1U81A

Delta-17 human adp ribosylation factor 1 complexed with gdp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
164
structure length
164
Chain Sequence
MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor 1
publication title Conformational changes in human Arf1 on nucleotide exchange and deletion of membrane-binding elements.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 41
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2004-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1u81A00
1IN7A 4F4IA 1NF3A 1YRAA 4QBIA 5FBVB 4HDCA 2ZSBA 3BC1A 3QPVA 5FTJA 2BJVA 3QG5A 5KPJA 3OE7A 2AD5A 1JB1A 1E1QA 3QPUA 4HUQA 221PA 1E2LA 4NYIQ 1XEWY 1W36C 1T6NA 2PZFA 2ZSDA 4YMWA 1OHHA 1DAGA 1LVGA 2RH5A 2NIPA 1H8ED 4PZZA 4JLVA 5KU1A 4BGDA 3IIMA 2OSBA 3BAFA 2HLDD 2XSZD 1N6PA 4HEJA 4LJ6A 2C5LA 1Z28A 4R2HA 2OCBA 4IFEA 1Y3AA 2ATXA 2QU8A 1YZKA 5FR2A 3W6PA 1QVRA 3QOFA 1DEKA 5EXPA 1N5JA 2HUPA 3BD9A 2C03A 1KTVA 2YWEA 2ZRFA 2BIFA 2XOKD 2GEDA 1DAMA 2QP9X 2ZVPX 4W9MC 2B6HA 3K70C 4PAQA 3OFNA 1HQCA 3LV8A 2XTNA 5DIFA 4DLXA 4UQOA 3WRYC 5JJKA 3X2SA 2FFQA 1VDZA 2W6JD 5JI2E 1XZPA 3IHWA 1M1YE 1U2RA 5DH9A 3UWOA 4HYYA 4NMMA 4X8HA 2REBA 2XXAA 1E2KA 4EFLA 2CEAA 3TRFA 3EC1A 4BUJA 1DAIA 1UM8A 5E7JA 4JLNA 5EXTA 1LF0A 1NMZA 2WJHA 2GXSA 5LD2B 1SVOA 3NC0C 1YZGA 2GK7A 2IX3A 2CE2X 2QGZA 4NYMQ 4CF7A 2ZYUX 1QHIA 1JPJA 5FPYA 1YJ5A 4BFUA 4TZ0A 1EFUA 4M1SA 1KDPA 4L5BA 2F7SA 1JAIA 1QDEA 2SHKA 3QBTA 4A0FA 3DKVA 4HLDA 4A8JC 2JASA 2IXFA 1ANKA 1E2GA 1FUUA 1LS1A 2PLRA 4HAWA 4M1OA 2RGGA 1SKQA 2QEQA 3CKLA 5G53C 3U2QA 4Q01A 2JLXA 2GK6A 3U4QA 1CTQA 4BLOA 2FV8A 1ZRHA 4TMXA 2EFHB 4TMWA 3IHLA 4ZCLA 4Z8YA 3GJ7A 1KKMA 3TQFA 4JZKA 2VA8A 2PMKA 3FMFA 1GZSA 5EXXA 4P3YA 4BRUA 2J46A 3FTQA 4E22A 4V0MA 3T12A 1E9RA 4OI2A 1K6MA 4HAXA 2G0TA 3CPHA 4DIDA 2ASEA 2XZLA 4AD8A 4JBWA 3NBZC 3A1VA 2ZJAA 3CW2A 4Q1CA 4YDSA 1U9IA 1F3OA 2IW3A 4UJ5A 4B73A 4HZIA 4D25A 1PV4A 2IYZA 1BYIA 3LBIA 4RY2A 2KE5A 4Q9KA 2J0SA 1WQ1R 4Q1AA 1X8LA 4PPFA 4DUGA 1DAFA 1WB9A 2ZVQX 2IK8A 4M9QA 1RJ9A 5DLQC 1AKYA 4YLGA 3LW8A 5KNCA 2HJVA 4ZDIA 5KTYA 1CJTC 121PA 5BQ5A 2ZREA 3FE2A 4URUR 4EQ6B 4LJAA 4KLZA 4B34A 3GLIE 4QHYA 4RKEA 5FBWB 5FH9A 4RZXA 2OV2A 2IYTA 2RKOA 4XVQA 2J0UB 4JVNA 3FKSD 3FGNA 1GL9B 4JBXA 1KSGA 3QUSA 3M6AA 1KSFX 5CYPA 3TR5A 3ZJYA 1G19A 3KTAA 3RYTC 3SNHA 4TT3A 3IIKA 5C4MA 1GM5A 3VX4A 1IJEA 1CR0A 1GITA 3GLHA 4BQSA 3LW7A 1ZC3A 1SVSA 2VRWA 5B2ZA 3LX5A 4DZZA 4DDVA 3EZ9A 3UANA 1N0UA 5FPTA 2ZUCA 4ZI3A 1AZTA 4CT5A 1KI3A 3TSZA 4LWZA 1DAHA 1DAKA 1GRQA 2GVDC 2W0MA 2V4ZA 4LYJA 3B9PA 3HU3A 2ODNA 2BBWA 1S4QA 1OPXA 1EGAA 3MGCA 1F2TA 3KQKA 2QSYA 5H68A 3LXRA 2BWJA 2E1RA 4GOKA 2WMOB 4BEBA 3A58B 3K9NA 1GUAA 4K81B 1A2BA 1XB2A 1OF1A 4DJTA 3P20A 4AKEA 2ORVA 2PLFA 3H1TA 1L8QA 4M1KA 4KXFB 5LPNA 1J90A 4PC7A 4RFSB 4RZ3A 2ZRGA 3Q85A 1HY3A 4BWYA 4F4CA 2ODWA 1BYUA 821PA 1EFTA 2GCNA 4GOXA 1E69A 2O0JA 2VP5A 3QKSA 3SHWA 1SVKA 3IO5A 1XJQA 2W2VA 4M9SA 4DB2A 1DVRA 5G40A 4K46A 3BBPA 4YMVA 4BFYA 2MSCB 3W3ZB 2QPTA 2ZRCA 3FPAA 2QTFA 4WBSA 4PTLA 4RKFA 2I3BA 1IXSB 4CDGA 4E09A 5FBLB 4NDZA 2OCYC 2WICA 1OFTA 2ZR9A 1R6BX 1ONBA 4M9ZA 1YZLA 4HB0A 3LA6A 4MRNA 3Q5EA 3VMFA 2RGEA 4BLTA 5BN5A 2HCBA 5L3VA 1XU4A 3AVVA 3H0KA 2WSSD 2J7KA 4Z1MD 2PEYA 2W2TA 3RS0A 4CEJA 5JS7A 3S1AB 2QTHA 4OQNA 1L2TA 1VPLA 4BZPA 2NO9A 2FN4A 4JVLA 4F38A 3AVTA 3B8HA 2GZAA 3NVAA 4HAYA 3QF4A 2GEVA 4IW3B 3PQCA 2QBYA 3DDCA 3OIWA 3Q8XB 5J47A 4NYJQ 4TSFD 1HTWA 2D06A 3C5HA 3J81k 1N0WA 3GFPA 3Q9LA 1CRQA 2IYYA 1G6OA 2ZAOA 3VR5A 5CK4A 5ANRB 4MDFA 5JZVA 1ZD9A 2GXAA 1KI9A 3IBYA 2K5UA 4P32A 4TL8A 3KQUA 5FI0B 1E2NA 4PPNA 2YVUA 4TLBA 4B2LA 4B74A 4C2TA 1ZIOA 4TMVA 1J8MF 4FI3C 3CZPA 1I4DD 2I4IA 1TX4B 4FMBB 3BRWD 3I61A 3IUYA 2O8DA 4L9WA 1S3GA 4MA4A 3I62A 4AIIA 4PQYA 4D80A 3ZZTA 4AKGA 5BYKA 1L4YA 1W0JA 4YONB 3NHBA 2RHMA 2ZYTX 2KSQA 4M1YA 2ZI3A 4M22A 5TV2A 2FSHA 3B9QA 1NSFA 2OM2A 4Q4AB 5JSZB 1Q22A 1ZD1A 2D2EA 4DCUA 3TW4A 3CNOA 5GJVC 3VR3A 5K8IA 2CHVA 1FZQA 4KBGA 1IONA 2DFLA 3PJRA 2L0XA 3FWYA 4FIDA 3QVVA 4FD2A 2ZJZA 1T8UA 5L3SA 1U99A 1QRAA 1X1SA 4UNSA 4BZXA 2PEZA 1VYUA 4LC1A 4LRWA 3B60A 2OCAA 2O0HA 3P4YA 4CYMA 2C99A 1WP9A 3CM0A 1TF5A 4EKDA 2GHIA 4PX9A 4B35A 2ORWA 3PENA 2W83A 3MMPA 4KBFA 4PQRA 5KNDA 3P27A 1HE8B 2R9VA 5HKKA 1HYQA 3SEAA 1L7VC 1R8QA 2R62A 2NTYC 2IUUA 1EXMA 1NN3A 2ZSAA 4ESVA 1E9BA 2WPDA 1AK2A 3GEEA 1UDXA 4TMTA 2OUKA 3K0CC 1Q3HA 1TMKA 4ZI2A 3N2IA 3RSOA 2EW1A 1XJ0A 4AKIA 2DY1A 1FMJA 2QQEA 4LJ5A 3HPRA 4LHXA 1ZMXA 3MUFA 5AWFC 3UMSA 4D0GA 2LCFA 4P4TA 2IEZA 4YMSA 1HH4A 4Q66C 1ZNWA 3ICEA 4PPGA 5LBIA 1FNNA 2ZITA 1KK2A 4MRSA 3E1SA 3FFBA 4D4MA 3D31A 1BO6A 1J70A 5EE5B 3T35A 4JLDA 3GPLA 4IXMA 1D2EA 1RRCA 2J45A 4LGMA 1GFIA 5JLJA 3UG6A 1DARA 2YKGA 4GDFA 1SKYE 4Z51A 5DSZA 2ZU0C 5BXQC 1Z07A 2G6BA 2FJUA 4Q5IA 2KBEA 4E07A 3GLIB 3CB4A 2ZPTX 2O8FB 4WVFA 1E4YA 2DWPA 1EFRA 4JLKA 4DUGD 3EPKA 4P4UA 5KSYA 3QXCA 2GF0A 2O8BA 2GEUA 4PFSA 5KHOC 4KJZA 4JS0A 2XITA 1XBTA 1WMSA 2ZJ5A 4LYAA 2F3RA 3C15C 2QY9A 4IOJA 4LCBA 2QAGA 4XD7A 1D8TA 1DE0A 4E5UA 3C14C 4M9XA 2GVZC 2WKQA 4JMPA 3L43A 4PHTA 4D4KA 4WAUA 4GP6A 2NGRA 4XVUA 2W6IA 3MWLA 4GPTA 