1U81A

Delta-17 human adp ribosylation factor 1 complexed with gdp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
164
structure length
164
Chain Sequence
MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes in human Arf1 on nucleotide exchange and deletion of membrane-binding elements.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords ADP-ribosylation factor 1
total genus 41
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2004-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1u81A00
2H8KA 4TLEA 1RRPA 3RAPR 1E2FA 5BN3A 2QMOA 1QVRA 4QHTA 1F2TA 3LQRA 4TT3A 5AUQA 4RZ3A 4NHOA 4JIMA 1G64A 3FB4A 5CITA 5FTJA 4V0OA 2AR7A 1IN7A 3SFZA 4C0LA 4Z8YA 3CRMA 2W58A 3E2IA 4TL7A 2XZLA 2CXXA 1KZGB 4ZCLA 4U7DA 4LBZA 2DPXA 1AA9A 2BBOA 1RPZA 2WOOA 2IUUA 3R20A 2HEIA 2C96A 3AKCA 4BFXA 3RS5A 5DN6D 3CB4A 1VG1A 4UXJA 1TAGA 5M04A 2YWHA 4BWYA 4XVUA 1NVWQ 1GKUB 1WDTA 2VHUA 2C98A 1XPRA 1W46A 1L4YA 3B6EA 4BFUA 2JJ8A 1FZQA 2W83A 1Z0IA 4RCZA 5BQ5A 1Q22A 4QBIA 3X1XA 3UIEA 2OCPA 1P73A 5HPYB 3AQ4A 1M74A 3U3KA 1FTSA 3O8CA 2BOVA 3D8BA 4A9AA 3SBEA 2REBA 3PUWA 1J90A 2HCBA 3FMIA 3A37A 4L16A 2ZETA 5J4YA 5FBQB 2QQ0A 2CHQA 1GFIA 4B73A 5J47A 1MABA 2JEOA 4JKIA 4QGGA 5LD2C 1WB9A 1E79D 2QQEA 5JRZA 3PG5A 5HKKD 3BB1A 1JEDA 1P60A 4XD7D 1M7HA 5FUVA 1R0WA 4Q4JA 2J59A 5CB6A 3EW9A 2FJUA 4QC2A 4R9UC 2FFQA 4EPYA 2GXAA 5HE8A 2GCOB 5G41A 1II8A 4NYMR 1P62B 3NHBA 4TLAA 3MG9A 2ODNA 4DDVA 3SBDA 4ZI2A 4GDFA 2G3YA 5GADl 5GJVC 2GEDA 2WKPA 2VF7A 1ZJ6A 3DKVA 4LC0A 3HU1A 3FMPB 3REGA 4GFDA 4URYR 2R6CA 4B3CA 3BB4A 3LAWA 2IYTA 5D3MA 1R4AA 5AWFC 3EIQA 1GUAA 2ZRNA 3IPXA 4E03A 3C5HA 1Z28A 3LXXA 5FTKA 2CCJA 1N5JA 3SJAA 1JQLB 1W0JA 1CTQA 1XTIA 2AXPA 1UBFA 1AQUA 2ZRLA 3HR7A 4BQSA 4CT4B 4BFZA 3GJ8A 2REOA 2VP4A 5G3ZA 3TH5A 3AUXA 2WWXA 3FKSD 1JXMA 2WJVA 4LJYA 1G7CA 2W0MA 4BFWA 4KVGA 3TSWA 4PZYA 5AJWA 4CEJB 2D4HA 4B2LA 2MSCB 3BK7A 5L3QB 3FTQA 5J4HA 1E2MA 3IEUA 3NXSA 1C9KA 2ZE8A 3HP1A 3W5JA 2FN4A 3I1FA 2QT0A 3U6BA 3M0EA 4TTQA 3U3MA 4A6XA 3MGCA 1UEJA 2H92A 3TVTA 5AJXA 3R7WB 1E9BA 2IWHA 4YXWD 3AH8A 1DBSA 5KSZA 1ESNA 1F2UB 1UFQA 1QHHB 2BV3A 4KBGA 3T1VA 3PIRA 1G3IA 1G8PA 3T1OA 2QG6A 2QPTA 3C4JA 4GI7A 5EUMA 3ZVNA 2GJ9A 5J40A 1SKYE 3LFUA 5FTNA 1MR3F 1QHSA 2X2EA 5P21A 4PHFA 1D9ZA 1A7JA 2QA5A 3QY0A 3U3RA 3RC8A 2EVWX 5JECA 4LWZA 1CEEA 3LO5A 4DUGD 4Q66C 2YVUA 1XEXB 3R8CA 2R44A 1ZIOA 4NMMA 4IDHA 5FI0B 5E7MA 2J1LA 2JLVA 2QBYA 3FFBA 3Q3JB 3KB1A 2VSFA 4LPKA 1G5RA 1J8MF 4BZPA 4A0RA 3GEIA 4LJAA 2PZEA 3R9WA 5A4JA 1P5ZB 1YZKA 4OI1A 3OAAA 4KXFB 1EESA 3BB3A 1SVIA 4Q4HB 3A1WA 3QJYA 2W6JD 4V0MA 4IOMA 1IBRA 3THWB 1ZC3A 2ZXUA 4FIDA 4BASA 2PT5A 4LV8B 2CL0X 4AY2A 1Z06A 2IEYA 2GZDA 4ZPXA 3MWJA 5BYJA 3AVVA 2V4ZA 1JR3A 2F7SA 1E1RD 3K0FB 2VHCA 4HB4A 5CK5A 2F43B 5C18A 2ZJZA 3GLGE 1OFUX 2WPDD 3CR8A 4A4DA 4RZ2A 3KFXA 3P1JA 1QDEA 2OFOA 2AX4A 3B7GA 3KKMA 3TQFA 4KODA 3A1UA 4N3NA 1ZINA 1T8TA 1KK2A 2B6HA 2Z4SA 2ZRDA 4HB0A 4KFUA 4Q4HA 4RCYA 5G3YA 1XCMA 3G0HA 1PUIA 1NN1A 4M1SA 1T91A 2V6JA 3RNLA 3MJHA 4LJ4A 4NYJR 2ZUCA 