1U81A

Delta-17 human adp ribosylation factor 1 complexed with gdp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
164
structure length
164
Chain Sequence
b'MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor 1
publication title Conformational changes in human Arf1 on nucleotide exchange and deletion of membrane-binding elements.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 41
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2004-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1u81A00
3CM0A 3QXHA 3AGPA 3IPYA 2GTPA 2SHKA 2WWGA 2D7CA 1J8YF 5FPYA 2QGZA 2JLZA 2IUSA 2QAGC 5AJXA 4D4KA 5CYOA 3WBKA 1N6NA 1X3SA 1EESA 121PA 3KKPA 2H92A 1NLZA 4MRRA 4TMXA 3WRXC 3IUYA 3REFA 2IYSA 2KWIA 4TL9A 5FBQB 5KSYA 4PHGA 3EPKA 1P2UA 2JATA 1DO0A 5EP1A 4I1UA 1OH7A 4BWYA 2O8FA 1DADA 3B1WA 2DFKB 4MYTA 4W5HA 1G8YA 4R9UC 1ZUIA 4ZDIA 1OFIA 2ZR0A 3A8TA 1E2NA 3WYFA 4C0BA 2FGJA 2ZTSA 3U44B 3ZD6A 1DG3A 1G5PA 3KFXA 1TX4B 3DPUA 5CK5A 3B82A 4KFSA 1FNNA 3I5YA 4H1VA 4ARZB 2WJVA 4JYBA 3CRQA 4PR0A 5FFMA 4AG6A 5EQTA 5J4HA 2XZPA 1JECA 1G6HA 1Q1EA 1E2IA 4G3XA 3P20A 4LK2A 3LX8A 4TSFD 2JLYA 4I1VA 2N1BA 4Q9IA 3L82B 1Z3IX 3C8UA 4FD2A 1JPJA 4Q47A 4US2R 1JJVA 1E4YA 4QGHA 3TKLA 2NIPA 3WXMA 4BRWA 4LSGA 5BN5A 1JQJC 4TTRA 4RD1A 1FUUA 1QDEA 2JJ1A 3GD7A 4Q4HB 4HZUB 1TPZA 1Z0AA 2GDJA 2XTMA 3KFVA 4B32A 2VRWA 4WZ6A 4AK9A 2IS2A 1G8HA 5FTLA 3UMRA 2J7PA 5C46F 1Y63A 3MCAA 2IEZA 3RSLA 2RGDA 2D06A 4QBIA 1W44A 3AVPA 1E2DA 1UBGA 3AKDA 1S3GA 4TMVA 1R5OA 4RCZA 1ZM4A 3EIEA 3Q7PA 5L3QA 2O8DB 4F4IA 1LF5A 2GXQA 2YOFA 4LYFA 2XSZD 4W9MC 1E6CA 1OHHA 4O2LA 3WYAA 2QE7A 1N25A 4DCTA 1OFTA 2IXFA 2W00A 2PX0A 3SN6A 2BBOA 1G3IA 2F1RA 2QAGB 4MITA 2AN9A 4PC6A 4ZPXA 5KDOA 1S2MA 1AGRA 2MSEB 4LHWA 2IYRA 3OEHD 1ZMXA 3K70C 4KU4A 5FL7A 4TQUS 1COWD 1G6OA 3ZGXA 1QZXA 3EZ7A 1S96A 2NO6A 3KQLA 4OBEA 3U3KA 3UANA 1S1MA 3QF7A 4OQMA 4ZKDA 3THXA 1F6BA 1W4CA 4L9SA 1G3RA 2CCKA 5DISB 4AYTA 4FMCB 4DLSA 5KPDA 2R62A 2O0JA 3C41J 5KNCA 1XXHA 2A5JA 3CNLA 4JVSB 4NONA 5LD2C 1E0SA 2CVHA 3FOZA 3PR1A 1P4SA 3T1QA 3AKEA 4YONB 1F48A 4JLPA 1KI9A 1OKKD 1CR1A 1NIJA 4FIDA 3LFUA 4LHVA 2GJKA 4B6FA 2GCPA 4LJ9A 3PV0A 1XB2A 1NY5A 2YWFA 1CBUA 2J0SA 5AWFC 1N5KA 1KDRA 1CJKC 1YZKA 3QXJA 3FMOB 5IK2A 3B9QA 1RRGA 1OXUA 2Q6TA 5FTMA 5AJVB 4XJXA 3BBPA 4EQ6B 2VLIA 4EUNA 3I61A 3B5JA 4XSGA 3TIFA 3U5ZB 2WICA 1Z8FA 1E1RD 2WKRA 5E3HA 4KLNA 1HEIA 3RC3A 4HAYA 4WOPA 4GL2A 1QBKC 3NG1A 2GK7A 5FUYA 2P5SA 2ZR9A 1YR7A 5EE9A 1OH5A 4WW0A 5CDFE 2ZUCA 1JAIA 3ZVRA 4IKEA 4JJKA 2FE4A 3I1FA 4O2RA 4RD0A 4DLVA 1KI1A 4KHZA 4FW9A 4A9AA 1E2GA 1T4GA 3I92A 4ZDKA 3THYA 1T8TA 3IHLA 3P4YA 2X77A 5C2JB 2R44A 4PHHA 3O8BA 1AGPA 4PPFA 1M74A 4MUBA 3CWZA 4RY2A 4Q48A 3RS5A 2VHCA 1EFTA 1Z08A 2ZU6A 4PAQA 1GUAA 3WP0A 4UNRA 5DN6A 2VF7A 4E5UA 5KHOC 3SQXA 3K70B 2KBEA 4LI0A 3DOEA 5C4GB 1H8HA 4MYUA 3QY0A 3IBYA 2WAXA 3KTAA 3QVUA 4ABYA 5JZVA 4I99A 3OZXA 2BVNA 1KO1A 4RVCA 2DFTA 2QSYA 4HB4A 5HTKA 2ZJ5A 3Q7QA 1W1WA 1HA3A 5CJPA 4OI2A 3NHAA 3U4QA 3KZ1E 2PLRA 2WJYA 2ZQ5A 4LCBA 1QRAA 5LD2B 4HB2A 2O52A 1WXQA 1UBEA 2IHYA 3PUYA 2HCBA 1SGWA 2OE2A 2AFIE 1FMJA 3ZIAA 2O8FB 2QM8A 2ATVA 1L4UA 4BE7B 5TMPA 5B64A 3SZRA 1FFHA 2YKGA 4HAZA 1XJCA 2CL7X 4HB0A 2B21A 1P60A 3TJZA 4CZ2A 4GFDA 2ERYA 1GKUB 3DEFA 3GMTA 2OESA 5TDHA 4ACBA 2PT5A 1NY6A 1G5RA 1QHXA 3EIQA 3OFND 4QNMA 5FBRB 4KBFA 4H9GA 2Z5FA 4HI0E 4DCSA 5JLJA 1UEIA 3CUEF 2UKDA 1KZGB 2OFWA 2CXXA 3KJEA 2X8AA 4YMUA 4B3BA 1T9HA 5IK2D 5ELXA 1JNYA 3L2OB 4TLAA 1G7RA 4DEYA 2QAJA 3AF1A 4NBSA 5JI3E 2A7QA 3IQXA 3MWKA 3RRMA 2JEOA 1XX6A 3AF4A 1KZ7B 5FPTA 3CZPA 1JB1A 3T1VA 2HUPA 1YZLA 4Q4JA 2VO1A 5SZIA 5FUWA 2C9OA 1C9KA 4ILEA 4A2WA 2OFXA 6Q21A 2WKPA 1NIPA 2ZRFA 2GJ9A 3DZDA 3W3AA 2ZRHA 4C0SA 4EPXA 2O0HA 2PT7A 4WXPA 1F5NA 1IY2A 3TLXA 1G3QA 1Z5ZA 1ZP6A 3PQCA 1G8GA 4G5SA 4QJ3A 1HT2E 5FR2A 2W83A 3LXXA 5L3QB 3THWA 1PV4A 2BMDA 2ZPTX 3KX2A 3K9HA 2YYZA 2ZEJA 3OAAA 3BFVA 3B85A 5JRZA 2W6ID 1JAHA 1L7VC 1XBTA 1X8JA 4A15A 1UADA 1NLFA 4AKHA 2FFQA 4CW7A 2ZS8A 3L43A 5AUNB 4TTPA 1OLOA 3OHMA 2X19A 3HU2A 2PZFA 3U7FB 3BERA 2IS1A 1TEVA 1T91A 3RRZA 1GRNA 5E4FA 4C0AC 4II7A 2HLDA 2A5GA 2GESA 2YC4C 1KK3A 2MSCB 1YJ5A 3THXB 1KDOA 1X8LA 5AJYA 2XTZA 1OB2A 1I4LD 2GJAA 2D7DA 5FBLB 3ZIAD 1XXHB 1ETUA 2YC2C 4URZR 2KB0A 4HLUA 4LBWA 1MH1A 5K8TA 2ZANA 4XWOA 1FW6A 3G82C 1UKYA 1G291 3B13B 5CB6A 5CDFA 1VG1A 4NYJQ 2C9YA 3IEUA 1FL9A 4GRAA 3W90A 3I73A 2O8EA 1JR3E 1G3MA 1ZCAA 4P0TA 2OAP1 2ZSFA 2JJ2D 4CDGA 2FPKA 3QF4A 1ZUHA 4X8OA 1XZPA 3B1XA 3ZH9B 3SJZA 5TARA 1KO5A 4AYWA 4GT1A 3OE7D 2IF0A 1M8PA 1IJFA 3X1YA 4URUR 4URXR 1NMYA 1DAEA 1X8KA 5C4MA 3T1TA 5JSZA 4A6XA 1Q1BA 2QBYA 3HYTA 1MKYA 4DSOA 1VYTA 1AZTA 2LCFA 1XEWY 3LLUA 1NI3A 1XMIA 1EXMA 4FI3C 1KMHA 4DEXA 3ZQJA 3SYKA 5KDDA 3V9PA 2ZJAA 1SHZA 2PJZA 4Q1CA 4PFSA 3AB3A 2CHQA 2F9LA 1KOFA 1QHIA 4IOJA 4JBYA 3SBDA 2FOLA 2QP3A 3Q8XB 1SKYE 2P6NA 1N6OA 4U7DA 3G5UA 4KODA 2IS4A 1XPOA 2KJQA 1GITA 3KJIA 3A58B 4OK6A 1FMLA 4L8GA 4Q00A 1IY1A 5L3RA 1E9FA 3ETLA 2FX3A 3D31A 4ASUA 4DLTA 5L8VA 2E87A 1KI3A 4QKQA 2WMOB 4OI0A 4GMXA 2A9KA 2ASEA 2IYXA 1LS1A 2FFHA 3RS2A 3UMFA 2GXUA 3KTAB 4V0OA 4B74A 