4XWAA 4F7WA 5JI3E 2P3SA 4BFWA 4D0NA 1VCNA 3GD7A 1LW7A 4TT3D 1KZGB 5J4HA 1KK1A 1CJVC 1NJGA 1VHTA 2JAQA 1D5CA 3B85A 3U3OA 2BV3A 2BMJA 4LHZA 3BB1A 4KCGA 3Q7PA 3MRSA 3RRZA 1CXZA 2VP9A 5IF9A 2G88A 5CYOA 2HLDA 3JVUA 2IHBA 2A5FA 4MQBA 2BHRA 2WV9A 3X1YA 2IS1A 2GJ8A 4YMTA 4XOIA 1K5DA 4UJ3A 4OK3A 2H5EA 2ZTSA 2Q9CA 2VYFA 3IQXA 3CO5A 1S1MA 3QXXA 4URWR 3SHFA 5CB8A 1NL3A 1U90A 3U7FB 3AP2A 1LFDB 2V7QA 3ZVMA 3QEOA 1PLKA 4DDTA 1OIVA 4IDPA 2CMKA 5BYJA 2FZ4A 2GF9A 4BRWA 5FL3A 3PEVA 4MRRA 4B3GA 2QP4A 3DKPA 4QC2A 5EZ6B 5DYGA 3EWSA 4W5WA 4ERNA 1IY2A 1NG1A 3DO6A 3GJ5A 5JHGB 4PHHA 8OHMA 4UNRA 4B3XA 3GLFE 1KO8A 1VMAA 2JATA 2KI5A 3CR8A 2OEPA 5SZHB 5DHFA 5LB2A 1U9IC 1KY2A 3TE6A 1DO2A 2WJJA 4Q00A 4RFSA 3TMKA 2GRJA 2A5DA 4MGKR 4DKXA 1OFIA 3PITA 2QM8A 3T15A 2C96A 3CX7A 4MKIA 2YV5A 1CJUC 3M4YA 2N42A 5ELXA 1XPRA 2H16A 4M53A 4C0BA 1N6IA 1P6XA 1LTQA 2IYUA 2ZRMA 4OQFA 4TYPA 1LB1B 4XIGS 3AVYA 1J2JA 2MSDB 2CBZA 5CJPA 4G01B 2XNDA 1AGRA 2R44A 3U4QB 2OHFA 4JIMA 2MSEB 3IDQA 4FCWA 1WDTA 2ZRHA 1PJRA 3THYA 3U3MA 3O8DA 4Q02A 4IDNA 5CIWA 3ZQJA 3LDAA 2VBCA 3KXLA 4AG6A 1T5IA 4B44A 1FTNA 3KB1A 4BEJA 3T1OA 4W5JA 1UAAA 4U5XA 5EE1A 3U60B 3EC2A 4EUNA 5BWMA 4JSYA 1P2UA 1PUJA 3TSOA 3WNBA 2FSGA 2P0EA 4YMUA 3NEJA 3EPHA 4US0R 1NLYA 3EIQA 5C18A 3S1AA 3WBKA 4D81A 1E6CA 2QENA 2WMNB 1TF2A 2LWIA 5DN6A 1P62B 3RABA 4Q7MB 2JJ8A 2OESA 1T3HA 2RAPA 5IK2A 3ZLJA 4NKRA 1CJKC 3DL0A 4Q9IA 2YINC 5IT5A 1I4LD 1HA3A 1RJ9B 2JIZA 1OB2A 3FMPB 3MWKA 1MT0A 1CJMA 1A5TA 4KFSA 3ZGXA 2CVFA 1GNRA 3RS2A 3EARA 3EIHA 3NDBB 1E96A 3KUDA 5J4LA 3L0IB 4MITA 1HURA 1G8HA 4HB2A 1G4AE 4NU0A 4QBFA 1GTVA 1KZ7B 1UKZA 1XCGB 3AUYA 2ZI4A 2A78A 1PVOA 3W8RA 3DZDA 3WYAA 5EE9A 3RNLA 4YDHB 2VHUA 1VHLA 1W0JD 2EYQA 2RGNA 1EG7A 3WP1B 1DG1G 3KJIA 1MKYA 3TJZA 3QKRA 4AURA 1R5NA 2XZPA 4HAVA 1OW3B 1G21E 4TZ6A 2WIAA 4HSEA 2V54A 2NZ8A 2QRZA 5JSZA 4EJSC 1WBBA 1T4GA 3BERA 5FPSA 2RHDA 2JLYA 4F91B 1MRSA 1EFHA 2GDJA 1YR9A 4IRUB 1XMSA 4BFSA 3AP1A 3BFVA 1P2VA 3SJBA 2CE7A 3UIEA 4HI0E 5AJYA 4FCTA 4XTRA 5F3WB 2ANBA 1KMQA 1XPOA 1EWRA 1Z83A 1SULA 2AXNA 2YYZA 3AVQA 2C8VA 3K0EA 2V1XA 3U44A 1G3RA 1MR3F 4DSUA 2VP4A 2Q3FA 4PO9A 2Q0HA 3QXHA 1UKYA 1ZP6A 2VQSA 4BLRA 1AJEA 5AUOB 2VH5R 5HKKD 4QM7A 1E0SA 4MRPA 4DWJA 2IC5A 1KGDA 2A5GA 1P61B 1QHYA 3ONWA 2F1HA 3R7WB 2JEOA 2WPDD 3DPUA 3L0SA 3GJ0A 4BFTA 1KJWA 4IOMA 3VNUA 1ZBDA 4IEIA 2PBRA 4KFTA 4LYFA 2NZJA 4WW0A 1ZUNB 1JQJC 1IXRC 1WF3A 2CVHA 3E70C 2VP0A 1E2HA 4L9SA 5CM8B 3THOA 421PA 2QM7A 4PAOA 4JKIA 3LFUA 3VHXA 2GJKA 3NBXX 1Q0UA 1OFHA 1ZCAA 2GTPA 2QROA 3TUJC 4EPWA 2FU5C 1M2OB 1S8FA 2EFEB 4CEJB 2AWNA 3MCAA 3CWQA 4LV8B 2ORIA 1CU1A 2QORA 1P72A 2WSSA 4Z1MA 4R7ZA 2CLDX 1P4SA 1XTQA 3QF4B 1RIFA 5JWRA 3FB4A 1COWA 2QBYB 1R10A 4FN5A 2J0VA 4LOAA 1G7CA 4MRVA 3SFVA 1BKDR 2C9CA 3BOSA 1GVNB 2NOAA 4IDHA 4TYQA 2FFAA 1EFRD 4Q48A 1D9XA 5SZIA 1XNJA 1GL6A 3WY9A 5AUPB 3W34A 1W4AA 2BBTA 4D4LA 3LLMA 1N0VC 3THXB 4FWTA 4PXAA 4X8OA 3KQHA 2D3WA 5GJCA 4DRZA 2ZRNA 3T61A 3CLVA 1UKEA 4JKYA 2PT5A 2BBOA 3Q72A 4TN1A 3CX8A 1E79D 2W6ID 4AYXA 2QGNA 4V03A 2O8DB 1Z0IA 4EDHA 2X77A 1GP2A 1XRJA 2XEXA 2ZUBA 2AR7A 2JCSA 1BOFA 4QG7A 4O2RA 4MGIR 3AKEA 1WRBA 4RD4A 3SYLA 4A2PA 3U3KA 4QJ3A 5LD2C 3IEVA 1GDDA 2VHTA 2W2XA 2P5SA 2OLJA 1E2IA 1PZNA 1YR7A 2X8AA 3LVQE 1M6NA 2IEYA 3LY5A 4NYIR 2WBLC 2B8TA 3BB4A 4KYUA 4G3XA 1E9AA 4UXHA 3LBHA 1TQ4A 1XEWX 621PA 1GAJA 2ZU6A 1IOZA 3KKQA 5L3SB 2V7QD 3WMGA 1AGPA 1G7TA 4ACBA 1LNZA 1R0WA 4WZBE 2FFHA 1NY5A 4HB3A 2YJTD 3RWOA 3K0SA 3DM5A 1P3JA 1SQ5A 4A1FA 4UKDA 4TLCA 3PG5A 3SBDA 4AWXA 1T0HB 3BGWA 1DO0A 4LJYA 1T3SA 2IYVA 2JLRA 3W6NA 5EE0A 4EPVA 2GZHA 2R6DA 5KYKA 4YXWA 3O8RA 1YZUA 4MGZR 1G1MA 3QQ5A 4W7SA 3GP8A 2IXGA 3N70A 4GBMA 5DO9A 5C46F 2YNMA 3EWAA 4N0DA 4EPYA 1G8PA 3B1XA 2QMOA 2R65A 2VSFA 2GKSA 3CH5A 4V0LA 1KNXA 1TAGA 2BKEA 4B3CA 4O0MA 4TWZA 3VNVA 1CS4C 3SFZA 4PANA 4HLCA 4B43A 1NP6A 2DBYA 1G64A 2QAGC 2XNDD 3FDIA 3VFDA 4TYWA 3CRQA 3AV0B 3W8NA 4QKQA 4YQFA 5GADl 4NPHA 3RSLA 1E2EA 1G5TA 2BCJQ 2WKRA 2CJWA 4EPTA 3HPQA 3LQQA 4B3BA 5JEDA 3U3RA 3KQNA 2YWFA 2E87A 2YWGA 3WYGA 4V0NA 3GJ6A 3I8SA 3MD0A 4ARZA 1K8RA 3VHLB 1N5KA 5BN3A 1FTSA 2GILA 3TKLA 4UNQA 5DN6D 5BN4A 1G291 1RRPA 2CL0X 2OBLA 5FUWA 4JBYA 5IK2D 1FX0B 4DB4A 1KI2A 1G7RA 1JR6A 5FPKA 5HR5A 1WE2A 3A8TA 5KSOA 2CHGA 1N25A 1N6NA 3CF6R 2O8BB 2JIZD 1FQKA 2XX3A 1DAEA 1E32A 3NH6A 4FXPA 4JT2A 1W48A 1KO1A 1Q1BA 1YHNA 2F9LA 4C7OB 2IS2A 2ONKA 2QAGB 3LNCA 4MYUA 2G0NA 2A3RA 3GEHA 4OK6A 2O8EA 4ZCIA 1KI6A 4OHYA 2ZRPA 5K8TA 1SVWA 5H1YA 4Q7LA 4RD2A 4PSAA 3PUYA 2PX3A 3HR7A 1G18A 1ZYUA 3D7MA 3LH5A 3Q7QA 4CEIA 2QT1A 1VG9B 2UZIR 4JLPA 4JVMA 4HAZA 1FW6A 3KKOA 4PZYA 4RZ2A 1TTTA 4M0LA 4C4PA 4ILEA 5A0FA 4B2PA 4J0QA 4GL2A 1AQUA 1YE8A 3A1SA 1Q44A 3AKDA 2W0SA 3U3JA 3CIOA 3VKWA 4M8NE 2B8WA 2AHOA 3SJAA 3ADDA 3SE0A 3JZAA 3RC8A 1TPZA 5LB4A 3L2OB 3BORA 1CIPA 4QGGA 2Q9BA 4ZKEA 2D7DA 4AC9A 2FEOA 3B7GA 1R2QA 4RJLA 4D2IA 4OHXA 1RRFA 1D6JA 3OESA 3I4LA 2ZQ5A 1KK0A 2IYWA 3W6OA 1TQDA 5GJBA 2F1IA 3KZ1E 3P4XA 1JALA 3AVOA 3VAAA 1E0AA 1N5LA 3L8YA 3H86A 4WZ6A 2QPAA 1JNYA 4LHVA 2EVWX 4GP7A 3AF4A 4JLAA 5L8VA 5CDFE 4BPBA 1E3MA 5HE8A 2QT0A 3LBNA 