1U81A

Delta-17 human adp ribosylation factor 1 complexed with gdp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
164
structure length
164
Chain Sequence
MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes in human Arf1 on nucleotide exchange and deletion of membrane-binding elements.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords ADP-ribosylation factor 1
total genus 41
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2004-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1u81A00
3NEYA 2PCJA 2X2EA 3IUYA 4HDCA 4QGFA 2FSFA 4M9QA 3WP0A 1U9IA 2OLJA 5L3SA 5EP3A 1PUIA 1QVAA 4DLUA 1VECA 4B48A 3RABA 2A30A 2G0NA 2GRJA 1CLUA 2BCJQ 4HAZA 1OFIA 2ZYWX 3CRW1 4YC7A 1JNYA 1IOZA 1HT1E 4LC1A 1E1RD 4JJKA 4IDPA 4Q4HA 4WXRA 1F2UB 2GWHA 5DI3B 2JDID 2ZQ5A 3RS5A 4DDTA 4DLYA 5BYKA 1KKMA 4Q1CA 4GNKA 3ASYA 5J4YA 3AVYA 3SS8A 5DHFA 4B6EA 2QT1A 3TIFA 2WZQA 1FP6A 2WAYA 4GT1A 1NKTA 4FCWA 5EE1A 5IRCD 3W3ZB 1YQTA 2OSBA 1IN7A 1N5KA 3VAAA 1OW3B 1CJMA 2EVWX 1SVMA 2PZEA 2XSZA 4HUTA 3EC2A 2Y8EA 3KJHA 1ELOA 2CL0X 2JLSA 3QPWA 5FUXA 1S8FA 2A5FA 3TQCA 2J3EA 4KJZA 1P5ZB 4CF7A 5F98A 3DVLA 4I1OA 1E2IA 3NKVA 3NVAA 4BLTA 1AM4D 4D4MA 2B6HA 3OEEA 4WZAE 1TQDA 2WKRA 2XNDA 4M4SA 3RS3A 2F55A 2QP4A 2YWEA 1ZP6A 2ZREA 1FFHA 1K8RA 1KJWA 1S3SA 3CNLA 4LBZA 3TR0A 1EX6A 1YR6A 1SKQA 2EFHB 2BM1A 2OHFA 2YOHA 4JLDA 3IKJA 4B44A 4NYIR 2V7QA 3L43A 3R8FA 3C7KA 4QHSA 3WHKA 1O87A 1W5SA 5C4GB 2IUSA 4HAYA 5KSZA 2BJWA 2ZANA 1DBSA 4OJQA 4BLQA 4XSHA 1D6JA 1PJRA 1G9XA 3TUIC 2GJSA 3B78A 1WBBA 1JI0A 2P3SA 2QRNA 4S2EA 2OCBA 4V0LA 4DRZA 2G1JA 5GJWC 4BE7B 4TSFA 4DLVA 4IEEA 2OBLA 3RSOA 3KKPA 4XWOA 1IONA 4AIIA 1JAHA 4NCHA 1J99A 2YHSA 1XXHA 5HE9A 4WBSA 2VQSA 1XCMA 3VX4A 2P67A 2RGXA 3BBPA 3T12A 5JCPA 1E2GA 2WM9B 5K8LA 3KKOA 1GNQA 3FHTA 4PAOA 3JZMA 1J8MF 1ZC3A 1ZCBA 2GXQA 3P27A 4IVQA 4P32A 3ZVNA 3WNBA 3FMFA 1XXHE 4IDHA 3VNUA 4PPQA 2QMUA 4A2QA 2CCJA 5K8TA 2BEJA 4A4DA 4C30A 3CBQA 6Q21A 1KAGA 1RFLA 1US8A 4GOXA 4UJ5A 2BWJA 2Q21A 1R5NA 4D0LB 5CM9C 2IYSA 4AKEA 1HYQA 3N70A 1YZUA 4NCKA 1DO2A 2AKAB 1IXZA 1E4YA 1TNDA 2PEYA 4TYYA 4HDOB 1XEWY 1KKLA 4P3YA 1ZAKA 3FKQA 1A2KC 3QEOA 1AQUA 4PC3A 4DSNA 3GFPA 4Y0VA 2OESA 3EZ2A 2LWIA 2GCOB 3A1WA 2ZJ2A 5DISB 3U60B 2FFHA 5FL7D 5HCNA 1GKIA 5EP1A 3UMRA 1KHTA 2CL7X 4NMMA 3QF4A 2PEZA 1CJKC 2W6ID 5JS8A 1T91A 4XSGA 4B73A 4YQFA 3VKHA 3PENA 5E7MA 1LVGA 4MKHA 4YMUA 3OZXA 2WSMA 5KOYA 2B7BA 1GAJA 3CLVA 3D31A 3T35A 1JQJC 4N3NA 1SXJC 1JPJA 4LJAA 2ZRBA 2C03A 2EYQA 4IDOA 2GEDA 4UXHA 2MSEB 1GP2A 3UANA 1S1MA 3U7EB 3NTUA 3SHFA 1D5CA 4Q7KA 3UWOA 1KI7A 3RRYA 4AC9A 4YMWA 2OFOA 1IN5A 4TLEA 4TT3A 3TR5A 3L0SA 3UXMA 4R71A 5B64A 3DPUA 5EE5B 4JSTA 1EGAA 5KYKA 5HCIA 4B2LA 1HT2E 4NCIA 3LVRE 3NH9A 3EX7C 2QE7A 3DKPA 1KYIA 1SXJA 4V02A 1NBME 1YRAA 2ZI9A 2QORA 4B6FA 4DT1A 4Q9JA 4OYHA 3UPUA 1JXMA 2KE5A 2C2HA 2Z6VA 3U3MA 5JEDA 3EIEA 4FMBB 1E2HA 2CLCX 4AD8A 3JVUA 4MYHA 5FR2A 3SJAA 3BD9A 2GNOA 2JLQA 1KZGB 2O8BB 2ERXA 3OFNA 1AIPA 5EE0A 4HAWA 2F9LA 5DIFA 1Q22A 5FL3A 5L3SB 3R20A 2AKYA 3BH7A 4BRWA 3CRQA 5DGXA 4Q9LA 2QBYB 2G0TA 4NH0A 4FIDA 2QBYA 4Z8XA 3NHBA 2ZM5A 1DAGA 1R0YA 3VFDA 2WOJA 2IXGA 5GJBA 3SEAA 2RGEA 2XTZA 1E9FA 4ZDWA 1NLYA 1UBEA 1QHXA 4JLPA 4QRHA 421PA 4IFBA 5B2ZA 4UXIA 1GWNA 1VCIA 5HE8A 1N6LA 4TL6A 4AY2A 1NNEA 1Q57A 1ESNA 4TQ9A 5FOUA 4IVRA 2VHCA 3SC3A 4DLTA 1LF0A 3HPQA 4XJXA 1P75A 4H1VA 2Z43A 3EASA 2QE7D 4BGDA 3GEIA 1DE0A 5L8VA 5DLQC 2J5XA 1WCV1 3CZQA 2V1XA 3E2IA 3QPVA 3FFBA 2J0QA 3WMEA 1BKDR 3C41J 2X1VA 3AV0B 5DN6A 5KO2A 2F9MA 1NJGA 2GHIA 4C7OB 2ZRDA 5CLQA 2DFLA 1CIPA 3N2EA 1N0VC 3QG5A 1TQ4A 1PLKA 4LOAA 2AN9A 4OHYA 3B13B 4IOJA 3VR5A 3DO6A 3TSWA 3LO5A 2WJYA 4AKHA 1XF9A 4E03A 1U0LA 2Q0HA 5DHAA 1GDDA 4DDUA 4KAXA 2H18A 3UK6A 4QKQA 3V4RA 4RZ2A 4N0EA 5CLLA 4TLBA 1L4YA 5FL7A 4ERNA 5KDLA 2OCYC 4U02A 2OO7A 5AR1A 3THXA 4TTPA 1C1YA 4JKIA 1IY1A 1FPMA 4URWR 3IILA 1IN6A 1XP8A 3W6OA 1QHIA 4DEXA 5H1YA 2RCNA 5UKDA 1NSTA 1VYVA 2WJHA 3KX2A 1IY0A 4YMVA 4XTCS 4DIEA 3QF7A 3OE7A 2Q3MA 1TF7A 4LZZA 5JWOA 3SFVA 5L3QA 5FBVB 4LSGA 4XVUA 2ZE5A 4M1SA 3T15A 1G20E 1Q1QA 1F2TA 3C15C 4NKRA 4A36A 4JYBA 1XEXA 2BM0A 2EFGA 1WB9A 2G83A 3QY0A 3PUVA 4HAVA 4FMDF 1P9NA 1D2NA 4MGYR 4BLOA 2OG2A 4B33A 2NO7A 3ND9A 1CS4C 2HYIC 3GLHB 1W36C 2BV3A 4PPFA 2IWHA 2PH1A 4B47A 2B8TA 2ZSAA 2JCSA 4MDEA 1AGPA 1OJLA 1XTIA 2IYWA 2SHKA 3CF6R 4B3GA 3EWSA 5BN5A 4OI0A 1AK2A 2BKUA 2IBMA 1YE8A 1XJ0A 5FH9A 1LF5A 3V00A 2ZRJA 4JZKA 2D7CA 4R9UC 4FWTA 2BBSA 3PEVA 3U3KA 4V0MA 3PEYA 1NVVR 3IIMA 3OFND 5JJLA 4P4TA 4Q7JB 5FPTA 2HJGA 2GCOA 1X8KA 2Z5FA 4NYMQ 5EJEA 2BBOA 5ELXA 5JZVA 4GPTA 1VKJA 4D25A 1EFTA 1TU3A 2EFEB 2IXEA 1P72A 4A82A 2NO9A 3RANA 4PO8A 2W00A 2RGCA 3EA5A 3PCRB 2FFQA 5JMTA 2QENA 2ZUBA 1G7RA 2MSCB 4P33A 4QJ4A 2O8DA 4JLKA 2BMJA 4PANA 4CGZA 2XTMA 4HAUA 4HUQB 5EP4A 3IEVA 3QUSA 2OEPA 1KIMA 1YZTA 3MWJA 1OIXA 3KQNA 1GSIA 1D9ZA 2VF7A 2NO1A 2ORVA 1ZM3A 3H0KA 4JL8A 3FTQA 4MGIR 1W4CA 2BOVA 4GOKA 2QSYA 4G5SA 4HYYA 4UXJA 1SXJB 1XTJA 3AGPA 3ONWA 3T1QA 2VPPA 2FG5A 2OXRA 5BXQC 5JI2E 2ZXUA 2PJRA 3ICQB 5DYIA 3PEUA 2IX3A 3A4LA 2ZJAA 4M1TA 4DB2A 1N0WA 3N5CA 3B9PA 3A4NA 4TMZA 