2RGEA 4CT5A 3PJRA 1QHNA 5EZ5A 4LWZA 2FDCA 4O25A 4QM6A 3LDAA 3R20A 4C0KA 2DBYA 3P26A 2J5XA 1M7BA 3NC1C 4PPNA 3V4RA 2G9NA 4C3ZA 4AI6A 4BUJA 3U4QB 3F5FA 2HLDD 3PUWA 2Q3MA 3CRVA 4GZLA 4AURA 3BJIC 1VMAA 1E0JA 4RSGA 1R2QA 3C16C 1ELOA 3DZ8A 4BECA 4B3GA 1RJ9A 2RKOA 3WNCA 3LA6A 3RS4A 1AQYA 1IN8A 2ORIA 2YINC 1OH6A 5F9FA 3OIWA 4Q1EA 5CYPA 1N6KA 4LYJA 3CIOA 1P5ZB 1U99A 2GVZC 3EWSA 4HLUC 4UNQA 1OXSC 4Q21A 2OLKA 4IW3B 1H8ED 2NO1A 2FMXA 4QNRA 5JWRA 1KI8A 4IOLA 2ZRNA 5DHAA 4B47A 1XD9A 1U81A 2LKDA 1KIMA 3T35A 2GNOA 2R6GA 1R8QA 1VCIA 5D3MA 1OB5A 1NG9A 2C96A 1E79A 3AEZA 4J0QA 4PAOA 3SYLA 3T61A 1A2BA 4A2PA 3U3JA 3W6NA 3BFKA 3AVWA 2VSOA 5G53C 4EFMA 3KXKA 5GVSA 1KHTA 1FQJA 2RCNA 2W2XA 3GLGE 5TXGA 4Q4JB 4S35A 2FZLA 4P3YA 4DWJA 5GJBA 4HDOB 4TMWA 1NKSA 2AR7A 4JLJA 3WYGA 2AKAB 4IFBA 2CLSA 4R98A 3E2IA 3KQKA 1SVLA 1KYIA 3N2EA 5K8UA 1M7GA 3ZS9A 1QHHB 1TEXA 1JXMA 2B6HA 5KYKA 4B3FX 1N6HA 4FCVA 4TLBA 4D0LB 1QVRA 4QHSA 2VA8A 4BFSA 3THWB 2BJVA 3WMFA 2ERXA 1DARA 2ZI7A 1DAFA 2BKEA 2QZ4A 1YZNA 3B1ZA 2UZ3A 1QHYA 1OSNA 4DIEA 4Q02A 1T3LA 1E2HA 4KV9A 2P0EA 1E9CA 3C4JA 2JLVA 2FU5C 1KSHA 4WA7A 4Q1BA 3SJAA 4MQBA 4CEJA 2WOOA 1U8ZA 2ZSDA 2ZJ2A 2ORWA 1E2LA 2YOGA 1XTIA 4JBXA 1AZSC 1SVKA 1U8AA 3CPEA 2CK3A 4BLSA 3NEYA 2C8VA 3GJXC 2P3SA 2PLFA 4D2IA 4MKFA 1W0JD 2R6DA 4P31A 1KNXA 1SVIA 1CIPA 2ANBA 5EJEA 5J4LA 1LV7A 1CKEA 2CNWD 1GRRA 2IYVA 2DFLA 1R5NA 2WPDA 1GVNB 2WTUA 2IUTA 2FWRA 2C9CA 1IJEA 1N6LA 2WSMA 3EXAA 1E3MA 2B7CA 4OKSA 2OXRA 4DUGD 5FPHA 5EXTA 1CRPA 1A7JA 4A8JA 5DYGA 2VP6A 4DDTA 2O8EB 2OV2A 5J4KA 2ZRPA 3CF2A 3CR7A 4K46A 1TL7C 3GEEA 1XF9A 4LPKA 4BZPA 1YR6A 3D7MA 3QF4B 3VQTA 4QGFA 1LFDB 4LZZA 4FINA 1JR6A 1Z29A 2RGXA 1K8RA 5CLQA 3Q85A 3BORA 2BJWA 3KXLA 1W46A 4LJYA 4OHVA 4TT3D 4CF7A 1LW7A 2AXPA 2HXSA 5JSZB 2QBYB 1E9BA 1GL7A 2CE2X 1ESMA 5DO9A 1FP7A 1GKIA 2OM2A 1RIFA 1WB9A 2OCYC 2XNDD 3PUXA 4H1UA 1D2EA 2NO7A 1NVWQ 4O0MA 5FPKA 2ZS9A 1GZSA 1KMHB 4DT1A 3NDPA 3UK6A 2AHOA 4PC1A 1VYVA 3NKVA 3LXRA 1Q3TA 3NBYC 4LV8B 4NCHA 4DLRA 4YQFA 4UJ5A 1FOEB 4G5QA 1NN1A 4GZMA 2RHDA 1N2CE 4UXIA 4B76A 4DSTA 5IF9A 2FFBA 1XCGB 2V9PA 2QI9C 5UKDA 3TUJC 4Q4AA 4XWKA 3AUXA 4B2LA 4LJ8A 3RANA 4EDHA 621PA 2HDNB 4TSFA 1ODFA 2OHFA 5DHFA 4FMDF 2NTYC 2ZRIA 1S0UA 1WBDA 4LYHA 5EP4A 1PZNA 1Z0IA 2PEYA 2HYIC 1OF1A 1P3JA 3VFDA 4C7OA 3BD9A 3IIMA 3MUFA 2Z4RA 3AF0A 4IDPA 5C18A 2O8BB 1RPZA 1BIFA 3ZVLA 1YRAA 4B73A 3IPXA 1XRJA 5EP3A 1RRCA 5D3QA 1OT3A 4Z1MD 2RMKA 5FOVA 4BRUA 3RLFA 5EE1A 1M6NA 4F38A 4NYIR 2VHUA 1IXRC 3GLGA 4NMMA 4ZDWA 4NE2A 3QI2A 4ZI2A 3U6KA 4IVRA 2PEZA 1RFLA 4IOMA 1TUIA 1V5WA 2XJ9A 3T06B 1EWQA 1KY3A 1JJ7A 4MKHA 4O3MA 1OPXA 1RJ9B 2G88A 4QHTA 3RHFA 2OBMA 1SHKA 1EFCA 4M1SA 4EIWA 3AM1A 2ZSBA 2XSZA 1KNQA 5HZKA 4F92B 3LQRA 3MLEA 4V03A 4YMVA 721PA 3S1AA 1BKDR 5F98A 1WMSA 2Z0MA 3LD9A 3QEOA 3BH7A 4I4LA 5GVRA 3A4LA 2F43B 2XOKD 3D6TB 3GJ5A 4MRVA 3LAWA 2I1VB 3OEHA 5KO2A 4A8JC 4LOAA 2XNSA 2WIBA 2GEUA 1Q44A 1KSGA 5D3MB 1COWA 4KSBA 3AVOA 4LJAA 1SVMA 1S9DA 3AVQA 4PO1A 4PX9A 2G77B 3GQBA 2AFHE 1XTQA 4QGAA 1XU4A 1C4OA 2VHTA 2BCGY 3K9LA 2Q21A 1KKLA 2QY9A 1P9NA 3CPJB 3K9NA 4BFTA 4C2UA 3VKGA 1T5LA 3Q5EA 1LVGA 2OXCA 3BWDD 1SVOA 1UKEA 2QP9X 5JEEA 3AVUA 1IBRA 3X1ZA 4C0JA 4IXNA 5CIQA 1GG2A 4Z54A 4ZKEA 2GK6A 3ASZA 4Q03A 3IHWA 4HB3A 5BYKA 1OKKA 1KK2A 2D62A 1TQDA 2O8CB 3JVUA 4MH0R 2VQSA 4ZO4A 1E96A 1G21E 1VDZA 2CDNA 2J7KA 2RHMA 1W2GA 4QBHA 1ZINA 3EAQA 4IVQA 1A5TA 5J47A 4GI7A 5DI3A 1W7AA 4JZKA 1MRNA 1ZAKA 2IYZA 1SXJD 4LC0A 2QMUA 3MG9A 3MFYA 3SNHA 1QF9A 3B1YA 2P65A 4RZXA 2NPFA 2V4ZA 2JGNA 1W48A 4XTCS 3TGPA 1E2JA 2WJJA 1E1RA 2EVWX 4DLWA 4A92A 1HYQA 5KSPA 5E7MA 1TAGA 4CEJB 4MRSA 2CJWB 1WCV1 2MSDB 4TQAA 2DWQA 3CH4B 1I2DA 1P2TA 5BYJA 2GJSA 5HPYB 2BM1A 5KNBA 1Z6GA 4QJ4A 3ZLJA 2RGAA 2W2VA 3M1IA 2WKQA 4XVQA 3VX3A 4HDCA 2P6RA 1C1YA 2RAPA 1G41A 4F4JA 4A1FA 1U90A 2EFHB 1GL9B 4E22A 3ZS8A 4ESHA 2OLJA 2A78A 1KO7A 3BS4A 4CGZA 2ZE7A 2WJGA 5M04A 3FMIA 1WE2A 5EXXA 3DMDA 4M0LA 4W7SA 1SKYB 4A8JB 3FKSD 2FFAA 2XGJA 4JSYA 5IHPA 3HR8A 2JCSA 2G0NA 1T3SA 4ZCLA 5DH9A 4IRUB 1NVXQ 4AG5A 2DCUA 1E94E 3RRNA 1E2QA 1H65A 2D2FA 3TW4A 3EPHA 1EFRD 3A36A 1OE0A 4D0GA 4QFMA 1UDWA 3NHBA 4WVFA 1XTRA 3VTKA 1UAAA 1ZM2A 2ZI5A 3HP1A 1G17A 5KDLA 3UPUA 1HY3A 2F1HA 4DT1B 5BN4A 3U7EB 3O8DA 3ZVMA 3A4NA 3X1XA 3GFTA 3I4LA 3CX6A 2J59A 1IXSB 1WA5A 4EPTA 1Z83A 4IEIA 1Z6YA 2ZRKA 4TYPA 3SE0A 4BLTA 1UFQA 4LBZA 2YVUA 4B2IA 4LHZA 1CLUA 1MO3A 1LF0A 3ADCA 2FEMA 1P75A 1U0JA 3OFNA 3CH5A 1TTTA 4KLZA 1Y3AA 4Q4AB 1P2SA 3IILA 5CM8B 5HZHA 1EX6A 2R6AA 2KI5A 3L0IB 4IVPA 4IHQA 1RC8A 3UG6A 2RGGA 2AL7A 1IN5A 2ZRAA 4OQNA 2VTKA 1II9A 2VHQA 4HUTA 5GJVC 4C7OB 4PO9A 2ZITA 1E2MA 1Z2CA 2TMKA 4LGMA 5FOSA 3IQWA 3EPJA 3QUSA 5J40A 2ONJA 2V1XA 2X2FA 5F9HA 2ODWA 2C04A 2FSFA 2QEQA 4JLKA 5EE0A 2OUKA 1ONBA 2IYWA 3A6PC 1EWRA 4L9WA 4QOSA 4X8MA 2CBZA 3CZQA 3GPLA 3GLGB 1KI2A 3CLVA 5HE9A 5K8LA 4DB2A 3VNUA 2JASA 1VIYA 3Q9LA 3QKSA 4HYYA 3GJ0A 3M0EA 1KK1A 1YE8A 4QC2A 1AA9A 4DLYA 4S2EA 2WWFA 1U8YA 4GOJA 5FOWA 2ZSEA 2W6IA 2EQBA 4GOXA 3FFBA 2QP4A 3S1AB 4Q7MB 2EW1A 3TSWA 1E4VA 1BYUA 2PJRA 1NN0A 5BQ5A 2GBLA 4B33A 1RYFA 4RD4A 1AS2A 4HZIA 3VNVA 2IYTA 