1KJZA 1MH1A 2VSOA 1ESMA 3DEFA 4AYTA 2P6NA 4PC6A 3NH9A 2LKCA 3AH8A 5FOTA 3KJEA 5F2EA 3R7WA 3U6BA 3ZIAA 3TIFA 3K9LA 4NCIA 3ADCA 4LPKA 4N0EA 3THYB 2BOVA 2WWHA 1NG9A 5AJVB 5HE9A 1DBSA 1X86B 1GNQA 5AUQA 4OHZA 1IJFA 1FUKA 2WJGA 3MWJA 1UBEA 3E5HA 5TDHA 4TTRA 4URVR 3GJ4A 2P2LA 2H17A 2RGNC 2AKAB 4IVPA 1JEDA 1XTIA 2ONJA 1KI4A 2E9SA 4ITRC 1W2HA 4BZQA 2BMDA 3IBGA 4A0GA 1IN8A 1COWD 1TADA 4OL0A 4NH0A 5H8WA 1HQYE 4Q4HA 4IFBA 4OKSA 2X2EA 4BLPA 1UEJA 4XWOA 5F9HA 2N1BA 4URYR 3W3AA 2EFDB 2H57A 4BLQA 1VTKA 4Q1EA 4QHTA 2J0QA 4L8GA 3IQWA 4TMKA 3I73A 1I2DA 1I4TD 1KSJA 1L4UA 1XEXB 1Z6AA 1X8KA 2AKYA 2PT7A 4GNKA 3FVQA 1EFCA 1XMIA 3KJHA 3KL4A 5J40A 1A82A 1IQPA 1TEXA 2J41A 4IOLA 3QE0A 2BM0A 4PHGA 3TVDA 1U0HC 3THXA 1NVXQ 2PZEA 4A2QA 4TLEA 3AEZA 3GJXC 2NG1A 5B30A 3V4RA 2HT1A 3IILA 3K0AA 3EASA 1QHHA 2IF0A 5TMPA 3GLGE 3EA5A 1N6RA 3EX7C 3RAPR 3ZD7A 4US2R 1P2SA 2PCLA 2P6UA 1IN4A 4N1AA 1CF4A 2ZRBA 1SXJA 5CK5A 2GBLA 3HJNA 4LBYA 2ZETA 4LHYA 3QKRB 3V00A 2JJ2A 1A1VA 3KUCA 3MLEA 5EQTA 3U61B 3DOFA 1W44A 3TBKA 4B2IA 1CRPA 2OXRA 4PR0A 1Z0FA 4NCHA 1FNMA 4R71A 1XTKA 3NBFA 3SU8A 5DGXA 4D26A 4C0JA 2EYUA 4NP6A 4WA7A 3MSXA 2WHXA 2P5TB 1CP2A 2V8OA 4WZAE 1IAQA 4FINA 2NMVA 2CXXA 1XEFA 2PJZA 2C78A 3TSWA 2WKPA 3BWDD 3NTUA 4PSVA 4QNRA 4CVNA 2Q9AA 5M04A 5JBQA 5HPYB 1W0KD 3GLFA 4LDJA 1W7AA 1WXQA 5IRCD 1QHNA 3U44B 2HDNB 3GMTA 4RD0A 2BEJA 4JYCA 2Z5FA 1GSIA 2VLIA 3AQ4A 4RD6A 3R8FA 4PQFA 3KJGA 3T5GA 4YXWD 4FW9A 2H8KA 4DDUA 3LAWA 1Z6GA 1KKLA 1NKTA 2JDIA 1KK3A 3WMFA 1YU9A 3T1QA 1ZAKA 2FWRA 4TLDA 1MOZA 3SJZA 2XGJA 3IIJA 1Z47A 4F93B 3PV0A 5AK0A 5EE3A 1N6HA 1NMYA 1Q20A 1KNQA 1I2MA 1W4CA 3X1WA 4BE7B 1P7CA 1Q3TA 4LJ7A 4QGHA 1E2PA 2V1UA 1N6LA 2FPMA 5EXSA 1SGWA 1EX6A 2DWOA 4PHFA 1FQJA 1OH7A 5FOVA 2J59A 2HT6A 1S2MA 1AZSC 4QGFA 2D4HA 3U7GA 2WJYA 1U94A 2FE4A 3GCGA 2FH5B 4DLSA 2F55A 5FR1A 4L16A 5JRZA 5JFGA 1ZD8A 4B47A 1JXMA 4CIDA 2C2HA 2YC2C 1IBRA 4V0KA 2UKDA 2YOHA 3MAAC 4PC3A 4B3DA 4DSNA 3LQRA 4DLTA 3B1VA 2IYRA 1M7GA 1W46A 3BH0A 3JVVA 4EAQA 1FX0A 1GG2A 4PZLA 3B78A 1E94E 1JBKA 5AJWA 3RRMA 3ZVLA 4DCNA 4MYTA 2GXUA 3B1WA 1VIAA 3EZ2A 3P26A 1TU3A 4C7OA 3QY0A 1IY1A 3OEED 3F5FA 1FPMA 2FSIA 1ZNYA 3LXXA 2IXEA 4ZV4A 4C0QC 2BMEA 3A37A 3RC3A 2G1JA 1AM4D 1XP8A 2DWQA 3ZS8A 2ZI7A 4B32A 4NZYA 1E79A 1HT2E 4ZPXA 1R5OA 1OSNA 1XWIA 1Q1EA 1NSTA 1TUIA 3AKYA 2MMGA 2NQ2C 2NPIA 3CH4B 2YOFA 4Q1DA 4R9UC 4RD3A 1BH2A 1YR6A 5FOWA 3TW8B 4A15A 1IXZA 3NC1C 4LJ9A 4TYYA 2XJ4A 3B2EA 4Q18A 1UBFA 5AJZA 4KAXA 2IWRA 1G3QA 1Q1ZA 3RS3A 2Z0MA 3UMRA 4A8JA 3A1UA 4GFDA 3LRPA 3C7KA 1SXJE 2HV8A 4ON9A 2RGXA 1NN0A 3G0HA 1IN6A 3SDZA 1NRJB 4IEEA 2WAYA 3OIUA 1SVMA 3AF3A 3JZMA 2VL7A 4GRAA 3RANA 3RWMB 1FP6A 4A0RA 1LV7A 4O3MA 4C0HA 3LD9A 1GIAA 2ZJ8A 3ASYA 2CNWA 5E3HA 1ZINA 2IYQA 4Z54A 3DMNA 1NVUQ 4JT4A 1Y63A 2YHSA 3EG5A 2JJ1A 1Z2AA 4EPXA 2FZLA 4B6FA 1RRGA 4MYHA 3X1XA 4NCKA 4H1VA 4OBEA 4U7DA 4M1WA 1PUIA 4WXRA 3CONA 3SYNA 2GWHA 4MUBA 2J87A 3HDTA 3IO3A 5DI3A 3TNFA 4LBWA 5EZ5A 3ZYCA 4JYBA 3R8CA 1KDOA 2AD1A 2C95A 1DELA 3SI7A 4I81A 4FMCF 1U98A 4LBZA 1QHGA 2WWIA 5K8UA 1F5NA 3PFIA 3TK1A 2IHYA 3BFXA 3FMIA 4ZDJA 5SZJA 3WYFA 2B92A 3EW9A 1VYVA 2HYDA 3QJYA 5GVSA 2WTUA 2Q6TA 1OB5A 4M2LA 1RPZA 4A4DA 5JJIA 1DOAA 3ZIAD 1SHZA 1G5RA 4UXIA 2CDNA 3PEYA 3ETLA 1WCV1 2CJWB 2FOLA 4LJ8A 1S1CA 2VP6A 2W00A 2BKUA 3SR0A 5KDDA 2C04A 1B0UA 2OBNA 1SVLA 4XSGA 1P2TA 3ASZA 3G5UA 4D6PA 4DXAA 3A6PC 2WAXA 4ARZB 2FDCA 1XFAA 4AG5A 5CLQA 1ZUHA 4C0AC 4IVRA 1XCMA 5HCNA 1OH5A 3AF0A 3F0TA 4KSCA 2KB0A 3CRRA 1KHTA 4B48A 1E2DA 1FMLA 5FOSA 2GJSA 5FTMA 4LV5B 4DBLC 1LS6A 4A6PA 1B23P 1XMVA 1Q1QA 4HB4A 4HZUA 3GLGB 1QVAA 5EUMA 2F1RA 2O5VA 3CR7A 1JEEA 2EU8A 5L3QB 4U00A 1XEXA 1IHUA 1GL7A 4EPRA 2O8EB 2ZANA 1T0JB 1KI6B 2CLSA 2WIBA 1N2CE 4QNMA 2QTVB 2BBSA 5KDLA 4HDOB 4KI0A 1G20E 1JXOA 1OXSC 3KKNA 4RD1A 1VG8A 3EPLA 1G8GA 2NO7A 1IM2A 3AVPA 4KU4A 2X2FA 1H65A 1XDBA 3VR2A 1UPTA 3PUZA 2D7CA 2ZR0A 1JR3E 3TAHA 1SXJD 1R0YA 2ZE6A 1S9HA 2ZRIA 4F4JA 1JJ7A 1N6OA 1XPUA 2JJ2D 4IHQA 3RRNA 5TB5A 5GVRA 2G9NA 4DC9A 1YVDA 3EA0A 4OYHA 1Z63A 2D2FA 2VPPA 4POAA 3BFKA 1Z08A 2PL3A 2R2AA 2OAQ1 3U7EB 1N5IA 2FPKA 2WWWA 3ND9A 2FGJA 2ZJ2A 1KDTA 4V02A 1TL7C 3BJIC 4E03A 1MABA 4A92A 3R9XA 2WJVA 4JLMA 2QL6A 2EWWA 3CNNA 4NTZA 4ASUA 2IYSA 3R9IA 2XTMA 4JL6A 3GFTA 3M0EA 3RVBA 3ZS9A 4CEHA 1SHKA 4D0LB 2IT1A 4LJ4A 4NHOA 3DHWC 2EFGA 3PEUA 2XB2A 2GNOA 1WBDA 3DMDA 3G82C 4BFXA 4KODA 3SQXA 4GZLA 1R4AA 1D2NA 2ZYVX 4LK2A 3X1DA 3L0PA 3W5IA 4TQAA 1G8FA 1H8HA 4HLQB 1E1RA 1W4RA 1NVVR 2JDID 3O8BA 1NIPA 3PIRA 1RFLA 2WJIA 1A4RA 1CULC 4WXPA 4QRHA 3QEJA 5CITA 5DNYB 1F6BA 1Z5ZA 2B7CA 1KIMA 5FBRB 3LX8A 2VEDA 4US1R 2V3CC 1OKKA 4XVRA 5FUYA 3EZ6A 1TF7A 3T5DA 3LWNA 3B6EA 1OXTA 1WA5A 1NIJA 3REGA 5JEEA 5E95A 1X8JA 1SKYB 1W36D 2ZROA 2DCUA 1P9WA 1W5TA 3QVUA 2GBLC 4JL8A 3X1ZA 3AKCA 2VHJA 4K8OA 2BJWA 4Q1FA 1OH8A 3K9GA 2QPOA 4IDQA 4YC7A 4TL6A 2P65A 4Q4HB 1JJVA 4LYHA 1VKJA 1C4OA 2WSMA 4Q9HA 4Q9JA 1S9DA 2KWIA 3SOPA 3U6KA 4QL3A 2X19A 3GJ8A 3TGPA 4JJKA 4QFMA 4Y0AA 3KXIA 4AK9A 1VG1A 2D62A 1HV8A 1NLZA 3BH6A 3K70D 1S3SA 2QN6A 1KSHA 2VF7A 3EIEA 3QF7A 1YZQA 2PX0A 3CRVA 3I5YA 1YZTA 3NDPA 3P32A 