4FD2A 2KB0A 1QF9A 3CPHA 3THYA 2QA5A 3X1DA 1XDBA 4PSVA 3THYB 1XXHB 1LS6A 2RMKA 2WBLC 4ESVA 2G77B 2P6NA 4JLAA 2QPTA 2ZRAA 2FSHA 4P31A 3SZRA 3OAAD 1Z6GA 2IYZA 3CONA 1ZD8A 1DAHA 1D8TA 1HEIA 1WP9A 3CX7A 2YV5A 2NPIA 3FWYA 3ZS8A 1SKYB 4Q1BA 2K5UA 2C96A 3AM1A 1JEDA 3P20A 2ONKA 3I8XA 2IYVA 4OI2A 4Q48A 3MWYW 5FPSA 2YOGA 3S1AB 1AQYA 2OAQ1 4GZLA 4IEIA 4L9WA 4OJKA 3UIEA 4C0KA 4M1YA 3X2SA 2OUKA 2IEZA 4OK5A 1G7CA 1CR4A 2B8WA 4MYTA 4WA7A 4F91B 3GEEA 4Q7MB 2D7DA 4LYFA 3SN6A 1SVOA 1X8JA 2ZPTX 1NVVQ 1BMFD 2HDNB 2KBEA 4Z8YA 3R9IA 4C4PA 4B3CA 1S2MA 2ZR7A 1KI6B 3BORA 4EPVA 1E79D 3CW2A 4FN5A 4G5GA 2JJ1A 4N0DA 1A7JA 5JLJA 3AKYA 3KXIA 4F7WA 2HXSA 2XTNA 4IW3B 1L4UA 1IN8A 4URXR 1XD2A 1Z63A 2REBA 2WWFA 1OE0A 2GAAA 3AKDA 3BWDD 3EW9A 4QHYA 2AFHE 3QOFA 3ZZUA 3THWB 2R6GA 1HUQA 1RRFA 1H65A 1G5TA 1ZVQA 3THWA 4LBVA 5IK2D 2HCJB 2IS1A 3RVBA 1I2MA 1NVXQ 1A82A 4HAXA 4TYPA 4L8GA 1TMKA 1E9AA 1U8AA 521PA 4ZCIA 1HQCA 3GLIE 2EWWA 1GL7A 4QFMA 3L82B 1GKUB 1IHUA 1O3YA 2ORWA 3I92A 2QUZA 3IHLA 1A4RA 3GEHA 4LX0A 3B8HA 4D0GA 1KJYA 5LBIA 1MO4A 1ZIOA 3A1UA 4HB3A 5AUPB 4A6XA 1R6BX 3W90A 2AXPA 4U7DA 4DT1B 1XTRA 1LS1A 2WICA 2IA5A 4O2RA 4CDGA 3ZYCA 3WNCA 1CEEA 1S0UA 1DTSA 2IYUA 4RKEA 4C0JA 3MD0A 2J45A 5TY0A 4EFLA 4L5BA 5LD2B 2KWIA 4RD4A 2QP9X 1MKYA 5J4LA 1NG1A 4D26A 3RRNA 1V43A 1Q3HA 4TSFD 2IYTA 1IJFA 3IIJA 5DI3A 3DZDA 2IUTA 3MAAC 4RCYA 4KSBA 4JIMA 1SVKA 2C99A 2WIBA 3CIOA 1M7HA 2ZETA 3I3SR 4FINA 3U3JA 4LYHA 5CYOA 1RRCA 4Q9KA 3K9GA 1CJVC 3OIWA 3A1VA 3LBIA 1SVLA 3M1IA 1LFDB 2EYUA 5DSZA 1W48A 1VYUA 4UNSA 4X8MA 4V0ME 3AVPA 4FMCB 1KAOA 2QPOA 5K8IA 1SHKA 4ITRC 1LV7A 4R7ZA 2VH5R 1IAQA 1M6NA 1NG9A 2ATVA 1E4VA 4L15A 4TTRA 5EP2A 1CU1A 4HZUB 1NJFA 2J7PA 1T5IA 4GZMA 3KUDA 5KNBA 3MSXA 1Z08A 1CF4A 3KXKA 5TV2A 1NMZA 4KLNA 5HZKA 1KI8A 4D82A 1MH1A 3O8CA 2QAGC 1TUEA 1DAFA 1XWIA 3FKSA 2GXAA 2VO1A 3SQXA 2A78A 4KBGA 4ZDKA 4PX9A 3TVDA 3BB1A 5ANRB 4KSCA 4DUGA 2P6RA 5FPKA 3A37A 3B5JA 5CIQA 1HTWA 4PHTA 2J87A 3ADDA 4DLSA 1BIFA 4ZCMA 2V7QD 1AZTA 4TMTA 3THXB 3U3RA 1COWA 2ECKA 2H1LA 4P4SB 1EFRA 2BVNA 1G3QA 2ZIAA 4IXNA 2ZE8A 2GA8A 2RGAA 3FYHA 4E09A 5HR5A 5C46F 1U9IC 1NVUQ 2V55B 4I1UA 4AI6A 3TUJC 2GEVA 2XX3A 3THOA 5FOXA 3B9QA 3VR6A 2FN4A 4URZR 4G1UC 1D2EA 3QXSA 1Q21A 1EFCA 2FSIA 3AVOA 4ZV4A 5GJVC 1W0KD 3EZ7A 3KB1A 4LJYA 5FUWA 1MOZA 3NBZC 4W9MC 2J41A 1KK3A 2W2XA 4HB4A 1P3JA 2GZAA 4E22A 1OIWA 1JB1A 1Z22A 4Q66C 4CT5A 5EXSA 4FMDB 4RVCA 3CH4B 1YVDA 3QKSB 1KMQA 3PVSA 1CTQA 2YKGA 1W2GA 1NLZA 2PCLA 5H8WA 4HZUA 4JBWA 1MABA 1DOAA 2FDCA 2OLKA 4YDHB 1W5TA 4UNNA 1NVWQ 3F0TA 4BFVA 3R9WA 2IYQA 2QY9A 2ZI3A 3AF0A 2OE2A 1S4QA 2HXYA 4NTZA 4Q18A 1E9EA 2ZTSA 4DLRA 4RJLA 3EC1A 2AXNA 5DH9A 1U8YA 2EU8A 4D81A 1ZW6A 1X1RA 2D2FA 1NIJA 1Z2CA 4HLUC 1Q20A 1NN1A 1M74A 1X1SA 2L0XA 3HU2A 2GJAA 4PSAA 5FOSA 3QVVA 2H92A 2ASEA 2JLVA 5HTKA 1NIPA 3QF4B 4DIDA 2ZVPX 3K8YA 3K9HA 3C14C 4KI0A 5AJXA 4MGZR 3KKNA 4IVPA 4IOMA 1K5GA 5E7IA 3NH6A 2WV9A 1FTNA 2HF9A 3W8RA 3WRYC 3TJZA 1XU4A 3EWAA 1DAKA 1V5WA 3CO5A 4HUQA 4C0HA 3F3YA 2QU8A 1FQJA 1HURA 2H7VA 3UG7A 3K1JA 2B21A 3K9NA 3AP3A 2G1KA 1EG7A 1WA5A 4ARZB 2Q9AA 1BH2A 3BERA 2G9NA 4DSUA 4Q9IA 2PJZA 3R7WA 3LY5A 1ZNWA 5J4HA 2F3RA 4CYMA 3KFXA 2WJGA 4KFUA 5DYGA 1ZM2A 4JL6A 4LDJA 1FX0B 1R8SA 1SXJD 2CNWD 2FOLA 3QKSA 4M2LA 3TLXA 2RGBA 4RD0A 4FMCF 5SZHB 4EDHA 4DC9A 2W83A 4KFTA 1G5PA 4MQBA 5FOWA 4FWIB 4DCSA 5KNDA 5K8UA 3B7GA 3VHXA 4CVNA 1Z07A 5SZKB 5TB5A 4A0RA 3PUZA 1GVNB 1WMSA 1KDOA 1E1RA 3HU1A 4GFDA 3ZZTA 5LD2C 4NBSA 4EPYA 1MT0A 1NRJB 2ZS9A 3JVVA 4PC6A 2MSDB 3CNOA 1U94A 3BFXA 2WTUA 3MJHA 4M0LA 2DCUA 4DJTA 5FPHA 5E95A 2ZVQX 1GOTA 1P62B 4RD6A 1XRJA 1Z0JA 3C8UA 5KSPA 4PO1A 2W0SA 3WMFA 3FHOA 3FMPB 2ZI7A 4IRUB 1M7GA 3BB4A 1OHHD 2BDTA 1Y3AA 1KSFX 2C9CA 2JIZD 3TW4A 4C9BA 4Q19A 4MYUA 3S1AA 1GL9B 1KSHA 3L0PA 2GK6A 3IO3A 3PUYA 4AYXA 2IS4A 4V0KA 2AD5A 2J9RA 3CRVA 2ZJYA 4A92A 3MMPA 3TBKA 3IPYA 4GBMA 3I5XA 1I2DA 1XMIA 4NYIQ 4TYNA 4WOPA 5CK4A 1IXSB 2RH5A 2GETA 3KJEA 3ZIAD 1OFUX 1ESMA 3GLHE 2JLZA 2GBLC 2BKEA 2YC2C 2GXSA 2ZI5A 5AJZA 4XTRA 1H8ED 4HB0A 2ZE7A 3OEHA 1KI4A 1UJ2A 1OLOA 1HY3A 1G7TA 3GLFB 4JVMA 1U98A 1GKYA 2QG6A 1G8PA 5JWRA 1DAEA 2H16A 3I1FA 3K0AB 2GF9A 1BMFA 3K0CA 3OF5A 4H1UA 4A8JC 1N5LA 2IXFA 2GESA 5KU1A 1Y63A 4IDQA 3RWMB 2JJ1D 4XVRA 1G1MA 5FI1B 3QSYA 1DAMA 4PHGA 2X77A 2YJTD 2A5DA 4JT2A 4QBIA 4DCTA 1TQ6A 2WJIA 3B1XA 1S3GA 4F4IA 4JL5A 3U7GA 1R0XA 2OXCA 2XGJA 3G5UA 3VMFA 3EZ9A 1AN0A 3MWLA 4PPGA 2ZI4A 4JVNA 4LV6A 3WMGA 1E9CA 4DLWA 1XX6A 3GLGA 1YHNA 1G7SA 3LLMA 2AX4A 2HF8A 5B30A 3REGA 1BYIA 3LLUA 5F3WB 1UDXA 3PQCA 4Q00A 5L3QB 1TL7C 2OILA 1GM5A 3OE7D 1Z3IX 3PUXA 4EUNA 2A5GA 1N2CE 2BBWA 3DZ8A 1U8ZA 2DY1A 3SNHA 4C0LA 3AGQA 5LPNA 2WPDA 5EXXA 1G19A 1XEXB 3RHFA 5FUVA 4TYQA 4A0GA 4GMDA 2HYDA 1JR3A 2F1IA 5FBRB 1N6OA 3BH0A 2QRZA 2FX3A 1TTTA 2ZSDA 3VR4A 1MO5A 1TPZA 4HLCA 1ZNXA 5FTJA 621PA 2ZSBA 1Z83A 1GRNA 1LW7A 1KI6A 3MRSA 2O5VA 4JLBA 3RS7A 2ZRFA 1Z0FA 3BIFA 1LNZA 2FEOA 4AG6A 4QNRA 4ZCLA 2IS2A 3GLFA 1NN5A 5TXGA 2O52A 1XD2B 4CW7A 5G41A 4YDSA 3LQRA 3UG6A 4HEJA 1ZCAA 2ORIA 4WZBE 3IDQA 3U4QB 2VF8A 3GP8A 3SYKA 4JLJA 2C77A 1W0KA 1NSFA 4QHTA 2HLDA 