1II8A 4M4SA 2GAOA 1IHUA 1CR2A 4XH9B 3TQCA 3FHTA 1NF3A 3D3QA 1U2RA 3R9XA 4PTLA 1KDTA 4I1SA 2N46A 1LS6A 2ZUBA 2F3RA 1W4BA 4OJKA 4Z51A 4KYIB 5C1BA 1IN6A 1HQCA 1Z0FA 4UKDA 1UM8A 3RS0A 4V0KA 1ZC4A 3KUCA 3U2QA 4DZZA 3TUZC 3QKRA 3TH5A 2ONKA 4PQYA 4A36A 4JIMA 3MMPA 4BASA 1GILA 2J3EA 2IF2A 3TW8B 4AY2A 1Q3HA 3WMEA 2FPMA 5AUPB 1AM4D 2GCNA 3AUYA 4UXHA 5AJZA 1D6JA 3R8CA 2JJ2A 1M7HA 3K1JA 3ZDQA 3R9WA 3M4YA 1Q0UA 2J46A 4NHOA 5DI3B 4DRZA 3LW8A 4BFZA 2QSZA 3QBTA 4HUQA 1RRFA 3OE7A 4BEJA 3LX5A 4C4PA 3BOSA 3EC2A 1ZU5A 2FSHA 1EFHA 2QMHA 2P2LA 1TUEA 1OH8A 2QM7A 2K5UA 4UNSA 1M34E 4C30A 1NBMD 2CMKA 2ATXA 4V0LA 1ZD9A 2IYYA 4CRWB 4XD7D 4I1OA 1E9RA 2WSSD 4Q9KA 4KAXA 5KOYA 2QN6A 2VL7A 2IWHA 5BW8A 4Q9HA 1IN7A 1OYWA 3W34A 1XJQA 1UBCA 2XB2A 1SZPA 1OIWA 2QUZA 3EIHA 4GPTA 2H7VA 4Y0AA 2EFCB 3UG7A 1YHNA 1R0ZA 2W2TA 3UMSA 2WBLC 4A4DA 1KAGA 1B23P 2P5TB 2R6FA 3OIUA 1DG1G 5J5CA 3ZVNA 2W6JD 4QM7A 1Q12A 4XWAA 3A37A 4TMTA 3A1VA 3H84A 3KB1A 3CR8A 3D8BA 2REXB 5JECA 4IDOA 3RABA 3ADKA 4B48A 3VR6A 4IDQA 4JVNA 1ZW6A 2ZIAA 3HR7A 3I3SR 1GIAA 4Q7KA 3X1WA 4HLCA 1ZUNB 2PCLA 4XIGS 4R2HA 1TQ4A 2LWIA 4KSCA 4A0FA 1P61B 4EPVA 4D4JA 2QPOA 4B3CA 1HH4A 2C03A 3BC1A 1J8MF 1TMKA 3L0PA 2V55B 3P27A 5A0FA 3LW7A 3LY5A 4BLQA 4TYNA 3K0EA 1KK0A 4LV5B 1D2NA 3NBFA 3CX7A 2D74A 5A5GA 3PIRA 4U02A 3T1OA 1N0UA 4OI1A 5BXQC 2I4IA 3K0SA 3C7KA 5HCIA 3TAHA 2QPTA 2OT3B 5KPJA 2RB4A 5KNDA 3T34A 4Q19A 4DJTA 2J0UA 4G1UC 1H8EA 2QQ0A 1NL3A 4JLDA 1O87A 4OI4A 1V43A 3B60A 2A5DA 4DCNA 1RE0A 4B71A 1W5TA 5P21A 1KTVA 5CIWA 2WVJA 4FMCF 3SU8A 3PCRB 4AKEA 1QHSA 3TNFA 1Q57A 4LHYA 1BH2A 2HJVA 1F2TA 2I1QA 3W8RA 4KO8A 4JYCA 4L15A 2IL1A 3DMNA 5FOUA 1G3UA 1UDXA 2QRNA 4YXWD 1KI4A 2V7QA 5LDDC 4GP6A 4RJLA 2QTFA 1XPRA 4XSHA 4NZYA 3VR5A 2EFEB 2GRJA 4L5BA 2GILA 5L3SA 2RGBA 3CNNA 5JS8A 2ZVQX 3LBHA 1N5IA 4DCVA 3QKSB 3SYNA 2AXNA 2G1JA 2WM9B 3TRFA 3THYB 3TR0A 4DLUA 4WBSA 2WOJA 1YVDA 3GJ3A 2O5VA 4BPBA 3ZQ6A 3NEJA 4ERNA 2JLUA 2EFGA 1KJZA 1Z6XA 3OIYA 3PXGA 1A1VA 2H17A 2GJ8A 1G9XA 1GP2A 1E9EA 3BB1A 4C0QC 3L8ZA 4MGZR 1XTSA 5HCNA 3WHKA 1J70A 4V0ME 3REGA 3OIVA 1DAMA 3C14C 3DKVA 1II8B 1HURA 221PA 4RFSA 2PH1A 1TADA 5H70A 3V4FA 4IEEA 5FTKA 3NWJA 5JS7A 1W0JA 3CW2A 2ZSAA 1P9RA 1IM2A 2IEYA 1N5JA 5LB2A 3PITA 1DVRA 2QT1A 2Z83A 3K8YA 2G83A 4FXPA 1NJFA 2CNWA 3MJRA 1UPTA 3EW9A 1K5GA 3K0AA 1DOAA 2NQ2C 3TAUA 2OEPA 5H8WA 2R65A 3VU9A 1QG4A 1NVVR 3QKRB 4TL7A 1I4TD 4DUGA 2V8OA 8OHMA 2PZEA 1II0A 1T3HA 1N0WA 2BIFA 2WJIA 1SXJE 3CBQA 3SDZA 2VP9A 3VR4A 3DDCA 4MDEA 4NYIQ 2QTVB 1T6NA 1E2FA 4RZUA 4D4MA 1HQYE 4U00A 1R4AA 2AD1A 2CL0X 3RDPA 2ZAOA 3FGNA 4P4UA 3BH6A 4EFNA 3IIJA 1U98A 4HUQB 1HV8A 4E03A 2PBRA 1DO2A 1TU4A 3DOFA 4PC7A 1XEXA 2VPPA 2H8KA 1OFUX 2HJGA 2X2EA 4TT3A 2HEIA 1LTQA 4ZIRA 4M1WA 1F3OA 2VBCA 2VSFA 3QVVA 421PA 3TVTA 2QGNA 3CWQA 2QPAA 1KSFX 1G64A 1NRJB 2V7QD 2XNDA 5LB4A 3WHLA 3QG1A 3CNOA 4KFUA 4OL0A 4LYAA 3ASYA 4EPRA 4M53A 3V00A 3TVDA 1YZGA 1I2MA 2NMVA 5HKKD 1ZNYA 1E0AA 2ZI9A 1Z0DA 2GEVA 2IYLD 2VP0A 2D4HA 2GHIA 5B57C 3RNLA 3MWLA 3BFXA 3F8TA 1ZD1A 1DTSA 2JLWA 1G18A 2ZI6A 2ZM5A 3PFIA 3N70A 4FN5A 2IXEA 3MJHA 4JVLA 3QPWA 4PANA 4JLNA 4G5RA 1E9SA 2HT6A 3Q3JB 4NCNA 2FSIA 3VMFA 1Q22A 5FI0B 1W4AA 3IIKA 3KXIA 3I32A 3J81k 4B34A 4EPYA 4OK5A 1BYIA 2DWPA 1E99A 4KYUA 4OK3A 2KBFA 3GFPA 2FNAA 3I8XA 4OHZA 2ZJOA 3A1SA 3FTQA 3UWKA 4Q9LA 3U6BA 4FMBB 1W36D 3KQNA 1J90A 1IONA 2UVQA 2ZRDA 4Z1MA 3B1VA 1CR0A 3MGCA 5AUQA 3CRW1 5EUMA 4U5XA 2ZETA 1OXVA 1Z22A 4F7WA 1N6PA 2VP5A 4JS0A 2REBA 4RKEA 2JIZD 4PZYA 1W2HA 3EA0A 3GP8A 1UKZA 4ZCMA 4XVUA 2CE7A 3C5HA 1KKMA 4BZQA 1P6XA 1RW4A 4HZUA 4JJZA 1OXTA 1E9AA 1YR9A 1US8A 3GJ8A 4PQRA 3U3OA 2C77A 2J0UB 2JDID 2BEJA 4N0DA 2J0VA 3L0SA 5EE5B 1XTJA 5CK4A 4NCKA 2OCAA 1NLYA 2XOKA 4OQFA 2C95A 4BLPA 4DDVA 4M21A 3C5CA 3QEJA 5FUXA 3F0TA 3ICEA 1W0KD 3BK7A 3NBXX 3FB4A 4URVR 4DIDA 1G4AE 3CRRA 3GLHE 2DYKA 2B7BA 4RCYA 5ANRB 2C99A 1RVDA 1OYYA 2IHBA 1F2TB 3B78A 4NP6A 3NH9A 4OHWA 4V0MA 5IDVA 1EG7A 2DWOA 4A0HA 1JALA 1K5DA 1NP6A 1VG8A 1YRBA 3DL0A 3TK1A 4QHYA 1IN4A 2GCOA 3U7HB 1NVUQ 1F2UA 4HLQB 1GM5A 2BC9A 2E1RA 5TY0A 1P73A 1VKJA 1Q1QA 1R0XA 2HYDA 5L3SB 3WP1B 2WWWA 1G19A 4QRHA 1G7CA 2ZRMA 1W49A 5TV2A 2QMEA 1AS0A 1NN3A 1T0HB 2OSBA 4K81B 3P1JA 1JI0A 1GOTA 1HE1C 3E70C 3ZD7A 2ZI3A 3QKUA 3K9GA 4DSUA 2KSQA 3GLIE 2AWNA 2JLSA 4GDFA 4NH0A 4YMWA 3O8RA 1SXJA 5H1YA 3AP3A 4OYHA 5LBIA 5F3WB 2F1JA 5FPSA 5GJCA 4QBGB 4LHXA 2Y8EA 3DKPA 3NVAA 4Q01A 2G0TA 3GJ4A 2VH5R 1J2JA 2NO9A 4DC9A 2CHVA 5J4YA 3QNUA 3OF5A 1BMFD 2CLCX 2VHJA 1Q20A 1PVOA 4RFSB 2DR3A 4JKIA 3VR3A 3ZYCA 3PEWA 2JAQA 1MO4A 1XFAA 4MGIR 1Z6AA 1E32A 1E1QD 2WJHA 1WRBA 1AIPA 2OZEA 2ZR7A 3NTUA 2C98A 5DI9A 4MDFA 1IAQA 4JL5A 3HU1A 2ZJYA 3RRYA 1FPMA 4TL6A 4Q7JB 3VU9B 5AR1A 3VKHA 1XEWX 4UJ3A 3LVRE 1A4RA 4OHYA 1NSFA 1AJEA 1U94A 3BB3A 4NYMR 1E98A 3GFOA 3FKSA 3BE4A 4NCIA 3WRYC 1IXZA 5FUVA 4R71A 2FJUA 4GOKA 1QVAA 1E9DA 1GNRA 1NBME 2F7SA 1JBKA 1N3BA 4D81A 3QJYA 4GSYA 4ESVA 1G1MA 3FWYA 4B6EA 1T5IA 5SZJA 4G01B 3X2SA 3EZ2A 3ZZUA 4M22A 2WWHA 4HSEA 4R2IA 4AIIA 1WF3A 4PPGA 3QQ5A 3VX4A 3OESA 3RWOA 1EFRA 3JZMA 2XXAA 2BMJA 3JVVA 4ZIRB 1SULA 1FZQA 1OW3B 4MYHA 