2GXQA 4RCZA 4MDEA 4A36A 4RZUA 4LUCA 3L8ZA 2HXYA 1RVDA 3FHOA 3K0AB 4S2EA 1QHHB 2CK3A 1VIYA 3C8UA 4G5OA 3NIBA 4JL5A 4MKGA 4QJ4A 5AJXA 3VTKA 2XJ9A 4LSGA 4DVGA 1GOTA 2FA9A 2CHQA 4KFUA 2J7PD 4KO8A 3V9PA 4DLVA 1E99A 2JLVA 4DT1A 5TXGA 1SXJB 3QXJA 1IN5A 3K0FB 3B1ZA 4LHWA 4PPQA 3UMFA 3NEYA 4A9AA 1ZM9A 2JA1A 2ECKA 521PA 5TY0A 4QGAA 3K53A 4MUAA 1GKYA 1YKSA 1OH6A 3K0CA 1FP7A 4KYIB 5DISB 1RYFA 1MO3A 2ZSEA 5JWOA 4XTCS 3MJRA 1CLUA 1E0JA 1U81A 2QZ4A 2OFXA 4L4UA 4S35A 5HZHA 3GLFB 1C9KA 3SBEA 2CNWD 5B58C 1Z3IX 3RHFA 3I8XA 1OT3A 1W0KA 1VG0B 2JJ1D 4ZO4A 2EFCB 2FPLA 4BASA 3ADBA 3B82A 3D6TB 3AF2A 5CDFA 3R20A 5JECA 4DLYA 3A4LA 3MWYW 1Z0JA 2C9YA 2QQ0A 4P0TA 2AFIE 3FOZA 2AXPA 1Z6TA 1OXVA 2VHCA 1QHSA 2G77B 4MH0R 3A4NA 4OQMA 1QHXA 2QUZA 1PLJA 2FX3A 5E4FA 1R0ZA 2Q21A 2WVJA 1D9ZA 1Z6YA 1E9EA 1W4BA 4CZ2A 4G1UC 3TR0A 2YZ2A 3BB3A 4Q4JA 1Z29A 4OQLA 1W47A 1TQ2A 3HR8A 2DHRA 3B5JA 2Q3MA 2PH1A 4NCNA 4B76A 5JCPA 3KX2A 3O8CA 4CW7A 5JCZA 1K5GA 4P4SA 2F43B 2J3EA 1ESNA 4NYMR 2ZRKA 3H84A 4KHZA 1XX6A 2XB4A 3IPXA 5KPDA 1U0JA 2ZI5A 2G3YA 2H7VA 3IKJA 1W36B 2FMXA 2ZS8A 1QF9A 3K1JA 3TUZC 2LKDA 4I99A 4OQXA 4QXAA 2AL7A 4D82A 1XCPA 4KVAA 3AP3A 2ZIAA 2GAOA 1ZJ6A 2IUSA 3A1TA 4HUTA 1FOEB 4QBGB 3UPUA 3BH7A 1BS1A 2ZRLA 5GJWC 3D8BA 3C41J 1XTSA 4ZDWA 2IA5A 3PXGA 4QM6A 1KI8A 1R0XA 2ERYA 4BECA 4I1UA 5BW8A 1P9RA 3UG7A 4N3NA 3AF1A 3K70B 4KITB 2QMUA 2R6GA 5IHPA 1QG4A 2RMKA 5HCIA 1U0LA 3GQBA 3GLGA 3CPEA 2IF2A 3L0OA 3BK7A 3WHKA 5L3QA 1V43A 2F1JA 2N46A 2V9PA 3UWKA 1G3MA 1F2UA 3WXMA 4Y0VA 2IS6A 5J5CA 1ZUIA 1KY3A 1YRBA 2GCPA 2Z6VA 3OEEA 3RS7A 1US8B 3QKTA 4KFRA 3C4JA 3PEWA 1KMHA 3FHTA 4P33A 3AB3A 2AN9A 3OF5A 3OIVA 1UBCA 3B13B 3TH5A 1N6KA 3ND8A 3QSYA 2AK2A 1XXHE 1E9SA 1GNPA 1TNDA 1JAHA 1J99A 5SZKB 1YZNA 2DR3A 1OXXK 2QP3A 1Z0DA 5DYIA 1NBME 2VO1A 4XWKA 3QI2A 1ZNZA 3U5ZB 4A6XA 4A8JB 1T5LA 4URZR 4G5SA 3QENA 1RYHA 2ZJOA 3OAAA 3FFAA 1ZM7A 2J9RA 3TAUA 1II8A 4BFZA 1OV4A 1XD2B 1CR1A 4KSBA 4O2LA 2O8CA 2GA8A 3FKQA 2F9MA 4W5HA 4C9BA 4ASUD 5G3YA 4DLWA 4A2WA 4HLUA 2GCOB 4IXNA 1DS6A 3OEHA 3PUXA 2GJ9A 1T8TA 3LLUA 2C77A 1RC8A 5KNBA 2A30A 3C16C 4XJXA 3K8YA 3WBJA 1ZNXA 3SYKA 1C1YA 2O0KA 1UF9A 4ABYA 3KKMA 4WOPA 1AIPA 4EIWA 2JLZA 4DSTA 2F3TA 5DI3B 3RLFA 4OHWA 2BDTA 4DLZA 1W2GA 1H8HD 1V5WA 3VR4A 5JRJA 4JJZA 3VU9B 3AGPA 4X8MA 1E1RD 3SQWA 2PZGA 2ZE5A 2C98A 3KXKA 2YWHA 1JPNA 2A2ZA 2RGDA 1GRNA 1T9HA 3QKUA 1OE0A 5FOXA 5TARA 4TTPA 3ZZ0A 2ERXA 3ZQ6A 4IJMA 2XZOA 1SVIA 3K09A 2RGAA 5FL7A 1NN5A 1OKKD 4QBHA 1G4UR 2VP2A 2QMEA 1E2JA 3AVUA 5DHAA 1UJ2A 1TEVA 4LV6A 4DCVA 3ICQB 3KDSE 3VR1A 5JS8A 1KI1A 3KFVA 5DI9A 4TL7A 3IEUA 2OAP1 1GILA 1P5ZB 721PA 3TVTA 1CEEA 1GKIA 4Q4LA 2IUTA 4C3ZA 1KI7A 1AKEA 2G1KA 1ZC4A 4UNPA 2Q3HA 1ZCBA 2FF7A 2IS4A 4D4JA 2B21A 4DLUA 2R6CA 3WNDA 5J4KA 5P21A 5LDDC 3EAQA 1TUEA 4EJSA 2ZI6A 4GOJA 1O3YA 1U8YA 2HF8A 4HZUB 2NO1A 4I1SA 4L15A 3I3SR 1G3IA 4QHSA 5G3ZA 1MRNA 1E2QA 3CRW1 4ESHA 2EWVA 4OI0A 4I1VA 3P1JA 4IKEA 1DTSA 4FCVA 1M8PA 1CR2A 3HU1A 3QIAA 2J5XA 1OIXA 2REOA 1OLOA 1J8YF 4ZIRB 1VCOA 1DADA 4NYJR 3CF2A 2CK3D 1AQYA 4KV9A 1M74A 5FBQB 1NBMD 5C2JB 1XTJA 1O87A 2QG6A 3OIYA 5EP1A 2TMKA 4FWIB 1RZ3A 3CRMA 5EP3A 1IY0A 3THWA 4V0ME 3W90A 4JSTA 1P9NA 2J1LA 5E7MA 3FMOB 4NE2A 3A4MA 2GESA 2ZEJA 1DPFA 1Z0AA 3K0FA 3REFA 3WMEA 3HYTA 3LVRE 4Q7KA 4M1TA 2H18A 2PCJA 1FL9A 1II0A 2QAJA 4V0OA 1ZIPA 4ZCMA 2ANCA 1AS0A 1HT1E 3LO5A 3WHLA 4HAUA 1MABB 2VTKA 2JGNA 3SZRA 2NO0A 2CL6X 3BE4A 2WM9B 3OE7D 4P31A 1E1QD 3N2EA 4GI7A 4CEHB 2IYXA 2DFTA 5A5GA 2QE7A 2ZRJA 4EFNA 3QPWA 2ZRDA 4NONA 1MO4A 2FSFA 3CUEF 1OHHD 5UKDA 1SZPA 1KDRA 1UEIA 3ZVRA 4LX0A 4PO8A 1VCMA 1P75A 3RRYA 1AA9A 4B3FX 2ZJBA 1NMXA 3BXZA 2Y8EA 4ZDKA 4WIAA 2HJGA 3VR6A 1KO5A 1YQTA 1JECA 1G7SA 1NY6A 1E9FA 3U7HB 4A82A 5J4VA 3GLHE 4H1UA 1N3BA 4CGZA 2JLQA 4JLJA 2FEMA 2OZEA 5AR1A 2A5JA 1UFQA 2DPXA 3OFND 2R6AA 5C4GB 1UBGA 1G8YA 2ZYWX 1Z8FA 3F8TA 3TQCA 3VKHA 2ATVA 4M21A 1EX7A 3N5CA 3PUVA 3ADKA 3AVWA 4Q19A 3GJ3A 4DLRA 2O52A 1R8SA 2AK3A 3ZDQA 2NO6A 2F43A 3PCRB 4MKHA 2JLSA 4G5GA 5HZKA 5KOYA 2I1QA 1G16A 2QMHA 2RGCA 2Z4RA 3AUXA 3D3QA 4TTQA 2OFOA 4C0KA 2OE2A 3UXMA 1GKUB 2IWHA 4CEIB 3AM1A 1TQ6A 4NL4H 2F6RA 1M7BA 4Q1BA 1NNEA 3ZZUA 5JJLA 2WWGA 3T34A 2BC9A 4II7A 2OT3B 3K9HA 1E98A 5DE3A 3VQTA 1S0UA 2PMDA 2UVQA 1G9XA 1Z0KA 1XXHB 2RGBA 1D2MA 4B33A 5CIQA 2HXSA 3O47A 2RB4A 4HDQB 2CL7X 1JR3A 4Q47A 2Z4SA 1QZXA 2QI9C 3SJCA 4GZMA 5CM9C 5JWHA 2BEKA 2OBMA 3PR1A 2ZSFA 2DFKB 1US8A 4DT1B 5AUNB 3MFYA 3I5XA 2GETA 3RS4A 5K8LA 1BMFA 3QNUA 2J7PA 3SC3A 2FFBA 2B7BA 3TUIC 3EZ7A 4EFMA 2Z43A 5D3MB 1OIWA 2G83A 3CZQA 4R2IA 1VYTA 2D74A 2GAAA 3I32A 1G17A 4XSHA 1KOFA 1TU4A 1JQLB 1KJYA 3IGFA 3OAAD 3ECCA 4OJKA 3EXAA 5EP2A 3GFOA 5CJ2A 1W5SA 2VIIA 4MGYR 2IL1A 2ZE8A 2ZE7A 3FHCB 4EQ6A 4HUQB 4URXR 4RFVA 1XD2A 1ZW6A 3M1IA 1MO6A 3OEHD 4DCSA 5CLLA 2J0UA 2V6JA 3EZFA 3NHAA 4Q21A 2GCOA 2R8RA 4PAMA 1A7JA 5FUXA 2WWXA 3H4MA 2OILA 4OJQA 4PSKA 3NG1A 4GMXA 5FTNA 3FYHA 1H8EA 3SN6A 4QOSA 1JI0A 3UK6A 2XSZA 3OHMA 4RSGA 4AY2A 1A2KC 1OYYA 1AS3A 4Q7JB 3AGQA 1E4VA 1KO4A 5E7IA 2FNAA 2XNSA 4RVCA 3MJHA 2WOOA 1CKEA 2NPFA 2QRNA 3VU9A 2XOKA 3BIFA 1M34E 4JLOA 1UKVY 1T91A 2CCJA 