA 1ZNXA 4W5WA 1ZD8A 3UMRA 2AWOA 5CITA 3U60B 3CZQA 1G8FA 1R0YA 4RFSA 4DLSA 3B1WA 3WYGA 1CLUA 1DO0A 1KO8A 2REXB 1D9XA 2IUUA 1OPXA 4IRUB 1F3OA 2WWFA 2ZROA 1H8ED 4DWJA 4A9AA 1NJFA 2WV9A 1XD9A 3AVUA 1E2GA 3NEYA 4CT4B 3SJZA 1HH4A 2QGZA 4ACBA 3DPUA 5EE0A 4B33A 3TVDA 4BASA 1KI6B 4FD2A 4L16A 1WB9A 2C9YA 4BFSA 1ZINA 3PUXA 3OEED 2W58A 3G0HA 2G83A 2QGNA 1D2EA 2P6NA 1HURA 1W4AA 2CXXA 4ARZB 3G5UA 2DPXA 2IBMA 1F2TB 5H68A 1FNMA 2ATVA 1HE1C 3CWQA 1AIPA 5EP1A 1OFUX 3WRXC 3P1JA 4P4TA 3QUSA 2QUZA 2JLUA 2UZ3A 2WOOA 5KUTA 5DYGA 3PG5A 1SVWA 4GRAA 3V4FA 1YZGA 1OYWA 3OEHD 4I4LA 4RJLA 3CPEA 4M1MA 3AF1A 4GI7A 1U99A 4PHFA 1E1RD 3TUIC 4LK2A 2O8CB 1P2VA 2KE5A 2K5UA 3LRPA 4C0KA 5JJKA 1HQCA 2OSBA 1X86B 4PHGA 4GSYA 4M9QA 1SZPA 2X1VA 2GEDA 4H9GA 5LB2A 3I92A 3AVTA 2JLSA 1W4RA 1R8QA 3RRMA 1KMHB 3C7KA 2WM9B 3QEOA 2KB0A 2PT5A 2X2EA 3KJIA 4IVQA 3LFUA 1G41A 1VG0B 1G8HA 3BAFA 2BEKA 3IILA 2ERYA 4B44A 2XTZA 4Q4JB 4RFVA 1MR3F 3CF6R 4JL6A 3FKQA 1ZNWA 2EFHB 3LD9A 5GVRA 2XNDD 1EX6A 1TX4B 3CRVA 2WVJA 4NPHA 1M1YE 4LY6A 1AZTA 1ESNA 1GIAA 1N5IA 3K8YA 1I4LD 2AD5A 3KKPA 3HR8A 2YWGA 2HXYA 5FUVA 5KSZA 2IUSA 1R5BA 2ZETA 2ANBA 3X1XA 4Q4AB 3ETLA 1YR8A 1D6JA 3CONA 2WJYA 2IHYA 3OEEA 2BJWA 5CK5A 4M53A 3UMFA 3THYB 2ORWA 3KJHA 4HSEA 2YVUA 4HB2A 1Z28A 1M6NA 1DO2A 2ZJAA 4TZ6A 4LHXA 3IQXA 4FN5A 4NU0A 4OI0A 4AYXA 4BRWA 1XTQA 1EFRD 4M1OA 1P72A 3N70A 1LF0A 4RZUA 3BXZA 1Z08A 4EJSC 4B3XA 1I4TD 2JDID 1GL9B 5TV2A 1L8QA 1KMQA 4TMVA 2Y8EA 2YKGA 5LPNA 1F6BA 2GK6A 4YDHB 1TADA 2BBOA 4HB4A 5G3ZA 4DUGD 4KBFA 1UDWA 1TEXA 3FPAA 2BMEA 3GD7A 4D0NA 2OLJA 2YWHA 5DN6D 3U7HB 1AJEA 1R0ZA 1UBEA 1K8RA 3SYKA 4QHSA 3T61A 5D3QA 3B7GA 4QC2A 1KSHA 1JQJC 3MRSA 3GLIE 4L4UA 2GDJA 3LX5A 1X3SA 1CIPA 2ZRHA 1XB2A 1ZYUA 3SDZA 4KO8A 2QY9A 1YE8A 1W0JA 1IN6A 1AGPA 1CTQA 1NLFA 1UKYA 1YZNA 4HLCA 2IS1A 2Q3FA 3CB4A 3S1AA 3IO5A 1MKYA 2PJRA 2OBNA 2IS2A 2XNDA 2C95A 2J0QA 5BN3A 4TYQA 1U94A 1BYIA 1ZUIA 3B13B 3CUEF 3HYTA 4KLNA 4Z1MD 2A7QA 2BWJA 2DCUA 2BKUA 3P20A 4WA7A 4FMCF 1XD2B 3SBEA 4CIDA 3K70B 5FOSA 3RYTC 2GCOB 2XTNA 3B60A 1FP7A 1KY2A 5JLJA 1W4BA 2N46A 3HWSA 4RD3A 3CIOA 4LWZA 5AJZA 4MYHA 2DFKB 2KI5A 1ZRHA 1FZQA 1N6RA 1ZM3A 2VHQA 2IYTA 4Q7JB 4AIIA 2AXPA 3EWSA 2Q6TA 5SZKB 5CDFE 2Z43A 4Q00A 3O47A 3EA5A 3GLHB 2F1IA 4R2HA 1S1MA 3PUVA 3QBTA 1ODFA 1SULA 4IHQA 1OKKD 2ZITA 2J7PD 4ILEA 4F92B 4NCKA 4IDHA 1OH8A 4KFRA 4LZZA 3FMFA 2BVNA 3I1FA 5TXGA 4PC6A 2Z0MA 4J0QA 1G17A 5KTYA 2ZJ5A 1P73A 3A1TA 5DO9A 1E9SA 2IF2A 1KYIA 3GFTA 4N1AA 3WRYC 2GILA 3T1TA 4PZLA 4GP7A 3QNUA 2IL1A 4DLYA 4KU4A 2YC4C 5FBWB 2D4HA 4Q1CA 3T34A 5CIQA 3GLGB 4N0EA 1P9WA 4A8JB 1Z2AA 4LJYA 4QJ4A 1QHXA 2R2AA 3DO6A 3EPKA 2IYVA 4B3FX 2DWOA 1BIFA 3ICEA 4TLCA 3KZ1E 3I4LA 4I1OA 4OQXA 2AL7A 2QAGC 4OBEA 5DI3B 3W5IA 5AJVB 2BJVA 3AH8A 1VPLA 2ZIAA 1Z2CA 3AP1A 2FG5A 5IT5A 1E2QA 2IEZA 2ZI7A 4W5HA 2C03A 1P4SA 3ZDQA 1G7RA 1W36D 3DZ8A 3DEFA 2CCJA 5KYKA 4YXWD 4XVRA 4KODA 4HAWA 1HYQA 4O2LA 4S35A 3DKPA 1A2KC 1XJCA 2BCGY 4CYMA 2GZDA 1NP6A 1KAOA 4BUJA 3AUXA 4YMVA 2BC9A 1M34E 1QHYA 1XCMA 3WP1B 1SVSA 1ZU5A 1NNEA 2BMDA 2IWHA 3GJ6A 1IXZA 1XEWY 5DGXA 4BFWA 1E3MA 1XMIA 2JJ1D 3AKEA 2MMGA 4MGKR 2ZUDA 2ZUCA 2PMDA 4LJ4A 1XTKA 4A2QA 3GLFB 5HCNA 1E2HA 5AUOB 2WPDD 5EXPA 3TUZC 2IXEA 3AF0A 3L0IB 3NBFA 3CR8A 3QXJA 5AUPB 1OKKA 4ZDWA 5FUXA 4LHYA 1KKLA 1E0AA 2D06A 2RKOA 2XOKA 2XTMA 4DBLC 4TL7A 2HLDA 3ZVLA 4JLOA 1N6LA 4CEJB 4GOJA 1ZUNB 1Q12A 2V55B 3RS5A 4Q4HB 4WXPA 5BXQC 2P6UA 4HUTA 3E2IA 2X19A 3C14C 1E2IA 1NSTA 4US1R 2G88A 3PIRA 4IVRA 4KHZA 5C18A 2A30A 1S9HA 1F2UA 2JATA 3TAHA 3BH7A 2XSZD 3UIEA 3SJAA 1W4CA 3VNVA 2JLQA 1BYUA 1U9IA 3VTKA 4D6PA 3LBNA 2XX3A 3SQWA 3L8ZA 4B2PA 3D8BA 1KK0A 4RZXA 2R6GA 2W2VA 4TSFA 1XF9A 3MG9A 4MRSA 1DG1G 1VDZA 3PEVA 4EPXA 2NO0A 2WICA 3F8TA 1RVDA 2GEUA 1N0VC 4LHWA 4FMCB 1SGWA 1AKYA 2IYUA 2XB4A 1MO4A 3CKLA 3GLIA 1Q0UA 2JIZD 1XMVA 2F9MA 3QKUA 4XTCS 2ZYWX 2ZE6A 2CEAA 1NI3A 1KI2A 1NBME 1AGRA 2JJ1A 3ADKA 3P27A 2B8TA 1K5GA 4MGIR 4RVCA 2ZI6A 1UDXA 3H2YA 4QL3A 4JLJA 4Q66C 1FQJA 1GNQA 2WPDA 2MSDB 3SFZA 1CF4A 4TL6A 1A7JA 1OB5A 1E79A 4M22A 5HE8A 4LV6A 5DLQC 1F48A 2GBLA 1HEIA 3W6NA 1I4DD 2ZRLA 2YWFA 3Q9LA 2R8RA 4P32A 1VHTA 3KX2A 4BLRA 4OQFA 1O87A 4FCTA 2RB4A 4YMTA 3RWMB 2AHOA 5BQ5A 5KPJA 3K0AA 3RRZA 3RSLA 4BZXA 1G5PA 4Q9HA 5L3QB 2IYYA 1S3GA 2EFEB 3BRWD 1DAHA 3WHLA 5GJCA 4TYNA 4CW7A 4PAQA 2XSZA 4OI2A 2VH5R 4P33A 1ZU4A 5CDFA 3FMOB 1KI4A 1L4UA 2EYQA 3VR4A 1HTWA 1X1RA 4AY2A 3CX7A 2P2LA 1WMSA 3BWDD 3GPLA 1VCIA 4PO1A 2RGAA 4R2IA 2DFLA 1RJ9A 3CO5A 1XXHB 2WMNB 2ZYVX 2F1HA 4K8OA 3ZJYA 