1ETUA 4F93B 2BMDA 4NL4H 3HJNA 2VA8A 1IN4A 5M04A 1Q44A 2F1JA 3FE2A 3LQQA 1P73A 3FMOB 4M9XA 3K0SA 2D06A 3Q3JB 4EJSB 1VHLA 1N6RA 4ZI3A 3MG9A 1E2NA 3ECCA 1GZSA 2NZJA 2D4HA 1E6CA 2RAPA 3LWNA 1WF3A 4POAA 3WP1B 2Z0MA 5EE9A 1G8HA 1T3HA 1EXMA 3T1OA 3H1TA 4RKFA 1R8QA 2QMEA 4US0R 2MMCA 3KL4A 5JSZB 1II8A 1KO4A 2XJ9A 5D3QA 1W1WA 1G4AE 4RCZA 4NE2A 4PXAA 4PAQA 1OB5A 1F60A 4ESHA 1XCGB 3PV0A 5AJWA 4ACBA 4EPRA 4HB2A 1XB2A 1MO6A 1FMLA 2CE7A 4HDQB 3EAQA 3SU8A 3NEJA 1NBMD 5SZIA 4BFUA 2D3WA 5TMPA 1IXRC 2ZRHA 3AVVA 4M21A 1TAGA 1WQ1R 2XEXA 4TL7A 1W0JD 3W5JA 2JJ8A 2O8EB 5BQ5A 3FHCB 3RRZA 2XZPA 4QBGB 1EFRD 4TZ6A 5KSOA 4DXAA 4MGKR 3TNFA 4B3FX 1W7AA 2VIIA 3D6TB 4CEJB 1WXQA 2BBTA 2VHJA 4B2IA 2REOA 5GVSA 2RKOA 4LI0A 4JBXA 1OXXK 4H9GA 2CCKA 2KBFA 4KLZA 1UADA 4Q4AB 5AJYA 1N6NA 3WHLA 4TL9A 4W5WA 4OQFA 3WYFA 1OYYA 2IS6A 2C9YA 3SJCA 1T3LA 4G01B 3RSLA 4OI4A 1E2MA 2V1UA 1L2TA 2VL7A 4BZXA 1RPZA 5JJIA 3PR1A 5FTLA 2QSZA 4OBEA 2J46A 3NC0C 4M1KA 2DHRA 1EK0A 4QJ3A 2DFTA 1IM2A 1XTKA 5KDOA 3E1SA 5LB2A 1ZJ6A 2Z83A 5CITA 2WPDD 3SR0A 1E99A 2RB4A 2HEIA 1T5LA 4II7A 2JLUA 3CB4A 3M0EA 4DKXA 3VR1A 1II8B 5FOTA 2F6RA 1Q0UA 1NBMA 4RZXA 2ZRKA 2CL6X 3AP1A 4LJ5A 5AWFC 4RD2A 2PX0A 1IY2A 2EFCB 2G6BA 2H5EA 2VRWA 2UVQA 3ICEA 3T1TA 2O8FA 1HV8A 1M1YE 1HQYE 2VSOA 4TQUS 3K0AA 4BFWA 2QEQA 1JALA 4F4CA 4YONB 3NG1A 2ZU6A 5GADl 2OCAA 4LPKA 1UDWA 1DG1G 4NCNA 4DLZA 1FOEB 1G3UA 4Q7LA 2CEAA 2CMKA 2XAUA 5AK0A 3ZDQA 3ASZA 3SHWA 2V6IA 2O8EA 4C0SA 4Z1MD 1RC8A 1L7VC 1G3IA 2XXAA 1KGDA 2DWQA 3KDSE 3K0CC 5C4MA 2WSSD 1SGWA 2WJVA 1KY2A 1RW4A 4US2R 5IK2A 2OV2A 2XNSA 4KYUA 2AR7A 1QVRA 1XFAA 1LY1A 4LV5B 1RVDA 4JT4A 3FFAA 2R8RA 121PA 4Z54A 5JWHA 5BN4A 2GF0A 1OH8A 2RGDA 4KFSA 3ETLA 4QM6A 1ANKA 1K6MA 3QXJA 4D4KA 1HE8B 1US8B 4DUGD 1VYTA 4M9SA 1DAIA 5B58C 1JBKA 3D3QA 1KK1A 5CDFA 5BWMA 4IDNA 1CRPA 3GJ0A 3NBFA 1CP2A 1NN0A 1UKYA 2ODNA 4QGAA 2QNRA 3EPLA 1Z0IA 1VG9B 3F8TA 1M7BA 1T0HB 3HP1A 1E2JA 1E96A 1FUKA 1YZKA 4WAUA 2WJJA 3ZH9B 1AA9A 1AS0A 1OKKD 2ZSEA 4MKGA 5CB6A 1MRSA 2J59A 2IHYA 4XWAA 1G18A 2Q6TA 2ZRNA 4RD3A 3SBEA 2F7SA 3SJBA 3BFVA 3BXZA 2I4IA 3B2EA 1ONBA 4AYTA 2P5SA 2W2TA 3ZQJA 4LJ4A 2D74A 1XJCA 1VTKA 4UKDA 4BFZA 4Q1AA 4KU4A 1CKEA 4WZ6A 3ZQ6A 2JGNA 4X8HA 2DFKB 2O8CB 1W49A 3FPAA 2P5TB 1XNJA 3U6BA 2XB2A 4BFTA 3W8NA 4IFEA 4PZZA 4E07A 1E9BA 2AK2A 4DBLC 1ZUNB 1J2JA 2QL6A 2XOKD 2XZOA 2H17A 3V4FA 4YXWD 3VU9A 1UKVY 4NP6A 5FR1A 2WKPA 2W58A 3CF2A 3FDIA 3F5FA 3IBYA 4TZ0A 1T0JB 4XH9B 2J0VA 1EESA 1R0WA 4QM7A 1E2QA 2CVFA 3ZZ0A 1H8EA 5E7JA 2P2LA 1NY6A 2C5LA 4QL3A 2WVJA 3L0IB 5DO9A 1KMHB 3P4XA 1T3SA 2BC9A 1B0UA 5EUQB 4MRNA 2BCGY 4DDVA 2RHDA 2DYKA 4ZDJA 1ZD1A 2CBZA 2FEMA 3KUCA 3UATA 1YR9A 2QMOA 2C95A 2TMKA 1W4RA 3X1XA 1ZMXA 2OZEA 2VTKA 1COWD 3AF2A 4IHQA 3I62A 1UKEA 2FWRA 2ODEA 4O2LA 2VHUA 3LXXA 2W2VA 1UAAA 1NN3A 3K0FB 4QBFA 1XPUA 1QG4A 4QBHA 1RJ9B 3A36A 5EUMA 3Q5DA 4GDFA 3MFYA 2EWVA 3I32A 4GP7A 3IO5A 1JR6A 4OQLA 4AKGA 1BS1A 3QKTA 4F4JA 3T5GA 4W5JA 2GILA 1G41A 5IHPA 2P0EA 4KVAA 1UKZA 4Q21A 1VG1A 3K0EA 3T06B 3DEFA 5KPDA 3LD9A 4MA4A 3SYLA 4ON9A 1R0ZA 2G88A 1E9SA 3NIBA 5G3ZA 4BFXA 4FCVA 4JVLA 4B71A 4LBYA 1EX7A 4J0QA 1DS6A 4B74A 5IF9A 2OT3B 3SOPA 2WWWA 2FE4A 3I72A 4D4LA 3KZ1E 1IQPA 5L3VA 3RC8A 2CDNA 2FFAA 1QHNA 5P21A 3SBDA 1UBGA 1LTQA 4OHVA 3MUFA 4WXPA 3SQWA 4AK9A 1Z6AA 3KQKA 1P6XA 3FB4A 2IW3A 3NBYC 5CK5A 4DCVA 1PLJA 2AD1A 1R5OA 2WAXA 2BMEA 2MMGA 4LHVA 1RKBA 1W44A 1FNMA 2VP9A 2P65A 2QGZA 1T8TA 4BLSA 5AUNB 2F3TA 3RRMA 2O8FB 4JLOA 1KI1A 2GVDC 2ZJBA 4URVR 1KI2A 4YMSA 3TH5A 3CNNA 3AF3A 4DSOA 2BIFA 3EPKA 4EJSA 2AWOA 4M53A 4FI3C 4Y0AA 1E98A 1RZ3A 4PZYA 2J0UB 4JYCA 3GQBA 3GLGB 3WNDA 1HE1C 2PX3A 3A4MA 1XCPA 3TQFA 2JLXA 1KO5A 1ZC4A 3TRFA 3RAPR 1DO0A 1JJ7A 2O0KA 3IBGA 1VCNA 2ZS8A 2A5JA 1CXZA 1N6KA 2FJUA 2IWRA 4ACAA 5J47A 4LCBA 2WIAA 1Q1BA 3VKWA 3P26A 4YXWA 3W6NA 3RS4A 1XEWX 2ZITA 3P32A 3QJYA 4LHWA 2BEKA 2CJWA 5FPYA 4W7SA 3BAFA 1FX0A 3K70C 3A1SA 3BGWA 4KFRA 4TL8A 3BJIC 1J7KA 3CWZA 4U00A 4C3ZA 2JLYA 1G8YA 2XITA 4LJ7A 3CUEF 3EXAA 3LX5A 2ODWA 3VQTA 4BFSA 3AP2A 3ZVRA 4YMTA 2JA1A 2ZYUX 4HSEA 4CEJA 1QHGA 4Z1MA 1CR0A 1W4AA 2CLDX 2CLSA 1G6OA 1VIYA 2V6JA 2NPFA 5FBLB 2CVHA 4KITB 1W46A 2VP6A 3T34A 4L4UA 3KQUA 2AHOA 4PR0A 1M8PA 3EIHA 1NY5A 1QHSA 4D80A 3IGFA 1NL3A 2ZYVX 3DMDA 4AYWA 1SHZA 2IEYA 1ZM9A 2YNMA 5TARA 2O8DB 1E2LA 2ERYA 2FGJA 4BLRA 2R44A 1UM8A 1LB1B 5JI3E 2OCPA 3TSOA 1X8LA 2REXB 2VHQA 5JBQA 1ZRHA 1VPLA 3GLFE 1Z5ZA 4LY6A 1KSJA 3KKQA 1KK0A 3K09A 1NKSA 3HYRA 2VLIA 4KHZA 4OHXA 4V0OA 2OM2A 3KKMA 5JSZA 3ZLJA 1D2MA 1G17A 1EWRA 1ZU5A 3HR7A 1NI3A 1DPFA 3VU9B 5C18A 2QAGB 1Z6XA 4TMXA 1KI9A 4QG7A 2VP2A 4DCNA 5EZ6B 1FL9A 1OIVA 2N42A 1ZM7A 3QQ5A 4B43A 3RS2A 1OV4A 5FTMA 1S9HA 1ZIPA 2Q9BA 3C5CA 4Q4LA 3MGCA 4X8LA 2EQBA 4N1AA 4Q47A 2GEUA 3TGPA 2PT5A 3QIAA 3QBTA 4M1MA 1P2UA 1GRRA 3CX8A 3KQLA 1SULA 3W5IA 3P4YA 2O0HA 4KCGA 1SQ5A 4KVGA 3RLFA 2JATA 3U5ZB 1OT3A 5FI0B 1Z47A 1C4OA 3OAAA 2N46A 4B2PA 3DMNA 3OIYA 5KHOC 1NMXA 2A9KA 1P2VA 3CZPA 1P2SA 2PLFA 2QTHA 1P9RA 2OAP1 3AVWA 5AUQA 2C78A 3NWJA 1G6HA 4NHOA 1KK2A 2IC5A 3AF1A 1GTVA 3CF0A 1ZUHA 3I8SA 1U81A 1Z0DA 2X2FA 2QTVB 4NCJA 4MH0R 