4G5GA 2WTUA 5CIQA 2RH5A 4MGZR 2GXSA 1QF9A 4QBGB 4HZIA 4XSGA 5C4MA 2GEVA 4NCHA 3B9PA 5FH9A 2OCAA 2KBFA 1Z6GA 1YR8A 4PQRA 5LPNA 2F43A 1VKJA 1R0XA 3T61A 1XTKA 4XJXA 4AKHA 1F2TB 1KHTA 2IK8A 4QGHA 1II8B 1R5BA 1XMSA 4NCJA 4MGKR 2F1JA 3U60B 1W0KD 3EPJA 3AP3A 4HATA 5F9HA 4A92A 3K0EA 2G0NA 4JT2A 1KO8A 2V1XA 4Q02A 1E2IA 1P9RA 1F5NA 4DRZA 1Q57A 1YZUA 2OO7A 2X2FA 3CX7A 2J9RA 3U3JA 3OIWA 1VYTA 2A7QA 1XNJA 4I1UA 2GHIA 1NMYA 2X77A 4PPGA 3A4LA 3VX4A 4M2LA 1Q20A 2JLSA 2UKDA 1R5OA 4B3BA 3WRYC 1E9AA 1Z6TA 2VIIA 1DVRA 1UPTA 4TSFD 2G83A 4RD4A 4OQFA 3SJZA 4DLXA 5AUNB 4XWKA 4KHZA 4WZAE 3HJNA 2P0EA 1GNPA 4C0KA 4Z1MD 4QNMA 2J3EA 1RE0A 2AFHE 1SULA 4F4JA 5JFGA 1BYUA 2IX3A 2Q9BA 4HZUA 3QKSA 1I4DD 3LQQA 4EJSC 2GZHA 5KSPA 2HLDA 5FPTA 4ZDKA 3DOFA 2AK3A 1DAFA 2CEAA 3WYFA 2XZPA 4BRWA 4BECA 1HTWA 1D2MA 1KO4A 1XD2B 5C1BA 3QG5A 1XJ0A 4Y0AA 3E70C 2IUTA 1OXTA 3PEUA 1NL3A 3QE0A 3B5JA 2I3BA 4KV9A 4C0AC 4BEJA 3TJZA 4JL8A 1YRAA 2R9VA 3TQCA 1OH6A 1LV7A 3TNFA 1JB1A 1LTQA 1RKBA 3MMPA 4Q5IA 4QJ3A 1GITA 2CJWB 1DELA 1RC8A 3B1VA 1Z07A 5EE5B 1E2EA 1K8RA 3ZGXA 3CF0A 1X86B 4QNRA 3IQXA 1W48A 3IKJA 3QVVA 2GCOA 1P7CA 2O8EA 2C03A 5HZHA 3SYNA 3DOEA 3QPVA 1QZXA 1Z83A 2ZSDA 3DZDA 4KJZA 4US1R 3I61A 4X8MA 4X8LA 1KNQA 2ERYA 1YZLA 2QZ4A 5EXXA 5TY0A 1Z22A 1TUEA 2BBSA 2DHRA 3K8YA 3KJEA 3WP1B 4TYYA 3WYAA 2XOKD 3DMNA 2RKOA 4H1VA 5B58C 2OAQ1 2O52A 3KKNA 4LYAA 2WAXA 3DKPA 4ARZB 3DM5A 1AJEA 3AF4A 2ZPTX 1NG1A 3PENA 1E2NA 2X8AA 1P9NA 1ZM9A 3LX5A 4M21A 4TLCA 4B47A 5C2JB 4AD8A 4KFSA 1NY5A 1JQJC 5SZHB 1E2QA 4LHVA 3RANA 3IBYA 3RHFA 3CRQA 4A8JC 4NU0A 1UKZA 5GJBA 2YOGA 5FL7D 1R8QA 1SVKA 1LB1B 1E2PA 3OIYA 3AP1A 1AGRA 2BEJA 5FL3A 4CZ2A 2OZEA 3ZZTA 2BMEA 4BLTA 2GF0A 1HV8A 4XTRA 1W36B 1U81A 1RW4A 3ZZUA 2QAGA 2XGJA 2HLDD 5EE3A 3OIVA 2WOJA 5DLQC 1KMQA 4FMCB 3S1AA 5TDHA 4TN1A 1ZM2A 1GG2A 2PJRA 2Q3MA 1OXSC 5IDVA 3ADCA 2YINC 1ZP6A 3HDTA 4OJKA 4Q9KA 4UXHA 2YOFA 1SXJA 4H1UA 4JLOA 5AUPB 3I72A 2JJ2A 2FEMA 4PC6A 4A2PA 2K5UA 2X1VA 1NSTA 3QQ5A 4Q4AA 2D2FA 2YWFA 1DOAA 1XWIA 2FPLA 1KDPA 2GJAA 1FUKA 4M8NE 2VP5A 1P6XA 5FBRB 4HLUA 5KPDA 4FWIB 4M9XA 4II7A 4LV6A 2QBYB 1KYIA 1UKVY 1N6KA 3IIJA 1CR2A 4NCKA 3CPJB 1IJFA 1DAEA 3GLIA 1KKLA 1NI3A 3L8ZA 3IUYA 4JL6A 4PO1A 1E0KA 5DE3A 3AP2A 1IXRC 3R9XA 3FKSA 2ZRJA 1EFRD 3T35A 2R2AA 2W6IA 3AVWA 4YXWA 3KTAA 4WVFA 2YYZA 4OHYA 4IDPA 3T1QA 4O3MA 1E99A 4Q7MB 2YOHA 4QKQA 1OYYA 3THWA 1W0KA 1O87A 4LX0A 4KITB 4DB4A 4OI0A 1E9SA 3H1TA 4UJ5A 1XPOA 3GJ6A 2J41A 5FOVA 2ZM5A 2QE7A 2ZYWX 1CR1A 5E3HA 3VQTA 4EJSA 3ICEA 2FSIA 1VIAA 3B1YA 4EFMA 5IT5A 3KKQA 1DAIA 3TR0A 1VHTA 2F1HA 3QENA 2VO1A 1FPMA 3RRNA 2NO0A 1BOFA 5KO2A 4LY6A 5AK0A 3C8UA 1CULC 3GJ5A 4LHWA 1KDTA 1CIPA 4GP6A 1E2HA 2PBRA 1RFLA 2ZI7A 4OBEA 1A2KC 4XIGS 2CVFA 1KJZA 5EZ6B 4DDTA 5K8UA 5A0FA 1NN3A 3QF4A 4MUAA 2ZUDA 5ELXA 2HJGA 2FSHA 1OFIA 3TMKA 4M1TA 5JHHB 1VECA 3Q7QA 2LKDA 3P4YA 4TZ0A 4LJ6A 3EWSA 4AKEA 2YV5A 1E1RA 2DFTA 3NBFA 1XPUA 4KBFA 1W0JD 1XD9A 4P0TA 4MQBA 4B74A 1R10A 1Z63A 2H7VA 4JS0A 1L2TA 4Q1DA 2IYUA 3BWDD 4A2WA 3DDCA 2O8EB 1NF3A 4E22A 4NYIR 