1J7KA 1ZNWA 2FH5B 1R5BA 3KUDA 4BFWA 3QSYA 3ZZ0A 2ZRLA 4FCTA 3SBEA 2W58A 3I72A 4ZDJA 2V6IA 1NNEA 1FTNA 1PUIA 1AS3A 1VYUA 2WHXA 3BAFA 4LJ6A 4LC1A 1SKQA 4DHEA 2PMKA 1D5CA 5BN3A 1Q21A 5F2EA 2RH5A 2AX4A 5K8IA 1QHGA 1ESNA 2W0SA 3OEED 1GRQA 1XZQA 3K0CA 3EZ9A 4A2QA 2VEDA 2XAUA 1BOFA 3IGFA 4AKIA 3QXXA 4XVRA 2B92A 2GAAA 4NPHA 3KJGA 4US0R 2E9SA 4YMTA 1X6VA 3W5IA 1SXJC 3EARA 3AF2A 3VKWA 1ZCBA 2IW3A 4TLCA 2GEDA 2V1UA 2ZYVX 4B75A 5DNYB 1VHLA 2GZHA 3KKOA 2YZ2A 3LBIA 3U3MA 4OQXA 4JLOA 3GLFE 1Z07A 3GLHA 1D9XA 2ZU0C 2EYUA 2H1LA 1OFHA 3SFZA 4CYMA 3WBJA 1NMXA 3KKMA 2I3BA 2D3WA 3GEHA 3IEVA 3L0OA 5E7JA 4DBLC 3CO5A 3R7WA 3AP1A 5JJIA 2J1LA 3AQ4A 1XMSA 2G1KA 4M1YA 1NJGA 4BFXA 1Z0JA 4LDJA 2BV3A 3BIFA 3EA5A 2RGCA 4LJ4A 3VR1A 5JRJA 4JT2A 3E5HA 2FZ4A 4ZCIA 1N0VC 2WAYA 3FFAA 3GJ7A 4YMSA 3F3YA 1DE0A 4BFYA 1EX7A 1W5SA 1US8B 2JLRA 2ZROA 4BLRA 3BB4A 1OXXK 1XD2A 1VCNA 4LV6A 3FMFA 3SJCA 4Q1AA 1KJYA 5JFGA 5TVKA 4BLOA 2R6CA 3GLIA 4MKGA 2XTNA 3HWSA 3ND8A 2WWXA 1Z0KA 4MGYR 4BZXA 1MO6A 3SJBA 2A5YB 4C0LA 5FOTA 2OG2A 1RRPA 4PC3A 4RD2A 3UWOA 4BEBA 4IXMA 5JEDA 2CHGA 1DBSA 3I8SA 3I62A 1CJTC 4RZ3A 1JPNA 2BBWA 5TB5A 2IXGA 3K70D 1VCOA 1S8FA 3KQUA 4M1OA 1CJUC 2GCOB 2QORA 4RD6A 5CJ2A 1VECA 1F2UB 3FE2A 3HYRA 1TQ6A 4IFEA 1OV4A 3CF6R 1ZM9A 2OO7A 2IT1A 4URYR 1FNMA 4P33A 4NU0A 1MO5A 1AKEA 1Z28A 2FV8A 1KO4A 3KJHA 4F91B 4Q1DA 4HAWA 2C78A 2QRZA 1CJVC 5EXSA 3THOA 1NN5A 2F6RA 5FR1A 1ZD8A 1SXJB 4I81A 2JA1A 2OCPA 1NMZA 4JL8A 2ZRGA 3K0CC 4EFLA 4M2LA 2B8TA 1VCMA 1XWIA 1NKTA 1NBMA 1DELA 1ANKA 1IY0A 2CCGA 5JHGB 4CEHA 4CT4B 4L4UA 2P67A 4MKIA 2ZS7A 1MOZA 4XD7A 2FEOA 2QENA 3QXCA 2WSSA 1YKSA 2BEKA 1GNQA 2IYUA 1D2MA 5FTJA 1ZYUA 2QA5A 5IT5A 1U9IA 1Z63A 3EASA 3EC1A 2CEAA 1VPLA 2NO0A 4MUAA 4RZ2A 3LV8A 3MRSA 2C5LA 2ZE6A 1XD8A 5JI2E 4UNNA 1GDDA 2Q9BA 4E07A 3ZZTA 2V54A 2A5FA 2MMCA 1E0KA 2IC5A 2JJ1D 2ODNA 3GEIA 4PHFA 4EKDA 2Q3HA 2ZRBA 5JCPA 4KITB 1SVSA 2W6JA 4IOKA 1L8QA 3SHFA 2ZJZA 1XCMA 3K0FA 2J7PD 4PZZA 5FBVB 2Q3FA 1ZM7A 2RGNA 3HU3A 3CB4A 1CP2A 5JCZA 4AYXA 4ON9A 2W0MA 4KBGA 4WZBE 3SFVA 3R8FA 1T8UA 4DVGA 1X1RA 1MR3F 2NZJA 2Q0HA 4M1TA 5JMTA 1NG1A 1VG9B 4URWR 4DLXA 2NZ8A 3P32A 3R9IA 1N6RA 4FWTA 2CL6X 1GTVA 2XXAB 2PL3A 3CONA 1OHHD 3IKJA 2QE7D 3C15C 4US1R 1A2KC 4RFVA 3W6PA 2WZQA 1E2KA 4Q5IA 1AQUA 3UATA 4PSAA 2GZDA 2XITA 5B58C 2ZE8A 1DEKA 1YU9A 2OBLA 3GLFA 3U7GA 5AK0A 4ZV4A 1FQKA 3SI7A 5FL7D 3NXSA 4DDWA 3I5XA 3P4XA 1XP8A 2ODBA 1P2VA 2BOVA 1CS4C 2J45A 5KU1A 4D80A 1HUQA 2R9VA 3FKQA 4PQFA 4LUCA 1S3SA 2ORVA 4JT4A 4DCUA 3ADDA 5CLLA 4A6PA 4QXAA 3ONWA 1NVVQ 1F60A 1K6MA 4POAA 2PZGA 2XEXA 1JQLB 1XNJA 3B2EA 3EZFA 4LBYA 1JXOA 2O0KA 2DPXA 2HF8A 1CRQA 4KXFB 2LKCA 1YZQA 3QKTA 4QBFA 1G5TA 4LJ7A 3H86A 3KKQA 1KI7A 4KI0A 4DDUA 3TSZA 4AKGA 2EFDB 1G20E 2ZRCA 4HAUA 4L16A 4V02A 4YXWA 1ZJ6A 2YWHA 2ZI4A 1YZUA 3FVQA 4WZAE 2N42A 4M9XA 1GSIA 2QMOA 2IX3A 4GP7A 3Q72A 3GLHB 3WNDA 2QG6A 1P7CA 2XJ4A 5CITA 4AWXA 2GVDC 2QROA 1UBFA 5EUQB 2A3RA 3R7WB 2DHRA 1CF4A 1KI6A 3DVLA 2ZAMA 5AJWA 1U9IC 1YQTA 3MSXA 4ACAA 1AN0A 2X1VA 1VHTA 1VTKA 4CEIA 2F1IA 3PENA 1O3YA 1CR4A 2QU8A 5FL3A 3SR0A 1G8PA 2GXSA 3LWNA 4TL8A 4A82A 3T5DA 4P32A 1FP6A 2OFOA 1XDBA 1ZM3A 2OCBA 1KO8A 1R7RA 4M8NE 4TLEA 1KGDA 5JWOA 1U0LA 1XD2B 1TQ2A 2ECKA 5EXPA 1QHHA 2ZXUA 1GWNA 4D26A 3GLIB 3A1TA 2HF9A 1DAGA 1ZIPA 3LQQA 2A2ZA 4X8LA 4JBWA 2GBLC 3IDQA 4Z8YA 2RGNC 4QG7A 1R0YA 1WP9A 3U61B 1MV5A 1Z2AA 4Q1FA 2IUUA 3VAAA 5DN6D 1PJRA 2YV5A 2ZVPX 2WMNB 4D6PA 2DFNA 4UXJA 2WWYA 2DY1A 2JLXA 1H8HD 1LNZA 3NC0C 5KSOA 3LLMA 1X86B 821PA 2BCJQ 4JLBA 4TQ9A 5CM9C 4A0RA 2QNRA 5DLQC 4F93B 4OHXA 2WIAA 1GKYA 2PMDA 4M9SA 3E1SA 5DGXA 1G7SA 1XTKA 5GJWC 1J99A 3TMKA 4TYWA 3L8YA 2EU8A 1WQ1R 2GF9A 3AF3A 4HEJA 2JLQA 3AVTA 1ZNXA 2H18A 3W5JA 2BBTA 2VP2A 2ZUDA 1FX0A 1DPFA 3ND9A 2BBSA 4TZ0A 2VF8A 3EPLA 2Z6VA 3CKLA 3AGQA 2C2HA 2H16A 2CVFA 3W8NA 3LBNA 5AUOB 1UF9A 5KUTA 4W5WA 3SOPA 4DSNA 4CEHB 4G5GA 4B3DA 1CTQA 3O8CA 3T15A 1M1YE 1XCPA 2QT0A 1D9ZA 1MT0A 4PHTA 4Q9JA 4P4TA 1UJ2A 3QPVA 3AKYA 4TN1A 3UXMA 3UKDA 4DKXA 3A4MA 3CX8A 3DHWC 4G5OA 5HKKA 1CJMA 2AD5A 2GZAA 4Q18A 2HXYA 1EGAA 5JHHB 1KJWA 1CEEA 3PVSA 1N5LA 2J41A 3DM5A 4P4SA 3TSOA 4B44A 4FWIB 4WAUA 5SZKB 4HLDA 3PEVA 1RZ3A 1TF2A 2EYQA 4FMDB 3NDBB 4D4LA 2YNMA 2HT1A 4ITRC 5DYIA 4TTQA 2A30A 3HPRA 2PCJA 1R10A 3RVBA 4GMDA 1L4YA 3K0FB 2NOAA 1IOZA 2XB4A 3QENA 1S1CA 4XOIA 4D82A 1ZIOA 4W5JA 4M1MA 4Y0VA 1UKVY 1AKYA 1OJLA 4D25A 1ZBDA 1XMVA 4DLZA 4KJZA 3BRWD 1R0WA 2FSGA 3EG5A 4OJQA 2ANCA 3CF0A 3OAAD 1DAIA 2AK2A 1MABA 3AKCA 3FPAA 4JLAA 1PLJA 1OIVA 1EK0A 1T0JB 2BKUA 2GKSA 3LVQE 5EE3A 4TWZA 4C0HA 1U0HC 4Q7LA 2YOHA 5B30A 2JIZA 3HPQA 3GLFB 2AK3A 4EJSA 4NTZA 3W9YA 2O8BA 3MWYW 3LO5A 3LNCA 1LY1A 2BHRA 3QG5A 2H57A 2IS6A 5A4JA 3AP2A 3SHWA 1GNPA 3TQFA 1M2OB 4CVNA 2VP4A 3A1UA 2REOA 4K8OA 4ZI3A 1G7TA 5DSZA 4IDHA 4V0NA 2JDIA 4N1AA 4R7ZA 2GETA 5FI1B 2BWJA 4M9QA 2MMGA 1P72A 2H5EA 4DB4A 2ZYTX 4AC9A 4N0EA 3AH8A 3RWMB 1G8FA 1P62B 2F9MA 4FCWA 3FHCB 2FG5A 1W0KA 3ZJYA 4MRNA 3B8HA 1SVWA 4NYMQ 1KDPA 1YZTA 4BFUA 1E2PA 1G16A 2XZLA 4MGKR 4NL4H 4CIDA 2Q9AA 1X1SA 4B35A 1DAHA 2V6JA 5GADl 1P9WA 1AK2A 2HCJB 3DO6A 4NKRA 5JJLA 