1ETUA 4Q4JB 4G5RA 4HATA 4KLNA 4ZKDA 4DHEA 4Q03A 5EP4A 5FOUA 5FL7D 4LBVA 1XD9A 2ODBA 2FGKA 3DM9B 4LI0A 2XXAB 4P4SB 2UZ3A 2AX4A 2W6JA 4PC1A 1AS2A 1E9CA 1XTRA 5FTLA 2GZDA 5D3QA 2RCNA 4X8LA 4Z8XA 4KVGA 1NJFA 1AN0A 5EUQB 1II9A 4DEYA 1W49A 3CWZA 5FI1B 2A7QA 5CB6A 4B71A 2CCGA 2GJAA 4LPSA 4OI4A 4CT4B 4LY6A 1HEIA 4TYNA 4FMDF 2QA5A 1RW4A 1UADA 2BMFA 5KUTA 1G3UA 2IYLD 3HYRA 1X3SA 3CX6A 2A9KA 2P67A 2VF8A 4OK5A 2DFNA 3SS8A 3EPJA 4LZZA 3ZVNA 1ZVQA 1E2FA 2AWOA 5H70A 1GRRA 1S96A 3CBQA 2A5YB 1Z22A 2WZQA 2XTZA 4HLUC 4GT1A 1G41A 4LC0A 3VX3A 3WNCA 1P60A 3QBVA 1OYWA 2DB3A 2JLWA 2OG2A 1F2UB 4BFVA 1QG2A 2XAUA 1KAOA 2ZS7A 4GSYA 4UXJA 3HWSA 1KMHB 1U8ZA 1VECA 3PUWA 4ZIRA 2C9OA 2I1VB 3F3YA 4ACAA 4RCYA 4DDWA 1U8AA 1F48A 5B64A 5TVKA 1XF9A 5JHHB 2QNRA 1QBKC 2ZS9A 1X6VA 1P73A 3NXSA 1XJCA 1Z6XA 2CCKA 2ZI9A 1RE0A 2W58A 1HUQA 4AI6A 4TL9A 2KBFA 5L3RA 4JVSB 3K09C 2EQBA 2ZRAA 2HCJB 1MO5A 3NKVA 1II8B 3NBYC 1G6HA 4FMCB 1GWNA 1ZM4A 2H92A 1G5PA 2OCPA 2O8CB 2MMCA 4IDOA 3T1VA 4AKHA 3C5CA 1ODFA 4CRWB 1VCIA 2IBMA 1NN1A 4GMDA 4DSOA 1XMJA 2AFHE 3I72A 3KTAB 2QE7D 5KSPA 3ZH9B 3FKSA 1J7KA 1PLLA 1R7RA 3RS5A 5KO2A 4PC2A 2BM1A 2ZXUA 4DIEA 2DYKA 3GLHB 4F92B 2HEIA 1R5BA 3I1FA 5A4JA 1ZM3A 5F9FA 2V6IA 4UNNA 3KKPA 3DZ8A 1LF5A 1XD8A 5FFMA 4C2UA 4MKFA 1NLFA 1FFHA 4C0LA 2H1LA 4OHVA 1NKSA 1EWQA 4M4SA 1KYIA 2ZR7A 4Q4AA 2REXB 1LY1A 2BVNA 3T06B 1Q21A 4G0NA 2VHQA 4FMDB 1XZQA 4XH9B 3L82B 3ZD6A 1E9DA 1F2TB 6Q21A 3WRXC 3T1TA 2JLUA 1F60A 3B1YA 1CBUA 2FG5A 2YOGA 1NVVQ 1OFUX 3IPYA 4OI1A 3R9WA 4JLBA 1W1WA 1HE1C 2X1VA 3QXSA 3TLXA 1MV5A 3GEIA 3MG9A 5KDOA 2ZAMA 1NI3A 1RKBA 4H9GA 3W5JA 3W9YA 4I1OA 2OXCA 3CF0A 3UKDA 4BLSA 1BIFA 3QKSB 1ZU4A 2V55B 1KO7A 1SXJC 4Q9LA 3KQLA 5G41A 3DOEA 1CR4A 1Q57A 3A1WA 3Q3JB 4O25A 4B75A 3BS4A 4QJ5A 4TLAA 1T3LA 2HYIC 5F98A 4U02A 4TQUS 4TMZA 3RDPA 4EJSB 3VKGA 3UATA 2OLKA 1E0KA 2ODEA 2OFWA 2ZJYA 3PVSA 3KB2A 5IDVA 2VSXA 3CPJB 4C0SA 2KJQA 3HP1A 4AYWA 2ZM5A 1ZU5A 4TQ9A 2QSZA 3QG1A 4MYCA 1M7HA 4M1MA 4C30A 1Z2CA 2WOJA 4R98A 1KAGA 2OO7A 3A36A 1ZM2A 3I92A 3KFXA 3CNLA 5FUVA 4PO1A 3AVXA 1JR3D 1Q12A 2YC4C 1XXHA 4DEXA 5EJEA 5KSZA 4I4LA 4A0HA 1NBMA 4B6EA 3THWB 2P6RA 1BMFD 4IVQA 1UDWA 3WP0A 5JMTA 2CLCX 1Z06A 2R6FA 2ZUDA 2PJRA 3NWJA 3V4FA 4TSFA 1YR8A 5C1BA 2Z83A 5FTKA 5B57C 1DG3A 1NVWQ 3E2IA 3GLIA 5J4YA 2BCGY 2O8FA 1E2MA 1OXUA 3DVLA 5D3MA 4NCJA 4G5QA 3OZXA 5HTKA 5FPHA 1ELOA 1EESA 2WWFA 4DCTA 1EK0A 1X1RA 3HU2A 4NBSA 4XD7D 2WWYA 2HF9A 4IOKA 3Q5DA 3H2YA 1OJLA
chains in the Genus database with same CATH superfamily
2BGLA 1NF3A 1X38A 2NTJA 2G36A 2W4MA 3OCUA 3TLAA 4EUSA 2H1CA 2P4QA 2R6JA 1OLUB 1RHKA 1FBNA 5I9MA 3TZBA 2Y2VA 1VPTA 2AD5A 2FEXA 3QPUA 1U2GA 2AE2A 5JXHA 5JNWA 1UT5A 1JE1A 4P86A 4Q9AA 4YV2A 5JJBA 2P5YA 4UM5A 1DL5A 4TRMA 2VNKA 4YMWA 1AO0A 1MC4A 3E7WA 4EKGA 1J5PA 3GW8A 5T5QA 4V0SA 5CB4F 1U1EA 1RQ2A 3VPSA 3FPLA 4PZZA 3UT5A 1P1KA 3EF3A 4JLVA 3IIMA 4NBKA 2A9QA 5HWSA 5KU1A 3H1AA 4HEJA 2IY7A 2IUEA 1Y6JA 2OCBA 1LTKA 3JQ6A 2HK6A 5AXDA 4C0WA 1E62A 3ZGYA 3MUNA 2GD0A 2PQ6A 2QTCA 5EXPA 5TF4A 3BWCA 4IEFB 1AKQA 3T3EA 3G89A 1KTVA 2JFPA 3AY3A 3QHPA 1RWMA 1VSVA 4QBTA 4TLLB 1ORHA 1DAMA 4J4TA 1V26A 2B6HA 2DR0A 3OFNA 4AXBA 5CBKA 1HQCA 1VB5A 3FYUB 4M49A 1FTQA 5EC8A 1L5HA 3SX4A 3VSDA 4UTPA 4I1YA 3T0GA 2HWKA 2GD1O 1CT9A 1E2UA 1G4HA 1IOLA 1VDZA 2DY0A 4ZVKA 1NULA 1PJZA 1QWOA 2QL5A 5IN4A 1AU9A 1UFKA 1M8KA 5D7BA 1WXHA 2REBA 3A7EA 1E2KA 4K9RA 3DEIA 4NK5A 4UBMA 3TRFA 1M2WA 3CLRC 1DAIA 1FFXA 3L46A 1TZCA 4P9NA 3FWNA 3V3TA 1HG0A 2Y1OA 2C5HA 1CIJA 1YZGA 2GK7A 1TM5E 2PPVA 1CX9B 4NYMQ 1FFDA 2B1QA 5C32A 3IDFA 1YBFA 2MSWA 2FOXA 1NUSA 3NP7A 4PAWA 1I3KA 1KDPA 2PUJA 1TVCA 3QBTA 3U37A 1G0OA 3RW9A 1ANKA 1LS1A 4M1OA 3DWEX 4HAWA 1VSQA 2X9GA 2EEPA 2FUNB 3IP5A 5G53C 2JLXA 1ZCJA 2QLNA 2WKSA 2GK6A 2IZ7A 4Q01A 3L7OA 1RKVA 1BXGB 4JR2A 4KXMA 4HSGA 5JALA 4C03A 2O2ZA 3AL2A 2EFHB 2DQ4A 4M0MA 4TMWA 1ZSVA 3DBLB 2W6CX 3G1TA 3GJ7A 4GIBA 5HQ3B 1KKMA 1PT9A 5CDHA 2PZAA 1QCYA 1YB7A 5EXXA 3LDHA 4R41A 3P9QA 1TC1A 4TS9A 3ZGVA 4E22A 3T12A 5EJ8A 3CNBA 3LPAA 2O2EA 2WD7B 5AH0A 5FBKA 4O2AB 4FSHA 4FHGA 2VDLB 4OXQA 4DIDA 4B46A 5CFNA 4AD8A 1W6UA 1JTEA 1T1JA 2CFRA 2XYQA 3NKLA 4PLHA 4ZVTA 2ZJAA 1XU7A 1NU8A 3TD2A 2QLFA 1F3OA 3ICPA 2P9JA 5EERA 1ZAYA 4GECA 3TZHA 4X1YB 2IYZA 1C3JA 3BAZA 5EESA 4Y6OA 5B3AA 3ZLUA 4WK4B 1WQ1R 1C7QA 3DSRA 3M1AA 3I2IA 2PNFA 4HNRA 4Q1AA 3VJMA 3ZHYA 1A7AA 2OR3A 4R54A 2I1WA 5DLQC 3KDAA 3EFEA 1Z7WA 4I3HA 2WE7A 1N9GB 4YUWA 5KTYA 4RSHA 121PA 3INYA 5BQ5A 3OQOA 3N2KA 3FE2A 4JDPA 4LJAA 2JAWA 4Y1EA 3MTQA 5CG1A 5BUZA 2IYTA 1NVKA 4LYDA 2BSAA 2R8PA 2WM2A 2FRVA 2FPPA 2PK3A 4JBXA 3M6AA 4R6XA 1KSGA 2AJCA 3MOIA 1SXPA 3RYTC 1VE9A 5JPDA 1BFUA 5BSFA 5IXJA 1ID8A 2VTBA 3DJFA 4DAOA 2CXPA 3VX4A 4BQSA 1LPBB 3V1NA 4DMFA 1ZC3A 3TG8A 1DQZA 3PK0A 1LDMA 2FXVA 1FDRA 2YRWA 4PTYA 1CJBA 1MQ8B 3DT9A 1QTRA 4J43A 4CG3A 4DZZA 3GFFA 5BW5A 1B6SA 1NZJA 1U7UA 3FYTA 3HXKA 1KMMA 3H5AA 4N3AA 1J0CA 2QRJA 5FPTA 1SXQA 4CCSA 3EVDA 2I3DA 4LXUA 2NO4A 1JA9A 3C39A 2ZUCA 3L0BA 1AZTA 5DBFA 1YB4A 3TRHA 4BCCA 4CT5A 2P75A 4ZI3A 4PNEA 5JD6A 3PLNA 5LLTA 4GI5A 1MGPA 1I7PA 2O3QA 3ZNOA 4D9KA 3GROA 1GNVA 