3CRRA 1CR1A 5FBLB 4RCZA 1X1SA 1CRPA 5H8WA 4WOPA 3KFVA 2C77A 1E96A 5CYPA 4HAVA 5FBQB 1OT3A 1KI1A 4CDGA 1NMZA 2XZLA 1OW3B 5SZHB 4A0HA 1T91A 4HDQB 3CF2A 4DIEA 4ZO4A 5H1YA 3SC3A 1COWD 1KTVA 2W00A 3UG7A 1R8SA 2WAYA 1Q22A 1GWNA 2VP0A 4JS0A 1Z6TA 2WZQA 4DDWA 4CEHA 3Q85A 3X2SA 2VSFA 4OI1A 3GJ8A 4MGYR 1FFHA 1P61B 1ANKA 3K9LA 4IFEA 2FN4A 2QQ0A 5C4GB 5KNBA 4EFNA 2ZREA 4N0DA 5GADl 1JJ7A 1EGAA 3FFAA 1US8A 2OV2A 3EZ6A 4B76A 5L3VA 2BKEA 1OE0A 4QNMA 1XWIA 1XJ0A 2LWIA 4BZPA 4ON9A 2H92A 3B1VA 2FV8A 3SR0A 1XPRA 4DCTA 3U44B 4MDFA 2YZ2A 4M1KA 2PJZA 1RRPA 2BCJQ 4MKIA 1RE0A 4Q9JA 1NBMD 4HATA 2ZJYA 5L3RA 4EPTA 2W0MA 3BS4A 1U8AA 3QPVA 3THXB 2PCJA 4TYYA 4UNQA 4FI3C 1LF5A 1DADA 4E22A 3SEAA 3EZ7A 2F3TA 2QM8A 3SZRA 2V7QD 2AD1A 1ZM4A 1HE8B 4Q1EA 5DE3A 2QBYB 4JT2A 1CJUC 3OZXA 1DAIA 3IPXA 4TMXA 5J47A 1VKJA 3NHAA 4DLUA 4TQ9A 3IEUA 4X8HA 4XVUA 3Q72A 1ZC3A 4BZQA 2PBRA 1NG1A 3LH5A 4CF7A 1TU3A 2CE7A 2AX4A 3P4YA 1IONA 3GJ3A 3RABA 4G3XA 5FUWA 4X8OA 1KNQA 2ATXA 1VCNA 4US2R 2AK2A 1GSIA 4LYAA 4I1VA 3A1UA 4NKRA 4AD8A 1XDBA 2I1QA 2F7SA 1G9XA 1N6KA 1Q20A 3EG5A 2WSMA 4QM7A 4QNRA 3J81k 1U2RA 2R6DA 4JKYA 4LI0A 3PXGA 3ZS9A 1N2CE 4FINA 1SKYE 1VECA 4ZCLA 1G3QA 1Z22A 2X8AA 5DYIA 5IK2D 2FA9A 3EAQA 2YC2C 2D62A 4Q01A 3TW4A 1TMKA 4D26A 5KDDA 3BC1A 3A1WA 1BMFD 5EXXA 3SE0A 5P21A 1YKSA 1GKIA 1E9EA 4A6PA 1N6IA 3TW8B 2QA5A 2IYSA 3WBJA 2C5LA 1W48A 1RRGA 3GQBA 4YQFA 1D8TA 2P6RA 2OZEA 1J2JA 1DAFA 2WIBA 1WBBA 1CRQA 2CL0X 5M04A 4MRRA 5KDLA 2AK3A 2IS6A 3KQHA 4P3YA 1OYYA 2J7KA 4NBSA 1DPFA 1X6VA 3U7FB 1TAGA 2ZRFA 4YMSA 1XU4A 4JLDA 1SVIA 1VCMA 1NBMA 1U98A 2O8DB 2A5FA 3DMNA 621PA 2PLFA 3L0OA 2UZIR 3EARA 2ZU0C 1O3YA 1OXXK 2NO1A 4XSHA 3NC0C 1JB1A 4HAZA 1SXJC 3IQWA 3TVTA 4NH0A 1H8HD 4UQOA 2IYRA 2Q3MA 3IHWA 2J5XA 2GCNA 1QHGA 4NZYA 4E5UA 4F4JA 3IEVA 3CH4B 1VYUA 1ZAKA 2AFIE 2BHRA 4QBIA 2R62A 3VR3A 2GAOA 2VL7A 2ZEJA 5KNDA 3VU9A 3BBPA 2XGJA 2JASA 2GXQA 4Q4LA 1PV4A 2FSIA 2F55A 4URWR 1Q1EA 1G19A 4DJTA 4Z8XA 3U6BA 2H8KA 2YOHA 2W6ID 5CLLA 3T12A 4AYWA 3GEEA 4BLOA 3PJRA 3TE6A 4LBWA 4F7WA 2TMKA 2RGEA 4EJSA 4BLTA 3HYRA 1GUAA 1Z06A 4BFVA 5EXSA 2QPTA 5HTKA 4RD6A 4DT1B 4QJ3A 4LJAA 4DB4A 4C0AC 1MO5A 1N3BA 3LBHA 1XCPA 4OKSA 3BFXA 1G291 3DHWC 2HUPA 4G0NA 3G82C 1KO7A 1BMFA 3RWOA 2J0UA 2ZE8A 2OCBA 4Q9LA 4Q7KA 1HY3A 4AC9A 2WKPA 4B43A 1DBSA 4H1UA 2A3RA 4ZV4A 4TLBA 1J99A 2JLYA 3AVXA 4EPWA 4LGMA 1K5DA 3V9PA 5ELXA 3ZD6A 3QKSB 5EE9A 2WMOB 3AKCA 1FL9A 3B6EA 4Q47A 4URZR 1EX7A 2BIFA 2YV5A 5JECA 5FTKA 4PQFA 2QSYA 1DVRA 3Q7QA 3GJ4A 2SHKA 1YR6A 1H8HA 4FCWA 5FOVA 4NYMQ 1EWQA 3CNNA 4RKFA 5KNCA 5D3MB 1QZXA 1RKBA 1N0WA 1XX6A 4CZ2A 4F4CA 1FX0B 1X8KA 2ZSFA 2N42A 5EUQB 5EE5B 1V43A 3C15C 4ZKDA 3K0CA 2PEYA 3L2OB 3H86A 5CB6A 221PA 1S1CA 4IOJA 2H17A 1LFDB 1IN5A 2QG6A 2WJJA 4YMWA 5L3SA 3HU3A 2RAPA 4JBXA 3H1TA 1Z07A 1OIVA 1ETUA 2W6IA 1VIAA 4DLZA 1E9AA 1JPJA 2ZSBA 1OHHA 1CS4C 1FMJA 4AKGA 2UKDA 3HU2A 1XBTA 1KDPA 1E2NA 3H0KA 2JCSA 2FF7A 4XWKA 4PPFA 2FEMA 2LKDA 1Z47A 1IXSB 3KTAB 4I99A 1VG8A 2GZHA 1KOFA 4HI0E 4UKDA 1MH1A 3ZS8A 2ZYUX 8OHMA 2YYZA 2ZRNA 2PZGA 4EPYA 1GVNB 2GJ9A 2RHDA 4TMKA 4DCSA 3N5CA 4JBWA 3QG1A 5F2EA 4BEJA 3AGPA 3A58B 1P7CA 5FR2A 4UXHA 2FU5C 4YDSA 3MWLA 2P65A 4LYHA 3IUYA 3VR2A 1NY5A 1LB1B 1XMJA 1JI0A 3OIWA 5FOWA 4HZUA 2IYZA 3REFA 4D2IA 1KK2A 2OAQ1 5B2ZA 5E7JA 3B2EA 1CP2A 2IYQA 2O8FB 2QAGA 2B8WA 1Q3TA 2GZAA 2ZQ5A 4G5GA 2O52A 3U5ZB 2FH5B 1KZ7B 5JRJA 3RHFA 2EVWX 3TLXA 4A15A 3RC3A 1RPZA 1FUUA 2NIPA 3V4RA 4L9SA 4L5BA 4LOAA 1ZM9A 4KFUA 4LYJA 4B3DA 3I5XA 1OF1A 1FPMA 1R10A 1Z29A 2RGCA 2RCNA 2RHMA 5JRZA 1Z0FA 3CX6A 1RC8A 2IHBA 3BIFA 3NBXX 3I8XA 4M21A 2XXAA 2ZRCA 2WKRA 3CM0A 4FMBB 4UXJA 3K9NA 3VAAA 4UXIA 4KCGA 4OK3A 4RD0A 5JWOA 3AVYA 1W0JD 2IYXA 3AP2A 4EQ6A 3CZPA 4JSTA 2O8EB 4DB2A 3JZAA 1QHIA 1KIMA 3U3JA 3SOPA 2ZAOA 3BERA 4WW0A 4PSVA 5H70A 1KAGA 4A2WA 1A82A 3WMGA 5KU1A 1P6XA 5LBIA 1JNYA 2HCJB 4OQNA 5AK0A 4ZI2A 1E6CA 1IBRA 4Q7MB 1KGDA 1XEXB 3T5GA 4HUQA 3R7WB 3JZMA 3IKJA 4XD7D 1NL3A 1QHNA 1ZIOA 4XJXA 1MRNA 3AVVA 2CJWA 4EKDA 3VKGA 4E07A 3AM1A 1GNPA 1GFIA 4QGAA 1E2EA 4R98A 3QKRA 1W2GA 3IIKA 5SZJA 4Q1BA 2WWIA 2CL7X 3H4MA 721PA 3AB3A 3RRYA 1G1MA 2D2FA 4NYMR 5JI2E 2ECKA 1DELA 1HUQA 3TSZA 2GXUA 2C99A 2AFHE 3NIBA 2KBFA 4C9BA 1KNXA 1QG4A 4PAOA 3U3KA 1IY2A 1OLOA 4IEEA 1E1QD 1T8UA 821PA 1M7GA 4E09A 5K8UA 3QF4B 2IW3A 4FIDA 1N5LA 3TQCA 4ZIRA 2OLKA 2ZXUA 3I61A 1ZM7A 2J41A 2ORVA 3PUYA 3CRQA 5IRCD 4D4MA 2XAUA 3GFOA 3TR5A 2OAP1 2HT1A 2REBA 2O5VA 3IIMA 4PC3A 3SYLA 2VP5A 2RGGA 1UKZA 2HYDA 2DWPA 2ZI5A 1LV7A 2XZPA 4MITA 4PQYA 1NSFA 