5FBWB 4EPWA 4UQOA 2V3CC 3VHLB 2F3TA 3WNBA 5FH9A 2BM0A 2F43A 3UIEA 5E7IA 1FUKA 1N6IA 2FPLA 4LBVA 3TUIC 1L2TA 4D0NA 3PUVA 2Z4SA 1DAKA 2EWVA 2IK8A 2P6UA 4LY6A 2OAQ1 3QIAA 1KI6B 2D2EA 4HAVA 1D8TA 5H68A 3VR2A 2OILA 3K09A 1S9HA 2PX3A 1CXZA 5HE8A 3MWJA 3EZ6A 4MYCA 3TE6A 4JKYA 1WDTA 4EAQA 4CEIB 3HJNA 2ZJBA 1PUJA 4TLDA 3PG5A 3RS3A 2ZYWX 4YDSA 3U44A 4PO8A 4A0GA 1HT1E 2HV8A 5G3ZA 1NSTA 2VIIA 2O8CA 1TNDA 5FTNA 1VG0B 4X8HA 1BMFA 4LRWA 3HDTA 3RC8A 3CPHA 3GJ6A 4GNKA 4ARZA 3M6AA 1TU3A 2YJTD 2YWEA 3W6OA 3KKNA 4IDNA 4KVGA 5LPNA 4PSVA 5JBQA 2IYQA 4TZ6A 3SC3A 2AKYA 4ASUD 1E1QA 4LJ5A 1W47A 2J0QA 1W36C 4PZLA 2QL6A 4AD8A 1R6BX 2QTHA 1SQ5A 4QL3A 1WBBA 1JR3A 2YHSA 4LX0A 1EFUA 4PXAA 4JLVA 2L0XA 3RS7A 1TF5A 2DB3A 4PC2A 1BS1A 4HATA 2IWRA 3NBZC 4Q4LA 3KL4A 4B43A 2QQEA 3H1TA 4JLMA 3FMPB 1PLLA 2CJWA 1UEJA 4HAXA 2GXAA 4Q4HA 1Q1ZA 2KE5A 4KFRA 1GAJA 1YR8A 4EJSC 1LB1B 3ICQB 3H0KA 3QXSA 2J9RA 2GA8A 3WY9A 5KSZA 2OBNA 2BMEA 4M9ZA 3H2YA 4JMPA 4NYJR 4PAMA 4BQSA 1B0UA 1KMQA 4N3NA 1IQPA 1FX0B 1FTSA 1RKBA 3IO3A 4JVMA 3RSOA 1G4UR 4BGDA 1KAOA 2ZREA 3SQWA 3K53A 4QJ5A 1A82A 1Z6TA 3AV0B 4RKFA 3U60B 2O8DA 3GCGA 4KVAA 3T5GA 3AVXA 2ODEA 3N5CA 1Z47A 3A1WA 5G41A 3X1DA 2BMFA 1JEEA 3B9PA 1I4DD 5KTYA 1R8SA 3O47A 1ZVQA 4NCJA 1ZNZA 5CB8A 4PSKA 2G3YA 2QAGA 4B2PA 3TR5A 2WV9A 4LPSA 2J87A 4GBMA 4B3XA 2R2AA 4M1KA 4YDHB 3LH5A 2FGKA 5IRCD 2CCJA 1E79D 1BO6A 3KDSE 5BWMA 4JSTA 4Z8XA 3PEYA 4NDZA 3RYTC 5DE3A 4Q66C 5EP2A 4P4SB 2EWWA 3OEEA 3BGWA 3ECCA 4TMZA 4MRPA 4OQLA 4KFTA 2ZRJA 3FYHA 4YLGA 2CLDX 2VSXA 2AWOA 3K09C 2IBMA 3PEUA 2FN4A 3QOFA 1PLKA 3QE0A 3AVVA 1HE8B 2YWGA 3KQHA 2FA9A 2FF7A 2VYFA 3MAAC 3NIBA 5E95A 1DS6A 1XPUA 3DM9B 2XX3A 5JWHA 5B2ZA 3Q5DA 4WXRA 1W36B 3G0HA 1XMJA 4C2TA 4G0NA 4BFVA 4KCGA 3B6EA 5J4VA 1MRSA 2R8RA 3MD0A 4YC7A 5L3VA 3QPUA 2F55A 1MABB 1XEFA 4TMKA 3IBGA 2ZJ8A 2NPIA 2IA5A 1RYHA 1ZU4A 3LRPA 1JEDA 1JR3D 4EQ6A 5HR5A 3NH6A 3IO5A 3K0AB 4RD3A 3TBKA 3EX7C 2GWHA 3W3ZB 2JJ8A 1E2EA 4EJSB 3RAPR 1Z06A 1KSJA 3QBVA 2NGRA 1CU1A 1CULC 4F4CA 2ZYUX 4JL6A 4MA4A 2Q9CA 3AVYA 3EWAA 4XTRA 3KB2A 3B7GA 5EZ6B 1E69A 4WIAA 1XXHE 1ZC3A 2CK3D 5SZHB 1S4QA 1TF7A 5G40A 5DIFA 3VHXA 1OIXA 521PA 4IJMA 2UZIR 4HDQB 1XJ0A 2WPDD 2B8WA 1QG2A 3CRMA 3N2IA 5JJKA 3SS8A 4QGGA 2XZOA 5G3YA 1HTWA 1GFIA 3BXZA 3JZAA 3WMGA 3U3RA 4TYYA 1XEXB 3SEAA 2Z43A 5FOXA 2WWIA 2ZE5A 4TYQA 3FDIA 4DXAA 4UNPA 2BDTA 2GF0A 4PPQA 3T12A 1W4RA 2G6BA 3H4MA 4C9BA 3PUZA 3FHOA 1KY2A 1ZRHA 1GL6A 4E09A 1VIAA 3BH0A 2NG1A 3ADBA
chains in the Genus database with same CATH superfamily
1J20A 1L1RA 3QWIA 4Q4DA 3CA8A 3QXHA 4PLYA 4R9SA 2AA3A 3GJZA 1YBVA 2D7CA 2PMCA 4E31A 3ZUGA 1TVMA 3FRJA 4S1NA 4Z9FA 3NX4A 1Y82A 1NNLA 4D4KA 2IITA 3WBKA 5K03A 2XVZA 1N6NA 1HGXA 4HDSB 1X3SA 2JHPA 3AETA 2RK3A 121PA 4MRRA 5SICE 1QTIA 1EESA 4K87A 4R9RA 3IIEA 3LT1A 4O29A 4C2TA 3LJKA 2DMRA 2VJYA 2KWIA 3MIZA 4TL9A 2UV8A 1YJQA 2A7XA 3PRYA 1V2GA 5FBQB 3EPKA 1P2UA 2GKGA 3FVRA 2HTEA 3CINA 1BU8A 2VN8A 4V3BA 4Y9UA 2OORA 4RELA 4ESOA 2EG9A 4QWWA 2FW7A 1FSPA 1R9GA 4BWYA 1KJ9A 4QXPA 2Y9PB 4I50F 2I65A 3AV3A 4MYTA 4W5HA 4BNGA 2AYYA 4YBRA 3ZK7A 4JOSA 1E7YA 3HCDA 1E2NA 3U44B 2JGDB 3EUEA 3FF1A 1T5BA 2AJDA 3OTWA 4LA4A 2BI4A 2X7JA 3LXMA 3KFXA 1TX4B 3RIEA 2W42A 2OZVA 3GVHA 3I5YA 1BCSA 3IAUA 2Z8ZA 4QX6A 1HI9A 3UAOA 4BAUA 4JYBA 1FDUA 4L0QA 2MINB 3RUFA 1XMXA 1H66A 2QJWA 3CRQA 1SQSA 3GJQA 4OQDA 5ALFA 3R75A 4B4VA 1ENOA 1JECA 1G6HA 2SNIE 2XF2A 5J4HA 1D4AA 1WJGA 4E0BA 2BMWA 4BO8A 3T54A 4MQFA 3TEMA 2FK7A 3HO8A 2QTWB 3L82B 1QS0A 3VNAA 4OUKX 4US2R 4MAMA 4R1OA 2LE0A 4QGHA 3KSMA 4A0SA 1RAIA 3BRQA 4M0FA 3CXRA 3QVOA 2WJWA 3TKLA 3WLMA 3OWHA 3GGJA 4ITUA 5BN5A 5EKSA 1JQJC 2HMVA 2QN8A 2VJLA 4RD1A 2FCAA 5ALZA 1ZSYA 2UYQA 5IBPA 3GD7A 4Q4HB 3USZA 5I47A 1PJZA 2CZCA 4RTSA 4P0PB 1Z0AA 1W85B 4I9HA 3KFVA 1YOVA 3FGZA 2IS2A 1G8HA 1WCXA 1RFGE 3A31A 2JGJA 4B82A 3INNA 4GEGA 3U39A 1R00A 3O93A 4F3RA 2D06A 2O2ZA 1W44A 3JQRA 4IIDA 1E2DA 1YIOA 5CB4F 1OBVA 1YGYA 4TMVA 1R5OA 4ZRNA 2BH9A 1CY8A 2IHZA 2A9VA 2W2NA 2HDOA 3OQIA 2C5HA 1MD9A 1DKNA 5F12A 3L7DA 4PSDA 4XWTA 1YJ8A 2O8DB 4MJXA 4LYFA 4PGFA 2J3LA 3PQEA 1K3UB 1E6CA 1T10A 4IX9A 4O2LA 4EENA 4DCTA 1TO1E 2FE1A 2WE7A 4RGQA 4TM8A 1Z7BA 2A9OA 2AKEA 1DBWA 4PC6A 5H7XA 4CRWB 5KDOA 5FUMA 2MSEB 3DE0X 3Q40A 5BSHA 1ZMXA 1QK3A 4ZEOA 1YTUA 4KU4A 2H1VA 5G1OA 2JI9A 2BUAA 1GNLA 2GN8A 4FB5A 4EZEA 5JS1A 2H7CA 4AFNA 1YQDA 2W6ZA 1UXGA 1U1FA 4ZQGA 2BEVA 3U3KA 1ZPDA 2BEUB 3QF7A 1RZUA 5F7OA 4CLRA 2WWRA 1HNWB 3JCZA 1LRLA 3JR7A 1W4CA 3O38A 4L9SA 1DBIA 4WPGA 1MW9X 3OM8A 2CCKA 1C3LA 1PJBA 4CM8B 4AYTA 3JZIA 1N2HA 2DG2A 2O0JA 2ZSHA 5KNCA 2YHIB 1NRIA 3KQPA 1ADBA 4K28A 2CVHA 3EMKA 3LQ2A 2JAOA 5CVTA 2O19A 4YONB 4PZDA 3MCUA 1GU1A 2OCXA 3GG2A 3LFUA 4DLAA 1WNTA 4RGBA 2GCPA 1T2DA 3NUZA 4RKQA 4B6FA 4ABTA 3Q2IA 4ZRMA 7YASA 4Z53A 1Y8AA 2C61A 3UUWA 2LBPA 2ODTX 3UHOA 1IVYA 1N5KA 1B1AA 1KDRA 3E9YA 2C7GA 5FO1A 5LKRA 3VPCA 4MWDA 1XAIA 1OXUA 1RWOA 5FTMA 1P45A 2E89A 5AJVB 2B7LA 3OUUA 2UUPA 3C1OA 4EQ6B 4B3JA 3I61A 3TIFA 2SKCA 2DSTA 4NJMA 2WICA 2JIQA 5L7TA 1OMOA 1Z8FA 3RE1A 3ESDA 4KLNA 1VPDA 3TLKA 2Z6QA 1Z15A 4WOPA 3U4DA 1JU3A 3LC0A 4CKYA 2GSWA 1HDZA 