3VR3A 2DWOA 2NO7A 3U7FB 4UXIA 2VP0A 5DH9A 5LB2A 2NG1A 4L15A 2GESA 3WY9A 5F9FA 1SKYB 3SHWA 4DBLC 1MO3A 1RZ3A 4OQNA 1W1WA 4L9SA 4PPFA 4CF7A 1UBEA 2TMKA 3CX6A 3K70B 1ZBDA 2A5JA 4YMWA 3U3OA 1IONA 4KI0A 1NBMA 4OHZA 1JJVA 1U8YA 3GFPA 5CM8B 1T3SA 1DEKA 3AKDA 3QBVA 3ZS8A 2UZ3A 1QHNA 4US2R 1ZNYA 1V43A 1Z6YA 3SFVA 3PUZA 2YWEA 1A4RA 1ZNWA 2QSYA 3EA0A 3OEED 4BRUA 4Q4LA 2GBLA 1I2DA 2FFHA 3O8DA 3K0AA 4HLDA 4MRNA 4V0KA 5KDDA 3P32A 1NMZA 4XH9B 3THYA 3TRFA 2AXNA 2PT7A 2QAJA 3FGNA 2JLZA 4D0LB 4C2UA 1IQPA 2WSMA 3A4NA 5JWOA 3HYTA 1X8LA 4Q9LA 3QXCA 3NHAA 3QXJA 1E2JA 2JIZD 2WBLC 4EQ6B 1V5WA 3LD9A 1LW7A 2ZR0A 1CP2A 1BMFD 5FR1A 3K70D 1YZQA 1HT2E 3QKUA 3RRMA 3ZH9B 3FYHA 4MDEA 3FDIA 3KZ1E 3B85A 2BVNA 1G7TA 1MRSA 2AHOA 4DC9A 4RD2A 1OW3B 4AKGA 1IN8A 1QRAA 4DLRA 4TTRA 2JATA 3U61B 1YZGA 2CJWA 4M9QA 2F55A 5JWHA 4KLZA 4CEIA 1FL9A 1KJWA 3KUDA 2ATVA 4I81A 2QU8A 1AKEA 2P5TB 4JJKA 1N6HA 1UKYA 5EQTA 1KK1A 1YQTA 1LY1A 4MGIR 3ZD6A 3O47A 4M1OA 3AEZA 2GJ8A 2UVQA 1R0YA 1HT1E 1MO4A 1KY2A 1E1QA 2I1VB 4Q18A 1DAGA 1GP2A 2JLRA 4XVRA 1Q1BA 2ZI9A 3WNDA 2QGZA 2XAUA 4EDHA 1Z5ZA 3ZLJA 1W36C 2A5GA 1K6MA 3UG7A 3U7GA 5EXSA 3KXLA 1N2CE 4O25A 4WAUA 3U7EB 3EG5A 4HLQB 4EFLA 4F4IA 5FOUA 4GMDA 2RHMA 1FX0A 5AJZA 4BLOA 1I4TD 2B8TA 3ECCA 4DCTA 1LNZA 4ZDIA 3RWOA 1N25A 2PZFA 3W90A 3A4MA 4NKRA 1M7GA 1N6RA 1TQ2A 3C15C 3LBIA 4ZCMA 3CNOA 2W0SA 2ZAOA 4Q9IA 3AGPA 1WP9A 5FBWB 4QFMA 4KSCA 3G5UA 4JYBA 3ZVRA 2H18A 2KE5A 1KK3A 3CBQA 2IS1A 5LD2B 4BLSA 1ZD1A 3AGQA 4D26A 1SXJC 1NKSA 2FZ4A 1KJYA 2OSBA 5LB4A 2QAGB 3RWMB 1AQYA 2GCPA 1U99A 3KXKA 2BCJQ 5DISB 2E9SA 3I3SR 1W47A 4CVNA 4HLUC 5KU1A 4NL4H 2CCGA 3LX8A 4JBXA 1SVSA 1JBKA 3V9PA 4OQLA 4EFNA 5DNYB 4ERNA 1TF7A 4Q7JB 1GRRA 3FHTA 4DHEA 4PQYA 2ZRAA 2CLCX 3LVQE 1S9HA 3KKOA 4U5XA 5KOYA 4JSYA 5EE0A 4MRVA 2J7PD 3I5YA 1KMHA 2Q3HA 3THOA 3BOSA 2XSZA 4RD3A 2ZUBA 2Q21A 2JLQA 1F48A 1W2HA 2IUSA 2N1BA 4W7SA 4O2LA 4TZ6A 2Z83A 1TADA 3TKLA 1CJVC 4DDUA 1XZPA 1P9WA 2GXQA 5EXTA 4DLZA 4RKEA 1D9XA 4C0HA 1FTNA 4K46A 5KDLA 1D2EA 1ZC4A 2ERXA 2P3SA 3LXRA 2EU8A 2QUZA 3IQWA 1JPJA 1KSJA 2BMFA 3MUFA 2V6IA 4MKIA 4A15A 3UANA 4B6FA 2ZVQX 3EZ7A 1CBUA 4I1VA 5DI9A 1SXJD 1E4VA 2FX3A 1PLKA 5JWRA 1G6HA 1WF3A 4QHYA 1NKTA 2J0QA 2YWGA 4I1OA 4QGFA 1D5CA 2HUPA 3BH0A 4I99A 3W5IA 4UNQA 5JS7A 2JLWA 4V0NA 5AJVB 1UADA 1CJTC 4PANA 3U44A 4TMXA 1NLFA 1DG1G 2J0UB 4LJ9A 1IY0A 1WE2A 2D74A 3W6PA 4WIAA 2QP9X 2G77B 3IDQA 3TW4A 1EX6A 4DSOA 4F93B 2GA8A 4L5BA 2WAYA 3OEHA 1HYQA 3EZ9A 2RB4A 1DPFA 4G5QA 4A6PA 1K5GA 4EQ6A 1KK0A 3OEHD 1T9HA 4P4SA 4PFSA 4U02A 3LY5A 4PHGA 2FE4A 2GWHA 2CVHA 2NMVA 4HZUB 2O8DB 3HU3A 2V8OA 2WWWA 3A1SA 3VR6A 4EPWA 2OBLA 1OXUA 4O0MA 5E4FA 2C99A 5IF9A 4JVLA 5H68A 1EK0A 4LJ8A 3GLHE 4L8GA 1FW6A 2XXAA 1E6CA 2FWRA 2QTHA 3GEHA 5SZJA 5HR5A 4CDGA 3UKDA 2IC5A 3P4XA 1KKMA 2RGXA 5TXGA 3RYTC 3PEVA 4CEHB 3KX2A 1ZYUA 3U2QA 4TWZA 2D7CA 3CW2A 4TSFA 4FW9A 2AL7A 5EZ5A 4P4SB 2ZS9A 4IOKA 4NCIA 5F98A 2BBWA 1G8FA 2YNMA 3KKPA 3GFOA 5EP1A 3GLIE 1G7SA 2G0TA 3F3YA 1IAQA 4PQFA 4QL3A 4HUTA 2IEZA 3LBNA 3TGPA 3CZQA 2BWJA 