2FJUA 4II7A 4MGZR 2A5YB 3LAWA 3EW9A 3EXAA 2OILA 1SXJB 1WE2A 3B78A 1AN0A 1VMAA 1W36B 2RGDA 3GJXC 1EFHA 1E0KA 1GILA 1NMXA 3K0FA 2F43B 1JBKA 3GFPA 1MRSA 2VHCA 3HDTA 1G8PA 3LXXA 4NHOA 2VF7A 4PPGA 1TPZA 5FR1A 4M9ZA 5HR5A 2J1LA 2AXNA 4KYUA 4UJ3A 5G40A 3RS3A 4JLKA 2QORA 4LCBA 4ABYA 1G16A 2J87A 2VP6A 1WBDA 3CRMA 2IUTA 2OEPA 2Q9BA 4XD7A 4URVR 2ZJ8A 5F9HA 3F3YA 1S2MA 2B7BA 1WF3A 2V8OA 1J8MF 1U0LA 5JSZB 5EQTA 2ONKA 2ZRDA 5BW8A 2Q21A 2N1BA 5IHPA 1MABA 3VKWA 1MT0A 4RD1A 3CPJB 1VG9B 4O25A 3ZIAD 4B35A 4PO8A 4TTPA 3QE0A 2FSHA 1M8PA 2G1KA 4HLQB 4X8MA 3VNUA 3FB4A 5KDOA 3VHLB 1W46A 3W5JA 3GLHE 2NO9A 1UBGA 2H18A 4L9WA 5C1BA 3K9HA 1E1QA 3W6OA 3QI2A 4I1UA 4URYR 2XOKD 3GMTA 1KO4A 2BM0A 2HLDD 4IDQA 4OL0A 4U5XA 4M0LA 3R8FA 2H1LA 4A82A 4PX9A 3MCAA 4ESHA 4D4LA 4LHZA 2W2TA 3Q3JB 3AQ4A 1WXQA 3ZZTA 2O8BB 3KKOA 5EZ5A 2OBMA 3PUWA 4D4JA 3K09A 3GLGE 2XNSA 3NH6A 4B71A 1II0A 2W83A 1Z6YA 2ZAMA 1OV4A 4KVGA 5FL7D 4ARZA 3QKTA 1MO3A 2C98A 2CNWD 1F2TA 2RGXA 3KDSE 3PFIA 2VA8A 3DVLA 4P31A 4Q19A 4TN1A 5AUQA 2V54A 2YNMA 3GEHA 2QAJA 4NDZA 4NMMA 3RS4A 3FTQA 1XTRA 2Z4SA 4JKIA 2WJVA 4D82A 3AGQA 3PR1A 2JLXA 4TSFD 1E99A 2QT1A 4C0SA 3QBVA 2R6FA 4PTLA 1JJVA 5LB4A 4W7SA 4WVFA 1NKTA 5GVSA 3L0SA 5EUMA 2VTKA 5K8LA 2DR3A 5B58C 3I3SR 5CIWA 4PHHA 4OHYA 2WIAA 2O8CA 1J8YF 1LVGA 1Z5ZA 2JA1A 1E94E 3LNCA 4PANA 2J3EA 4QOSA 3OF5A 3MMPA 4Q5IA 4TLDA 3WHKA 1KJWA 2GHIA 1YU9A 3KKQA 2ZI3A 1N6PA 1KMHA 2IWRA 1TL7C 4B3CA 2ZR9A 4RZ3A 3ZIAA 1UF9A 521PA 3SI7A 1OIWA 3DM9B 3BB4A 1PLLA 3NVAA 2AKYA 2QMHA 4Q4JA 2CL6X 5EZ6B 4K46A 4C0LA 3KKNA 4Q03A 1AK2A 3GLFE 3THOA 2VHJA 4KI0A 3FHTA 4DDUA 1G5RA 1QHSA 1A1VA 1E69A 4A0GA 1E79D 1GITA 2R9VA 1AZSC 2AWNA 4BFUA 1P2SA 3P32A 1V5WA 1R6BX 1CJTC 3K70D 1ZCAA 2ZS7A 3NEJA 4POAA 2D3WA 3C4JA 2ODBA 2XITA 2GCPA 3QVVA 4Q4AA 4KFTA 2EFCB 4TT3D 4C0BA 2QTHA 4Q9IA 1YZKA 4B75A 3THYA 2CHVA 2IXFA 5FL7A 1P62B 4QBHA 2CNWA 4KLZA 5FPTA 1Q1ZA 3ZVRA 5TDHA 1NJGA 2ZS9A 3CPHA 1MO6A 3QSYA 4C2UA 1P9NA 3KFXA 1QDEA 4V0ME 2EWWA 1Q21A 3M4YA 3ONWA 5EP4A 3CWZA 3L8YA 3NHBA 2FNAA 1Z8FA 4MRVA 4DCVA 1N5JA 1UADA 1ZUHA 1II8B 3AVQA 4MKFA 4DLWA 4QRHA 2B21A 4NYJQ 5G53C 1E4YA 3QXCA 2J59A 4KAXA 3QXHA 4BLPA 3FKSA 1CR0A 3OAAA 4TTRA 3AF4A 3CW2A 2GTPA 2PX0A 5FFMA 5J40A 4FWTA 4LRWA 1XTIA 3AF3A 3FE2A 2VO1A 3R9WA 3N2EA 2V4ZA 4MA4A 4PC1A 3ADBA 2FFQA 4B73A 1X8JA 2BMJA 2ZYTX 3LW7A 2RGBA 1CU1A 2VPPA 3JVVA 4JVNA 3LQQA 2OFWA 4JJZA 4S2EA 5J5CA 1IN4A 1PJRA 5GJBA 2D74A 3QXXA 3FGNA 1UEIA 3U3MA 2CLSA 2IT1A 5LD2B 3ZD7A 1U81A 4DCUA 3EPHA 2Z5FA 1XEWX 2YWEA 2QP3A 3U2QA 1OFTA 4IFBA 2C9OA 1E2LA 2AR7A 1FTSA 4O0MA 4PO9A 4NCHA 1XD2A 4JMPA 3KQNA 1EFTA 2GCOA 3LV8A 3TRFA 1XZPA 5B57C 5IF9A 2FFAA 3KXKA 2ZU6A 1P9RA 2IYLD 1G7CA 4TT3A 2BM1A 1AQYA 3PEUA 4C4PA 3I62A 2CHQA 5JEEA 2GRJA 4ZDIA 2KJQA 2ZSEA 5CM8B 1AM4D 4BE7B 2ZVPX 2QMUA 4P0TA 3VMFA 4YMUA 2ODEA 4C3ZA 3OFNA 1MOZA 4UNPA 5DSZA 5JCPA 3NBZC 3GLHA 1WDTA 1XRJA 1T9HA 4ERNA 3A36A 2G9NA 2MSEB 3DOEA 4QBFA 4EAQA 4KYIB 1GRQA 3THWB 1A4RA 1BOFA 1XPOA 1XXHE 4CEIB 5EJEA 2ZE5A 1IN7A 1W0KA 3HP1A 4JL8A 3ADCA 1XNJA 4DCNA 3A1VA 3L0PA 4MKHA 1RYFA 2YOFA 3GLGA 4GMXA 2IF0A 2O0HA 4A8JA 4XWAA 5HPYB 1Z6GA 3FWYA 4G01B 4JJKA 4UNRA 1LS1A 4CVNA 2KBEA 3U4QA 1ESMA 2PT7A 1TU4A 3TGPA 4OHWA 3CNOA 5JS8A 2NO7A 3B8HA 4DLRA 4OHXA 2A5DA 4C0JA 4ZPXA 3PQCA 3R9XA 5LDDC 4HLUA 3RNLA 3VX3A 4HYYA 2GETA 3LY5A 2CLDX 4DEYA 2GF9A 2OT3B 4ITRC 121PA 1N5KA 3K53A 1D2MA 4GFDA 2J45A 1NF3A 4C7OB 3DMDA 1Z0IA 2RGNC 3ZVMA 1CBUA 1NIJA 2NO6A 1NVVQ 3SHWA 1EFCA 2ZE7A 1KHTA 2FZ4A 2FFHA 2ODWA 1U90A 4RSGA 2E87A 3T1OA 3R8CA 2GJAA 4H1VA 2H7VA 5FPYA 1JR3E 3M1IA 4NYJR 4A36A 2ZUBA 1C9KA 3AV0B 1GL7A 2W0SA 4P4SB 1KI7A 4Q21A 3GLFA 2OHFA 1P75A 1Q3HA 1UEJA 1IJEA 1JALA 2VQSA 2DHRA 3WBKA 2WHXA 3TBKA 4OQMA 5CYOA 1CJKC 3ZZUA 3TMKA 1CJMA 3ZGXA 1NRJB 1QHHB 1G8GA 4RZ2A 3AVPA 1DAMA 2FE4A 4CEJA 2FEOA 1XD8A 3DDCA 2BBSA 2GESA 4Q4HA 4M1SA 3DL0A 3KXLA 4HDCA 2OM2A 4LSGA 3RDPA 4D4KA 4JSYA 1CULC 3EZ9A 5CJ2A 3T1VA 5JHHB 4M9XA 4LX0A 4Q18A 4RFSB 4YLGA 5J4LA 5DHFA 1GTVA 2VRWA 4L15A 4F4IA 4MUBA 1ZNYA 1Q1BA 1JEEA 4DXAA 1L4YA 3U3OA 2EW1A 3R20A 3ZVNA 2ZI9A 1I2MA 4GBMA 2Q9CA 1R2QA 4Q1AA 2O0JA 4GMDA 1E2DA 3KUDA 1KSFX 4V0MA 3TKLA 2F6RA 2ODNA 2WSSD 2GK7A 4U7DA 3NG1A 5HCIA 2AKAB 3OIYA 1JAHA 2FSFA 4PC2A 4A92A 1CXZA 3MWYW 2EFDB 1DARA 2ZANA 3PVSA 4F38A 3L43A 3QIAA 2CMKA 1FP6A 2A5GA 2DFTA 3IGFA 3LLMA 3VR6A 4OHVA 2VLIA 1E0SA 1Q1QA 1PVOA 1SKYB 2QSZA 3M0EA 4IOLA 3NDPA 4TMZA 2A2ZA 4PFSA 3ZQ6A 2MSCB 4M1WA 4QBGB 5TB5A 3AP3A 1FQKA 1U9IC 1CKEA 2J0SA 1VCOA 3K0SA 1UJ2A 4M1TA 2JJ2A 