2RGNA 2GXUA 4Q4JB 2DFNA 2Z4SA 2ZYTX 4OK3A 3X1YA 821PA 1Z0KA 4Q4JA 3DHWC 3QXXA 4CEHB 1J8YF 1JR3D 4DVGA 4DHEA 1XTQA 2JDIA 3WY9A 3B1ZA 2FPMA 1Z6TA 4CEHA 2HT1A 2GTPA 2ZS7A 2VEDA 1E9DA 2BMFA 3I4LA 4RSGA 1DARA 1JXOA 1MR3F 3RS0A 1G21E 2OBNA 4KYIB 3LRPA 3O8BA 3RDPA 2ZI6A 1JAIA 2KJQA 3CR7A 4MDFA 4Q1EA 2YOFA 5IT5A 4QJ5A 2CXXA 2VSFA 3GJ3A 1XMSA 1WDTA 2ZR9A 2O8CA 1OPXA 2OBMA 2WOOA 3MWKA 4ABYA 1ZBDA 3U4QA 2Q3HA 1DVRA 1Q3TA 1QG2A 3TW8B 2W0MA 2JJ2A 1OSNA 1TEVA 5CIWA 5HKKA 2JAQA 2AL7A 4B35A 2H8KA 4IKEA 3DKVA 4RZUA 2IT1A 1ZINA 1XEFA 3BS4A 2NO0A 5JHGB 4HLDA 5B57C 1P60A 1FW6A 3DOEA 2RGGA 1VDZA 4A6PA 2J0UA 2CHVA 1W2HA 1YZLA 2IHBA 3GCGA 1W47A 4RFSB 4PTLA 5BYJA 4PPNA 3Q9LA 1KDRA 3SI7A 3L2OB 4UQOA 1KTVA 1QHHA 2OFWA 4NYJQ 3GLGE 3I61A 5EXTA 2DBYA 2YVUA 3KJIA 3LVQE 5JFGA 4OKSA 4B3BA 1JJVA 1E2PA 1E0AA 4D2IA 4I4LA 2A2ZA 3M6AA 4JMPA 221PA 2LKCA 3A1TA 1Z2AA 2IK8A 4LYAA 1OYWA 4GI7A 2PL3A 1SXJE 4EQ6B 1RIFA 4DLXA 1RJ9A 2B7CA 2VP0A 1E9RA 2CK3D 3BRWD 3U61B 2DR3A 1XPOA 2ZE6A 2OFXA 4PO9A 4JLVA 5CJPA 3H84A 2JJ2D 5HKKD 3FMIA 2ZU0C 1XJQA 3DDCA 3DL0A 4C0QC 4HATA 4M8NE 1I4LD 2FZ4A 2PT7A 2VSXA 2QMHA 3CRRA 2LCFA 4OHZA 5KDDA 2IL1A 4KXFB 2UKDA 4OQXA 1Z8FA 1U0JA 2ZRMA 1F48A 3C5HA 1IBRA 4XVQA 3W6PA 4NDZA 1E3MA 1MV5A 2FFBA 1R7RA 1UEIA 2A7QA 3CPJB 3MJRA 4KODA 4Q1DA 3IIKA 4D6PA 4TLAA 2FPKA 4G5RA 4MRRA 1WBDA 1R4AA 2GCPA 3ZIAA 4WVFA 1DEKA 1YZGA 4G3XA 3HDTA 5G53C 1ZNYA 3FKSD 2DB3A 1UBCA 5J4VA 5A5GA 1TUIA 1ZU4A 2UZIR 3LW8A 4NZYA 4EPWA 4R98A 4XWKA 1QBKC 1FNNA 5FTKA 2ZUDA 2BHRA 2YWHA 1KO1A 1Q1EA 4TWZA 5KTYA 4UNQA 2YINC 4XD7A 4NYJR 5FFMA 1DG3A 1XD9A 3GLIB 1II9A 2QZ4A 1XMJA 5H70A 3AVQA 3CWQA 3GLIA 4HLUA 1KJZA 2AK3A 4EQ6A 2NGRA 2Z4RA 4HZIA 3AH8A 2R6FA 4ZO4A 1WE2A 3LDAA 3K0FA 2RGNC 4JS0A 4TMWA 2QQEA 1AS3A 3QG1A 1AKEA 3LNCA 2XXAB 1I4DD 5CM8B 2C04A 2X19A 3QKUA 5C1BA 3HR8A 4AURA 5FBWB 4F92B 3BOSA 4EFMA 2C98A 4LUCA 4PQFA 2O0JA 2UZ3A 5FUYA 3QE0A 4WW0A 4Q4AA 1JECA 1UBFA 4TLCA 1GNRA 4BLPA 4RFVA 1ODFA 2QPAA 2Q3FA 1FZQA 4O0MA 4F38A 2P6UA 5G3YA 3VKGA 2GZDA 3W34A 3ADKA 2N1BA 5CJ2A 1N0UA 4ZDIA 3NDBB 3T61A 1F5NA 4DSTA 4XIGS 3O8RA 2V3CC 4MUBA 2FV8A 5KPJA 2PMDA 4EAQA 1G4UR 3QENA 4LWZA 4Q4HB 3Q8XB 2VHTA 2JASA 1S9DA 4XD7D 4B3DA 4U5XA 2WMOB 4OL0A 2WKQA 3GJ5A 1KDTA 1Z6YA 4UNRA 2GK7A 3Q7QA 3LV8A 3B85A 5AUOB 4JBYA 1KO7A 1JEEA 1GFIA 2NTYC 1XTSA 3SJZA 2NOAA 3N2IA 3GJ8A 1F3OA 1OKKA 2NIPA 721PA 2PZFA 1X6VA 3O47A 3U7FB 4EKDA 2CK3A 4JLMA 4Q02A 3EPHA 1Z28A 1P2TA 1CULC 4HLQB 2F1RA 2XB4A 1VG0B 5EE3A 5JCZA 4BPBA 2F43A 2R9VA 1G3MA 1OFHA 4BASA 1QHYA 3B1WA 4BEBA 2RHMA 3TK1A 2GJ8A 5C2JB 4MKIA 1PUJA 3O8DA 1GUAA 3KJGA 1G3RA 1SVSA 1H8HD 3Q85A 4TLDA 3R9XA 1AJEA 4ZKEA 5A4JA 2I1QA 1K5DA 1U99A 1ZNZA 3RWOA 1YR8A 4ILEA 1JQLB 4JSYA 1CR1A 1VCOA 3EARA 1E79A 1S96A 3M4YA 2YC4C 2NZ8A 3L8ZA 3CH5A 3NDPA 4QGGA 1P61B 3LW7A 2QM8A 3L8YA 4E5UA 4OQNA 1GNPA 2R2AA 4C0BA 1PV4A 2CNWA 5JJKA 1XD8A 1N5JA 4I81A 1N6IA 2CHQA 5BN3A 5GJCA 1B23P 1RYHA 1X3SA 4W5HA 4A2WA 2YYZA 3DM5A 3RNLA 3VX3A 4EFNA 4GRAA 4PC1A 1KDPA 5J5CA 4EJSC 2FMXA 1F6BA 3GFOA 2XJ4A 2LKDA 2KI5A 1XZPA 4JVSB 4B76A 3KB2A 4LPSA 4A15A 1W0JA 3IEUA 5HPYB 3GFTA 1P4SA 2X8AA 1T4GA 2WWHA 3B1YA 3OESA 3PIRA 3T1VA 1BOFA 5DNYB 4MUAA 3QKRB 3B60A 4AWXA 1T6NA 3EIQA 5F9FA 2DWOA 2XSZD 2A3RA 5JHHB 2QAJA 3W9YA 1X86B 3RC3A 5D3MA 1H8HA 3NC1C 3W3AA 1OHHA 2JIZA 3QNUA 4TTQA 3QBVA 2ZEJA 3ZVMA 1N5IA 1YZQA 4V0NA 5G40A 1G291 2ZSFA 4B32A 3LH5A 2EW1A 2H57A 1DELA 4IJMA 5JS7A 3SE0A 5E3HA 3AQ4A 4RZ3A 4O3MA 5A0FA 3U6KA 3MLEA 1J90A 3QI2A 5AJVB 2XNDD 1A5TA 1YZNA 5KNCA 2O8BA 1U0HC 1G5RA 1SKYE 5FTNA 3WYGA 4ZKDA 4X8OA 2NQ2C 3EZ6A 3X1WA 2WWGA 4IOLA 4NYMR 4FXPA 5BW8A 4EPXA 3HU3A 4CRWB 1QDEA 1VG8A 4K46A 2FZLA 3TE6A 3OEHD 4B75A 1NF3A 3OHMA 3TKLA 2DPXA 3LX8A 4MITA 2FU5C 3CR8A 3K09C 1E69A 4QGHA 1KMHA 3MCAA 1ZYUA 3AEZA 2ANCA 3SYNA 5CB8A 4DEYA 1U2RA 3GJ4A 4TN1A 5L3RA 2VP5A 4URUR 1VHTA 4IOKA 1G16A 1GILA 1T8UA 3PFIA 4NPHA 1OH6A 4PQRA 3QPUA 1QZXA 3G82C 1C9KA 4TQAA 3CRMA 3HWSA 4A0HA 3A6PC 3NXSA 5F9HA 2VBCA 3UWKA 3WRXC 2QTFA 1E0JA 2KSQA 4DWJA 3LXRA 1PVOA 3PJRA 3BFKA 1JR3E 2D2EA 3WYAA 2WHXA 2ZRCA 1I4TD 4PHFA 4A8JB 2QN6A 5TDHA 2VYFA 4FCTA 5D3MB 5J40A 3T5DA 2PZGA 4B34A 2R6DA 4D0NA 1II0A 4TYWA 4PFSA 5FOVA 1GIAA 3BB3A 3H86A 4I1SA 4KBFA 3WBJA 2D62A 1E1QD 3LA6A 2V54A 4PC7A 4BRUA 4LHZA 3P1JA 4RD1A 3UMFA 1IJEA 3U7HB 1KSGA 2EFDB 5DE3A 4AKIA 3NBXX 2NG1A 5LDDC 1GL6A 4GL2A 2ZR0A 2ZAMA 3U3OA 1M34E 4P4SA 4G5QA 3K70B 3PXGA 3AUYA 2I1VB 4FW9A 1PZNA 2ATXA 4GSYA 4K81B 1FP7A 4EIWA 3TAHA 3KXLA 1CR2A 5SZJA 3FVQA 2YWFA 1HH4A 2QQ0A 2ZROA 4MKFA 3PG5A 3X1ZA 4BZQA 1UF9A 1XZQA 3ZVLA 1KO8A 4BUJA 1R2QA 2A5YB 4ZIRA 1AGRA 2ZRGA 2QP3A 1A2BA 1TF5A 1OFTA 1PLLA 1TQ2A 3ZD7A 4CT4B 2GCNA 1CJTC 3EA0A 4M1WA 1NMYA 3OEED 4LBWA 4LGMA 3J81k 1UEJA 1QRAA 4OK6A 2GDJA 2J7KA 2V4ZA 4UJ3A 3DOFA 1E2FA 2FF7A 4AG5A 1RE0A 2CE2X 3D8BA 4M1OA 2IYYA 2FSGA 1MO3A 4LYJA 1E1QA 1KZ7B 1MABB 2BJVA 2XOKA 2VP4A 2ZUCA 4OHWA 1AZSC 2DWPA 4XOIA 1KNXA 1RRPA 5F2EA 3R8CA 4A8JA 8OHMA 3D7MA 2IF2A 1M2OB 2WMNB 2ZRLA 2ZAOA 1WRBA 3BH6A 1FTSA 3SFZA 4S35A 1QHHB 4G0NA 1CJUC 5JECA 3IQXA 3AVTA 4PAMA 3LBHA 2QAGA 3FGNA 1EFUA 3LBNA 3HYTA 