3QPUA 4M1MA 2XB4A 1XMIA 3NKVA 2P6RA 2NO1A 3KL4A 5BN5A 2JAQA 3AVOA 4BFVA 2DCUA 2WWIA 5H70A 1LS6A 1P2VA 3QXXA 3T12A 1XCGB 4MA4A 1OB2A 3AVUA 2ZI3A 3WMFA 1U98A 3SEAA 4B32A 1GRNA 2W6JA 2YKGA 1G3UA 2KI5A 2A3RA 4OI2A 1ZU4A 1VYVA 2ZRKA 3PR1A 2EWWA 1YR6A 4W5JA 3VHLB 3B1XA 1HQCA 2BMDA 3AF0A 1ZNZA 5CDFA 3GLGA 3AM1A 1CLUA 4M1WA 2G1JA 4M9SA 5J5CA 1GRQA 3FPAA 4HAXA 4PO9A 1W7AA 3P27A 2EFEB 1NVUQ 2CL6X 1MABB 1ZM7A 3EARA 3CF2A 3QF4B 3L8YA 1T3LA 2WVJA 3K09A 2ZJYA 4DUGA 4D4KA 3NTUA 4RFSA 2EWVA 4M1YA 1Q21A 1FP7A 2P67A 1EFCA 2Q9AA 3E5HA 5L3SA 5FTMA 3H0KA 2O8BB 4ABYA 4E5UA 2ZJ2A 3I8SA 5L8VA 2QRNA 2JCSA 3HWSA 4GZLA 3UMRA 1DAKA 4A0HA 4PSKA 4AK9A 3H86A 1EG7A 4GRAA 1Q0UA 2DWQA 3TAHA 4DEXA 2PCJA 3CKLA 1G5PA 2R6DA 4D0NA 2JGNA 4BPBA 3AVYA 4RZXA 2C9CA 2XZOA 2WKRA 4JLVA 5TV2A 2IL1A 4OKSA 5EE9A 5KNBA 1TF2A 4IXNA 2ZAMA 3TSOA 4R71A 1SVLA 4D80A 2H17A 4ZIRA 3L0IB 4TTPA 3ZS9A 3F8TA 4BZXA 1Z47A 4NP6A 2VA8A 2FPKA 2R6AA 1LFDB 1KSHA 3H2YA 4Z1MA 3GLGB 4ON9A 4IEEA 4QM6A 1MT0A 4UJ3A 4ZKEA 3RSOA 1LVGA 3FKQA 1JI0A 3QXSA 2VRWA 3HPQA 4LGMA 3RRZA 1HA3A 1HURA 1G5TA 2FGJA 2WPDA 4TL6A 2GAOA 3T5DA 3PJRA 3VMFA 3TBKA 1NNEA 3K9HA 2IHBA 1CJKC 1AS2A 3EZ6A 4OHVA 1M2OB 1VHLA 2WJGA 4XWOA 5K8LA 1OPXA 2O8FA 2WIBA 1OT3A 1FNNA 3B60A 1XXHA 3PFIA 4HI0E 4AYXA 1I4LD 2KJQA 2VHJA 3FE2A 4B3DA 3AF3A 4PPNA 4HDOB 3RS4A 4JVSB 3EIHA 4AURA 3Q5DA 2UZIR 2ZJAA 1E9RA 5KPJA 1TX4B 2GK7A 2GBLC 3MD0A 3GP8A 4JLAA 3TW8B 1XJCA 4Q47A 4TLDA 2HT6A 1M6NA 2WIAA 4MYCA 3HU2A 1BH2A 4BFTA 3UWKA 2RGNC 3F0TA 3M4YA 3GJ3A 2GDJA 5K8IA 3L82B 4BGDA 3L0SA 2WZQA 4G5OA 2QMUA 1Y63A 1J2JA 1II0A 3ADBA 2W00A 2IWRA 2GNOA 4DLYA 1WBBA 2BM1A 3DMDA 3MWLA 4GPTA 5F3WB 5DYGA 2FFBA 1AK2A 3QI2A 4LOAA 4R7ZA 1N6IA 5JI2E 1G8HA 1T3HA 4NCNA 4C7OA 1CR0A 2GILA 2FMXA 4KSBA 3PV0A 1J7KA 2W2VA 3RSLA 4JBYA 5DIFA 2H16A 4CW7A 2A2ZA 3OFND 5FI1B 2WJIA 2R65A 4Q1AA 4L4UA 2CBZA 3CWZA 1G4UR 3SYKA 2BIFA 4P31A 1XXHB 2AD1A 4C30A 2VQSA 1E0SA 3GFTA 3PUXA 4D4LA 3CONA 1SQ5A 1XTSA 3U44B 2GJKA 4PC3A 5C46F 1OHHA 2GRJA 3IEVA 3X1WA 2ANCA 1IY2A 1KO5A 3SQWA 1E69A 4I4LA 2GEUA 2RMKA 4RFVA 2YZ2A 4IDQA 4TQ9A 2QSZA 5CJPA 3V4FA 1MO5A 5FUWA 3K09C 1NBME 3VU9A 1YR7A 4B2PA 1GKYA 1EGAA 1XMJA 6Q21A 1H65A 5JZVA 4IDOA 2PMKA 4XOIA 4EPXA 3AUYA 3ZD7A 2DFLA 2ZQ5A 1S8FA 3BD9A 3C16C 3LW8A 4V0LA 4DVGA 1N6PA 2QTFA 3B2EA 5EP4A 5TVKA 3BJIC 2CHGA 5SZKB 1W5SA 1IN4A 1OH5A 2OV2A 5JSZB 1YKSA 1COWA 4X8HA 3HYRA 4MYTA 1C4OA 1II9A 2A5FA 1KI7A 2WICA 2NO6A 1W4AA 3NWJA 1ANKA 1RJ9B 3CUEF 5HTKA 2G9NA 2C78A 4CEHA 3K0CA 1IN5A 4F92B 1TUIA 2ZSBA 1KZ7B 3M6AA 2QROA 2IXEA 3OZXA 4GMXA 1NSFA 4HUQA 4PAQA 5GJWC 1UAAA 4MH0R 4LC1A 1UDXA 3HPRA 2A78A 3BS4A 3MRSA 4D4JA 1PVOA 5UKDA 2IYZA 1GL7A 1IXZA 2PL3A 2RAPA 1ESMA 2BMJA 2GETA 1NBMD 1PLLA 2IBMA 1US8B 5AJYA 3RC3A 5SZIA 1KTVA 4D6PA 4F7WA 5JSZA 3U7HB 4CGZA 4QM7A 4OHXA 4Q00A 2ZEJA 4FINA 5KTYA 3NEJA 2P5SA 4FD2A 1W2GA 5G40A 4B75A 1DO2A 3RS2A 4ZV4A 2V9PA 2JJ1D 1SXJE 1XEWX 2PH1A 3K53A 3VNUA 3LA6A 2B8WA 4LYHA 1T4GA 4Q19A 5E7JA 2OAP1 3SR0A 4WBSA 4HAVA 2GJSA 2GVDC 1E9CA 5A5GA 1EWQA 1QG2A 