2R6CA 3ZH9B 4PR0A 1OH7A 3EC2A 5CK4A 3QOFA 3LQRA 1MV5A 3D6TB 1E2JA 4GP6A 2E9SA 4RY2A 1W36C 1VYVA 4MUAA 1T4GA 4L8GA 2PCLA 1ONBA 4G5SA 1TF2A 3Q8XB 3QVUA 3B82A 1GKUB 2WJIA 5CM9C 1RIFA 1T5IA 2ERXA 3W8NA 1ZD1A 2WWXA 3LBIA 2GXAA 1G3UA 1TUIA 3WNCA 3MUFA 2IEYA 2EYUA 3U7GA 3OESA 2XB2A 2VP9A 4TL9A 4DLTA 2GXSA 3T06B 3ASYA 4G5OA 1R5NA 3RANA 5B64A 1N0UA 5J4KA 4TWZA 5K8TA 4XH9B 5L3QA 2HV8A 1UAAA 1Z6XA 1OHHD 2QQEA 4KJZA 4XTRA 2PX3A 3FMPB 2A9KA 4CGZA 2CE2X 1YHNA 4BEBA 2BDTA 2WSSA 1NVVR 1E9CA 1IM2A 3I5YA 2KWIA 4LUCA 4HAUA 4Y0AA 3UMSA 1A2BA 5KSOA 1XXHA 3IO3A 4URUR 3HPRA 2WWWA 5GJWC 4FW9A 1W5TA 1ZP6A 2V6JA 3BGWA 4A6XA 2R44A 3NWJA 4BECA 3CRW1 5E7IA 4IXNA 1LW7A 5TMPA 2V1XA 3FMIA 3NBYC 2BV3A 2D7CA 1KK3A 3W90A 3C8UA 5J4HA 1JXOA 1I2DA 4QGFA 3EZ2A 3RS0A 2GNOA 3FFBA 2GJSA 4BFTA 4EFMA 3WY9A 1NMYA 2HT6A 2WJGA 5EXTA 1Z0AA 3HJNA 4M8NE 4XVQA 5UKDA 4KXFB 4MRPA 4Z8YA 1LTQA 5G41A 1YJ5A 1J7KA 4ASUD 3QJYA 1XEFA 3O8CA 2IK8A 1CEEA 1UKVY 2I4IA 1S9DA 3X1ZA 5AWFC 4MRNA 4F93B 3NTUA 2G6BA 5E7MA 1KDOA 3RC8A 1TUEA 4LBZA 2ZRJA 4HEJA 2ZS8A 5AJWA 1QBKC 2WTUA 1YRAA 4Q9KA 1YR7A 2JEOA 3FYHA 3S1AB 3W8RA 3B1YA 3U44A 1G64A 2JLWA 3VR5A 2GF0A 1AQUA 1IY0A 1JR3A 4Q1DA 4EPRA 5HZKA 3THXA 2W6JD 1IQPA 3LA6A 2HDNB 4LC1A 2PEZA 2FX3A 2DYKA 5HZHA 2QZ4A 5BN4A 2JJ8A 4KFSA 3A1SA 4MYTA 2QBYA 3MWJA 1JPNA 1OFHA 4TZ0A 1DAEA 2VF8A 2KSQA 3B9QA 5J4YA 2ZPTX 3NH9A 3ASZA 5FTLA 4AURA 2HXSA 5CJPA 3BB1A 3TNFA 1E98A 4EPVA 2BEJA 2I3BA 6Q21A 3CNLA 3W34A 2V9PA 1GZSA 4PSKA 5FPSA 3GJ0A 5AJYA 2H16A 2OXRA 3X1DA 1WA5A 3UXMA 2ZR0A 1WRBA 3EWAA 3AKDA 3QY0A 5BWMA 4AKIA 5TY0A 2OESA 1KJYA 4AG6A 1OIXA 4G5RA 2CCGA 3B1XA 4TYWA 4F91B 4CT5A 3O8DA 5FBVB 1RFLA 1JECA 2VBCA 3C16C 5DISB 1GAJA 1U8ZA 4W9MC 2XJ4A 4JLBA 1P3JA 4NE2A 3NKVA 1RZ3A 4OK6A 4GDFA 4IJMA 1AS3A 4ASUA 2CK3D 1S0UA 2YHSA 3IBYA 4N3NA 2QMOA 3D31A 4JVSB 3I32A 4NONA 3KL4A 4D0GA 4PHTA 3UWKA 4A4DA 4A0FA 1E9RA 1QF9A 1SKQA 4NYIQ 2YOGA 3MSXA 4E03A 1DE0A 1JAIA 2BBWA 1OB2A 3BH6A 3KQLA 4NCJA 4WAUA 5SZIA 4LJ6A 2ZR7A 5JJIA 4URXR 1T3HA 3A37A 3SBDA 4TTQA 3UK6A 4LJ5A 4PPNA 3RRNA 2O8DA 2QRZA 4V0LA 1GDDA 2W6JA 3SNHA 1KI3A 4B3BA 1S3SA 1YZUA 1KDRA 4DLVA 2VHTA 4BQSA 2ZSDA 5JCZA 3TIFA 1HQYE 4I81A 2H57A 2OCPA 1FMLA 5LD2C 1E2KA 1T0HB 3PEYA 2FGKA 3DZDA 1QVRA 1E4VA 4DSTA 5JWHA 1E9BA 1E2MA 3FHOA 5TARA 1IAQA 1SVKA 2ZRBA 4X8LA 4B74A 4LV8B 4JLAA 1HV8A 3KB2A 3U6KA 2QTVB 3WMFA 1B0UA 4Q02A 3RVBA 1Y3AA 5E95A 3MFYA 1J90A 2F1JA 3T5DA 1H8EA 3EZFA 1QG2A 2IX3A 1G4UR 2NOAA 4DC9A 1NLZA 1WCV1 5KPDA 5FOXA 1XTJA 1P2TA 4DT1A 2GA8A 3C5HA 5DIFA 4O3MA 5DNYB 4QG7A 2A5JA 4RD4A 3SYNA 4M2LA 3CF0A 1LNZA 3RAPR 4PQRA 2FFBA 3A4MA 3EX7C 1F2UB 2CK3A 3NC1C 1KJZA 1DS6A 3OIVA 3WYAA 4ZKEA 4DDVA 3KUCA 3RLFA 2ZRGA 3A6PC 4OJKA 3EIQA 4JVLA 2ANCA 4LBVA 4QM6A 2G1JA 1Q57A 1IOZA 1ZJ6A 5KO2A 1DTSA 1F5NA 2AN9A 4C0HA 3QKSA 3KQKA 4V0OA 4MKGA 2FPLA 2VIIA 3OEHA 4OQLA 5JWRA 4V0KA 2XJ9A 1SXJE 1YRBA 5JS7A 1GM5A 1ELOA 1CR4A 5FBRB 3VKHA 4ZI3A 1E1RA 2OCAA 4GZMA 2Q9AA 4B48A 1KY3A 3ZQJA 1G21E 3B85A 3A8TA 1U0HC 3BE4A 1XJQA 1ZBDA 2QNRA 2LKCA 5D3MA 5BYJA 1G3MA 2NG1A 3E70C 1TF5A 3GLIB 4HAYA 1AS0A 1FX0A 2ZVQX 4MQBA 5FH9A 1A5TA 1ZD9A 2QRNA 2WWGA 5F98A 1JQLB 3RS2A 4AKHA 2CVHA 3LLUA 4DSNA 2R65A 3FDIA 2NZ8A 2RH5A 4DRZA 2Q3HA 3X1YA 1ZM2A 2C8VA 3MWKA 3ZLJA 1W44A 1XTSA 2ORIA 4FCVA 4R7ZA 4HB0A 1NVWQ 4IW3B 5JMTA 5KOYA 1HT2E 1EK0A 4WZAE 2QPOA 4FWIB 2WBLC 3A4NA 3BB3A 3MJRA 4GL2A 2CDNA 3O8RA 1E2PA 2FOLA 2J0VA 2OXCA 3N2IA 2C78A 4NYIR 4MYCA 2V1UA 5EE1A 3F5FA 4LPSA 3K0CC 1SVLA 4R9UC 1KI9A 2HF8A 3WYFA 3K0AB 3DM5A 3KTAA 5B30A 1G20E 1G7TA 1P60A 4C2TA 1OJLA 3Q5DA 2ONJA 1OXUA 1GG2A 1DOAA 4LC0A 1TNDA 3KKMA 1ZW6A 4BLQA 1KI6A 2NMVA 1SVOA 2DWQA 1TQ4A 2ZJOA 4UJ5A 2G77B 1QRAA 4R71A 1EFRA 2CBZA 3TJZA 1WP9A 1XP8A 5IDVA 4GZLA 1LY1A 4RD2A 2JDIA 2FWRA 3DKVA 3QQ5A 2CVFA 1SHKA 4DLXA 1RJ9B 2NPIA 2ZSAA 3PCRB 1W5SA 2VYFA 1R5OA 5FI1B 2O8FA 2GJKA 3RSOA 4DUGA 2D7DA 2G0TA 1GP2A 5JEDA 4U02A 4EIWA 4LBYA 2Z4RA 5DN6A 3I8SA 2QT0A 3KXIA 2OG2A 2P5SA 2EU8A 2Z83A 2ZRPA 3VHXA 1UBFA 3W3AA 1T5LA 2L0XA 1M7BA 1UKEA 3WNDA 1P5ZB 2OFOA 1Y63A 4BGDA 5L8VA 5TVKA 1Z6AA 2HJGA 1ZMXA 2RGNA 5AJXA 1G3RA 1RW4A 2ZTSA 3FKSD 1PZNA 3OAAD 3AVWA 3P4XA 3U4QB 3T1QA 3L82B 1XFAA 1WQ1R 4B34A 1Z63A 3QG5A 2QENA 3B5JA 3GJ5A 2FGJA 2FSGA 2WAXA 2EQBA 3JVUA 2VSXA 4QHYA 2O8EA 2X2FA 1ZC4A 2FMXA 4B32A 4DVGA 4CEHB 1SXJD 2GWHA 2IA5A 3FHCB 1UM8A 1L2TA 4Z1MA 1PUJA 1N25A 2XEXA 1NY6A 1Z83A 3LVQE 3LXRA 1OH5A 4GOXA 4B6EA 2ZJ2A 1FNNA 1US8B 3OE7D 3HR7A 2G3YA 4PPQA 1XEXA 4LJ8A 3R7WA 1X8LA 1RRFA 2ZRMA 1RRCA 2OBLA 3BD9A 4M4SA 1EESA 1OFIA 1UFQA 2ASEA 4QGHA 1E9DA 1OXVA 3MGCA 4XOIA 4O2RA 3SHFA 2HF9A 1YZLA 5FOTA 3GEIA 3SS8A 2Z6VA 3EPJA 4FMDF 3SJBA 1W7AA 3QF7A