2ONJA 4A1FA 2FH5B 2CJWB 2JEOA 4TMKA 5JEEA 3I5YA 2C9OA 2NO6A 2QGNA 3TUZC 1CRQA 3GJ7A 4I1VA 4BEJA 4IXMA 3VTKA 4TMVA 5JRZA 1W36D 3IPXA 3AF4A 2IYLD 2E9SA 3H4MA 4Z51A 4CIDA 1S1CA 4A2PA 4QOSA 1YRBA 3KQHA 4MRVA 1OH7A 1ZUIA 2E1RA 1OB2A 4LHXA 4I99A 4URYR 4GOJA 4A0FA 2W6JA 1KI3A 3PUWA 3QEJA 3QXCA 4ARZA 1YKSA 3RYTC 5KSYA 4MRSA 3QKRA 3R7WB 1NP6A 4OI1A 4KO8A 4RY2A 2QROA 4BQSA 1SVWA 1KNQA 5HZHA 4CZ2A 3CKLA 1U90A 3AB3A 2ZRIA 5J4KA 5FBQB 3REFA 2PBRA 4BECA 2ZJOA 2HT6A 4KV9A 3TVTA 5DN6D 1F2UA 4MRPA 1MRNA 4QNMA 1OXUA 1R5BA 5EQTA 2G3YA 4C2UA 4NU0A 2CHGA 4LC0A 2W6IA 3CM0A 4D4JA 4L9SA 4EPTA 3Q7PA 2PMKA 4DDWA 1KY3A 2IYRA 4Q03A 1Q12A 2GJKA 4B3XA 5H68A 2V9PA 2YZ2A 3QVUA 1FQKA 3A58B 1YR7A 5TVKA 2C8VA 1OXVA 4BFYA 3IHWA 2ZJZA 1TADA 2JLRA 3LAWA 4P0TA 1E2KA 3TAUA 2B92A 3U44B 5EXPA 1AS2A 3IQWA 3Q72A 2W6JD 4LHYA 3U44A 4LJ8A 1W4BA 3KFVA 1P7CA 3B82A 2HJVA 1FMJA 1Z06A 3ADBA 1OXTA 4PZLA 2J7PD 4C0AC 3E70C 2WSSA 1FUUA 4QXAA 3CPEA 4LJ6A 1T9HA 5CDFE 2GKSA 2J1LA 3UMSA 3ZS9A 3VHLB 2JLWA 4C7OA 3BK7A 3B1VA 1HA3A 2WWYA 2GAOA 3GJXC 4LJ9A 5GVRA 3WXMA 3ZD6A 1ZD9A 4L16A 2HUPA 1R10A 3A8TA 1Q1ZA 1TX4B 4JJZA 3K9LA 1L8QA 2FNAA 1N6HA 1P9WA 1OXSC 2ANBA 3K70D 1VIAA 1A1VA 4DZZA 2QT0A 2HCBA 1NLFA 4LK2A 3TMKA 4M22A 2R62A 3QXHA 3WBKA 4US1R 1D9XA 1OH5A 3VNVA 3ND8A 1AKYA 4ZI2A 4C2TA 3AVXA 2YWGA 3JZAA 2Q9CA 2AFIE 5IDVA 1E94E 3AUXA 4QC2A 1G8GA 4BZPA 4PQYA 2V8OA 4GMXA 2IUUA 1W36B 4ASUD 2J0SA 3ADCA 3KTAA 2QI9C 4MYCA 1J70A 3BE4A 1TF2A 1DADA 1SZPA 3B6EA 1XBTA 3I73A 2IYXA 4ZIRB 3OIUA 2PLRA 1F2TB 3LFUA 3ZGXA 1GG2A 1XPRA 2GBLA 3K53A 3AVUA 1N25A 4R2HA 1E32A 2F43B 2R65A 1N3BA 4JKYA 1Z0AA 4WIAA 3VR2A 2ODBA 4GP6A 1YJ5A 4P4UA 5DI9A 4TT3D 3GLHA 3CX6A 1G8FA 1BYUA 1KOFA 1E0SA 2CCGA 4OQMA 4LV8B 1UPTA 2E87A 3EZFA 1JPNA 5E4FA 3NHAA 1OF1A 5LB4A 1E0KA 4DB4A 1EWQA 1GITA 2WWIA 1ZM4A 3AKEA 2GZHA 3VR3A 4NONA 1TU4A 2FGKA 1BO6A 2AWNA 3EG5A 1RRGA 2WWXA 4RFSA 5CYPA 3C16C 3C4JA 3SDZA 3PITA 3GJ6A 3L0OA 1TEXA 4V03A 1EFHA 3BC1A 4JLNA 4R2IA 3EPJA 1E2DA 2FA9A 2QM7A 4Q9HA 2NMVA 4BWYA 1Z29A 4YLGA 4Q01A 4DCUA 4ASUA 4PC2A 4PSKA 3AKCA 5EZ5A 3PEWA 4M9ZA 3Q5EA 3ZJYA 4CEIA 3HPRA 3OIVA 3GD7A 4LRWA 4G5OA 4PHHA 3GMTA 1XMVA 2HLDD 4CEIB 3GPLA 3V9PA 1UFQA 1G64A 1VCMA 3H2YA 3FOZA 4A9AA 1VMAA 2GJ9A 4HI0E 3G0HA 2R6CA 1CBUA 2HV8A 2ZRPA 4Q1FA 4ZPXA 3DM9B 5KUTA 1YU9A 3KTAB 1RYFA 1E2EA 4Q5IA 2R6AA 3TSZA 2ZJ5A 4K8OA 2FPLA 3E5HA 2I3BA 3UKDA 2IF0A 2XZLA 2GVZC 2F1HA 3U2QA 4O25A 1GRQA 1SVIA 2ZJ8A 5JRJA 4UNPA 1N6PA
chains in the Genus database with same CATH superfamily
1WWKA 3NEYA 3OT4A 2P35A 2PCJA 2X2EA 3IUYA 2ECPA 2W6CX 3T99A 2BGWA 4ZZ0A 3WB1A 1AGNA 4F5WA 2DT8A 3E27A 1L7BA 3KQMA 3NHLA 3HN7A 1TGVA 1JIKA 5EP3A 4BB5A 1VECA 4B48A 4F2HA 2FWIA 3KS9A 4E4YA 1YD7A 2G0NA 1TCCA 2GRJA 4DG5A 5T3UA 2Z98A 2ZYWX 4YC7A 1JNYA 4RGVA 4LC1A 1G38A 3D43A 2PJDA 4IDPA 3RQIA 4CDMA 4PBRA 2ZQ5A 3RS5A 5HM6A 4ZK2A 1ATIA 3D0QA 4XM1A 4Q1CA 3PS9A 2QPLA 5DULA 2X5NA 3VC3A 5J4YA 4UOEA 3AVYA 5DHFA 5THXA 4B6EA 1TIPA 1PFVA 2A9OA 3LUHA 2QT1A 2TECE 2X86A 4QX6A 5JD6A 1M67A 7ADHA 5LOVB 2WAYA 3M89A 5KTTA 4GGOA 4K9KA 4ND8B 3W3ZB 4HQOA 3X1MA 2SKEA 3TZQA 2OZLA 4MUKA 1SPXA 3IVRA 1KQ3A 1T9DA 3TI9A 4EITA 2XSZA 5IW8A 2HF2A 2GM9A 4HUTA 3IBFA 4OIFA 1OV6A 4RPIA 4XJSA 3IUSA 2CL0X 2RONA 5I9BA 1XZIA 2JFFA 3RVKA 1KH1A 1NJ1A 1GSAA 1Y1RA 2Y4OA 5FUXA 2I66A 2HQBA 3WHIA 4I4TA 2AMYA 3IEIA 1SWVA 3O21A 3RHTA 1SHTX 4C01A 5F98A 2ID7A 3EXHC 1EA5A 3OOJA 4XAQA 1U7PA 1WPRA 1PCXA 2VJLA 3LECA 4WZAE 2WKRA 1VE7A 4RK7A 1FFHA 4PO3X 4C4XA 1UT5A 1MVOA 1KJWA 4LBZA 3FM9A 2BFEB 3TR0A 1EX6A 1ZIXA 1SKQA 1XALA 4EHAA 2BM1A 3AU9A 3PBKA 3FLEA 2J9ZB 4PEVA 1E3IA 4TZKA 5AHKA 3IKJA 1SZDA 2WAMA 4C4AA 4B44A 1T9CA 1BWQA 1GFSA 3C7KA 2Q6IA 2PLAA 1ETHA 1W5SA 1RDFA 5KSZA 1CEQA 2EIHA 5AOVA 2BN4A 2JF0A 4HH4A 4MX8A 1X80B 1ODJA 4HX5A 2Z2ZA 5AKYA 4BLQA 1HQKA 2Z5LA 3E8MA 1FB5A 2IUYA 3TUIC 3URKA 2XMSA 4N48A 2Z9DA 1IU9A 4O02B 2P3SA 1IWBB 2IKSA 2OCBA 4V0LA 4MLPA 5H81A 3UOWA 1XTZA 3DNFA 2VBFA 4JNKA 4OXKA 1NLUA 1SBCA 2ZBEA 4TSFA 3P9ZA 5EWLA 4BE7B 4U7GA 1WPQA 1YBHA 2QR2A 3EXFB 3K72B 2ZBGA 4IZ6A 4E5VA 1ILWA 1JL3A 3K8OE 4L28A 4GUAA 4NS4A 3S27A 3ZCVA 5LOVF 1IONA 3H04A 2OHVA 1JAHA 1D8AA 1OCEA 1XAGA 1XXHA 1CS0A 2YN4A 2WFLB 3H9CA 3IUQA 1NVGA 4GDMA 1XCMA 2IXAA 4I9HA 4LE2A 4AJPA 2XCTB 3T12A 5K8LA 4KAJA 2BFBA 4PGFA 4HVLA 4LZLA 3KKOA 1LBEA 2C5AA 4CETA 1GAXA 3CUWA 1COZA 1YFKA 1ZCBA 5AFSA 1K92A 4IVQA 3CU5A 5CUQA 4CQMD 3PNPA 3Q3GE 3R41A 5J9FA 4PPQA 4R7GA 3TL6A 3BK1A 2BEJA 3ZGNA 2QSJA 1LK7A 1Q0HA 1Z38A 2HBRA 6Q21A 5EI5A 5K0EA 1RFLA 3CSSA 1US8A 4UJ5A 3HA2A 2Q21A 3G2JA 4IGFA 2PZJA 4D0LB 1YZVA 2I4OA 5FPPA 1HYQA 1YGYA 3FUTA 3PXDA 4MLCA 4NCKA 5LLTA 2VYCA 4AMBA 4BX3A 2M98A 2NU6A 3K94A 4BQOA 1C3EA 1GCOA 1XRSB 4TYYA 4HDOB 4CMBA 2DUWA 1MEEA 2JFXA 3LBFA 4IILA 1A2KC 2NLOA 1E3EA 3QEOA 4OMFG 3ETEA 3OOHA 5KNCD 4Y0VA 3J7AC 2C4WA 2WHYA 3HV2A 3A1WA 4KLAA 1FFXA 3KKLA 1RR6A 3AT1A 1XCOA 4G84A 5ELLA 5A5EA 1NX9A 2F00A 3QE2A 5EP1A 5CA1B 3AEYA 3BTOA 3GGDA 1KHTA 1S8OA 3E4DA 5DEOA 4MVJH 2NVOA 1N2HA 1T91A 5LUAA 4XSGA 2GYWA 1NVMB 4UM9D 3C7DB 2Y99A 5ALHA 2BH2A 1PS8A 5AW6A 1MD9A 1GAJA 4GM4A 4I50A 3T35A 