2NZJA 1GSIA 4PZLA 3FMOB 4D82A 3UMSA 3SOPA 5E7IA 2WV9A 4TT3D 3KQNA 3NVAA 2V55B 2HJVA 3LDAA 4F4CA 2ANBA 3MCAA 3EPKA 1T6NA 2AK2A 5CYOA 1XBTA 2BJWA 3QOFA 5CK4A 3DO6A 2EFHB 2NQ2C 3S1AB 4QXAA 4DLVA 1Y3AA 2MSEB 3KJHA 2C95A 4MDFA 2WSSA 1E4YA 1N3BA 1Z08A 1XD2A 4HAWA 4JZKA 5DI3B 5JS8A 3LLUA 3T1TA 4HAZA 1UM8A 4UNRA 3EPHA 3UWOA 2QY9A 1Q1ZA 2VH5R 3SN6A 1GWNA 1R5NA 4EAQA 3R8FA 3CPEA 4LRWA 4ASUD 1U9IC 5GVRA 1MRNA 2FA9A 1GILA 1CXZA 1G6OA 4IVQA 2OG2A 4PZZA 3TUJC 4C0SA 3VR4A 2VHTA 5TMPA 2FEOA 2DBYA 2C9OA 1G3QA 5DYIA 5B2ZA 1SGWA 2MMGA 2H57A 1RIFA 4GL2A 2Z4RA 1EWRA 4QJ4A 3SDZA 1ZCAA 1E2KA 1KI1A 1GTVA 4EIWA 1EFTA 2D2EA 421PA 4Q1FA 4AYWA 1X1RA 4PO8A 3OEEA 1CRPA 2VL7A 4Q01A 2AKYA 2OT3B 2ZRFA 1XF9A 2FV8A 1FNMA 4URVR 1R8SA 4RY2A 3OFNA 2J7KA 4Q1BA 3R7WA 2FNAA 2OE2A 4Q03A 1OE0A 4DSUA 3VNVA 2JASA 4V03A 2W6ID 2QL6A 1E94E 4UQOA 2QMHA 3LLMA 4B43A 1XX6A 4MITA 1E2GA 4AC9A 4Q7LA 2IYVA 4IJMA 4ZDWA 5LDDC 2RGDA 2FFAA 2ZU6A 5AUOB 1NIJA 2XOKA 1VG8A 4B2IA 1KNXA 4ZI3A 4JLBA 1HQYE 4DKXA 1AIPA 2OM2A 3K0CC 3UATA 4YMVA 5H8WA 4MYUA 4KAXA 4PC2A 3I62A 1E9EA 1G21E 2NTYC 2QT1A 4LDJA 5FPKA 1JNYA 1NRJB 2CK3D 3A1TA 2DB3A 4Q9JA 1Z0JA 5EP3A 2ZVPX 2LWIA 3BORA 2XB2A 3MSXA 1YR9A 2WMOB 1Z0DA 2EW1A 1Q1EA 3QEOA 1ZUIA 1W4BA 4G5SA 1ZU5A 4LCBA 2ZI4A 2JLXA 3W9YA 3WHLA 3VFDA 1W36D 2WM9B 1JJ7A 5DN6A 3Q9LA 3NBXX 3QPWA 3VX3A 2Q0HA 3AF1A 2H5EA 2DY1A 4QBFA 3RDPA 2JJ2D 2IXGA 3AKEA 3B8HA 4PAOA 2VHQA 1P72A 4ZKDA 1G19A 2ZSEA 2O8CB 3QBTA 3QIAA 4JLNA 3VHXA 1NY6A 1G4AE 1XU4A 3NH6A 4NBSA 2XNDA 3L0PA 1S96A 3IGFA 1AS0A 2W2TA 4JL5A 1P2UA 4KFRA 2DR3A 1ZUNB 4XTCS 5FUYA 2PEZA 3K9LA 4WXPA 4ZIRB 2GKSA 3TSZA 4EJSB 5B57C 4NYIQ 4GOXA 4K81B 3RLFA 1FUUA 1ZCBA 3NDPA 4OK6A 4TMZA 1G1MA 2D3WA 3N2EA 4PR0A 1U0HC 3VR2A 1N6LA 1R0ZA 4YONB 1DAHA 4QOSA 2F1RA 1ETUA 2BKEA 1F6BA 2ZSFA 5FOXA 4PAMA 4X8OA 2HYDA 2ZSAA 1NJGA 2D7DA 1XD8A 3N5CA 3HR8A 1H8HD 2ZRMA 2FU5C 3Q5EA 1S1CA 2O0KA 1JAHA 5KNDA 4A8JB 3QXHA 5BXQC 4LBWA 3E1SA 2A5DA 3MWKA 2QM7A 1PLJA 4DT1B 1QG4A 2C9YA 1TEXA 4NYJQ 1U8ZA 3KJIA 5DI3A 2R6GA 2FPMA 3JVVA 2D62A 5JCZA 3QEJA 4A1FA 5J4LA 4HAUA 2CNWD 4URUR 2F3TA 4ACBA 3BH7A 4C9BA 5JHGB 4D25A 3K0FA 5CYPA 2ODBA 5HCIA 2R6FA 4MRSA 3Q7PA 2FF7A 4Q1EA 4ACAA 3BFKA 1SHZA 3C7KA 1A1VA 3A6PC 4TYWA 2VEDA 4TL8A 3A8TA 3NBYC 1VCOA 1B23P 1P61B 1SVWA 2XITA 1RYHA 1SVMA 2PLRA 3EZFA 1Q1QA 2B21A 2QRZA 3PCRB 5EP2A 4IW3B 4BEBA 5ANRB 1EFRA 5JRJA 1H8EA 1KI3A 4CYMA 1KI8A 2O8BA 4BZQA 1RYFA 4NH0A 2ATXA 4B76A 2CHVA 2OLJA 1NMXA 3UMFA 1UKEA 3U4QA 3K1JA 3BERA 2YJTD 2EFDB 3FMFA 3KFVA 2NGRA 4LJ7A 3T15A 3DHWC 5L3VA 1U94A 1W49A 5EXPA 4PX9A 2OESA 3MWYW 1IM2A 3NG1A 3TVDA 4Z54A 3GD7A 1HH4A 1U0LA 2BJVA 4HAYA 1W4RA 5AR1A 5FPHA 3IHLA 1CS4C 3B13B 5DO9A 4FCTA 2HXSA 2IA5A 5DHAA 4C4PA 2Y8EA 2ZRHA 4EPTA 3I5XA 2WKQA 1EFHA 3BH6A 2V7QA 3DEFA 1JPNA 4UNNA 2A30A 5JJLA 1XMVA 3Q8XB 3BGWA 1A2BA 2OBNA 2NO9A 2HYIC 1IN6A 1EX7A 2VPPA 4TQAA 3FOZA 3WMGA 5JJIA 1B0UA 4PC7A 4F38A 1HE8B 4UKDA 3ETLA 2FSFA 4RVCA 2C77A 2ZYVX 1DG3A 2ZJBA 2OUKA 2J0SA 4Q4JB 1KI4A 4IKEA 2VP6A 4BLPA 3QF7A 1PJRA 4QG7A 