chains in the Genus database with same CATH superfamily
3KDPA 1YS9A 1OSNA 4U3JA 2PH5A 1KMMA 1L7VC 4PYOA 3BMXA 1XPUA 3PQDA 2MDTA 4LNAA 3BF8A 2J7PA 3ZHTA 3WIVA 4LFCB 3P26A 5M29A 2ZRKA 5IVPA 3JQDA 2UXBB 4KIUA 2IS4A 2BFMA 3QEJA 1YZQA 2R1VA 2W90A 1YS4A 2A0WA 3ABOB 3V46A 4LF8B 3PDIA 5HMMA 3RM3A 4IIJF 4TSKA 1USWA 1EVEA 3UJNA 5IKEA 3LXUX 1BEUB 1YD7A 4QHTA 1ML4A 3VDNB 3AVOA 2R1UA 3DBHB 4KSBA 3QENA 2WDPA 3PC8C 5HE9A 1FJHA 2OGZA 4ND7A 2PMEA 4D56A 2IYPA 2PLNA 1Y3DE 1VI2A 1YE3A 1JAXA 2ZJBA 4JLPA 4ESVA 4GE0A 3JPWA 4Y2UA 3PQ6A 2FLWA 1TVCA 1JEDA 5JFOA 3A4YA 1EMDA 1WHSB 2COUA 1KK1A 1TCVA 1DAKA 1X2EA 3K0EA 4PBTA 1PT9A 2G4LA 3TQTA 3C3AA 3IHLA 3U61B 2Y4OA 3NT5A 4HPJB 4BNKA 3HCBA 4Q7LA 4QT4A 5L45A 3OP1A 5CDYA 4RV4A 4CGYA 1QRDA 3JPYA 3K0HA 4MO9A 1YVDA 2BBTA 2ZTMA 3UOAB 1GQRA 2XGMA 1SXJA 3R8XA 4CQMB 4DA4A 3EUWA 4G1EB 2XAAA 3EPLA 2JGLA 2ZJZA 3EISA 1TRHA 4YP7A 4I1SA 2XT9A 4EA8A 3OE7A 4EI9A 1GKLA 5EESA 1Z5OA 3D6JA 2VDUE 4JLNA 2H51A 1U3UA 2QTCA 4LCJA 5FXMA 2PUCA 4D79A 3W9YA 2VUHB 5EE3A 3P52A 4G1UC 2C07A 4LOIA 1CZLA 4JOCA 1XCGB 2X0EA 2DB3A 1W4ZA 3OCXA 2ZM5A 3RIHA 4ARUA 2EDCA 4HRYA 1EWRA 2QI9C 3JASA 3NRJA 1G18A 4OH7A 3VR0A 2VYQA 4OI4A 5I7OA 4DRXB 1L4MA 4ENPA 2WJZB 1NVXQ 2DY1A 3B3FA 2JLVA 2CCKA 2ZR8A 3HU1A 2DHEA 5FPHA 4UNNA 1QQAA 3FCYA 1Z0UA 2J9FA 3FTEA 5F9FA 4DLLA 3HKCA 1G5TA 1I6LA 4HLDA 2YJTD 2BTQA 3V42A 1H1LB 1NKSA 4CU2A 3KR9A 4F72A 1RVV1 3BFKA 1ECFA 3F7MA 2PG3A 4D96A 1T3SA 4GUAA 3UANA 1FOEB 2BF4A 3F5MA 1W30A 4R1LA 3PEWA 1JIVA 2C97A 1EYZA 1F2VA 2GN1A 1O5OA 2QPAA 5JBQA 5C4MA 2WUDA 4ZDJA 3L7CA 3R41A 1D09A 3K9GA 4Y2PA 1UXHA 3IBGA 2P2ZA 4JIMA 4E5KA 1G2QA 4EY8A 2Z6UA 2O8BA 2QZSA 4DDTA 1MZVA 3MTEA 2P4SA 2BHSA 5JVDA 2J9RA 4H7PA 1EHIA 1NAIA 4OJTA 1CVRA 4MYUA 1FXWF 3PR2B 4KC0A 1IB6A 4NAUA 2ZVDA 5FI3A 4QXAA 4G09A 1V1RB 4BCDA 5D85A 3DL2A 4B3SB 1GG9A 3S6JA 3BUSA 2ZCVA 2C31A 3IQHX 2O2IA 3O84A 3N6XA 4GLFA 1IZ8A 1MX3A 2QN6A 3QHQA 2FUG6 5B55A 5BMOA 4TV8B 2QW0X 1RCTE 3IAUA 4V2IA 3CYFA 4H3KB 4UREA 3TSWA 1ZRSA 1GPDG 3JYHA 3GUCA 3BCHA 3PI7A 4A8TA 4JYBA 4NL4H 4QGGA 2WFAA 4CLXA 3V00A 3CNBA 3RU7A 2ABWA 4ZZ2A 4PE5B 1N9GB 2C8LA 1FQOA 5ICGA 1ZEMA 5CDHA 1NPDA 4OLBA 3K09C 1VGQA 4RJ2A 3TJRA 1KSGA 2C2WA 3MS4A 1SHJA 2ZIZA 3C1TA 1JHXA 6REQA 4QYWA 5IC4A 1V1MA 2FDCA 4BFCA 1Z0DA 1ZNZA 3N2GA 3OMXA 3ILXA 3BX1A 4OKNA 4K86A 1SEVA 4XWOA 4IF6A 3BJIC 1RYHA 4M9CA 1U0EA 2A9VA 2C96A 3AEYA 3ZCSA 2I4LA 5JXJA 4ZOLF 2GSDA 5EXDA 3WGUA 3ZGZA 3KB1A 3Q4GA 3VDRA 3E5RA 2C3PA 4WCDA 4UVHA 1F0KA 2G5PA 1LSOA 2L69A 2RI6A 1EGMB 2ZUTA 2PUHA 3UJPA 4B47A 1ICIA 4TUYA 3IKVA 5K3BA 2PNJA 5HX7A 1KSJA 1Z3IX 2XCQA 5CT6A 1HETA 2PANA 5TGZA 4BKMA 3VFDA 4F0JA 4MDEA 4S1OA 3FYUC 3WGQA 2Z3WA 5IC6A 1C4OA 1IPFA 1T0UA 2CLCX 5BYKA 4BX0A 3ENZA 1U0FA 4BMCA 1CFJA 3LQKA 3GGGA 3LQ4A 4JQZA 1W47A 4XIGS 4KR9A 5LYYA 4I3FA 2X4DA 3OQJA 3QFRA 1BU8A 5DHAA 4PC7A 3WJAA 1I4WA 2DSNA 3DFMA 1NMQA 1H6DA 1DHRA 2BOVA 4FYKA 3RTBA 4CM4B 3USZA 4ZT6A 4KFCA 4LF9B 3AWIA 1ESCA 4KAAA 4YC7A 3X43A 2W6QA 4KR2A 2J3QA 1MOSA 1Y7HA 1KVUA 1M1XB 3SC6A 1SR8A 1P7ZA 2VPWA 2FPMA 4X24A 4R0VA 3BOSA 3JTMA 4TL8A 4KDRA 3EA0A 4WSOA 2NZYA 3EMKA 4NBVA 3X2FA 1TUBA 4MTCA 1ZD3A 4M7RA 5ALWA 3TM5A 4AULA 5G4KB 4JU9A 2A3NA 2H29A 1MJGA 2YMLA 5AHXA 4Z49A 4JENA 5B1SA 1II8A 2R6R1 5DM70 1AXRA 1H65A 1NE2A 3ZNQA 1TFRA 3F9RA 1ODTC 1N3YA 3EFOA 3GFBA 3T35A 2FZVA 2D4AA 2CD7A 4L6IA 1IN8A 4MIOA 4D25A 1Z8HA 1N2CB 1K63A 2GBFA 3CH5A 3GP8A 4FZ3A 4EFLA 4WQMA 3UH1A 4CQMA 1K88A 1SXQA 1JMYA 3CEAA 5K0JA 1XQVA 2JGNA 4I1YA 3STYA 2VT7A 2WB2A 3CR7A 5FULA 2UYGA 1XEAA 3I2IA 5B2FA 1T2EA 2AMYA 2B6HA 2ZTLA 2K7ZA 3LNTA 3QW4B 4FK8A 4BQNA 4HGZA 1OX4A 1ZMTA 3VTAA 5FL3A 4QNNA 1LLFA 3ZY5A 4IOMA 3KVVA 2J6IA 3OLCX 3FDZB 1XA3A 2QRLA 4XKJA 5DI9A 3ZYCA 4YRSA 2OO7A 2C4MA 3KTFA 4GXTA 4EW3A 5KHOC 1L5MA 4YAOA 2XXAB 2R97A 2V3WA 1VMKA 2Q7XA 4AUEA 1MVLA 4BFXA 5ERXA 1UBLS 2PH1A 3ZCQA 1PI3A 2O1WA 3JARB 1JKJA 1JU4A 2EERA 4F9EA 3TSOA 1AA9A 1NBHA 4H7FA 1XO1A 4NBRA 5KHAA 1QANA 1UEXC 3ANYB 2RGWA 3DUFB 4X45A 5CPBA 4C43A 1FFWA 5WRFA 2R6AA 1E61A 3TK1A 5AVQA 5CVCA 1SPXA 2DXIA 4RM3A 1X7WB 5AKYA 3TQHA 1T4CB 2H48A 2PL9A 3I8OA 4Z51A 2XYVA 2NVUA 1CUWA 1AU9A 4UPVA 2XZOA 2IEGA 4UEQA 2ADFA 2EG5A 2IXGA 3JALB 3TSAA 3WNZA 1ULBA 4NS4A 4YNBA 2AFIB 3FUWA 1HQDA 2GDZA 3AHHA 2WYUA 1XMPA 3KYCB 4MH0R 4N0MA 1DSSG 5IJ9B 2FEKA 3WKAA 4N12A 3QKRB 4CETA 4LWQA 3SHQA 5KVQA 2NU9B 4D9MA 5A9SA 4P0QB 4HQ0A 