1MOSA 1J56A 1KZYC 1SCNE 1GAXA 1QBKC 5T57A 2O3RA 3B1FA 1QYVA 5FUYA 4O4HA 4H3VA 1BSVA 1Y80A 4H16A 1OH5A 2P5YA 4R0MA 1WU8A 4Y1EA 1QORA 1V71A 3IELA 3KTOA 1C7QA 4V0SA 3ZVRA 1Y3IA 1UFVA 3I1FA 3M6VA 3FSGA 1SUSA 2ZB8A 3D2AA 3QVGA 4YJHB 4FW9A 5EEGA 5I45A 5K8JB 2FFRA 3C45A 3THYA 5ECDA 3F97A 2JEZA 1KYTA 1BEEA 4Q16A 2WMDA 2X77A 2R44A 4TTIA 3UW3A 4PPFA 3ZY3A 4MUBA 3IKTA 1IB0A 3CWZA 4Q48A 2X42A 3KLOA 4PBRA 2ZU6A 3WP0A 4PAQA 5B3AA 4UNRA 3UJDA 5DN6A 1Z7EA 4G65A 4E5UA 1C3VA 3T3HA 4IIHA 4DR7B 3K70B 1NMEA 1A9XB 2RHJA 3N28A 1FFWA 1TCBA 1QJCA 1V48A 4HWTA 5F2NA 5JZVA 3N2KB 4H6XA 1PQUA 1SU4A 2WAXA 1LBIA 3IBYA 3QVUA 4NECA 1BTOA 4I99A 4ABYA 2OFFA 1EAYA 2OPBA 1ODKA 2ZYAA 3NV9A 2QSYA 3ZV3A 5HTKA 5HW0A 4G26A 1W1WA 4PXSA 2CBGA 2A84A 4BNMA 4DC1A 3UGKA 2NU9A 2FOIA 1AGXA 4X6YA 2RIPA 2ZQ5A 5CYGA 1T4BA 1QRAA 3N6VA 5LD2B 1XTVA 4RQTA 3DNFA 2OVFA 1USVA 2IHYA 3QGMA 1W29A 1EZZA 3OCUA 3REOA 3T1NA 1A8UA 5TQJA 2Y4OA 4GHWA 1FB5A 3CZMA 2W6PA 5MDHA 2ATVA 3UA4A 2Q2NA 3TECE 4BE7B 1MEEA 1ZGAA 1I1HA 2YHAA 4X7BA 1GQFA 5FNVA 4O4IA 2QLFA 4DKJA 1P39A 1Y0BA 1UH5A 2CL7X 5BSUA 4RTRA 1SHJA 1T0IA 3A4YA 3SLKA 4CZ2A 3DEFA 2LCQA 4C7KA 1JJFA 2XUFA 1WPGA 2PT5A 2QUHA 3DGFC 1LX6A 1G5RA 5EFOA 2YBEA 4QNMA 2BMVA 3AY0A 4M0DA 3RKUA 1UEIA 2XUAA 2BI7A 2OXIA 1QCDA 2YR0A 3BXEA 3L8CA 1HE3A 1JIJA 2CXXA 4MI1A 5K0NA 4FNAA 3SEZA 5LDGA 4B3BA 2VDMB 3SQDA 3OTIA 3ZWWA 5ELXA 1U2EA 3EPPA 3HBFA 5CXXA 5EWLA 3RBXA 4DEYA 3L7AA 4U39A 3AF1A 1JXQA 4WOKA 1C7FA 4GE3A 1WS6A 1P0CA 5AW8A 1PK9A 1XX6A 3IX7A 5EVCA 1XK7A 1KZ7B 1HT0A 4C06A 4F2GA 2X5NA 3BHNA 3VU0A 1A5SB 4CMHA 3T5CA 4Z4IA 2Q1UA 4MV1A 3IB3A 1YZLA 4X63A 1QVWA 2PGLA 2M9MA 1AOXA 4I4TA 4A2WA 2C9OA 1C9KA 2O20A 4O5AA 4QU5A 4JY7A 2HRCA 2UZ1A 5EINA 2ZRFA 3W3AA 1USIA 3UNXA 1EA7A 1EFVA 2YCBA 2ZRHA 1XU7A 1Z8HA 4C0SA 5I7VA 3B52X 1JFSA 1FFSA 4WT7A 2WUFA 3COJA 3PHGA 4HPXB 3MOGA 1G8GA 2FG7C 2VYVA 2GPBA 5F3DA 4PYRA 5E4TA 2IPMA 1IEQA 5FR2A 1JJBA 3OICA 4YUZA 5ALJA 1E4OA 4G4JA 2ZPTX 3KX2A 3VR4A 4EZIA 2AJ8A 3OAAA 1YACA 4DADA 3BFVA 5JRZA 4QOGA 2XMCA 4HT3B 2BGGA 1GLNA 1L7VC 1XBTA 5ISMA 2C5AA 1LDNA 3V1YA 4A15A 4KRFA 1PJSA 5LWHA 4AKHA 3MN1A 1VLZA 1PT7A 4K6HA 3DWIA 4F5WA 3NOQA 4TTPA 2ID4A 4FNOA 1QDUA 3OHMA 5JY6A 4Z2AA 2X19A 3HU2A 1RHRA 4UVGA 4GOND 1YUMA 2ENUA 3ROEA 5B2EA 3KEMA 1TLTA 2HB6A 2ZW9A 3EY9A 3SIXA 5AVZA 2R4TA 3ROTA 2I4NA 1VKOA 3GHYA 3RRZA 1GRNA 3PHCA 1QHFA 4JJ7A 3SP1A 1DEAA 1KK3A 2YC4C 4K7JA 2R86A 1I1NA 4YUVA 5M5BA 2OKCA 1QE0A 3HI4A 4D74A 3HM2A 3PJFA 1VE3A 2EGUA 4UHBA 4YP1A 3AHCA 1Z6QA 3DKIA 2R2GA 5BR7A 4UUPA 2D7DA 4XAQA 1QH1A 3NWEA 3LUHA 3ON5A 2PG3A 4MV3A 2RK6A 5FBLB 3ZIAD 5AW2A 5M7EA 4D8UA 2HLPA 1LA2A 3O26A 1DUIA 4LBWA 4HN9A 4BAGA 1NP3A 1WUTA 1VLVA 4WLUA 4XWOA 1UKYA 3H7AA 3JAKA 2OSVA 1VG1A 4YP0A 3L9WA 2JAUA 3IEUA 1RYMA 3FWHA 4MVJP 2AMFA 2JI7A 4UM7A 4WWHA 2JLBA 1UT6A 3EBPA 2ZJ4A 2ZSFA 4EI8A 3M83A 1ZXBA 4F72A 4FZ5A 3KVOA 1M6VA 2KPOA 4PGGA 4V3CA 2FPKA 2C7BA 1RKXA 2Q5LA 2ADFA 4JJ4A 3SIPA 4B31A 5HM6A 3B1XA 1NJ5A 2WG2A 1KO5A 1C0KA 1XSEA 3BE6A 4HQRA 2EHDA 1TYCA 4J8PA 4E2ZA 1M76A 5EN4A 2YMPA 3TOCA 4WJLA 1M5RA 2WYOA 3R3VA 1X8KA 4UOZA 4HD8A 4MEAA 4D3SA 1UJ6A 2B3DA 5F51A 4A6XA 2QBYA 3LKBA 1Y81A 3HXPA 3G9QA 1YMVA 1AZTA 4OGKA 3O1IC 3OCVA 4ZWNA 1J00A 2C58A 4JKOA 2X8WA 4YMIA 2DX7A 2Q3JA 3D3WA 3R3HA 1RPTA 2FCRA 2GFHA 3CISA 1LSOA 1SHZA 4LNAA 4PFSA 2F9LA 4C20A 4WFJA 3SBDA 1CT9A 3Q8XB 3F7OA 2P6NA 1WW3A 1HT3A 5F76A 5AM4A 4D9MA 2Y1LA 3G5UA 2IS4A 5A6SA 4LNUA 2C1ZA 2Y1EA 4RF3A 2KJQA 4EL0A 2GS9A 1JLMA 1GITA 1PR1A 3A58B 3E9MA 4LECA 4OK6A 1Y6FA 5AM1A 3SS9X 4I1RA 5B1DA 2VKQA 3TW6A 4BP9A 1DCKA 4GOOD 5HF8A 4BNDB 4DRYA 2E87A 2QRVA 1KR5A 1H0SA 2O2XA 4GMXA 1I51A 2ASEA 5E3JA 1H6DA 1Y1LA 1SUCA 1U04A 3Q6NA 3RS2A 1E3LA 1S3IA 2CFOA 3D5EA 3WJAA 2C2MA 1BCRA 4IHAA 4B74A 3GPIA 4EG3A 4GKKB 1HSOA 2IE8A 4G24A 4EVRA 3R20A 4QM6A 1JTEA 4MVWA 2HU7A 4C0KA 4PM4A 3MC1A 4PPNA 4JR1A 4Q6WA 1JN0A 2J4FA 3HTXA 3F5FA 2I3AA 3MJVA 4S0ZA 1J2YA 1M2GA 1T0PA 1D0VA 4IH9A 4FT4A 3CRVA 4MJ7A 3AUUA 3IXMA 4AURA 4CM4B 3T7KA 3S2FA 4Z2YA 1TQHA 3PDIB 1YA6A 3HXKA 3RHTA 3SJUA 3DZ8A 1B6SA 1IDN1 3L7JA 2K7FA 1RJ9A 4FFRA 4HX9A 3IAM6 3LA6A 3WNCA 2A57A 4BKOA 3RS4A 1BHQ1 4RVNA 3CE9A 1IN8A 3TEJA 1E6WA 3L4BA 3LUGA 4G0YA 3I6MA 1Y9AA 1YDEA 4MDHA 3EWSA 4R41A 2GVZC 2WFAA 3IAS6 1FSZA 3IC5A 4WK6A 4Y0NA 5B1HA 4FOSA 2GBIA 2PIDA 1H8ED 4MLDA 2NO1A 2FMXA 1ZVKA 4QNRA 3FPCA 2JFVA 3S2GA 3RYFB 1Z5GA 1JYEA 1FYEA 4R83A 5DHAA 4REQB 1QV6A 5DGHA 5BQPA 3TRJA 3NC4A 1VCIA 2WAOA 5D3MA 2J31A 1S2NA 1I1QB 2QNIA 2J9FB 4LMBA 1TPYA 1J9GA 1Z26A 3U3JA 5DMHA 3BFKA 1EWVA 2PUWA 2VSOA 5G53C 5CH8A 1H5NA 3D6MA 3KXKA 1SNYA 4AMBA 4BNFA 1FQJA 1Y1PA 5JDIC 2W2XA 3KV1A 5TXGA 5BORA 4AMUA 2ID9A 2LVBA 4JVOA 2XCRB 4DWJA 4HDOB 3WQQA 2WIDA 1KDZA 5K01A 1ISPA 5K0GA 4JLJA 2AKAB 4TRNA 16PKA 1A9YA 1U0SY 2A35A 2CLSA 3AEUB 2WU4A 4OVKA 4R98A 1KYIA 1OTHA 1M7GA 1M2VB 1V9LA 2BGKA 3Q1KA 4ZVVA 3ZS9A 3D8HA 3N2GA 5KYKA 1OX5A 4L4RA 2VTVA 1TZ2A 2XLBA 3E22A 2B4KA 4Q15A 3TQSA 4D0LB 4EAAA 3Q8LA 4GU5A 1JEYA 5KWSA 3SDBA 4QHSA 2VA8A 1UPAA 1HE5A 4RIIA 3WMFA 5TNXA 3SSAA 1MMFB 4Y98A 1Z2PX 4FYXA 1HG1A 3T7JA 3A9TA 1ZEJA 1UWKA 3B1ZA 2YJNA 