2QGNA 4IVRA 2CNWA 4C3ZA 1KMHB 5FBVB 4GOJA 2ORVA 2XSZD 2DFKB 1BO6A 1KO1A 2CE7A 2XNSA 3C14C 4M4SA 4PSVA 1O3YA 5FUXA 1LS1A 3LH5A 2QP3A 1VDZA 3SQXA 2QP4A 2RCNA 821PA 3CNLA 4QHSA 4BFSA 4JLJA 1ZVQA 2P65A 1M7BA 2ASEA 1UBCA 2F6RA 1Z2AA 3OIUA 1FQJA 2Z6VA 4XWAA 1OB5A 2ZJ5A 3BFXA 1I2MA 1G7RA 1X1SA 3PUVA 2ZRGA 4NTZA 3KQLA 2EYUA 3W3AA 1UDWA 3GPLA 3CRVA 3T06B 5H1YA 1E96A 1X8KA 1TQDA 4TYPA 2P2LA 1TTTA 2ZYUX 3QKSB 521PA 4R2HA 4DCVA 1S9DA 2Z0MA 4C7OB 1DTSA 3OF5A 4F91B 1MV5A 4QJ5A 3QNUA 4D2IA 5BWMA 621PA 5FPSA 3L2OB 4W5HA 2XX3A 4GNKA 1E2DA 3CH5A 1QHXA 4P33A 2BHRA 2MSDB 3CLVA 3THXA 5CM9C 4BE7B 1ZM4A 4B6EA 4IOJA 4ESHA 2OEPA 4YMUA 2LCFA 1N6OA 1OF1A 1JR6A 1WQ1R 4GSYA 1X3SA 2G1KA 2OHFA 1E9DA 4AG5A 1JALA 2IS2A 4C0JA 4DDWA 2XTZA 2OFWA 3A58B 5HE9A 1BS1A 1KSGA 3V4RA 1F2UA 3ADDA 2AD5A 3GLFE 5FTLA 2ZRCA 3IBGA 1ZW6A 4LBYA 3ZVMA 3A1VA 3REFA 1DAMA 1OV4A 2B7BA 2J87A 2IS4A 3W34A 2WJHA 3IIMA 3I32A 3KTAB 4NZYA 4AYTA 1YU9A 3SS8A 2ZI5A 3EIEA 2OCYC 2YC2C 1OJLA 1GNQA 1MKYA 1S0UA 5FOSA 4DEYA 4DB2A 3WYGA 4KLNA 4OI4A 4LSGA 3TE6A 1TU3A 2C04A 4LI0A 3WNCA 5HKKA 5L3RA 3ZZ0A 3MLEA 4JVMA 1E79A 1S3SA 3GEEA 1N0WA 1JEEA 1U9IA 2AWNA 4LZZA 5FR2A 2QPAA 2EYQA 3VTKA 1N5KA 3BFVA 1Z8FA 2G88A 2AFIE 3TIFA 4BLQA 2ZE5A 1D8TA 5EJEA 2REXB 1N5IA 1T5IA 4YLGA 1LF5A 2CL7X 2OCBA 2XJ4A 4RD6A 1NVVQ 1VCIA 3NC1C 4HB3A 2O0HA 4Q1CA 1AKYA 1KI6A 2BEKA 3PVSA 2FGKA 1GZSA 4G5RA 4Q4AB 2W2XA 4G01B 2XEXA 4C0BA 3GQBA 1XDBA 4A36A 4B44A 1GKIA 4V02A 4DWJA 1VYUA 3RS0A 3PITA 1P2SA 1G3MA 3LNCA 1KSFX 1OIWA 3NEYA 4M0LA 1TU4A 4MKHA 4DLTA 2FSGA 1N0VC 4B3GA 4ASUA 1HE1C 1OYWA 2PJZA 3AVXA 1DE0A 4LK2A 4RZUA 4Q9HA 1U90A 4MUBA 3K9NA 1QHGA 1XRJA 4GZMA 1R7RA 1TF5A 1SHKA 5JCPA 1SXJB 2KBEA 2RGEA 1CU1A 2GF9A 2ZRPA 2ONJA 2IYRA 5FOTA 1E9FA 3BRWD 3WNBA 1RVDA 1T0HB 1Z29A 1IOZA 2HF8A 1JXOA 1VG0B 1DO0A 1XTQA 4LYFA 2IW3A 4G0NA 4DZZA 4WZ6A 3ICQB 1SZPA 3B1ZA 1PV4A 1WBDA 1MOZA 2V54A 4P3YA 4DIDA 2G6BA 1PZNA 3TUIC 1QHHA 1QVAA 3CPHA 3IIKA 2XXAB 5JMTA 2WJYA 2QN6A 4LUCA 4MRRA 3RS7A 3VR5A 2QE7D 3ZYCA 5TB5A 3C5CA 4TL9A 3ND9A 3CX8A 3KQHA 1KI2A 2CLSA 2NPFA 2ORWA 1NG9A 1Z2CA 1VMAA 1XXHE 5IRCD 4M53A 3A36A 5JEDA 2LKCA 5GJCA 1OH8A 4KYUA 2QI9C 1WRBA 1XTRA 3WXMA 3CF6R 1XP8A 2RGGA 2PEYA 2XJ9A 3SJBA 1EFUA 1G3RA 1OLOA 2QTVB 4UNPA 1VPLA 3ZJYA 1TQ4A 1E98A 3TAUA 4FMCF 1RRCA 1BMFA 2DFNA 2RGCA 2ZRBA 1KAGA 5JLJA 2GK6A 4JLKA 4NYMQ 4HEJA 3UXMA 2WMNB 2CE2X 4H9GA 3AKYA 3U4QB 1F60A 2GTPA 3M1IA 4IOLA 5EE1A 1A5TA 2EQBA 3KUCA 4TYQA 3B82A 4ESVA 1FFHA 4PSAA 3DZ8A 4N0EA 5J4VA 3EPLA 1OHHD 4QRHA 1Z0KA 2NIPA 2EFGA 2GCNA 4POAA 1IY1A 2WSSD 4Q48A 1VCNA 1ZAKA 2OFXA 1C1YA 2ZS7A 4PXAA 3SU8A 3RRYA 2O8FB 3B1WA 1L7VC 1UEIA 2ZR7A 4HDCA 1FX0B 2HT1A 4TMVA 4JSTA 2F1IA 3JZMA 1ZIPA 4J0QA 2PX3A 1KI9A 3X2SA 1F3OA 1GL6A 1KIMA 2OLKA 4CIDA 3DM9B 3X1DA 1J8YF 1N6NA 4DIEA 1E1QD 2Z43A 3EC1A 4NDZA 4EPRA 4D4MA 1WCV1 3SJCA 5B64A 1M8PA 5F2EA 3ND8A 4OHWA 1D6JA 2YHSA 3CRW1 4B35A 2BC9A 5FBLB 2HCJB 4UNSA 2NOAA 2ZITA 4AWXA 5JBQA 2P6UA 3OE7A 1U2RA 1COWD 2GVZC 1VIYA 5D3MB 5CLQA 3K0SA 1NP6A 3DPUA 1TL7C 4HLCA 