3JQFA 1J20A 3ACCA 3KLNA 3OPYB 2GH1A 3MJHA 5CUQA 3SFVA 3DXXA 1U8YA 3OE5A 4XFDA 5BQPA 3KLPX 3THWA 1SBZA 3TBFA 1EFAA 1T36B 5KOIA 5KOHB 1JR6A 3VV3A 1LJUA 3S2UA 4BPBA 4CEIA 2PZEA 4EEKA 2HU5A 3TAUA 3NNDA 1NR7A 4UUMA 2OYCA 3LW8A 3ZWNA 2WZDA 5JROA 3HLTA 4QUEA 3UWPA 4YCMA 4QU8A 4DLAA 1JH9A 3BGDA 4P3PA 4PZZA 4E33A 4TQUS 3HNPA 4B7XA 2JI4A 1OVMA 1JSLA 4ZIRB 4D0SA 5EQDA 4Z7JA 1H2HA 3KQUA 5JNVA 4A2PA 1X1QA 4WNIA 1O96B 1K86A 2VHUA 3Q7SA 3D7KA 2QROA 5DH9A 2QP9X 3GIDA 2ID9A 3CZ4A 3P9KA 1FTNA 2B25A 3MQ4A 1YVEI 4IEFB 3H0EA 4W99A 5F35A 4DHEA 3FSJX 4EB8A 3DOJA 2V5VA 4A2WA 3DLAA 4M1YA 3IT1A 1GFSA 5EHIA 3T9FA 5GMOA 4ETIA 3BIXA 4BYMA 5AXCA 1XGKA 3AUSA 1IJFA 2F62A 2IUEA 3MD0A 3NO4A 4J4TA 5EP2A 4C7OA 2JI6A 1PYGA 2HWWA 4L72A 4PG8A 2OCLA 3HUTA 3PWTA 2RFLA 5JLAA 4G0ZA 2Q6LA 3K0FB 1T3LA 3LQFA 4K2AA 5D5HA 4EM6A 2YVKA 3QE3A 4IRXA 1GUBA 1GY8A 3N3AC 3GOHA 1C7IA 1ECJA 1JXMA 3FVQA 3BFJA 3N3BC 4TGLA 3UWOA 1BGVA 3HZZA 1JBEA 1KRHA 5KSPA 1T9CA 1UDBA 4AYTA 4CIVA 3CVWA 4DV3B 1P4JA 1DWQA 1Y80A 2EW8A 4KQEA 1FLDA 2IOHA 1C8LA 4U00A 4IZIA 1PT6A 2BFDB 3KZCA 4N5HX 4C1NA 2PKWA 1AF4A 1VZ2A 3GEDA 1N77A 2I1VB 3R76A 4CI0B 1C7JA 2FKNA 1EE1A 2Z6QA 2FWNA 1NKVA 3EUFA 3GRYA 1U0GA 3QVGB 3D3QA 3NHFA 3NETA 3R5FA 5E8RA 4CUJA 1QHHA 2VK1A 3BORA 3F0TA 1GRRA 3T7IA 1G6Q1 3FH0A 2YTZA 2WM2A 1FUEA 1VYTA 5FPKA 1VJDA 4YJFB 3LI2A 2FZLA 1CUEA 4GZ5A 4DOMA 2O8VA 4F3NA 1QOZA 3ZX4A 3U60B 3CZQA 2I2FA 4DLSA 4N03A 4TM7A 3WYGA 1FZTA 1CLUA 1CX9B 1DO0A 2REXB 5COQA 3G2KA 3CCFA 2IUUA 1CFZA 4JB2A 2RK6A 4EG8A 4IRUB 2WWFA 4LZWA 5TMDA 3T1HB 2X58A 3VNSA 5JQGF 1XXLA 3JRXA 3OOWA 1E2GA 1QHFA 3NEYA 4L08A 3T3DA 4RK4A 2Q5FA 1P80A 1E3TA 2QGZA 4F12A 1KPIA 5FQOA 5EE0A 3HHPA 4YRNA 1IIBA 3G49A 1Z35A 3UCFA 1R8XA 3E3OA 3PUXA 4CLDA 5B7PA 1ZNQO 4LF7B 1N1DA 2QGNA 2IH4A 1HURA 3V5NA 2G80A 1ENOA 1AKTA 3I9NA 3W8FA 2IBMA 5H68A 2BR5A 3A9VA 5ADUS 4RTLA 2M32A 2ATVA 4OXIA 1HE1C 3CWQA 4M83A 1IZYA 2BFBA 4HS4A 4PAWA 4WN9A 5EP1A 3WRXC 2AQKA 3P1JA 5K3SA 4QO7A 4FHCA 4IFIA 5EMKA 4HOYA 3LX6A 3PG5A 3KYDB 4HDNB 1YZGA 1OYWA 3OEHD 4U6NA 4YPFA 2QW8A 1Z4JA 4L51A 4LRQA 2RAFA 3DYBA 4PRYA 3WADA 2JFVA 3RG8A 4GI7A 4PHFA 4RTMA 3G6KA 2J3JA 5ICFA 2O8CB 1P2VA 1J9EA 5E6RB 2K5UA 3W2TA 3NPAA 2B1JA 3R7LA 4BRSA 4BVJA 2G9QA 3WWEA 3PLRA 1ECLA 1Y7IA 2PRZA 1NR5A 3NKLA 2X1VA 3LG2A 4ZO7A 4DMCA 4DYHA 4KLAA 4GOOD 1I6WA 1RAAA 1RKQA 3FCSB 3GN1A 1KMHB 4WUVA 2PFSA 2WKWA 3K0KA 2X2EA 4UVIA 4PYMA 5CYFA 4IVQA 3LFUA 5AICA 1G41A 3VNBA 1VFPA 1T0IA 1UK6A 3L7MA 2PMFA 3ILHA 3N07A 4Z9BA 4N47A 1MIHA 2XTZA 3A6JA 4B44A 5FWAA 4C3VA 4RFVA 1PR0A 4MPTA 4JR0A 1A8SA 1R6DA 2YIMA 1TPYA 3B7PA 1X87A 3QPCA 3RVMA 1ZI6A 3ZE6A 3FG9A 1EX6A 4E5MA 4C07A 2WU0A 2WVJA 4A0SA 2ZYSA 4LY6A 1AZTA 1USUA 5C34B 1GIAA 3TCXB 3SVZA 1XLUA 3K8YA 2OLEA 4BNDB 2BPOA 1SK8A 3DGFC 2XEDA 4NMXB 5JARA 4DCGA 1QCZA 2PUJA 3BDIA 2UVPA 5BSEA 2HXYA 5FUVA 3GVCA 3AXSA 4CM3A 3Q7IA 4Y1RA 1OI2A 5DM1A 3N2LA 1AHHA 1JSXA 3HCOA 2FLKA 3IMKA 4RMJA 3X1XA 4DCJA 1YR8A 3L49A 4QGBA 1KAEA 5JDIC 5CK5A 3EGIA 3PJGA 1N92A 2DY0A 2ZT7A 1KZHA 4BUZA 4NCBA 4WA8A 5CX1A 4BWFB 1Z28A 1ZZGA 2IPXA 4TZ6A 2W9XA 5HG0A 5I9SA 2VNKA 4EX6A 1EFRD 1B8PA 4JC4A 1YQWA 4LDPA 3OY2A 1N5MA 4LDRA 1Y6FA 2QL7A 2X0RA 2JDID 4DUPA 1XR3A 4ZARA 3JYLA 3NOXA 2ZUUA 5FFNA 3TTWA 2YKGA 1F6BA 2GK6A 5BW6B 1WNTA 4FOOA 1Q0TA 5G3ZA 1JDNA 3OJOA 1UPBA 2W11A 2Q7OE 2BONA 3GD7A 5DN6D 2OLJA 3U7HB 1EXWA 4XJVA 1AJEA 2WHYA 1X7DA 1TLFA 4C5CA 4G5HA 1K8RA 1LVUA 2B34A 2P5YA 3OU2A 3K16A 2PKQO 5D3QA 3W3AD 4FDVA 2CJPA 1NSYA 1WUTA 1KSHA 4RF4A 3REOA 2AC7A 1PJ2A 4XVHA 1NW6A 4GSLA 4L4UA 5FWYA 3WISA 1GPBA 1ARZA 2FF5A 4PX5A 1H85A 1WZCA 2QRVB 1YCDA 3T3IA 4L7QA 4EY6A 1IN6A 4AECA 4F4DA 2EKDA 2O3RA 1UKYA 3NHZA 4GBED 5LP1A 1Z18A 3STVA 5KJ6A 2F9FA 4L1KA 2Q3FA 3CB4A 3S1AA 3H5VA 1E5QA 1L7QA 2OBNA 3IXLA 4NXNB 1FE8A 5JC8A 1NYRA 4RF3A 4TS4A 3NWBA 4BWGA 3CUEF 1BE1A 2ZVJA 3HYTA 4Z1MD 4F1JA 5EAIA 5LUAA 3N8HA 2BKUA 3T5PA 4FMCF 4LRTB 3ANLA 3QP9A 4IDFA 3ZWKA 4CIDA 4YYEA 2H4ZA 1NJ6A 3UXYA 3NTOA 2GCOB 2PMWB 3D8SA 4HRXA 5ERGB 1SCKA 4OTZA 1E3SA 4ZVKA 1YASA 1W4BA 1T5HX 4RD3A 3E9ZA 3CIOA 3UKOA 4QSHA 5EJ9A 1ORHA 5ALKA 1XTZA 5BMVF 3ZWMA 3UA3A 3ZWCA 5CAEB 1O89A 1N6RA 1N78A 4UCFA 4AIIA 3HDJA 3UT6A 1BN7A 3UFXA 2NADA 1FSSA 2AXPA 2Q6TA 3DAPA 1K8XB 1RQ7A 2ODPA 3DE3X 3UV6A 3ZDRA 2WJAA 2OCIA 3ELUA 3VDMA 2Z43A 2GYWA 3AJRA 4Q00A 3ABIA 3O47A 3GLHB 2YJNA 3GH3A 3QELA 1JPVA 4E5VA 3AFNA 4N3NA 1QYVA 4ZVPA 4GOND 4U0JA 4RULA 3L41A 4ILEA 4IHQA 4MARA 2FMFA 4P3KA 4FEEA 3T5AA 2C4UA 1QDLB 1TD1A 1TVEA 4EUEA 4KRXA 5TXGA 1QFZA 4J0QA 5KTYA 2ZKLA 