3FOFC 1JQJC 1QFMA 3DMHA 4OL9A 4AFNA 2BAGA 2E82A 2AXEA 1C8VB 3A9SA 4JKOA 4MV7A 1JPJA 1PYDA 2JW5A 4L5JA 4E5PA 1QTQA 2GEDA 2GHRA 2MSEB 2R5WA 4HQRA 2XBMA 4F6RA 3BF8A 5BSHA 4EY5A 1QYCA 2VDOB 3OX1A 3VTFA 1D5CA 4Q7KA 4ZVTA 3ZBTA 2FPSA 1B3BA 5DRTA 3GVXA 5TMEA 2OENG 4L3OA 1KI7A 1W5FA 1AE1A 4RH3A 5CEEA 2GD0A 3DDHA 4IDCA 4J2TA 3L93A 3RSFA 4TLEA 4O4IF 5J5AA 3UGQA 1LUAA 3I6BA 4NK5A 3JQFC 5EE5B 2ICAA 3ITNA 1SC6A 3HGMA 1EGAA 4JSTA 5CXXA 1ZITA 1C0KA 4B2LA 1HT2E 1JZQA 3LVRE 1N9GA 3TR6A 4I4CA 2Y77A 1WOYA 1NBME 3MUEA 5F1OA 2QUAA 5ARDA 2GJ4A 2ZI9A 2OUIA 2PO5A 3L06A 3UXEA 4N8SA 2I91A 4EFDA 2VTDA 3NATA 3LCMA 2OMKA 4MQEB 4OBWA 5D8DA 2X76A 1HDCA 1H5QA 3HUFA 3I8OA 5TLSA 4Z7JA 1DBVO 2C54A 3PGVA 5FR2A 4MYHA 4G8JA 1HKHA 3SJAA 4Z7NB 2JLQA 3TOVA 1U2EA 1AIPA 2PM8A 4F2WA 2GR9A 1FFAA 2Z4TA 3CRQA 1Z4IA 2CFCA 3QU2A 2JAPA 2QBYB 3W6ZA 4JUDX 4NH0A 4EVQA 4YCSA 1J1UA 5AM2A 1XTTA 2IUFA 4FIDA 3NHBA 4G0UA 1R0YA 2WSYB 4E7PA 1WLSA 3V7UA 1ZCZA 4WNAA 2HO4A 5GJBA 1T8WA 1ZW1A 5AW8A 1UQUA 2F17A 2RGEA 4U2BA 4BC0A 1QQ6A 4D92A 4DCMA 3P94A 4ZDWA 2XMDA 4O2BF 2J07A 4P82A 1NLYA 1I9GA 3ZNPA 5B2ZA 4FYKA 5ENVA 1XAIA 5BWNA 3P71T 3AJEA 1C4KA 2I8AA 1N6LA 3O90A 4W1QA 1NNEA 3OWOA 2AB0A 1XMXA 4IVRA 3VBCA 5LJLA 4LYEA 3SC3A 4DLTA 2IPMA 1LH0A 4H1VA 4CR6A 3VRHA 2PXAA 4FFOA 3TZCA 1JR2A 1XELA 4N12A 3GEIA 2PPVA 5L8VA 2P6PA 5DLQC 1UPAA 5ALOA 1WCV1 1MO2A 3QEMB 1NTRA 2HIMA 3JAMA 2QOEA 4I5EA 3ONEA 1CY4A 3OU7A 2X1VA 3AV0B 5KO2A 2F9MA 2X40A 4C7OB 2ZRDA 1TFUA 5CLQA 2JFPA 4EB8A 2J9XB 2FHSA 2RGRA 1A8PA 1XTPA 1LXCA 3N2EA 2R96A 3KR1A 2UZ0A 2A57A 2AN9A 2NUBA 4PCAA 2ZBUA 2OMEA 4BNMA 4DZTA 1WXGA 3DZCA 3I28A 3PTLA 4HNRA 4IOJA 3EVTA 3DT8A 3UMJA 4DV0B 1Z0UA 3LF2A 4MP3A 4CCYB 4QG3A 1UC5B 4B7CA 4I5DA 4I8IA 5HDBB 1VE3A 1U0LA 5DHAA 3BMQA 4XGQA 4DDUA 3BWCA 2ZP1A 4ISCA 1QH1A 4PX2A 3V7FA 3CINA 4RZ2A 5DCYA 4N0EA 4IIHA 5CLLA 4QLBA 2VDRB 2VNIA 4ZT5A 2DPMA 2OCYC 4U02A 1TCVA 5AR1A 4HQNA 2Q4OA 3AOEA 3VR6D 4JKIA 4URWR 1FPMA 2FVYA 1L5HB 1IN6A 2OKGA 5EHNA 3TF5A 2I2AA 1QHIA 4DEXA 2YYSA 1R64A 2IY9A 5UKDA 1NSTA 1PT5A 3HN2A 5JCXA 2DQKA 1SXIA 1IY0A 2EEZA 2I6XA 4O2BB 3QXGA 3RGGA 2IP2A 1K8ZB 4IUBS 2WI8A 2LZ0A 3NANA 4FB4A 2C83A 1Z37A 2EBWA 4GOOD 4D1YA 3P9IA 4LZZA 5C5EA 2BP7B 3I0MA 4WBXC 3SFVA 4FLMA 1G20E 4E70A 2FZVA 1E7RA 4WK2B 4S1WA 3HXKA 3L7JA 4UDXX 3Q7SA 3IX7A 4GQBA 4HSGA 4JYBA 4PG6A 1CQZA 4BBPA 4A36A 4PX3A 3GGJA 2VA9A 3VJRA 4HAVA 5B4TA 1P9NA 1D2NA 3IVXA 4I1YA 4HYQA 2JFGA 1SVNA 2OG2A 4B33A 3PT5A 3GLHB 1H0KA 2BV3A 2IWHA 2PH1A 1UPUA 4B47A 2W43A 5ENDA 2VNAA 4INOA 3WAJA 3GGOA 1NR5A 1OJLA 2IYWA 3ANLA 3QKIA 3U4CA 4B3GA 1CF2O 3AEUA 5EKUA 1VSUA 3UW3A 5EMJA 4CMIB 4OI0A 1WCIB 4N5HX 3QY9A 4YX9A 1XJ0A 4EPRA 1SNYA 4RZIA 1ORHA 1SHLA 3LQYA 4FKZA 3STVA 4DAOA 5FH9A 1JTVA 3HRHA 4RIEA 3UOAB 4RVSA 3NYRA 4IHAA 4K9SA 3ZQUA 1NASA 3OFND 3EJ6A 2LBPA 1SU8A 4HY3A 4AUNA 3DLAA 3ESDA 2HK6A 4JY7A 3CIFA 1YBVA 2PZLA 1YTLA 3DF7A 5ETJA 1VJTA 1R1DA 2AOVA 3MELA 2X0FA 1X8KA 2Y2VA 4NYMQ 1S01A 2W2KB 5JATA 1SUAA 3ZN2A 1L4HA 5ELXA 4GPTA 5E3JA 4D25A 2O2YA 4FDAA 4G63A 1V45E 4NFLA 1M8GA 4OGGA 4PO8A 4MB6A 2G9RA 3EA5A 1L9XA 3VR5H 1FRFS 2FFQA 3NUQA 2NTEA 3WQSB 1V26A 5CCEA 4GYWA 2RH8A 1V71A 4H7JA 3NT4A 1C7QA 2MSCB 3DMGA 3QVMA 4TV8A 4BTLA 5KZMB 3DE6X 3IEKA 5AVJA 3SHVA 5BPHA 1JDJA 1I36A 4WVLA 2I5PO 4CGZA 1TLFA 4HUQB 4RVGA 3QUBA 5EP4A 4WBNF 1G20B 1FVHA 4RGBA 3IEVA 1E6MA 4QFCA 3RJ9A 4XFJA 4PYKA 1YZTA 1EEHA 1MX1A 3COZA 3AEKB 2QVXX 3KBOA 1HMYA 2IXDA 3MWJA 4JBHA 2FEXA 4Y30A 3VOBA 2C3PA 5TR9A 2Q29A 3M1AA 3VO2A 1DXYA 1GSIA 1KQOA 2G28A 2VF7A 3C6XA 4RQTA 4DV6B 2B1GA 3ZY3A 5SICE 5FNVB 1RXYA 2XUIA 4JL8A 2GRAA 3DO5A 3EMKA 1W4CA 3K2IA 2OL4A 1GTMA 4UXJA 1XTJA 3T1QA 1P8AA 2PJRA 1GKLA 2AYXA 1EB8A 3OQIA 1ZGAA 4KQCA 3RIGA 3TD6A 3AU8A 2IX3A 1T0IA 1XJ5A 2EEPA 1ENPA 3JVDA 3Q4GA 4FEEA 4UBIA 3WC4A 1QYRA 5HMLA 4A23A 2PSHA 3AETA 2FN9A 3SHTA 3GNQA 2BD0A 2JGEA 4TMZA 1U8FO 2QQ5A 3LP5A 2KB0A 4BP3A 1E9VA 3VU0A 4BNDA 3LWDA 3NIGB 3KWFA 3OPYB 1PZGA 4B5KA 3X1DA 4ITVA 1QAOA 4OYRA 1SXGA 3H4IA 4AJ9A 1KRXA 1IQUA 1TMOA 4LW8A 1MU0A 2HA6A 2IZ0A 4OHBA 2M6SA 4YAEA 4C7XA 4DRYA 4YFYA 4ND8A 1FS4A 4AZSA 2RAFA 4H7IA 2UUCB 1JRLA 1Q3KA 2IYZA 4HOYA 3UUEA 5EFZA 3DP7A 2OCKA 3D2LA 3MWEB 1IHOA 1M76A 3CX7A 4HEHA 4S0ZA 1CZRA 1VIDA 5EQDA 3WLAA 3TLBA 2DC1A 2H7YA 1JEDA 1QYDA 5H3HA 4KOAA 4KW7A 3A3NA 5M34A 5BV7A 3FPLA 1K7FB 2JBWA 2X5XA 3K9BA 1JDBB 3HXOA 4BY9E 2OAGA 1LSJA 2YYYA 4RY9A 1FE8A 1DIGA 2YOGA 4CMEC 1VMIA 4IEIA 3VR6H 4OJKA 4U2FA 2B94A 2BFPA 2FETA 5BNTA 1UKBA 2OUKA 3DMTA 1Z16A 3HNOA 3OTGA 2TS1A 3UHFA 3EPPA 3OKPA 3AZOA 2QTLA 4Q7MB 2NAPA 1XKLA 4WSOA 3UK7A 4B3JA 1KL7A 2D7DA 1NVVQ 2PRJA 2KBEA 4Z8YA 2FXVA 5H9VA 4C4PA 2J48A 3IUEA 4EA8A 3BORA 2QUHA 3GIDA 3KT6A 2O5EA 1U2TA 6ABPA 4IAOA 5LP6A 1CUCA 3EISA 1ISFA 4FN5A 2Q2WA 1YB1A 4AKTA 3IQGX 3D54D 1FJ2A 2VXCA 1G42A 3GO4A 3IELA 2H0QA 3ZHZA 3BIOA 3WL7A 3RRBA 4BIMA 1HQDA 4YA6A 5AD1A 1Z63A 3SF8B 2GN2A 4CCYA 3BWDD 2GAAA 3EW9A 4QEZA 4FX5A 5K01A 3TL3A 1F8FA 1T15A 5JSKA 2EQAA 1QIJA 1UDCA 2R6GA 3A31A 3CN9A 3C5VA 6GPBA 4P5PA 1XL0A 1QV9A 1PS9A 4UTRA 5JDIC 1FFSA 4W9RA 3TE7A 3G2OA 3OQVA 1GEGA 4FI3F 3T3PB 2Q6VA 4TYPA 