1T9DA 4L57A 2I7DA 2EHJA 3OF3A 4RDIA 1XKXA 2QSYA 5H68A 2RAUA 1QH1A 3LXRA 1V35A 2WMOB 2X0KA 3OPQA 4WY2A 4UTRA 3WGQA 4KDFA 3BCRA 4K81B 5C1BA 3ZXXA 2ORVA 2FPUA 3GARA 1R4ZA 1WQ3A 3HABA 1SKAA 5TGZA 1PR4A 2Z6UA 4M0PA 4KXFB 4OP1A 5CNJA 4CR6A 5HJ7A 2V03A 4HX5A 3VBEA 1J90A 3F5QA 4U2EA 1AF4A 4RZ3A 2ZRGA 4EB3A 3WLQA 4JMLA 2JGRA 5AK6A 5JXJA 4F4CA 2EP7A 2CN1A 1LBEA 2QTLA 5K3AA 1Y37A 1E69A 3N58A 3DVSX 4YJGB 2V7GA 4HYTA 2FEAA 3OP1A 3ZXIA 5DRYA 5G40A 3TOSA 4BAGA 5DM70 4KQJA 1ZN2A 2MSCB 4O4LF 4QXQA 3PWZA 2QTFA 1NZFA 2LRHA 4CM1A 2I3BA 3VZDA 1A04A 4B8WA 4CIVA 1IXSB 2P0AA 4CDGA 5FBLB 1Q1AA 4XLZA 4RK4A 2WICA 3WIVA 2ZR9A 4ZO9A 4WMLA 1R6BX 1U8CB 1L1EA 1ONBA 2IU6A 4MR8B 3TWOA 2GN0A 2VFAA 2A1UA 4JFRA 3LA6A 1LLCA 4XJVA 5J2UF 3KOYA 1E8MA 1JFFB 2HWUA 5BT8A 1Z75A 3FTFA 1VCHA 1SOAA 5BNIA 3QA3E 2VWGA 3RS0A 4CEJA 2AG6A 1JU3A 4Z53A 3O8OA 1VPLA 1Q16A 2NO9A 2YWCA 3ACCA 3QLTA 4JVLA 3VSEA 4TV8A 4HAYA 3NVAA 5FF9A 2ZUWA 1UXJA 3DV2A 2Y76A 2E6UX 1FSSA 2OHJA 5K0GA 3A0RB 1EFAA 1YQ9A 2KHZA 3UGJA 3Q8XB 3OZWA 1P0IA 4PO3X 5DBEX 2XTJA 1I2CA 1X92A 3KOWA 4HX9A 4UAVA 5DT2A 3RC2A 3RARA 3WGTA 3WLHA 3WL6A 3C5HA 2D06A 2VI5A 2Z9CA 4EHLA 3INTA 5E1OA 4ADSG 1P39A 3LTEA 4YRIA 1DDOA 2EQAA 2L19A 1XDWA 4YRJA 5TT1A 5FV4A 1KI9A 1GLVA 3UOWA 1ZXLA 1YACA 3PQ8A 4P32A 1Q74A 5JY6A 5LLSA 3H9CA 2PL5A 1FFBA 3O90A 4PIVA 5BWBA 5KZMB 1ZIOA 1Z7YA 2VJYA 5K4AA 1C2TA 2F4VB 5DHSA 5AM4A 3MUEA 1I4DD 4U6QA 3O74A 4JB8A 3TUZC 3PXEA 5LQRA 4K05A 1N33B 4X1KB 1E1CB 3JATB 4FMBB 4LKOA 6ADHA 5A3SA 1RLUA 4CMKA 5I4IA 3W1EA 4D80A 1T4CA 4A73A 1AO3A 2PGDA 3LLVA 4YONB 5LMUB 4XYGA 4REMA 2ZYTX 4QO7A 4EZIA 4WNIA 4RC9A 5EXEA 2ZI3A 3EAGA 4BMVA 5HKLA 2FSHA 3B9QA 1VB3A 3H11B 3L0CA 5KWIA 1I9CA 4AN1A 4I5IA 1Q22A 5EZQA 3N2YA 1WY7A 1TZMA 1DBIA 1I36A 3JS5A 4R1UA 5IMBA 3R0ZA 3GEGA 2X0DA 2WT4A 5K8IA 4RY8A 2IZ1A 3VV2A 1NMEA 4LY9A 1IONA 3GNTA 1B41A 4L8YA 2I65A 4XQCA 4LSMA 5BWOA 3DFFA 3QVVA 4FD2A 4IIBA 3CHYA 5CVEA 1XZFA 1T8UA 4QPDA 1U99A 1GG8A 9LDTA 2RHWA 1O94A 4FM9A 2G9UA 2YQ5A 2Q27A 3GRUA 3U7JA 2JFVA 3FYUA 1FF9A 2O0HA 3G2PA 3P4YA 4Q16A 5D84A 1VJ0A 3ZY3A 4CYMA 3NLLA 4AZ0A 1WP9A 3CM0A 1U2PA 4KPUA 2GHIA 4TV9A 3A04A 1QQTA 3F2VA 1OZAA 1ORWA 2YASA 3AM3A 1QFJA 4H31A 2XRMA 1JBQA 4RNCA 3MMPA 1DIOB 4KBFA 2F8MA 1AN9A 4N7MA 3UHPA 4J2OA 4UBNA 3P27A 2V74B 5B3JA 3PR2B 3RC9A 5K05A 5HKKA 2VQEB 2EBFX 3SEAA 5JR3A 1RQPA 1Z68A 1IHDA 2R62A 2DCMA 3RGWS 5BRNA 2YY7A 4RA9A 5IUKC 2GI4A 1I7NA 2OCIA 4D0RA 4DV1B 1EXMA 3OD1A 5TGTA 2KLBA 4ESVA 1DCMA 3DT8A 3DZJA 3K0CC 1Q3HA 3DTTA 1O08A 3N2IA 4UZEA 3SQDA 2YY5A 4AKIA 2DY1A 3VZBA 1WCIB 2VNAA 3HPRA 3MUFA 4PZUA 3DULA 3S2YA 4M9UA 4N7JA 3W9UA 1C1XB 2J6CA 3IHTA 5DLEA 3RVKA 3ZK7A 4YMSA 1J42A 3AUAA 5B1EA 1RZRD 3SHOA 2WSLA 1T4DA 5BSTA 4ER6A 5I4KA 1RR6A 2XWBF 2HNKA 3ICEA 5DEIA 4F04A 1U5BB 1ZMBA 4HVLA 1FYEA 4S1PA 3DBLA 3CNQS 2I87A 2XD4A 4CM7A 5HQ3A 1FNNA 1J8FA 5T4BA 3COYA 4MRSA 3E1SA 3FFBA 1Y34E 4DQVA 4GI2A 5TIIA 1OPRA 1MB2A 3M5PA 2J45A 4LGMA 2CNOA 2HMYB 4ZOQI 2WD7A 2YKGA 4GDFA 4JJIA 2HPVA 2ZU0C 1T0UA 2G6BA 1ODSA 4NHEA 5I7EA 4II3A 4BEWA 4XUCA 1O77A 4E07A 2ZPTX 3K94A 3N2ZB 3NWEA 1KJJA 2DWPA 1EFRA 1DEOA 1FNSA 1N2HA 3WYEA 3PA8A 4OGLA 3F6SA 2O8BA 4X41A 4PFSA 4FLFA 3U56A 3AEYA 3RB8A 3LBFA 1IAVA 5CCXA 3A9RA 2I4LA 2F3RA 4ZK2A 3C15C 4IOJA 4EGCB 2QAGA 13PKA 4XD7A 3SQNA 4BC0A 5AQ1A 3Q8KA 4M9XA 4LVOA 3L43A 2WJ4A 1NVTA 4D4KA 5KVSA 1XHLA 3OQJA 3GT0A 1N0HA 2AXEA 2H9AA 2VK4A 4MUGA 1Z13A 4U7TB 3MWLA 4HBGA 5DBGA 1GFWA 1PZEA 2OA0A 2VRNA 5EKTA 1PQWA 1XAIA 2W6OA 2PKEA 4JQCA 1NPDA 1LW7A 2POQX 2Y1FA 2QYOA 5ENVA 3EDOA 1KK1A 2M6KA 4NU8X 1UJ4A 2JAQA 4KO2S 1IU9A 2OXTA 2FRDA 2BV3A 1X7XB 4HX2A 5KEIA 2CLLB 4KCGA 3S1LA 2RAVA 4CKCA 4LWQA 2Y0PA 1N5OX 2DHQA 2VP9A 2VZ8A 2ETXA 3AHFA 2VTDA 2WJAA 3BMOB 2IHBA 3V7WA 3FBTA 1SBIA 3UY4A 3OZSA 4KO3S 5CLFA 1BXKA 1PK7A 2GJ8A 4BO5A 1TJYA 4OP2A 3D3WB 4MWGA 5NLLA 2ZTSA 3IQXA 3K9BA 2XVYA 1S1MA 3H2GA 5LP6C 4FKBA 2H63A 3S81A 4ZCRA 2I7CA 1V1RB 3P5SA 4LYGA 1LFDB 3QEOA 1OIVA 1ZMOA 2CMKA 4IDPA 4UHCA 4CIAA 4KXLA 3E84A 4K2HA 3DHYA 1ECCA 3DKPA 4B3GA 2GPTA 4K28A 4W5WA 1IY2A 3CF4G 3R7LA 3LO8A 8OHMA 3IMGA 4UNRA 4B3XA 4JJGA 3GLFE 2NUPB 1AZLA 5LB2A 4RVSA 3TE6A 1KY2A 5DHRA 2ZB3A 4AZTA 5CFPA 1F0KA 3OG9A 4ETNA 2GRJA 5BPFA 3PITA 3OLQA 1SCNE 2QM8A 4UATA 3HKEA 3M3PA 5K2MA 3EXHB 1J2TA 4DV2B 2PUDA 1WCXA 1YQGA 2N42A 2QF7A 3OCZA 3FTNA 4MIYA 3L7IA 2QGFA 2HRBA 1QDLB 1P6XA 1LTQA 2HPHA 3G1WA 1HLGA 1LB1B 3I9V1 3KR2A 4XIGS 2ZUTA 2OFPA 3JWIA 5LLDA 2XNDA 1AGRA 1CS0A 2R44A 2AVDA 2DWCA 1IHYA 2GBIA 4WUTA 3D0QA 5T7BA 1DWPA 4F71A 3VXKA 3O8DA 3F47A 4Q02A 1MMFB 3R4CA 4IF6A 1E3QA 3KR9A 3ZD9A 3KXLA 4M6WB 3UAWA 4AG6A 4B44A 2WZCA 3RKSA 4ER5A 1FTNA 3KB1A 4J1TC 3GP5A 2C29D 3EEBA 3L79A 3L6UA 1WPRA 1SNYA 3U60B 3ZE1B 1PJQA 1U3TA 3EXEA 4BV3A 3O03A 1P2UA 3PPVA 5BWMA 1XHEA 2FSGA 3VZQA 2A1IA 4QT0A 4D4IA 2VJPA 3VYWA 1X39A 4CMEA 3FOWA 3G8DA 3UWDA 1NLYA 1EHYA 2WMNB 5KJFA 2CXNA 4LXQA 3D6NB 5ETJA 3CN7A 2OESA 4QUBA 1T3HA 2FX2A 2RAPA 3AHIA 2JHCA 3SEZA 4NKRA 3ZLJA 2JFZA 4JUAA 3DL0A 5KQSA 4OQYA 5HF5A 5E4JA 3SJ7A 3TIVA 1VE1A 3D6MA 4L0QA 4Q9IA 2VDOB 1I4LD 2L42A 2VZLA 1RJ9B 4QUKA 4G5YA 3N1UA 2AJLI 