4N1AA 3C39A 2B5OA 3KJZA 2O7RA 2Y66A 3LQYA 4FSHA 4EHKA 1VBKA 3PSAA 4DMUB 3T1TA 1H4VB 1X7YB 4GP7A 4WCVA 5K0FA 4L76A 1RZVA 2IL1A 1LC3A 2EF0A 2YC4C 3C48A 3MJVA 3R74A 6LDHA 1GUDA 3BXXA 4QDXA 3B5EA 1L1RA 2PN1A 3EULA 1R74A 3ZQ4A 2C7RA 1Z2AA 5B3KA 2Q28A 3EFBA 3CG0A 2PPVA 1TZCA 4RPHA 4Y30A 4MVYA 3I4LA 1E6EA 4OQXA 5JDCC 4ZQBA 3QI7A 2ZULA 2BZGA 2QAGC 1L7AA 3AP1A 4JEMA 4GKJB 3IV9A 2ZI7A 2C03A 1G7RA 1ZRNA 2R87A 2NVBA 1O94C 4KQCA 3PD1A 1X80B 4HAWA 3RASA 2CXPA 1NXVA 4EHAA 1XJCA 2ZOSA 4O5AA 5IUKC 4I3HA 1KP2A 1KAOA 3FYUA 5K0EA 1JE1A 5DYNA 1MC8A 2YXEA 3SSAA 4BQIA 4IL5A 1M34E 1QHYA 4QPJC 4ZANA 4G0WA 5DLYA 1NNEA 1IEWA 4HVAA 1G63A 2IWHA 1ILWA 2GN8A 2I6TA 3MMSA 2NYAA 4O6VA 2K6GA 1Y9AA 2J4DA 1JFLA 1NOJA 3UUEA 4BO8A 1VI5A 4BFWA 5C5DA 1XMIA 1I1HA 6GPBA 2I3DA 4PLWA 4KXVA 4LJ4A 4I1RA 3V8BA 3GLFB 4DQKA 3JYQA 2QNIA 3QPBA 3WIBA 2R68A 5K0LA 4B40A 2H4FA 5EXPA 3IAS6 3L0IB 1PS0A 10MHA 3H2BA 3L1VA 2H5IA 1FMTA 3NBFA 3TX2A 1L7MA 1NM5A 1TK9A 1XJ5A 4QFCA 3U7QB 2QTVA 3C0KA 5C8YF 4C21A 2WF6A 1AKRA 2G72A 2GN9A 4X3CA 3L84A 4DLBA 1E0AA 2BUBA 4G97A 1AHPA 3I6IA 3LHKA 1PQUA 2AE1A 1DBVO 4OHUA 1JQDA 4GOJA 3RQIA 5JT1A 5KQMA 1HC7A 2ZWMA 3D8UA 4BNYA 1DWPA 2VPQA 1OI4A 1Q12A 1QB7A 3OVMA 5I7RA 3RS5A 5BXQC 3EIUA 3P0HA 4MZXA 2UVDA 1VL5A 3WVNA 5AVYA 4ITVA 3FWZA 5GONB 4I4TA 3I3OA 5C7IO 4EG3A 1TI7A 1E2IA 3SSNA 4D57A 3BE5A 3MTJA 4FCCA 4IVRA 2FE1A 4J6FA 3QZUA 2Y2VA 3NYIA 3BH7A 4RHCA 2YRWA 2R5FA 3UIEA 1BZYA 4KYVA 1CIJA 3EK2A 4BQPA 1F2DA 4DJAA 3II6X 2P91A 1JLHA 1U9IA 3A6GA 1R27A 1Q0HA 1PEKE 3ESDA 3O8QB 5A4DA 3IRVA 1UXJA 1ZA2A 4NI5A 2XDYA 1GADO 4HWKA 3WMWA 1XF9A 2GM5A 4K9SA 3MG9A 3LO8A 4Q3LA 1DG1G 2VDJA 2JLCA 3PEVA 1RLTA 1TE2A 1JILA 4EPXA 2PGNA 2HRZA 4MROA 4DNQA 4YT5A 3KALA 3F8TA 1JZTA 2QL5A 4ZAFA 3TLGB 2V7WA 2GEUA 1UPFA 5CNKA 4LHWA 3AYZB 5AVTA 5ALOA 3ZGYA 5EIBC 2IEAA 1YONA 1WBJB 1AKYA 1ZK0A 1MO4A 3CKLA 4BMYA 3RYIB 5BR4A 2JIZD 1UC5B 2F9MA 3OX3A 3BJZA 1G5FA 4WKBA 2I6XA 5CB0A 1KFEB 3TRDA 3V4OA 1NI3A 3P27A 3MF4A 3ADKA 1W1IA 4WBNA 4MGIR 4ZGGA 4S0XA 2ACEA 1RC1A 2P4QA 4EKIA 2IPNA 3H2YA 4QL3A 3EIXA 1YBVA 1Z38A 3EVEA 3GROA 4F4UA 1FQJA 1BGWA 1GNQA 1U5BA 5H0IA 4Z4GA 1EX9A 1VLQA 2VJKA 2Y6UA 4WT7A 3MOSA 5DBGA 3WAJA 3A10A 3H16A 4RTKA 4FHGA 4RHFA 1CUIA 2IHTA 4LV6A 3I9V6 4MIEA 4OLFA 4XM1A 4C01A 1T6ZA 2C29D 2IP1A 4WOKA 1I4DD 2FFJA 4P32A 1VHTA 1VPVA 3KX2A 5LXTF 5BXYA 4P7GA 1EA7A 2O5CA 4BVEA 5EXEA 2EZUA 2BI4A 1UFVA 3L46A 3QWBA 4NJMB 3RWMB 3W77A 3AG6A 3HJRA 3I5UA 1P4AA 4PYQA 1ZD5A 4BZXA 1XZFA 1G5PA 1MPTA 1W87A 2F3UA 2LP4Y 2EFEB 3ZK7A 3ZWYA 4DC0A 3WHLA 5GJCA 4YPVA 1HZZC 1RM4A 4CW7A 4N54A 2XSZA 4TPKA 2IRWA 3DCIA 1ZU4A 4R2XA 4DMHA 2LD4A 1KI4A 4MLZA 1L4UA 2EYQA 3LCJA 2IZZA 2NZ2A 1VP3A 2O2HA 3VR4A 1X1RA 2ACVA 4AY2A 1L7BA 1QLHA 1LDEA 3E3NA 4BKPA 4KOEC 3RTDA 1TA9A 2FSVC 4IH9A 1B41A 3FSRA 2PTHA 4H35A 1RJ9A 1WKCA 1Z4OA 3K5IA 3U9SA 4ER5A 3ZDEA 1HYHA 2B4RO 2CY0A 1XXHB 2BHTA 2OV1A 4LOLA 1H69A 1HSOA 2ZYVX 1XTTA 2F1HA 3D0RA 3UEOA 3ZJYA 5CFQA 3IE1A 4FFVA 2HADA 2QTGA 5A62A 3EVZA 5J3JA 4N5DA 3DL7A 4RCZA 2EV9A 3BREA 4G5FA 4GZ6A 5H8WA 1CRPA 4M0CA 4RKWA 1T2NA 2B1RA 3PCXA 2YIDA 2PRYA 4L8VA 3SIRA 5FBQB 3K2BA 1WUKS 1N8KA 2JG3A 4NJEB 3F7TA 3OQ1A 3TIIA 4CDGA 3V3TA 1NMZA 2HB6A 3VU8A 2O1XA 1HGXA 5DXJA 5DHPA 1T8YA 4GZ3A 1HDEA 4NZNA 5H1YA 3SC3A 4BNWA 4DIEA 2HLHA 2GPAA 3GMDA 3N53A 1T25A 4LKRA 1JHUA 1FU4A 4FR5A 4XDHA 5I9TA 4P0PB 4I1PA 3P9IA 5DEOA 5K3OA 3NTXA 4AQ7A 2Z2KA 1Z6TA 4KPFC 2VSFA 3PF9A 4NBTA 1MNAA 1FFHA 3K9LA 4GD3Q 4QIHA 1KYWA 2FN4A 3AERA 4HDKB 4KBYA 4ER3A 2VPZA 4EFNA 1E62A 2ZREA 3ECSA 1RI5A 4PLVA 4B6SA 4B76A 1DEXA 1E1KA 2BKEA 4E2ZA 2PUGA 3MCVA 2A9FA 2PHZA 2QY6A 4OFBA 1KZ6A 1MX9A 4LQLA 2I87A 3B1VA 1IM8A 3MUOA 1PJBA 3PFFA 4YREA 3U44B 4M60A 3R5XA 5MN6A 1JZSA 1RRPA 4ITUA 1CB0A 4MKIA 3GGDA 4RV5A 4RZQA 1Z45A 5L3RA 1KEEA 3ZDCA 3TEFA 3LUGA 1S2IA 2GZ3A 2PCJA 2DTXA 3AL2A 4ER0A 3I28A 1MO2A 1ZOSA 1DADA 3LCCA 4PG5A 3Q1KA 3RTGA 1JVNA 3ZDFA 2QM8A 3FYSA 3KPVA 2V7QD 4Y98A 1HE8B 3JATB 3NBMA 1PJLA 1G8AA 1W35A 2CBGA 3LX4A 4DDMA 2WWYA 3LU1A 2OP1A 4OQPA 1LDMA 1LK7A 1DAIA 1VKJA 2JFQA 3MBIA 3AL3A 4HP8A 4ZAYA 5CFZA 3IEUA 2Z3ZA 4DTIA 4XVUA 4CWAA 4W4TA 3VR3D 5EJ7A 4CF7A 1KYVA 2CE7A 1UKCA 2Q50A 3DP7A 3A27A 3ESBA 3Q0EA 5AI8A 2AX4A 4XUGB 3NHRA 5D51S 3RABA 4C04A 3WTCA 4GWLA 1SA0A 5FUWA 5HKAA 3EQ8A 1KNQA 2DLDA 1Z3CA 2ZJFA 3IOYA 4C7JA 3U19A 2P41A 1K98A 1Y8QA 4LYAA 1X3LA 1PKEA 4PHCA 1A77A 5LBUA 1G9XA 3VPCA 1Q20A 2GYYA 3BD7A 1AHIA 2AHRA 2CLIB 3OTHA 4QM7A 4QNRA 4DANA 2QX7A 4JKYA 4P98A 5IYZB 3AEQA 1N2CE 1H4SA 1VECA 1HFJA 1G3QA 1Z22A 