4L8GA 1TMKA 1WU7A 3F2IA 4Y2PA 521PA 4ZCIA 6CHYA 4EB6A 5ILGA 4IV5A 4NBNA 1PNRA 2VCEA 3I92A 1IHUA 3KL2A 5FQNA 2WU8A 2QUZA 4YJ2B 5IDQA 5FA6A 1GQOA 4OHUA 3RH0A 4WNYA 4LX0A 4PQGA 3N1UA 3B8HA 3T7CA 4D0GA 4MYRA 4NFSA 1MO4A 1ZIOA 1O4WA 4HB3A 4OIMA 4X20B 3WLPA 3ZGZA 2LVBA 4DT1B 4BYGA 3TMAA 3MRVA 3JQPA 1MHPA 4BTEA 2VK2A 3DLHA 4CDGA 1K8YB 1XN1A 2J4DA 4K0RA 4N47A 4A7PA 1I5EA 2PKYX 4E7OA 3R7NA 4PYLA 1DTSA 1L0BA 1R37A 2HCTA 3AWDA 4FXOA 4LE1A 3VR5D 4RKEA 3ANTA 4IDBA 4C0JA 1QOQB 2J45A 4WKNA 1RMQA 5HRAA 3O03A 2YCLA 4DXDA 3MTEA 4TLMB 5EXEA 1K3TA 2QP9X 2Q4BA 2L69A 5J4LA 4ARAA 3JX9A 2P3LA 2GBFA 4FFVA 1RTKA 1GSHA 1GN9A 4D5EA 1BHO1 3AEUB 2FZGA 2BI7A 2Q1UA 1QC5B 2H5JA 2Q28A 4J9VA 3P2IA 2O0MA 1IJFA 1Y33E 2OGZA 3CLRD 1L1RA 5D6NA 1U1DA 2IUTA 3K30A 3MAAC 1T4BA 4JQCA 4M49A 4CLXA 2HR1A 1A50B 2C7BA 2WF8A 3JYNA 2C99A 4R83A 2WIBA 5FKJA 3K5HA 3SQMA 3VO1A 1M7HA 2ZETA 2IQ5A 2GLXA 3TCKA 3B2QA 3RTEA 4PONA 4Q15A 5BP7A 5JY1A 2OD9A 1Z74A 4GI5A 1YZ3A 1D6SA 3K9GA 1D1QA 1CJVC 3LBIA 1SVLA 3UJAA 4MVXA 1J0EA 4HGPA 4D9EA 1CFZA 1VYUA 1W48A 3I0ZA 3GP5A 1DQPA 3PIIA 1Z15A 1P1JA 2QMYA 3AVPA 4AN1A 2QPOA 2IY7A 5K8IA 1SHKA 4BNIA 1LV7A 1VJ0A 2J5BA 4JOSA 2OLEA 2ZAIA 5EQJB 4L15A 5K0NA 3OI7A 1CU1A 3ZWKA 3GAZA 3IAUA 2J7PA 1A98A 4GZMA 3DW3X 3I9V6 4ED9A 3TZKA 5KNBA 1VLZA 3MSXA 3TIIA 4PZ9A 3SGLA 3KSDO 1NMZA 1PQ4A 2FN7A 3WIOA 5HZKA 1KI8A 4D82A 1MH1A 3O8CA 4LOKA 1DAFA 1X7XB 1XWIA 2ZB3A 3FKSA 3HDHA 3HKCA 3T9DA 4MS4A 3C8HA 1JG6A 3S29A 2P6RA 5ANRB 1SUCA 4KSCA 3ZBUA 1F0NA 1CG6A 1VMDA 2APJA 4KWIA 1ZGGA 1D09A 2JRLA 4OJTA 3VU3A 4I5GA 1DZ3A 3K5IA 5CIQA 2J87A 2RJ3A 4DLSA 1BIFA 2WV7A 3IC5A 5F7XA 3QE4A 3RVPA 2QZPA 2W2LA 3MYYA 5F35A 3I04A 3PEEA 1JA9A 1UP7A 5CVCA 5E9AA 4XIYA 4UQPA 1TKBA 2H1LA 3N8NA 1U0NA 4YRZA 2ID4A 1GGHA 3DOIA 3TIXB 3ZK9A 2ZE8A 1WD5A 2GA8A 3AETB 3PYMA 4K26A 4WLNA 5JNVA 1ADJA 2QXUA 1MJNA 4CLEA 3HZRA 4EKEA 4Z3OA 3FSGA 1OBFO 4LCEA 4AI6A 1Z3CA 4E4TA 3K16A 2HW8A 1UXOA 2WB2A 3M49A 1A9OA 3PE6A 1ZGZA 2XX3A 3DMTC 4K1LA 3B9QA 4QUDA 3THOA 3V2UA 3VSDA 4URZR 3ZCTA 1PNTA 4G1UC 5DASA 1D2EA 2JI4A 3QXSA 4LRSB 1QOPB 2G70A 4R5HA 4DKJA 5CYGA 5F5LA 1PFUA 1Q11A 5I7OA 3PK0A 5EGSA 4W9MC 1Q0TA 4G4SO 2ZYHA 2Q6OA 4C87A 3OQHA 4XW2A 2I3AA 4UARA 1X8XA 3I5AA 4BZWA 4E22A 3N3BC 3MWEA 4H3VA 4Q66C 1O9BA 4FMDB 4RVCA 5AOAA 1I30A 1XQXA 3RVQA 1KMQA 4TV8F 3A4TA 3FAKA 4IYJA 1QFJA 5D1NA 3Q15C 3RTCA 1WCWA 3E1KA 5NLLA 2OVFA 2X23A 5B7NA 5H8WA 1JH9A 2Z3WA 1MABA 1UAYA 1DOAA 5D00A 5ALNA 5TPWA 4UNNA 1QMPA 3CLTD 4ZVVA 3VSEA 2ZSJA 2DPGA 4FC6A 3R9WA 3THSA 2DECA 2OK7A 3K1YA 1ZK0A 3OLXA 3IXLA 1UC8A 4NOKA 4Q18A 3T9BA 4C14A 3N7UA 4UPDA 4DBLE 3KYDA 3CBGA 5ALQA 4W63A 5AVWA 1U8YA 3E9ZA 3PKIA 1QTRA 4B4DA 3ZH2A 1YQ9A 2IEAA 4YLEA 1Q20A 4KG7A 1X1SA 2BF4A 1URPA 3U3DA 3K73O 1ICIA 1LJ8A 2XOEA 3UK0A 3GWGA 3QFTA 3GCZA 1KE1A 1NIPA 5CVJA 2QTGA 5AVSA 1QH1B 5K5EA 4OXYA 3HE3A 3KKNA 4IOMA 1AQLA 5E7IA 4OAPA 3VO8A 3HVJA 1WKBA 3EEBA 3F6BX 3NH6A 3SF8A 5B6IA 2AE2A 5TC4A 1FTNA 1Z82A 3CGGA 2E1PA 4GMGA 4UM5A 2B5WA 1XU4A 5AW9A 3EWAA 5LQMA 2R2GA 3GUCA 1X7YB 9LDTA 1IB6A 4KXLA 4CG2A 3F3YA 2QU8A 3H2BA 1HURA 4H31A 3K9NA 1YQUA 2Y93A 3JAKB 2Y1FA 4ZO9A 1EG7A 4C5BA 3OJWA 4IJ6A 4AJNA 4IIXA 1BH2A 3R4VA 1ZJYA 3U1BA 1WMAA 1XXLA 2FLVA 3QV1A 3R6TA 3PZBA 2AMVA 5JMOA 1PI3A 2KQUA 4K2AA 4LZNA 3N0WA 5B53A 5JLAA 3PIDA 4XB1A 1YZYA 1LLFA 3HRKA 5ALKA 4KFUA 1A88A 3S55A 3B6MA 2A0UA 3KDAA 1FX0B 2JNWA 2I71A 2J5KA 1SXJD 3HA3A 2FOLA 2R4QA 1W76A 2BEUB 4AY6A 2VJCA 4DC9A 3CQ9A 2EBFX 2QTRA 3DWFA 1G5PA 5FOWA 4EW2A 3GPCA 3T9CA 5KNDA 4R40A 2R6HA 3H42B 3LFHA 4XI9A 4Y2SA 5SZKB 3J80A 2Z3VA 3AR6A 2PUGA 1O5OA 3KQOA 3UT5A 3MTQA 3VHXB 1Y7PA 1QH9A 5GINE 1DZIA 5KX5B 3OEYA 1YQGA 2ETVA 4HO1X 4IJQA 2HQRA 4NBSA 4RYDA 1ESCA 1TMGE 2I7XA 2NO4A 1JBEA 3WZLA 1OX5A 4EG3A 4TKVA 3HGTA 4Z0TA 3F1LA 1M2WA 4CLOB 1JVSA 1LFAA 4BNTA 5FPHA 2JH3A 4NZPA 4FCCA 3IKLA 5CLHA 5HRUA 4C7MA 1AX9A 3WMFA 2PBFA 3FHOA 2OQ2A 2NU8A 3KSUA 1GQFA 1RAAA 3FPJA 1U7OA 1KSFX 2C9CA 3DHVA 3S1AA 4U7FA 1WSAA 2X5OA 5CX1B 5HF6A 1OLXA 4R69A 2C0PA 4XGNA 3UXYA 2J9FA 2AD5A 1L5KA 1OI3A 4DV5B 2ZJYA 2W37A 3LC1O 3M4ZA 4KMMA 2Q0XA 4MIOA 1IVNA 1IVYA 3BQ9A 5F52A 3DAPA 3H0CA 4G9GA 2I7DA 3BL8A 4KX5A 2GETA 3KJEA 3RFCA 3CH7A 3VTAA 4UAGA 2GBLC 2YC2C 4Z4GA 3QVJA 2HMSA 4TTIA 1MX3A 5DV9A 5K0CA 3G13A 1KI4A 1UJ2A 2RBGA 1OLOA 3C3BA 5BSVA 4WOCA 1YE3A 4JVMA 4X1KA 1YJBA 1E1KA 1G8PA 2HSEA 4H7FA 4UFOA 3SCZA 3I1FA 1BMFA 1PFQA 2Z04A 4H1UA 2AZXA 2MYUA 1DWQA 4XQCA 5KU1A 2VF5X 3VUFA 1R6UA 3QV2A 5CPFA 5ED0A 3RWMB 2JJ1D 4DA7A 4GKJB 4B7XA 4BRSA 1EFPA 1B42A 4DJAA 4PHGA 3QSYA 3I64A 1O9HA 3DLCA 4KE6A 4LWOA 2Y1GA 3WHPA 1TQ6A 3B1XA 4F4IA 1MPTA 3CPSA 5TQVA 3A7EA 1CRLA 4JL5A 3U7GA 1U0SY 2YIVX 2XGJA 1MJGM 2X0RA 5JNLA 1C4XA 4URFA 2PMCA 3R5SA 5KWIA 4AP9A 3MWLA 3OC6A 3GN1A 1XX6A 4QOHA 3K05A 3OJ0A 1SCNE 2AX4A 2F8MA 2EWMA 4EKGA 3NHRA 1BYIA 3GC6A 2WUEA 3REGA 4BWFB 1C0EA 2WSIA 4Q00A 3CVWA 5DF1A 1L5WA 3H5VA 2V58A 4X7RA 4EECA 1T8RA 1N2CE 2BBWA 4L6AA 4C0LA 2DY1A 1JHMA 1VGQA 2NTJA 3AGQA 4WCFB 1ACJA 3E18A 5IP5A 3WG9A 4ZCTA 5A7FA 1RS0A 3GUVA 5EXXA 1XEXB 3UW1A 5L7TA 3RHFA 1JQBA 3ABIA 3PQ6A 2CWDA 4GMDA 3ME5A 3ORFA 3OF3A 