5D8DA 4GSLA 3RADC 2O23A 1G0NA 4EEZA 3DZKA 1DJPA 3BTVA 5K03A 1YQQA 3T9BA 3CCFA 1VKOA 5I3CA 3BF7A 3EDQA 1Z35A 3EARA 3ITDA 3KUDA 3A6FA 4ZI5A 4NH4A 2DBQA 1T2FA 3HJAA 1OXBB 2JFHA 1JIQA 4LOJA 3P9YA 2NP6A 1G8HA 1M8JA 2N47A 4TS4A 4ZD6A 2QX7A 4TV8F 4MRMB 3PHBE 3TIXB 3ZNPA 1NC1A 5A1JA 3S5UA 4BE9A 2A78A 2QHXA 5C53B 2HN9A 3WYAA 1E1CA 3JATA 4R9SA 4W1SA 1DINA 2FN9A 2RC5A 1IDOA 3AG6A 4RH3A 1W0JD 5HBRA 4CQMD 2RGNA 3WP1B 4F46A 2HCTA 1GPKA 3RR2A 1MKYA 2I55A 3WYNA 2QW1A 4EG6A 1ZHFA 4P4NA 4NDNE 5TS2A 1VBNA 1GDTA 2GLUA 3RE1A 4M83A 2QVCA 3GPIA 1T2AA 4R05A 2NZ8A 2YZMA 3OFKA 4BBJA 3COPA 4YR7A 1WBBA 4FX5A 3VR3D 3VUFA 1PDVA 4Y9RA 5FPSA 3TCXB 4F91B 5T4EA 3HVHA 1FSGA 4DV4B 4ALIA 3BFVA 1KZ1A 2FMIA 3TEMA 4RPKA 4HI0E 1UDRA 3GNSA 3KWMA 4RACA 1G5FA 5F3WB 4UUAA 3L7DA 2WA1A 3MYYA 1VPEA 1IMJA 4RQTA 2YYZA 4P0QB 3AVQA 2C8VA 3NHKA 4RPIA 1R0BA 3U44A 2WV7A 2EX0A 1EA7A 4I4TB 4OBXA 5EPEA 1RE1A 5DWQA 2SBTA 3IOYA 4V3BA 4AW9A 4GLJA 2Q3FA 4EP1A 1NVGA 4F2DA 2VQSA 3HCCA 4LN1A 3S44A 2DXIA 1YAJA 1ESZA 2C5SA 3DTNA 4RESA 1RKXA 4MJLA 1AJEA 3GELA 5AUOB 2VH5R 3QTBA 1KJNA 3IURA 1KGDA 1HFKA 3CXRA 1RYMA 2X8BA 1P7WA 4M99A 1MU0A 3ONWA 3QX7A 3P2OA 3R7WB 1JG6A 1QKJA 1UM9A 3DPUA 4LGYA 3SC2A 1EWTA 2IU0A 2PBRA 1U0SY 1KXZA 4X7MA 1KQFA 4Z3OA 1ZUNB 2WSBA 2ZDGA 4KAFA 1JLMA 1SQFA 4QDTA 1NURA 4IH1A 2BFDB 1WCIA 3THOA 2JHPA 2JZOA 3U3XA 3AB8A 5IVKA 4JI0B 1VA4A 4OMFG 5DLYA 4TV9F 1C1XA 2WD9A 1WXGA 2JBAB 1Q0UA 2QROA 2X2OA 5ALMA 4JI3B 4RBNA 1KFEB 5G0SA 4V39A 3MCAA 4B6SA 2BRUA 1YIAA 3HUUA 1GLGA 1Z56C 1CU1A 1HMPA 2QORA 1P72A 4GMGA 1UP6A 5AICA 4R7ZA 1UT6A 4A5OA 1E58A 2XUHA 2CLDX 3QF4B 1C81A 3HSSA 5CPBA 3UOGA 4A8TA 2P2CA 1KYXA 1KPIA 1ZZEA 3FUXA 1FFSA 5GONB 3RTAA 3QU9A 1V2GA 2FW1A 2YXLA 3A14A 4X0EA 5JS6A 2EDCA 2EEZA 1OA1A 4ZOLF 2V7PA 2ZYSA 3JQPA 5JDCA 3UAGA 2PWBA 3PSAA 1QYXA 1XF1A 4IDHA 5CP8A 3AYXB 1MC1A 1EH5A 1OQAA 1Y8AA 1B0AA 2XMSA 1MOPA 1TRHA 2YHUA 1EX9A 1PT5A 4J0HA 1W4AA 2OXFA 1NKVA 5IW8A 4ARIA 1XNHA 3LLMA 4ZODA 1NR1A 2N1MA 3G9ZA 1CEQA 3GT7A 1ONOA 4AG3A 1E60A 4ER0A 4NAVA 1RM0A 2ZRNA 4NY1A 1TAUA 4JKYA 2PT5A 3Q72A 3QE2A 2PFGA 3TRKA 2QJWA 4RGYA 2W6ID 3MSCA 4AYXA 2QGNA 3NW9A 2L18A 1BDHA 2YBDA 2X77A 5FWYB 2XEXA 3VI4B 2OV3A 2GPSA 3N53A 4MZXA 4LZLA 3UJPA 1BOFA 4GC5A 2BR4A 2Y66A 1UC9A 4NI5A 4N54A 5GPBA 4CQMB 4KQGA 4RD4A 1PHRA 4A2PA 5KYYB 1QHFA 3IEVA 3HFJA 2VHTA 1Y3DE 1XP5A 3JYLA 4RIIA 2WYHA 5JO0A 1QAMA 2G7MC 1YH3A 1YR7A 4HCJA 4F9TA 5AW1A 2NSJA 2CLKB 4L8WB 1RWOA 3O73A 3CVVA 3AERB 2NXNA 4PG4A 4B2YA 1XEWX 1JDTA 4YMLA 1O4WA 1TK2A 1KEUA 2ZU6A 5L3SB 3PQ3A 2BY4A 1XMOB 1QFXA 3KQQA 4ACBA 1WABA 4PCAA 4BKMA 3RLIA 4N0PA 1L6RA 4HB3A 1Q0LA 1GG5A 1F4VA 4UKDA 3D5EA 4RGVA 4DIOA 2EP5A 3O4FA 4LJYA 1L5QA 2I6UA 1T3SA 4IUYA 5DTEA 5EJIA 1UC8A 5AKIA 1FRZA 4BO2A 1TVEA 4IV8A 2JAXA 4MGZR 1KS9A 4MQLA 4W7SA 3O6VA 3RRFA 3GP8A 3N70A 4OQ4A 3OJLA 4UAJA 2NUPA 3PFGA 4N0DA 3WWOA 3C3CA 3ROEA 4EPYA 2BR3A 4E4YA 2JI9A 2DECA 2R65A 4L4XA 4PLTA 1LJUA 4V0LA 3AHEA 3UUFA 1Y1SA 1W9MA 3L4BC 3SS9X 3S2FA 4B3CA 4CN8A 1I10A 1NXOA 3CG4A 3G0GA 4HQFA 4NECA 1BWPA 4TWZA 5ALOA 2JCGA 3VNVA 4HLCA 4UPVA 2NZYA 4U0KA 1JSCA 1YRQA 2J5RA 3AV0B 1H4TA 2CF5A 1AUXA 2PWZA 4L50A 1P2FA 3W8NA 4QKQA 3EYWA 4NPHA 1U2DA 1KEEB 4HV4A 3BL6A 4PLYA 1DC3A 2BCJQ 3Q3VA 3ZXYA 4BLUA 1Z2EA 2CMGA 2HSDA 2XBMA 3OHPA 4BNMA 3FAZA 2O2DA 3LQQA 1ZESA 4B3BA 4BUCA 3KQNA 2YWFA 3DEKA 4M6WA 1BTOA 1OD6A 4DIUA 1Z6QA 1Q7BA 3GJ6A 3I8SA 1L5MA 1U7XA 1YASA 2DHEA 1ADCA 1K8RA 4LHSA 2C00A 3VHLB 3E81A 2VLBA 5CUQA 1CZLA 3QUQA 3O8NA 3KC2A 4KQHA 5BN3A 1FTSA 1TW3A 2R8YA 1IEVA 3GRAA 4NAHA 4MS3A 4UNQA 4PN7A 1WX1A 1TK9A 4EY5A 5A1TA 2W71A 3FJOA 2WSYB 2LVBA 4DM4A 1FX0B 5IK2D 4DB4A 1KI2A 3ND6A 5HR5A 3I2HA 4G4SP 3A8TA 2C2OA 1N25A 3G2IA 3CF6R 1PG5A 3I0ZA 2XX3A 1J00A 1DAEA 1K4MA 1RWQA 4G0OA 4DIFA 1ZJJA 1KFKB 1Z2PX 2D1YA 4QT4A 2AHRA 3WLSA 3ZWBA 1SZDA 3B70A 3OBBA 4GO1A 2RIRA 4OYRA 3EIOA 4MQEA 3LNCA 2G0NA 1BE1A 2R7MA 3GEHA 4RS4A 1KI6A 1LPAB 4TVOA 4Y1FA 1KH1A 1S2OA 4R4JA 3C3WA 1JSRA 4KX5A 3OLXA 3HKCB 5LYJB 5EG5A 4QLAA 2PX3A 3MWEB 1KL7A 1R37A 1CP3A 3R0QA 4LYYA 5LXTB 1ND5A 3GA7A 2CV0A 1ODIA 2QT1A 3D3JA 5C3UA 4MRMA 4JLPA 1WXWA 2CEKA 4JVMA 1WDLA 3R7FA 1FW6A 3AR3A 4PZYA 1TTTA 1FQWA 1V11B 4CIWA 4QVIA 1E6KA 4RANA 5AQEA 4B2PA 2IH2A 2GM9A 3VC1A 4BQOA 3N6VA 3RHTA 4R84A 5HYVA 5L51A 3AKDA 4G09A 1BX0A 2XMCA 1Z38A 3QPBA 1XLTA 1U5AA 4Y2SA 1SC6A 5FWNA 1EEHA 1BN7A 1DHRA 1NBWB 1RPAA 3EZYA 5CVCA 4QGGA 4AC9A 4O0LA 1JU4A 2W2MA 4HNVA 3HO1A 4KC0A 1SG6A 4UHHA 1WTCA 4ENSA 2ZJ4A 1DCTA 2C3MA 1MD9A 3MPUA 3OESA 5A2QA 4CKZA 3GEPA 1U80A 5DJ5A 1WB6A 2YUTA 2M9MA 4MPJA 3IT0A 2IYWA 3UYLA 1TQDA 4E33A 3PRJA 3GAZA 4G86A 4F85A 1OZHA 3T9DA 2IXAA 4JI1B 1Q91A 1M54A 2OBBA 4UQPA 3VAAA 1R4MB 1XLWA 3AY6A 1CW2B 3L8YA 2WHPA 1ZEJA 4I4TA 2IIBA 2EVWX 4PGMA 4GP7A 3H8JA 5I7FA 4F86A 4GBJA 5CDFE 4BPBA 2BI8A 4F8YA 4G36A 2ZAYA 4O5AA 3LBNA 1MH1A 1XRQA 3GJZA 1PGJA 1O1YA 5CVJA 1TVMA 4RXTA 4BKQA 4UM8B 1WDKA 1NV9A 2Y9PB 4KLCA 1VLLA 1CNMA 1TTPB 3KJEA 5F2EA 2D0IA 4Z9BA 4QPCA 3R7WA 2ZWOA 4G5HA 3AZPA 3U6BA 1N77A 7ABPA 1XWWA 4L85A 3K9LA 2CF6A 3SK0A 2X4GA 1RXSA 3QOWA 1L7EA 4N0EA 3THYB 2BOVA 4OA8A 4E5YA 2FUCA 