3BMNA 2UZ3A 3P52A 3VRHA 1OSNA 3RAJA 5ADHA 4Q02A 1T3LA 4FB4A 1P18A 5GAJA 4HNGA 3S44A 2QLTA 2C57A 2MIIA 1J8VA 1WKBA 1DKPA 2P0EA 3A0UA 3C4JA 3HJTA 3NBKA 4WA7A 3RCBA 2NXEA 2WOOA 1I36A 1QH0A 3KV3O 2PZKA 3KOZA 2IV7A 3TRDA 1MPXA 5LMUB 2ORWA 3PPIA 3ZG6A 1L5GB 3CPEA 4F71A 3WADA 4BLSA 5CR9A 2P3SA 2PLFA 1OFVA 4P31A 4YX9A 4YV2A 1SIWA 1ZOLA 4UHCA 5LIPA 3ZV7A 2Q4BA 3QHQA 4EEXA 1CKEA 4X54A 1GRRA 2IYVA 5HF5A 5ERYA 2CDRA 1U3FA 4ZMRA 1GVNB 2BTEA 3LG2A 3OMWA 3OETA 1Y1TA 3U49A 2GPJA 3EXAA 2O57A 2QXYA 2VYND 1WUKS 2A0XA 2X1LA 3WE7A 3OEWA 1I2BA 2DF8A 2XTJA 5F3RA 5LZ2A 2GUWA 5ICFA 1O58A 1DX6A 3FI0A 3GRZA 2IIPA 3PDCA 1CRPA 1PWXA 1UJMA 3VPAA 3KQQA 3M33A 5AI8A 5DYGA 3PQ5A 1DLJA 1R8YA 3FYUA 2DTEA 3P2YA 4KWTA 2CLKB 2ZRPA 3CF2A 2BSXA 5KYYA 4QU9A 3GEEA 4GPAA 4PIMA 2P2DA 2W2PA 1HQDA 4LPKA 4B4DA 5C8ZA 3QELA 3NM6B 1YR6A 1GGJA 1AMNA 1SB9A 5HK9A 3KVRA 4LRQA 4LZZA 3C6BA 5EHNA 3KQVA 3GLVA 1FS4A 1MFZA 1O94D 1SQFA 1FA9A 1K8RA 2NTNA 3LCJA 3MOIA 4RK0A 5DV9A 1CUWA 2BJWA 4MR9B 1Z4JA 2IU3A 4LJYA 5BWCA 1ZRSA 3EVNA 4G0OA 3JD4A 3CSDA 3L49A 4Y9TA 3TRKA 2HXSA 3O95A 5EWMB 3T1YB 1FP1D 4ZVPA 3DVSX 1EUQA 1NWHA 1RIFA 2OCYC 4GWKA 1NU6A 4HFRA 5A7FA 2NO7A 2R8YA 2A6PA 2VT7A 2ZS9A 1XTUA 4KQ6A 4TS4A 1FYFA 2E82A 1ZMBA 3H8WA 3EVTA 2J85A 4FGZA 3P7MA 4PC1A 3KT8A 2OZKA 4GLFA 4D9GA 4NCHA 4FR5A 4IP0A 1XLUA 4MUXA 5BURA 1IATA 2PXAA 3L7IA 1VE7A 4GVXA 4B76A 5IF9A 5F33A 3ECSA 3ILXA 2V9PA 3CZAA 3TDMA 2XVMA 3D5TA 4HNSA 4RH0A 3ZWKA 1E9VA 4UU8A 4XWKA 5LBTA 3AUXA 4B2LA 1D2RA 4EDFA 1NVEA 3PXCX 3EZXA 1XNGA 3ML1A 2PX2A 4GMGA 1SKMA 1QO0D 2H0AA 1M2NA 2HJHA 2OHFA 2RHCA 4MYSA 5G2OA 2NTYC 2OBXA 1W76A 3ITKA 3TDKA 4Z86A 1JFLA 4LYHA 5EP4A 5EJMA 2PEYA 4A8PA 2O59A 4Q3NA 1SQGA 1HLDA 1N2ZA 1ZI6A 3C43A 4KOAA 1DAOA 1XA4A 3WC4A 1QANA 1DB3A 2IBSA 5BQFA 1E3DA 1O54A 4M0UA 4YT5A 1PL0A 3PWKA 2Z95A 4JGBA 3HI6A 3UKJA 1LNQA 4TWAA 3ZVLA 1U8UA 3O2SB 1CUEA 4LWOA 4TTSA 1SG6A 1YRAA 1EVZA 2XUHA 5EP3A 5F73A 1RRCA 3UWMA 2A0UA 2V7VA 1OT3A 3LPDA 4Z1MD 1IE3A 5CDYA 5G1NA 4CXMA 1V7QA 5EE1A 2JFPA 4DCPA 4F38A 3C70A 4G07A 3GLGA 4MROA 3VDXA 4ZDWA 1E7SA 2JIDA 3OE4A 1KMCA 3U6KA 4IVRA 3BSWA 2CFSA 1EWQA 2O9JA 3JR3A 3HVKA 2FXVA 5IAEA 2ZAGA 4O3MA 1LLUA 1P81A 2G88A 4QHTA 3JTMA 1OBHA 3EXHC 1WUIS 3HRHA 4M1SA 3KKEA 1QOZA 2YRWA 2AF3C 5EXDA 5BNIA 5KREA 3OZAA 4LAFA 1RC0A 1XROA 5BRNA 5KOHA 4JI0B 4PZ0A 3LD9A 3M6XA 5D5HA 3TIXB 2I7XA 2F43B 2XOKD 3D6TB 3EMDA 3GJ5A 3ZBTA 5KO2A 4DR6B 4A8JC 4RA6A 1PKXA 3IP3A 1MH9A 2WIBA 3PA6A 1Q44A 3GF4A 4MW1A 3CVOA 4LJAA 3UTDA 4BTVA 2FX2A 4RLHA 4GS5A 2XE7A 4PX9A 4UAVA 2AFHE 1XTQA 3E82A 4MQUA 1C4OA 3FXAA 4F2DA 3G7NA 2BCGY 1CZHA 1N5OX 2VPYA 1VRCA 3IDSA 4OBBA 2PRKA 1ULZA 3CPJB 3K9NA 4BFTA 2ZBUA 2YRXA 4OMDA 3IVMA 1L4EA 3PC7A 5E4YA 5CTJA 5LP6C 3K6RA 3BWDD 5J3JA 1ULSA 1UMBA 3E3AA 3ZKAA 2GPTA 3AVUA 1WXDA 2OO5A 2ZBGA 4C0JA 3RVPA 5CIQA 2P4EA 4RAOA 3KHTA 2VDLB 1T13A 2QZZA 2O05A 3I37X 4MTLA 4XJTA 4TMYA 1JHMA 4RMJA 1JXAA 5AKGA 5BYKA 3SLRA 2O8CB 4JSRA 1E96A 2CDNA 2J7KA 4Y2JA 2RHMA 5CGQB 3SFTA 5K51A 4QBHA 3VR6H 4D3DA 4HRYA 3TQIA 5BSFA 4RE6A 3OX4A 3F4LA 5DI3A 3QI7A 2V9ZA 3NHLA 3O8NA 3DBIA 5G4KA 1J2UA 2QMUA 3M5CA 3MG9A 3SNHA 1MAWA 3B1YA 4MINA 4RZXA 2NPFA 2V4ZA 1BHSA 1EGMB 1NPTO 2JGNA 4ZMSA 4KL8S 3RVKA 1JG2A 3TGPA 1D6SA 1E2JA 1XZMA 1N78A 5JVDA 1D07A 2EVWX 4GYKA 2B83A 4AZVA 1AHIA 4A92A 3KR2A 5E7MA 5KSPA 5LR6A 1JG7A 4HXYA 5DT9A 4CEJB 2FAXA 4D4HA 2E6KA 1B6GA 1JL3A 2ZT6A 4IIXA 2Z1MA 4TQAA 2DWQA 4X61A 3VR3D 2FHPA 3AM3A 1XZDA 1QR2A 3LCMA 1FDIA 4ZOBA 2Q45A 3C6XA 4MZDA 4H4DA 1YCGA 3WWOA 1Z6GA 1JKJA 3BXOA 1R88A 3FNFA 4DL9A 5KNBA 3ZLJA 2HOQA 4IX1A 5DGDA 4HDCA 3IE0A 1WVMA 4AIRA 4DYHA 2CMFA 2P6RA 5KJ1A 1LI4A 3E9DA 1V96A 1G41A 4RS3A 1SC3A 1CQIA 1Q7BA 3JWPA 1ISFA 4PF1A 1ZK0A 4I19A 3QWBA 1GL9B 4E22A 5CXSA 4ESHA 1GXSA 1HKUA 3VDMA 5ALDA 2A78A 1KO7A 3FCOA 3QM1A 3MB5A 2ZE7A 1GZ3A 1PNQA 3WZLA 1WE2A 4C6SA 3B1JA 4M0LA 5IX8A 4C7XA 1OCEA 1A4IA 2AJTA 2P9GA 1R4MA 2FPIA 2G0NA 4IUBS 1G59A 5LLTA 2CKMA 4MS3B 3GUVA 4OXKA 4YWJA 1NVXQ 4GNRA 1RHJA 4XOUA 1BU5A 3RUCA 1XQVA 1RPNA 3MYRA 1PS9A 5AT1A 2Q4DA 4J6EA 4GXTA 2P8JA 1GTSA 3KM0A 3CXUA 4X41A 5DGTA 3JSAA 3KZMA 3UBTA 1UDWA 1RWXA 2QTGA 4Q0MA 5ALKA 5CVDA 5TX7A 3BGDA 2QUBA 3URMA 3O6VA 5C7OO 4XE5A 3HP1A 3LK7A 2I1LA 3KJFA 3BXXA 4KMMA 2OTCA 1I6WA 4AAYA 2AMJA 1HY3A 2F1HA 2CXTA 2OGTA 3AU9A 3CUWA 3EVEA 3OBBA 4DNQA 2NUPB 3X1XA 3I4LA 1E60A 1T4CB 3R6GA 4XYMA 5K99A 4ZYWA 2X0KA 1IXSB 1AY0A 2YXDA 1Z83A 3SXJA 4TYPA 3SE0A 1K7EB 4MW2A 2YVUA 4G0XA 4LHZA 4LSMA 1CLUA 4YRAA 1LF0A 4AUNA 5IU6A 1AZWA 4D8XA 1DWPA 1E20A 3IBTA 4QEDA 1KXZA 4EATA 3U9SA 1TTTA 5JD6A 3ZGOA 1JEQA 1P2SA 2ONCA 3RFFA 1GTL1 2B2XA 2HJSA 2WYWA 1EX6A 3R3UA 1K08A 1M6EX 3O5AA 4UAUA 4R2JA 2GJ4A 4DW8A 4G89A 1SOWA 5BOVA 1IN5A 4RIEA 2VTKA 4J29A 2VBFA 5GJVC 3T7SA 4PO9A 4HEA6 4DV4B 2VUIB 3ISJA 1Z2CA 5JU6A 1L5SA 4LGMA 3W6ZA 1UZNA 1CZNA 3WLAA 2ONJA 2V1XA 2X2FA 2QGFA 2W6NA 2P9CA 3VU1A 2ODWA 5JG7A 3OWXA 5IT0A 2HWWA 3F1LA 3F6SA 4EI9A 2JFOA 3PLAE 3WNZA 4EW6A 2FSFA 4LKRA 3D9QX 1SBYA 1LW6E 1ONBA 4RK5A 4FBMA 4F5DA 4L9WA 4N18A 4QOSA 3QNWA 1BWRA 4X8MA 2V9CA 2O6HA 3DLHA 1ORRA 3GPLA 3CLVA 3X43A 5HE9A 5K8LA 1T9GR 