2WAAA 2Y1WA 4V0RA 5EJ5A 1KWGA 2ZSDA 1I3OA 1CVRA 3I30X 4OKNA 1NHWA 3FOAA 1ODKA 1G8JA 4HLCA 5HBRA 1A72A 1ZLXA 5EMKA 3ORRA 3PUHA 3ZWNA 1GRNA 3TCNA 1LW7A 2WFZA 3ZGLA 2H08A 3QIVA 4FBLA 5JJBA 3IOYA 2GZSA 4Q93A 1JGTA 3RS7A 4F2GA 5I51A 1Z0FA 1WXHA 4V1CA 5ADWA 1ULSA 4QNRA 2IS2A 3DNPA 3GLFA 1YQDA 3D8RA 2XHEA 2JFZA 1ADFA 2O52A 2VT7A 3HI6A 3KUXA 4R84A 5G41A 3JZIA 4HRVA 1PJ8A 2P6OA 3IDQA 2EERA 2PN1A 2VF8A 3B12A 3HDYA 1FDVA 3EGDA 1ICEA 4K2HA 4KFCA 1KAQA 3H2KA 3Q7EA 1R18A 3U81A 4E32A 4PM4A 2ZB8A 1ORIA 4QHTA 4ZWNA 1FP4B 3DE0X 1ETUA 4QDOA 4F93B 3E9NA 1ZVMA 3PDWA 4NL4H 5CGQB 1V9CA 1NBHA 4HRYA 5IVIA 3WTCA 1IN4A 3PJEA 1F8XA 5M04A 4M9XA 1YHYA 4EHKA 3K0SA 5T8KA 3MLAA 2MSLA 2DM6A 2FLKA 3A27A 4DNFA 4EJSB 4MA5A 4RJTA 4ZI3A 3F74A 3A3KA 1J9ZA 2YHAA 5AKEA 1U2QA 2GEKA 3ECCA 1NW4A 1GZSA 1MLDA 1I32A 1Z0SA 2D4HA 2O2CA 1SBTA 3G85A 2ZIFA 3C7AA 1G8HA 1T3HA 1U2PA 3FMGA 3OCVA 4DQDA 1R8QA 4WLEA 3C8DA 1KO4A 2EKZA 1S8AA 1T2DA 2Z56A 3UMGA 2QF7A 1FVFA 1Y9DA 2CNDA 3WQRA 2P69A 4ZVUA 1T1GA 3OH8A 4WJLA 4PXAA 2G08A 4LTNA 3COYA 4X91A 3WWZA 2FK8A 1F60A 3G89A 3PV0A 1CHDA 1ZDMA 2I1WA 1MO6A 2F8LA 1E1MA 2B78A 4KNYA 4JR1A 4FKMA 2OY0A 1NP7A 1YMUA 3RWBA 8ATCA 1W36B 1Y98A 3SU8A 3BGOS 1NBMD 2H1OA 3EVCA 4AX4A 5TMPA 2ADFA 4NZNA 2XNCA 1E20A 1VE9A 4C3UA 1TAGA 3LL7A 2PZMA 2XEXA 2NVWA 1DKPA 1F0KA 1RRMA 2QK4A 1HG1A 4BNUA 1Y8QA 1CZUA 2XZPA 3BICA 5KSOA 1SCAA 1T43A 1ZO8A 2O6HA 4G5YA 4RHYA 5J59A 4DXAA 1S2LA 2CMHA 4DG9A 3M6VA 5E9WA 1W7AA 2C0QA 1WMBA 1WXQA 5L4SA 4MQMA 4H7DA 1X0XA 1TD1A 2RHHA 3G0DA 3DEJA 3UJNA 4H9GA 1IMOA 3COJA 4G0OA 4H3KB 1CWUA 3R3VA 4W5WA 3BIWA 4OQFA 3E0QA 1X7ZA 1YDMA 3PGMA 4X61A 2CBGA 5CDGA 1ZCFA 2YHIB 1T1SA 3DE2X 4RS3A 5LQRA 1E2MA 1EA7A 2V1UA 1CQJA 3BXOA 1SBQA 2HGSA 4FD3A 1H1TA 4BZXA 3K4PA 3IT1A 3PR1A 2QRKA 3VKUA 3NKFA 1QXSA 1OLXB 4RPKA 3EEYA 1JDZA 1K7CA 2IDZA 4QJ3A 1SUPA 3FPHA 1NONA 4LNUB 4ZO6A 2GN0A 3H6HA 1U63A 1ZJ6A 3HM2A 3WRWA 3DOCA 3SR0A 4NDAA 2HEIA 1T5LA 3IHKA 5CJJA 4ADSG 3RS9A 4D8VA 3Q3VA 4NRDA 5FOTA 4YRDA 5M7EA 1NBMA 2ENWA 3FLBA 5AWFC 1NATA 2DTXA 2XIQA 5ICCA 4R4JA 1YMQA 2HFKA 2IIQA 4MULA 1JAZA 5HCUA 4M8KA 1PR5A 2G6BA 4UD2A 2UVQA 1IN1A 3ICEA 3DPSA 2DKNA 3Q8MA 1NUSA 1O96A 5G4KB 3ACCA 2G36A 2VSOA 2C94A 3O1IC 3NG1A 3LK7A 1TMYA 4R2WA 1YVPA 3O2SB 3O4GA 4LPKA 4ETNA 3MT0A 4P92A 2ECOA 1G3UA 2HZBA 5I3CA 2MOKA 2AN5A 1RC8A 3RYIA 1MRZA 3H5TA 4N6GA 1WZIA 3TQRA 1LDNA 3KPJA 5AJHA 3KDSE 4KE9A 3GZTB 2WJVA 3PNMA 1KY2A 1RW4A 1UMCB 3L6DA 4IMIB 4KK3A 4Y1RB 4D79A 2MIIA 5KQLA 1Y8CA 3ENKA 1EFAA 3S2ZA 2AR7A 3UMVA 2Y1EA 3LDFA 1QVRA 3W2TA 3KVOA 2X13A 1XFAA 1LY1A 4KAAA 3JARB 3MAGA 3HK2A 1DTWA 3MWDB 1EG2A 1JSRA 5FWXA 3ZOZA 4Z54A 1BCRB 5L4NA 3KEOA 2GF0A 5SYNA 2RGDA 4N18A 4OO3A 5BN4A 3BJRA 3FUVA 4DPLA 3E48A 4FB5A 5CG1A 1JIXA 5JPCA 1OAOC 1YUNA 1L8XA 4HNSA 4JGIA 1YDFA 3T5CA 4LOLA 4E13A 1VYTA 2FEPA 1DAIA 1P4AA 1QHEA 2H0RA 2ZUUA 4ZAYA 1KK1A 1H9CA 5CDFA 3NTOA 4B17A 1CRPA 2OXEA 3KPUA 4JXZA 1CP2A 2CV0A 2YUTA 2O7VA 5LZ8A 3EPLA 5CDSA 3ORHA 1EFKA 3PHJA 4J16A 3PGXA 1A9SA 1JDTA 2DVMA 2C9MA 1D0VA 2Q5OA 3ZR4B 4FSXA 1M7BA 4YP0A 3HP1A 5DM4A 1PDVA 4TWRA 1Y6FA 3R5FA 1DCFA 1R0LA 1PNOA 4NFYA 4WAUA 5LA6F 3U48A 3WGJA 2AFRA 3K2QA 4EYKA 2WJJA 1CQIB 2DEUA 2I0FA 2J3DA 4KUGA 2BKXA 3A9VA 4OH1A 3HCBA 4BN0A 1Z18A 2VJQA 2IHYA 2IX9A 3FROA 4ZARA 5KQPA 1W1IA 3LGAA 2F7SA 2XB8A 2CNNA 2I4IA 5FA8A 4PCUA 2QX6A 4JJ8A 4A8HA 3HR4A 1Y4DE 3AL2A 2D74A 4KXXA 1JHYA 4WZ6A 2BTEA 1LPBB 2OXFA 3BWBA 3ZQ6A 4N3GA 2IHTA 3HHEA 3NDRA 1Y6QA 4PS0A 2DFKB 4M8SA 1C1DB 1CUYA 2GHQA 2R6JA 3V33A 1MX5A 4S0XA 1ZUNA 2AIRA 3MQ2A 3W8NA 1W88A 5CFRA 3VVLA 1E9BA 4BO8A 2XOKD 4D9FA 4YDQA 3DFZA 6PFKA 1IQRA 1WTCA 5LZ9A 2H17A 4TWBA 2F90A 3N76A 5JNWA 4DWVA 5HIJA 3VU9A 4B0PA 3UK2A 2JIBA 2Z9CA 1BFUA 2W58A 2ZSHA 3K1AB 2A8YA 3OLZA 1LWOA 4B2YA 4CTJA 4E08A 3VNAA 1HSZA 4C3OB 2J0VA 1I24A 3B38A 4NQZA 1P8JA 1R0WA 2O23A 3WJ7A 1EESA 3CT4A 1AZLA 1E2QA 1ORRA 1PR9A 1ZH8A 4QZVA 2ZUEA 5A9SB 1XU9A 1RXUA 3ZZ0A 1H8EA 2ZT6A 4WLUA 4AO7A 2BEUA 1NY6A 3TIVA 3Q6IA 3W78A 1GY8A 3AYXB 4FLFA 4YQEA 3P4XA 3TW0A 1AK9A 3C3JA 1B0UA 4EYEA 3REOA 4WESB 3WNZA 3OM8A 4OLHA 1IOWA 3H18A 3Q7TA 1YR9A 1XVUA 4EF6A 4P7FA 4P0QB 4ZHQF 5CP8A 1ST3A 1JHPA 1ZMXA 2OZEA 2VTKA 4ZODA 1UZNA 4GNRA 3RT9A 4L5YA 2XB6A 2QQFA 4O2LA 3FCAA 1P0QA 5HDQA 3D59A 1UAAA 4NC9A 3K0FB 1NP3A 4O63O 2HSJA 3D4BA 1IPEA 4QBHA 2J33A 2Q7OE 3CVYA 2BHNA 1Q0PA 1TT5B 1VLVA 1P0IA 1RAIA 1QTNA 4X54A 1PZEA 3WADA 4ABTA 3MBIA 4ONEA 1C2TA 1GGMA 4FMPA 5T4BA 1BS1A 3AY0A 1QP7A 2IQIA 4MAMA 1RJGA 1G41A 1YK1A 1NQWA 1K75A 4UVEA 3RW9A 3WGIA 4HNTA 1UKZA 2R7KA 4CM1A 2C9BA 3WDKA 1T5OA 1HEYA 3OURA 2R79A 3DEFA 4BV8A 4NS1A 3SYLA 2GFHA 4IQ0A 4BFXA 1WOMA 5B1YA 4LCJA 4LRTB 3WGGA 4B71A 4J0QA 4B82A 1L1EA 1HO3A 2OT3B 5IF9A 2EKQA 1Z35A 2EGGA 3VUEA 4D4LA 5CR9A 5EUCA 2Y0EA 5EJMA 3KZ1E 1ZOIA 1IQPA 1E1YA 2H31A 4XYEA 5C7IO 3RC8A 1KMMA 1FFCA 1H2ZA 1QHNA 1UWKA 1JVNA 4FFRA 2VDKB 3EGXA 2FPIB 3BCRA 1MENA 4X7BA 1Z5WA 2AOTA 4F5EA 1C9NA 3CNEA 4RH1A 1P6XA 2AXQA 3JW8A 5CK5A 4EJ0A 1SBNE 3UAYA 4LHVA 2HKIA 2MMGA 3P9YA 1NXVA 1RKBA 1FNMA 3I2KA 4EJMA 2FPGB 2B2CA 5DBEX 3GU3A 2CLIB 3HGQA 1K08A 4YRBA 2QDXA 5AUNB 1CYDA 1TA9A