3DW3X 2Y9PB 1TW3A 5DYIA 3T4UA 4MVJA 3IAM6 2ALJA 4MEAA 2X5XA 2PH7A 2IUFA 2DBZA 5KDDA 3IOMA 2GLUA 4JROA 1IK4A 3PL5A 3QBJA 4GPD1 3NB0A 5EXXA 3ZVKA 2CYBA 1GTSA 2X14A 3TLAA 1GKIA 4JUFA 1ZG3A 3FGZA 3PC6A 3TW8B 3E27A 4A6PA 2RD2A 2R8PA 1W48A 3R7AA 3SX4A 1IVSA 4NFSA 2OZEA 2V8BA 3KT6A 5T67A 2YQ5A 4ZYLA 1XZHA 1QFMA 4OP1A 3EE6A 5TQVA 1I51A 1VMEA 3EZNA 4XB2A 3WL7A 2GBCA 2AYXA 6PFKA 1F0YA 3KQHA 2WU3A 1OYYA 3DV9A 2HQ1A 1K66A 1TAGA 1X0XA 1R12A 2C42A 3G2OA 4JLDA 2JZNA 1SVIA 2PKCA 1WWKA 3R75A 2W6CX 2YHIA 4IO1A 2JGMA 2PLFA 4WZBB 3BXPA 4RPGA 3W6ZA 3LLVA 4XSHA 5C1DA 2P9CA 3WE7A 5BV0A 2YXDA 3KV3O 4WXYB 3TVTA 3IQWA 2A0FA 3P4UA 5EHGA 1H8HD 2Q3MA 5KNCD 1TMOA 2GCNA 4AB1A 1HE3A 1OU0A 4F9TA 2PSHA 4RFLA 3BXEA 3BIWA 2ZUEA 2YCLA 4QICA 3S2FA 4NFLA 2F59A 3EYAA 1ZVVA 2A57A 2PL5A 4ME6A 2PUFA 2AFIE 3GXOA 5FQNA 2AR9A 2IGBA 2DJIA 3CE9A 1P8AA 1ZA1A 2R62A 4QBIA 3E05A 1WW3A 3NFRA 3GYBA 1RQLA 1BQEA 2I62A 3E4CA 3VA7A 1VI6A 3DLCA 2OWDA 3SFTA 5JANA 3RYFA 1BVRA 3DBVO 3GLSA 3TZLA 4V39A 4F56A 1TW2A 1W5BA 3UYLA 4OXXA 3N05A 3ZV4A 4DJTA 2H8KA 2YOHA 4BLOA 1F7VA 4MWEA 3GEEA 2XE6A 5GV7A 2UYHA 3TE6A 2JI8A 1VLMA 5CA1B 1R1DA 2GBGA 2TMKA 4BO5A 4LE0A 4OYYA 2F67A 1TZJA 3VYSB 1V8ZA 4TV9A 3CLRC 2VF4X 3ZU6A 3ODGA 2DFPA 1Y5IA 2QSJA 2QF7A 5EXSA 4PX2A 4BVFA 4EZIA 2AA3A 4QJ3A 4OAPA 4LJAA 2WF8A 1N3BA 3LBHA 1UOPA 1JFVA 2P4UA 3IL2A 4L7VA 1DINA 3DHWC 3G82C 3LA8A 1IL0A 2CF5A 3DBRB 3NHUA 3VPXA 4Z2AA 1C0PA 1HY3A 4GO1A 2ILTA 2DQKA 1FTYA 4IO0A 4Q7KA 5AKHA 5DX1A 2CNBA 3EGCA 4B85A 1DBSA 1XZMA 4F1KA 1YIDA 3L4BC 1R0SA 3EY4A 1D0VA 1RRVA 2G07A 3ZCUA 5A6VA 1KBZA 2V7XA 4X71A 4LGMA 3T52A 3MGBA 4CM6A 2ISQA 1NYLA 2H9IA 1KPGA 4PLZA 5ELXA 3ZD6A 2OV6A 4MV7A 4XM0A 2YVLA 2WMOB 3OURA 3DV2A 5DWVA 2OAGA 2D7JA 1IM5A 1JDPA 2X7XA 2BIFA 3ENQA 1MN6A 3CGGA 4URZR 5FADA 3R3WA 2DLCX 1PYDA 2R60A 4Y9RA 5AM2A 3D6NB 2QSYA 1DXQA 5JD4A 1F9AA 4QLOA 1A5BB 2NUAA 2SHKA 3GJ4A 1YR6A 1FP4A 1USVA 4G5XA 3TZCA 4RKFA 4M1QA 3LF2A 3QYFA 1L7PA 3ZWXA 5GIPE 2GZRA 3JQ7B 1XX6A 3GFVA 2XYRA 4F4CA 2DLNA 3RC9A 2I7CA 1U3VA 1Z36A 1XZIA 2ZSFA 3NRCA 3OKCA 5EUQB 4LF5B 2FW7A 5EE5B 3A6EA 2VAXA 4ZKDA 3K0CA 3QVMA 1UJBA 3L2OB 1SVUA 1O0SA 1TYZA 3LIPA 1SOWA 4GC5A 3GH1A 1X1CA 4DV0B 2VDNB 1JLKA 3WGNA 3HUFA 1EJ0A 3PHJA 4P8RA 4CU5A 3HU3A 5L3SA 1SUPA 4OKIA 3H1TA 2VUTA 4MV9A 4QTXA 4EY4A 4ZYZA 3GNSA 2WR8A 1ETUA 2BGLA 2QRUA 3L8DA 1V8OA 2ZSBA 1VSVA 3TNJA 1FMJA 4AKGA 5IEJA 2UKDA 2O1EA 1FTWA 3W04A 4D3SA 1XBTA 4QXRA 3ZU5A 3VUEA 4A16A 1J00A 1DXYA 3O3CA 9LDTA 4OHBA 5I7FA 1AKUA 1DX9A 4M8KA 5ALJA 4HCJA 4EEZA 1WZIA 3UQZA 3KTAB 4HBZA 4I99A 4D41A 3HBAA 1Y98A 5K51A 5CDTA 1BE0A 4UKDA 1V35A 5J2UA 1MH1A 4LTNA 2YYZA 2YZMA 2PZGA 2ZRNA 2C0PA 3CZMA 1L7NA 4BTLA 2B3TA 3MTQA 3F2IA 4FDUA 4DCSA 5A03A 5LQJA 3QG1A 1R00A 4EHBA 4FYJA 3Q10A 2VUUA 4ND4A 4FHZA 4NNJA 1IZ9A 4CFYA 1FRQA 2P65A 3L7NA 5JD3A 3V55A 5FOWA 3VH2A 5J1SB 2OCGA 4KXNA 3S40A 3O31A 1KJNA 4X1YB 3UUFA 1F1JA 2QAGA 1XN4A 2LDBA 2VK4A 2X4IA 1BMQA 2CVZA 3P2OA 4MYDA 5FNVB 2EKZA 2JFYA 5TT1A 2NSLA 1P2BA 4MV6A 4M0KA 2OC4A 1JI3A 1V5FA 2EVWX 2CHFA 1DEHA 1TO1E 5D7NA 1ADJA 3IPCA 1KL7A 2JI9A 1ESZA 4L9SA 1ISMA 4L5BA 3TI7A 1JEJA 2AJ8A 3LLSA 4KFUA 1EHCA 3UHOA 3WMXA 1M6VA 2O14A 4YJ3B 3UJ3X 1XVLA 3CG4A 2IU3A 3QX8A 1YQDA 4LISA 3FCAA 5DYTA 3LL7A 4DM7A 2PS0A 3UV7A 4CKWA 1KQNA 5JRZA 4MUNA 2AG1A 3FWNA 3T3NA 3W1VA 1AF7A 3U0VA 4AL4A 4WBXC 1IB0A 4Z7OB 1M66A 1FDTA 1HYEA 2CXQA 5K0TA 2PGXA 4BTVA 4UXJA 4I4IA 3VAAA 1PV1A 4R7GA 4P08A 2ASVA 4KCGA 4UXIA 2IGTA 4RKYA 4OK3A 4AJIA 5MGBA 4JAVC 5JWOA 4Y7DA 4O4LA 2V7UA 3JZDA 4BNIA 4DNPA 3JZAA 4P4NA 1W85A 3PQ2A 5KB3A 4LFAB 5I7AA 2ZAOA 2XXBA 2OK8A 2C2YA 3BERA 3EZGA 4GR5A 4W1RA 3NX4A 4WW0A 5H70A 1P6XA 2IE0A 3WMGA 4KNYA 4L4XA 4ZI2A 1RPNA 1K5HA 3EWNA 2P35A 1OLXA 4PYRA 3N87A 3FZNA 4XD7D 4WNAA 1QHNA 4ALNA 1U63A 1W29A 3NORA 1IU9A 1QJ4A 5EIWA 4RSRA 2CJWA 3JV7A 3VKGA 1WSAA 1YCFA 4NY1A 1GFIA 4HG2A 3LY7A 4G63A 1E2EA 4MQUA 4QGAA 1SXGA 4YCBA 3OX1A 2I22A 3ZBPA 1UC4B 2BEWA 4GM0A 1ADCA 3ADOA 3VVCA 1BS2A 1Z4KA 2CL7X 4U3JB 3AB3A 2VR1A 2X8JA 3P2EA 3NYQA 4D43A 2ECPA 5EKXA 2GQ0A 3L7YA 4Q3DA 1DELA 4OLAA 1F9EA 1RP1A 4JXJA 1C1DA 3NIBA 5B6IA 2QV0A 4R1QA 3G79A 1YZ3A 1QCCA 4C9BA 2R1VB 1IY2A 1Q84A 4RHTA 1E1QD 1RTKA 1UXIA 3PDIB 4JQCA 5EGSA 4E09A 3R5JA 4TSRA 3PD0A 4KQHA 4GW3A 4S3MA 4DE5A 4FIDA 3TQCA 2OLKA 3NJ4A 3O38A 2IPOA 3C7TA 3Q0TA 3QV1A 5B4TA 5IRCD 4G1MB 5EHZA 4IKPA 1MHPA 1XKLA 1P5RA 2ET6A 2V03A 3ZN2A 4ZV7A 3HFJA 1KXZA 1WKVA 2J5BA 2A7XA 3MS2A 5T41A 4G41A 4ARAA 2HT1A 2ZZNA 4OIMA 4Y9UA 3U7RA 2FSSA 5LJIA 3I9MA 4PYKA 3HXPA 3OU6A