5CLLA 4TQUS 3G82C 3OE7D 3CO5A 4JVNA 1OXXK 3AF2A 1YZTA 3C41J 2DYKA 1T5LA 2O0JA 2JIZA 2QORA 1GAJA 2JA1A 2ZI6A 3H4MA 4LYJA 3X1YA 3CWQA 4MGYR 2J46A 4I1SA 2IF2A 3VAAA 4PPQA 4A2QA 1BKDR 1AM4D 2HDNB 2HV8A 2ZYTX 3GJ7A 2PX0A 1AZTA 2RGBA 1NN5A 2IYWA 1Q12A 3R9IA 4WOPA 4B3FX 4WW0A 4LJ5A 2KWIA 4CEIB 2ZE6A 1Q3TA 3ZQ6A 3MAAC 3W6OA 2JLUA 5FOWA 3EX7C 3X1ZA 1FMJA 2B92A 4O2RA 3NBZC 5D3QA 2FZLA 2VYFA 3CNNA 4M9ZA 3SYLA 5J4KA 5KDOA 1G8GA 3W6NA 2CMKA 3IO3A 4K8OA 3BBPA 4URZR 1JR3E 1CRQA 5IHPA 3N2IA 2JLYA 4AI6A 3VU9B 1FOEB 4US0R 4TMTA 3D7MA 4URXR 1VCMA 3T34A 4IDNA 2RGNA 1P2TA 1IHUA 3IPYA 1GIAA 2RHDA 4LPSA 1W44A 4TYNA 1OFHA 4HB2A 3AV0B 1NVVR 1R6BX 2Q6TA 2IYXA 4E07A 3VKGA 3GLHB 4A0GA 1ZMXA 4ZDJA 4WXRA 1XEXA 3D3QA 2IYSA 4JLDA 1KDOA 1NJFA 1RRGA 1JAIA 1R2QA 2ODEA 2OBMA 3KDSE 4A8JA 1TPZA 2HF9A 3ZDQA 2N42A 1CF4A 3I73A 1UBGA 2ZR9A 1Z0FA 1ZD8A 4YMTA 3UK6A 2N46A 1L8QA 3BAFA 3B78A 5L3QA 3LV8A 3I8XA 5IK2D 1XTJA 1MO6A 1E32A 4G1UC 2ZJOA 1FP6A 2ZU0C 4E09A 5KYKA 4BLRA 5KSOA 2O8DA 1CJUC 5FFMA 1ZRHA 3O8RA 1G20E 2R8RA 4A0FA 4Q7KA 2P6NA 1OKKD 1KY3A 4RJLA 2I4IA 4WZBE 3PXGA 1Z6XA 3F5FA 4D81A 4RKFA 4EPVA 4B34A 1G8YA 1TQ6A 3EAQA 4P4TA 4XSHA 3I4LA 3SHFA 5KUTA 4EUNA 3P26A 4KFTA 1XJQA 3IHWA 4IFEA 2V7QD 2BBTA 4U00A 1ZM3A 4NONA 3IILA 5KHOC 2VSOA 1DS6A 1KGDA 1VG9B 2JDIA 4OJQA 4YMSA 2VSXA 3GLFA 3K0AB 3GMTA 1NIPA 2QNRA 1EXMA 1P4SA 2F9MA 1E0JA 4FCWA 4RD0A 4C2TA 1P3JA 4A82A 3THXB 2VLIA 4MRPA 2AN9A 1JECA 1G291 1ZD9A 4YC7A 3QSYA 5FL7A 5E95A 2EFCB 4DSNA 1HY3A 1QHIA 2OXRA 2QM8A 3KQUA 1H8ED 221PA 2IYYA 3CIOA 4PTLA 3U6KA 1AGPA 3ZIAA 2ZS8A 3B9QA 1XEFA 2IF0A 2L0XA 4KO8A 4L9WA 3WMEA 4ILEA 4ITRC 3I92A 1AN0A 4LBVA 1Z6AA 3CR7A 3SI7A 4S35A 3N70A 4W5WA 2D06A 1DARA 2BM0A 4PC1A 1A82A 4W9MC 4LV5B 3GJ4A 2QAGC 4URWR 4OQXA 1L4UA 2MMCA 5JI3E 4DCSA 4DCUA 2BDTA 4DLSA 5KSYA 3KJGA 5JEEA 5HZKA 2VP9A 1S2MA 2ECKA 4N1AA 4JLPA 1OH7A 1G17A 4V0ME 2ZJ8A 1HEIA 1VTKA 3IO5A 5K8TA 4N0DA 4OK3A 1GL9B 4GBMA 4TLBA 4CT5A 3UPUA 3DVLA 3PEYA 4HYYA 1US8A 3CH4B 2FDCA 2I1QA 4KVAA 4PHHA 2J0UA 4FXPA 4S2EA 1GNRA 3WP0A 2V3CC 1QBKC 2ZE7A 4OQMA 721PA 4M22A 4ZCIA 4XVQA 3GCGA 8OHMA 1U8AA 4TMWA 4IFBA 4YDHB 2IYQA 3CZPA 1Z0AA 2KSQA 4P4UA 4DJTA 4IHQA 2GZAA 4EKDA 3Q72A 1BIFA 1TNDA 2WJJA 1Q3HA 4C0QC 3VKWA 1P75A 2ORIA 3SC3A 2H1LA 4ARZA 5L3SB 1T0JB 1M34E 3OAAD 3QUSA 1GOTA 4JKYA 3EWAA 3D6TB 3KQKA 2WWYA 1GM5A 1S1MA 3TR5A 3AVPA 4JT4A 1DADA 1S3GA 1XCPA 2A9KA 3GLHA 1YJ5A 1XZQA 1WMSA 3ZVLA 2DWPA 3QKTA 3WBKA 4FWTA 1GDDA 1Q44A 1FQKA 5BYKA 2VBCA 4WA7A 1AS3A 3KB2A 4DLUA 4OK5A 3FHOA 1BYIA 1OSNA 1GVNB 2C5LA 2PCLA 3LRPA 4AIIA 2ONKA 3L0OA 3O8BA 3BXZA 2E87A 5FPYA 3D31A 1K5DA 3U5ZB 2X19A 3RABA 1KDRA 2BKUA 3ZIAD 1JR3D 1CKEA 2IXFA 5G53C 2QENA 1FMLA 1XB2A 3W8RA 4DCNA 2SHKA 1U0JA 1W4CA 2PMDA 4HUQB 3BE4A 4MYHA 4KYIB 5HCNA 2XTNA 5CB8A 2B7CA 3EZ2A 3SNHA 2AKAB 4B71A 3RS3A 3FFAA 4JLMA 2IYLD 2R62A 3AVQA 3OHMA 5TARA 5CJ2A 2ZREA 3PQCA 4FMBB 1UJ2A 4GOKA 3TLXA 3H84A 4IVPA 2ZROA 4DLWA 5BN4A 4PHTA 4YDSA 1NVXQ 1NLZA 2IS6A 5LBIA 121PA 3NIBA 2XNDD 4HDQB 5B30A 4OYHA 1WA5A 4IEIA 