4DB2A 1WDLA 2CNOA 3VNUA 4RAQA 3GJ0A 4LTNA 1BFUA 2VHVA 1DLIA 1NQTA 2K2WA 4M54A 3PKJA 2ZB2A 2J5RA 4S2EA 1QYIA 2A1UB 2BGRA 1U8YA 4L95C 4E5MA 4B2YA 4KMSA 1X1EA 1TYEB 3LT4A 1ZN2A 1P4AA 1EGQA 3AFMA 2QP4A 3FFBA 2JBHA 4UDNA 5BMVA 4OP3A 1PR4A 2FEAA 4DA9A 3NNDA 5ALRA 3K9FC 1EQAA 4JR0A 1HMYA 1NN0A 5BQ5A 2GBLA 3OZUA 1RYFA 3TPZA 4HZIA 1Q3KA 3WYNA 4B0OA 4B33A 1GARA 1VHQA 2PUAA 1II8A 3OO0A 1KQOA 3QEBZ 3HJRA 4UEWA 2FN7A 1YASA 3LTNC 2VYQA 1GYPA 2IP2A 2WP0A 3KCNA 3UFBA 2HV9A 1U2RA 4CN9A 2VQ6A 1F9AA 4PTLA 5FB3A 3V7NA 4D3FA 5B3LA 2F3RA 2MYTA 2Z5LA 2Q5OA 3R76A 4KYIB 4M89A 5C1BA 5EJIA 3GP3A 1Z0FA 1GZ7A 1HQCA 1GT6A 1UM8A 2FJPA 4HYTA 4XRGA 3A05A 4V0KA 3MRTA 4O59O 3TWOA 2WU1A 3ZDCA 4U6QA 1H6BA 2RE8A 4W9RA 3QKRA 4OO3A 5EG5A 3TH5A 2ONKA 4M0KA 1Y8ZA 1KEKA 1A7KA 3FX2A 1JMVA 4BWGA 3MMPA 1K6JA 4FOLA 3GB9A 2PGNA 2PANA 1FXWA 1QNFA 2QTVA 2WZCA 4LRYA 3CEMA 5AUPB 5B36A 1PD1A 3BXFA 1QKKA 1ECJA 4U7JA 5KWEA 1EFKA 2V7PA 1U0FA 4DRZA 1PIWA 2J46A 2X6QA 3GK3A 3HL0A 4NHOA 3ZIDA 5A7GA 4YDQA 3FWPA 4MQ4A 3J81A 2NN3C 1XTPA 2R7AA 5HOQA 1RRFA 3TBFA 3G88A 4MK4A 3IUEA 4BEJA 3GGSA 3LX5A 3BOSA 4JYAB 2OCLA 2EXXA 4GXRA 4HAOA 5ADWA 4R5MA 4X64B 5LIRA 3KOMA 1Q83A 2QM7A 3D6FA 1U1DA 4JC4A 4Z9XA 5I4CA 1C9NA 1P74A 4I8IA 2ISCA 1QBGA 2FLWA 2R68A 5H82A 3QE3A 4MIYA 3U31A 1UDAA 4GWGA 4Q9HA 3GIDA 3FTFA 2O2DA 3HXLA 4BU0A 3RK1A 1O97C 2GHRA 2VUSA 3EWNA 5EJ4A 2QX9A 4ISBA 3C3JA 1Y6QA 3WWDA 4F84A 1UDRA 2JLCA 2VPXA 2QUZA 4IJVA 3W2IA 4GPTA 2H7VA 2AJCA 2XCUA 5CDUA 2NSYA 2W2TA 1G2QA 4K1LA 4WGGA 4CKBA 4OLHA 3UMSA 2WBLC 1K4MA 1P4RA 3KLPX 1KAGA 4QYMA 5D84A 4A4DA 1KFBB 4M99A 1B23P 2I76A 1C3OA 2R6FA 3HJUA 3MINA 1CVRA 2FJ0A 2NYRA 3OIUA 3OOEA 2JIOA 1OLSB 1X2EA 3DLIA 3P2EA 2PKWA 4U63A 4WY8A 1Q12A 1W5AA 2A58A 3I3OA 5U4XA 3TLGA 3AERB 1Q7RA 2Q1TA 1N2CB 3KB1A 3LDGA 3CR8A 4R8KA 1NZJA 3RABA 3OZSA 1SUIA 4IDQA 4ALMA 1L4MA 2FF5A 5CXQA 2ZB7A 1QMPA 4LRXA 2Q4EA 5KYWB 2NTVA 3TUZC 3HR7A 1GIAA 2BHSA 2PH7A 1ZUNB 2J6BA 2PCLA 2Q4RA 3JQPA 3U3XA 4DDHA 2AJBA 2LWIA 4A0FA 4G6ZA 2P8SA 3U56A 4IQFA 1GN8A 5IBQA 1WXWA 2QPOA 4E13A 1QFYA 1S2GA 1C3EA 2LTAA 2ZFUA 3BC1A 5K6TA 3P27A 2Q6OA 4B7UA 4ZAWA 2PX8A 4TYNA 1D1SA 1QGZA 4ND1A 3NBFA 2GTIA 4DCOA 4CKEB 1JLRA 2J3DA 1UC9A 1ZFNA 2CLMB 2Q49A 3IESA 4LJLA 3G2IA 5A5GA 3T1OA 4OI1A 2GNPA 2I4IA 3DPSA 1L4NA 2FK8A 1Z62A 1XALA 3MFQA 3LXUX 1GCOA 3TF5A 2OT3B 4DRXB 3IRUA 3OZBA 2VAWA 3O0TA 4IQGA 3P9SA 4I6JA 1H8EA 4OMCA 1IOVA 1P4GA 2GERA 2IGTA 3GAFA 3HEMA 2RKWA 2PPLA 4JB3A 1FBTA 3GFQA 4TKMA 4B71A 2YFHA 3GROA 1KTVA 1MX3A 4BNVA 3BXHA 5E2AA 5JH7F 1TGVA 3WK9A 1QQ5A 4AKEA 2PT6A 4QUKA 1VLLA 1QHSA 1C1HA 1C8VB 5EJ7A 1YI0A 3K1AB 2C3OA 3W4KA 3GBSA 3PQ3A 5L3ZA 4AS1A 3W8RA 4WADA 2HF7A 5H16A 4JYCA 2E5LB 2BE9A 4UUMA 1Q7CA 1V3VA 2LIVA 2PH3A 1G3UA 4TPKA 3DTNA 1UDXA 2IY9A 2V7QA 5IXJA 5LDDC 5KTRA 4UMDA 2PKRA 4II3A 1D2AA 1ISSA 2IFTA 4AJKA 4JDPA 5AM2A 1NBWB 3IA7A 4G0QA 4K9RA 5ALQA 3ZE2B 1KE2A 4JQSA 5ITVA 4A7PA 3GVIA 2ID7A 4YRIA 3LO8A 1DIRA 1PX0A 2A67A 5DM70 4PX2A 2O0MA 5DX8A 1ADFA 2IHUA 1PYGA 3H11B 1UMKA 1M54A 4F56A 4MVJF 5LYJB 1JI3A 2WZDA 3TR0A 2XDQB 3QK7A 1RBMA 2WOJA 5DCYA 2PWPA 3O83A 2V7EA 4EUHA 4ERNA 1S6YA 4C29A 3O92A 4TUYB 4B4WA 4Z4QA 4EYOA 3L6DA 4NBKA 4E2YA 3C5WP 2H59A 5IABA 2GJ8A 1NV8A 2PSEA 3W5CA 1AHNA 2R00A 1E9EA 4C0QC 3L8ZA 2YV2A 3WHKA 3EFOB 1PT9A 3GV0A 3L6RA 1QPZA 2ARKA 4W1QA 3C14C 1PAUA 4RFSA 5F5NA 1OXMA 3ES9A 5JSKA 4CFYA 3JQEA 4U7PB 1XUOA 5FTKA 4H7KA 1NE2A 1JP7A 2BGJA 2QVBA 4KR9A 5ELMA 1V6SA 3ESAA 2DGDA 3CW2A 3W5JA 1SXIA 1M34A 2IEYA 2ACKA 5LB2A 3PITA 4HV4A 4MUIA 1JJIA 3MJRA 3FCCA 2HU2A 3JAWB 3GLQA 5BSRA 4Y3UA 1MUUA 1DOAA 4BVGA 2IH5A 2NQ2C 3TAUA 2OEPA 5H8WA 4I3HA 3DOUA 1ENZA 2VYNA 5EGNA 4TL7A 4NNPA 2PA3A 1I4TD 4WCDA 1GGNA 4QYWA 8OHMA 2G4LA 2HRBA 3C3YA 1II0A 1N0WA 2BIFA 2QLNA 2ZJ7A 1PVDA 3C6ZA 2NYVA 2VP9A 3IJ5A 1XR3A 1MQ8B 2IVZA 4IKOA 2FRDC 1V7CA 3MBIA 2BGTA 3M9WA 4TWJA 3O3OB 1E2FA 2P91A 1RM5A 4P3PA 5D01A 1HQYE 3B51X 3HNRA 3HB4X 2ZAOA 3TBHA 4LIPD 4Q9NA 1IEVA 2R8PA 1RI2A 1IUPA 3EQ2A 4CI0B 4Z4GA 1ECGA 1E1NA 2HWUA 2XUOA 3IIJA 3BK2A 5AI0A 2DCMA 4YRRA 3IXLA 1D6MA 1L4GA 2Q8PA 1O94A 5HDQA 5DDIP 1PL8A 3RODA 3C5VA 1OFUX 5JXIA 3ZJTA 5CFLA 3ANSA 5FJJA 4BY9E 1T26A 1F3OA 2VSFA 1M1XB 421PA 2FVXA 3BTOA 1ZD5A 1G64A 4XFKA 5DVZA 3IT2A 5D1NA 5LB4A 4I50B 2WP8J 3CNOA 3FW1A 1PZEA 1QTRA 2B9VA 1JFVA 2EBFX 1EE1A 1YZGA 2VCYA 4OP2A 4L28A 5HKKD 1E0AA 2ZI9A 2ZVDA 2GEVA 1R0SA 2IYLD 5DLYA 5B57C 4CV0A 3GLTA 4PYMA 5AOVA 3PL1A 4KO3S 2PWBA 1ZIYA 2C3PA 2H2FA 1NM5C 2WTAA 3I23A 3OJLA 2JLWA 1G18A 2ZM5A 4YRBA 2XXBA 3UAYA 1E1KA 2JGAA 2IXEA 3DEKA 5AHWA 2TYSB 4EJ2A 5TGZA 1ADCA 5EZYF 5L3VA 4RULA 5IYZA 4PTZA 1QO0A 3KSBC 2HWKA 2UAGA 4AMVA 3G85A 3UXEA 2DPYA 4PX3A 1GPYA 1OXBB 4Z99A 4B34A 1JFFA 2DWPA 1W19A 4GF5A 4DZRA 2A9JA 1X0VA 2YRFA 3RTGA 1E99A 2G04A 3GIWA 4UBJA 1G9SA 1Y33E 3LUDA 4KYUA 4OK3A 3GFPA 3I8XA 4WACA 3ZE6A 4AUEA 5HUHA 4GE0A 4G36A 1PE0A 3OJ0A 4WJZA 1BX0A 2HC9A 4Q9LA 3U6BA 4PYKA 3ESBA 4JASB 1C7ZA 1S2DA 1RU3A 1K9SA 5CX1B 4CQMB 3RYHB 4V1CI 5MFZA 1T9KA 1VQ1A 3GFVA 4JC0A 1YS7A 2XGOA 1CR0A 4Z1MA 1OZAA 3F4KA 5ICMA 4E3WA 4U5XA 3T99A 3O91A 4QWMA 3D4BA 4JS0A 3SE7A 1G8SA 1T43A