2UUPA 1ZUNA 1EDOA 4AO8A 1N2OA 5E4YA 1NUPA 3CCBA 2HIAA 2M6SA 1FUKA 2WA2A 1GZ5A 1P5RA 1QMPA 1T36B 2EAUA 3MWJA 1PS8A 5FNVF 2DM6A 4NBLA 3WRWA 4C1NA 1UBEA 1QRSA 3WGKA 5COBA 1NXSA 2I6TA 2RAFA 4NBRA 5G2OA 5K3FA 4TTRA 3T3DA 2P2LA 2H17A 3V42A 1UPBA 1HDOA 4CLOB 1PX2A 3AL3A 2GM5A 3EULA 3IBGA 4FOPA 5CGZA 2H2FA 4O4HF 3JTEA 4YQZA 4H6VA 1H4SA 1BGXT 2AOWA 1Y98A 1RHUA 2X2EA 4OAPA 2XKBA 5GONA 1B2RA 1BROA 2VDVE 3AC0A 2EFDB 2RKBA 4BLQA 2X42A 2E0IA 2J0QA 1X1BA 2MYPA 4R8KA 3ZBUA 2WB2A 3R3YA 2QG4A 2PT9A 3I73A 2XMPA 1XEXB 1L4UA 4M8IA 1SJ9A 4BMNA 4P58A 2AKYA 4RF2A 2WLTA 1TM2A 3MELA 3OCJA 3E7PA 1V6CA 1MJFA 2OCKA 2J41A 1TEXA 4IOLA 3L1UA 3QE0A 5LWQA 4L4YA 1U0HC 2CXTA 3V4LA 4C3UA 3ENWA 2UUCB 3K73O 3H0CA 3GJXC 5B30A 3C6BA 2HT1A 1I7DA 2F48A 3QX8A 3FPSA 3OQIB 4NNJA 4INPA 3SKYA 3EA5A 2JIMA 3VJRA 4J0FA 2VSQA 4RLQA 3RAPR 2DETA 4US2R 1P2SA 2PCLA 3FPGA 3K4HA 3P0JA 4J76A 5JFTA 1Z8NA 1U7WA 2I54A 3ESDA 1K98A 2PYIA 2QY6A 1SXJA 4GXQA 5CK5A 1CF4A 1QQ7A 3DF9A 1H2BA 3PVCA 3VR0A 2O06A 3DUFB 1Z39A 3MLEA 4R3NA 1ZK3A 5DNWA 3CF4A 5KYYA 3NBKA 1UQRA 2PUBA 3U61B 3DOFA 4A16A 1VJCA 2QD3A 3KBOA 1P2BA 4IGEA 1CRPA 1P7ZA 5FFFA 1Z0FA 2HSGA 4QU5A 3NBFA 4HWTA 3SU8A 5DGXA 1FNCA 4D26A 3JALA 4OXXA 4WY8A 3EK2A 1P4RA 4I19A 4WA7A 4WI1A 3AFOA 3MSXA 5EMMA 1IMOA 2QVYX 1KEZA 3OLWA 3V4SA 1Y3CE 1GCIA 2C92A 2C78A 1LSJA 1P2GA 4LOIA 4DIBA 4F21A 3NTUA 3OOJA 2PKXA 1KE2A 3V4ZA 3GLFA 1IK6A 1KYYA 1TFUA 1W0KD 3FD8A 5BYBA 2I6FA 3V1UA 4QUAA 2IGBA 6ABPA 1CUJA 3A1NA 4WKOA 4R8LA 4HNAA 3BTOA 3AQ4A 2XF2A 1MJGA 4X00A 3KJGA 4YXWD 2DC1A 3IMFA 3S7TA 5FX2A 1NW6A 1YULA 2XB6A 4IDEA 4ETIA 4BOYA 3L8DA 3K16A 3JZFA 4PYKA 1Z9BA 1KKLA 4RKQA 4G23A 4KWIA 1KK3A 3HDHA 4TLDA 4BO3A 2XGJA 5B7NA 3P2IA 3L1VA 5EIBC 4E2YA 1JT9A 4OL9A 2Y71A 2PN1A 3DONA 1WCYA 3PV0A 4OB7A 4C01A 1V48A 1I14A 1N6HA 2P1DA 1DLIA 4KO4S 3CZCA 1NMYA 1Q20A 2WD8A 3L5OA 1K7SN 3RV3A 1I2MA 4AO6A 4ZYVA 4BE7B 3OZUA 4FN4A 3EFOB 1E2PA 1UOOA 4BS9A 3OTIA 4D45A 4OIFA 5CNMA 4PHFA 2D0PB 4OXKA 1NTRA 3V7NA 4EENA 1QGOA 3IQEA 2HT6A 5JUWA 4JNKA 1CY2A 1NYTA 4MW6A 1OLXA 1KEEA 1FP4B 4HZGA 3DOIA 2O3JA 3JCZA 4FD3A 1C8BA 5CGQB 5DGTA 1YZYA 4OQEA 4S1OA 1DDIA 1R1DA 1HGXA 3VYTB 4OSOA 3WL7A 4L16A 4X85A 5JFGA 1UZMA 4K9KA 4MUKA 1PL0A 4CIDA 2WSIA 1JLLA 4J0EA 4LJSA 1XQVA 4H7EA 2AN5A 1IBRA 3F4LA 4I50A 4ZYLA 4QYIB 1W4ZA 3OJCA 3LQRA 5AVVA 3B1VA 3GC6A 5TQJA 3MJFA 4D7AA 3H2SA 4TTIA 4IIJA 1G9TA 1PWHA 1JFRA 1P74A 1PR2A 2IYRA 4D0SA 3BH0A 4H08A 1TYBE 1G20A 3EQ6A 2EL9A 1FX0A 2PD6A 4Z7QB 4YACA 4LDPA 2P1RA 5JZMA 1MLDA 5AJWA 4ZC1A 3FWHA 5BQOA 1CRZA 3R40A 1A9ZA 4HXYA 2PSDA 2EP8A 3KK0A 4HN2A 1WSDA 4P54A 3RVPA 4L08A 5IPFA 2GD6A 3L01A 4PCVA 4GZ3A 3P26A 1N92A 1RPNA 1TU3A 3BRQA 3JWEA 2AFRA 1O97C 3JSAA 2BFAA 1JKIA 2FSIA 1ZNYA 2YV2A 1IZ7A 1ILWA 2IXEA 1QIIA 4Y6PA 2BMEA 5F5LA 4C7BA 4S04A 2EX1A 4WXEA 3C3YA 2C8JA 5DCUA 2G1JA 2XECA 5HG0A 2DWQA 3CQ9A 3MEQA 4UEQA 2ZI7A 4B3TB 4EGAA 2GAJA 2PQMA 3OCYA 3MZ0A 2E2WA 3C5VA 4MA0A 1U0FA 1P31A 3A6HA 2ZBUA 3N0WA 2YNMC 2J3JA 3GWGA 3GUZA 4G1CA 1OSNA 2WTAA 1XWIA 3GGPA 3X1JA 5KYUB 5KVQA 5LXTA 3QP9A 1BW9B 5IC5A 3CH4B 1H9CA 4UDYX 3ROMA 1BH2A 4LJ9A 4NV3A 1GCUA 2O48X 2XJ4A 4YO7A 4N65A 3MBIA 5AJZA 4NEGA 5D86A 3I4CA 4KAXA 3VR4H 4GQBA 4Q3KA 1SZJG 3K2QA 3RS3A 1Q1ZA 3UMRA 2JPDA 4PZDA 2ESRA 4RENA 4LIPD 2HV8A 3QM1A 2HBYA 3HLYA 2PIDA 4JKOA 1JQKA 1NWHA 4YCAA 3EXG1 3DEJA 5KC8A 4PG8A 2H4YA 4E6EA 1XQWA 2WPNA 1K27A 4IEEA 4NBTA 3H5NA 4NLLA 2IZ6A 3AF3A 3CSUA 2YQZA 3SZUA 3JZMA 3RWMB 3OOYA 3RANA 1I30A 1N9KA 2AIRA 3DPSA 2Y1CA 4QDUA 3UT6A 3VNAA 5KQPA 3HXOA 1PQ4A 5KKNB 3QVOA 2LIVA 3WYBA 4RTRA 2IYQA 3GLQA 1D4ZA 5EQDA 1C3XA 3C6XA 2YHSA 3B2QA 3UAVA 4BL5A 4CUZA 1OI3A 2FZLA 4JI5B 4EVQA 4YJ2A 4LF6B 3JYOA 2FPOA 4MGEA 4MR7A 4FYWA 1C3OB 1YI8A 3KYCA 3UXHA 4DDMA 5MGNA 3G2QA 3E6AA 2GWHA 1LDGA 1GHTA 2PLNA 2J87A 3IO3A 4K8RB 3Q3HA 4R8MA 1XRLA 4LBWA 1FJXA 2NU7A 1R4MA 4JYBA 4MS1B 3ZI4A 5A0VA 2CGEA 1DELA 1IIRA 3SI7A 2PAAA 3R6GA 2M98A 3DDSA 4QRDA 5K7SA 2WABA 2E4XA 1PNQA 3C4VA 4HVCA 2GJ4A 4B4WA 1U04A 1BVUA 3TM4A 4IY1A 5GVSA 1W29A 4KWEA 2B8JA 5BNWA 3TN7A 5JJIA 3C97A 1U28C 1VBFA 1TM7E 1VMKA 4TKZA 1G5RA 1KR5A 3PFCA 2CDNA 3Q7IA 3UYKA 3PEYA 1LLDA 1SCIA 4GR4A 4LJ8A 3NJ4A 1S1CA 5ALGA 2GYUA 2IFTA 2PRIA 1JZTA 4L72A 2WRZA 3OLVA 1U4OA 8ABPA 1IDN1 5FKJA 3CLTD 3ASZA 4B82A 4DXAA 1O95D 5CVTA 3HTXA 3HVJA 2J3QA 1RWPA 3FZGA 1YFKA 1NNUA 1T36A 2FDCA 3TIIA 1EXDA 1H6CA 4IH9A 4DJDC 2VPYA 1RPJA 4LZJA 1OH5A 5EIHA 3GEDA 5K3EA 2YYSA 5EPOA 5SICE 1A8UA 3F5MA 3T9CA 3GK3A 4YFVA 3DCNA 3MMSA 1FMLA 1L4NA 2OB2A 2B1GA 4V0QA 1YIOA 3ZR4B 2OGWA 1A2QA 3OWXA 1O96B 5HQTA 4BMYA 1RQNA 2IV2X 1YOVB 2ABWA 3ZUGA 1EFVB 5MN5A 4HB4A 1NHGA 3SR4A 1QP4A 3RYFA 1QVAA 3L4EA 4KDCA 4CCYB 2XLBA 1QIGA 4CDRA 2WTBA 1XEXA 3I83A 1GL7A 3D5QA 4EPRA 1W34A 5LOVB 3IOBA 5EHGA 4RYLA 3W5BA 1T0JB 2P27A 5KKAA 1C8LA 1N2CE 1PQYA 2QTVB 2WIBA 1J49A 1PFVA 1UMCA 3FGOA 3HUTA 1JXOA 3I0NA 3PDWA 3TL6A 3UWMA 5M34A 3FSEA 1VG8A 3PF9A 3VAYA 3N9IA 1P8JA 3WTCA 5C1OA 4U7GA 2PUHA 4K1XA 3OUTA 3QLUC 2MCFA 3LCVB 1WUKS 4HKTA 1QZTA 1PJ3A 1U3FA 2D7CA 3IMKA 3M7IA 3SLGA 2VDWA 2ZR0A 4A2CA 4E7PA 1E59A 3HZZA 1YOBA 3D81A 4BKOA 2ZE6A 3B5EA 3HDJA