2ODWA 1ELOA 2FOLA 1MH1A 2Q9CA 1OFTA 3CM0A 1X8JA 3LBHA 4JJZA 3LVRE 2A5YB 3VR1A 2KB0A 2XTMA 1IJEA 3FWYA 4B48A 3NH9A 2HXYA 2BCGY 1H8HA 1N5LA 2F9LA 2Z5FA 4FCVA 3KXIA 5C4GB 5IK2A 3V00A 3P20A 5KNCA 1E3MA 2ZRIA 2VP2A 3BC1A 4LHZA 2OILA 1TMKA 4Q21A 4JMPA 1UF9A 3EXAA 1QHYA 5CDFE 4IXMA 1D2NA 3NC0C 4GP7A 4B33A 4CEJA 1TEVA 3THYB 5BW8A 2WWGA 3WBJA 1KO7A 2IT1A 3ASZA 3MFYA 1OXVA 4D0GA 4BUJA 4IRUB 2WWFA 2PZGA 2J45A 2WWHA 1NN0A 4FMDF 4FI3C 3GJXC 1PUJA 2CLDX 3J81k 2IHYA 2JDID 4DSTA 1J70A 1T8UA 2NPIA 5DSZA 1RRFA 3LW7A 3DL0A 2VTKA 3OESA 3QKRB 3L43A 2OXCA 2ZANA 5JJKA 2J0VA 4JYCA 3W8NA 1YE8A 4KCGA 4DXAA 4LHYA 1KI6B 4MKFA 4Z51A 2QMEA 1Z3IX 1IXSB 4R98A 3UG6A 2YC4C 3NDBB 1G16A 2C8VA 3BIFA 2O8CA 1CJMA 4Z8XA 4FMDB 1M1YE 1J99A 1E0AA 1OKKA 2V1UA 1YHNA 2FH5B 4TMKA 1RJ9A 2ZTSA 4QGAA 3FVQA 1HUQA 2CCKA 1W5TA 3ZQJA 2CK3A 2AWOA 4GT1A 5DGXA 5CIWA 3K70C 3K9GA 2FG5A 1XEWY 2C2HA 1WXQA 3WRXC 1OIVA 4AKIA 3QVUA 3SE0A 2RGAA 1N0UA 3GJ0A 4M1KA 5GVSA 1YRBA 4ZO4A 3W3ZB 2F3RA 3EA5A 1NLYA 4Y0VA 4QBHA 3ONWA 3AB3A 3GLFB 2O5VA 3SZRA 1E2LA 3PEWA 3VKHA 4FN5A 1ODFA 4AG6A 4CRWB 1YVDA 3T5GA 3AVTA 4KU4A 1ZNXA 2Q3FA 2QEQA 2GAAA 1KOFA 3CRRA 1SKQA 3EASA 4G3XA 4JBWA 3ASYA 1S4QA 4YQFA 3GLIB 5DHFA 4HSEA 4MKGA 1OIXA 4XD7A 1G41A 2JJ1A 2NZ8A 2VF8A 3ADKA 3QG1A 3WHKA 3JVUA 1YZNA 4P32A 3EC2A 1LF0A 4LHXA 3QKRA 2CDNA 4RSGA 3TUZC 3RVBA 3FHCB 4R2IA 1SVOA 2GXUA 1AZSC 1ZUHA 4B3XA 1ONBA 4BFYA 3MJRA 5EUQB 4NE2A 1XFAA 3JZAA 4RD1A 2E1RA 4NPHA 4RFSB 4DT1A 4OL0A 1CR4A 1G18A 2QPOA 3TK1A 1KAOA 3Q85A 2J5XA 3LWNA 2WHXA 1G9XA 1X6VA 3PUYA 2J7PA 2PLFA 2ZIAA
chains in the Genus database with same CATH superfamily
2H8KA 3OSZA 8GPBA 1RRPA 3Q9NA 5BN3A 4EGJA 3SWWA 5C5DA 1MX5A 1QVRA 1U02A 4QHTA 3ZDFA 4XUDA 1OI2A 1M83A 3CW9A 4QSMA 2XAAA 2ZIZA 5IZ4A 3R0QA 1H2EA 3G2IA 3F3SA 5FNZA 4H59A 1UXHA 4HMQA 2RHTA 4JIMA 4PG5A 2ARKA 2IZ0A 1G64A 1XK7A 3R6DA 4AUNA 5CITA 1I2CA 1L7EA 1YRWA 4KMMA 2YW2A 3JWHA 3GARA 2J5RA 2MSNA 3C3DA 4FGLA 4W9NA 4I3HA 3WKCA 3I52A 1S7CA 1YJXA 1Y1KE 4QODA 2R4TA 4MLPA 5D5PA 4H7EA 2DPXA 3C8HA 3ERCA 3SYMA 3IPRA 3EGXB 1USWA 2CNOA 3HJUA 4BFXA 5K45A 2DSTA 3MJ4A 1TAGA 4R1NA 4UEKA 2JVKA 5D8DA 4ZT5A 1F06A 1A1SA 4MJ7A 1WDTA 3U4MA 1XPRA 1XHFA 1NFFA 3BMXA 3OFVA 2V6FA 4ME6A 1XL0A 3B6EA 4GEKA 1ZXXA 1KQNA 1ZI8A 1NNSA 2W2LA 1SQGA 2W83A 1Z0IA 1Q22A 2JFOA 2JI9A 2Z2IA 4ZMRA 3UIEA 3T0GA 1M74A 1B6SA 2O05A 2VSYA 2UVPB 4C2BA 4L0QA 3NHJA 3NUZA 4G1MB 4RMIA 4G6ZA 1Z7GA 2BOVA 5GM1A 4H6WA 2REBA 3KSBC 3PUWA 1FRFS 1GUDA 3ELYA 5FWYA 5FPPA 1J90A 1QANA 3FMIA 2EBFX 4B83A 1X42A 4L16A 3D6NB 3IURA 1YD7A 4PVDA 4HNRA 2IZ1A 5M5BA 1ICEA 3TRHA 4NCBA 4EJ2A 4HWSA 2Z04A 4I1YA 3NOXA 5KTKA 2QQEA 2XHZA 1G55A 3PG5A 4YCSA 5AW7A 1EDOA 1JKJB 4HGOA 3A3NA 4KX5A 4P7JA 5FUVA 3ZWBA 2J59A 1AXRA 2OXEA 1JU4A 2W37A 2XA9A 3PP8A 3EW9A 4NC9A 2Q7OE 2FFQA 5M7EA 3I8OA 1Y1LA 1FNCA 3THRA 3VU8A 3HB0A 2GCOB 2X13A 3FAZA 3LGSA 4TLAA 1V5FA 3G8CA 3N2LA 1D6NA 4OGFA 3T7KA 4NBLA 1DO8A 4R9SA 2J3LA 2OGWA 3ENWA 1IFXA 5LA6A 1O95C 1Q7RA 2LDBA 4GDFA 5A9SA 1UANA 2C5EA 4O0LA 2VF7A 3HYCA 1A27A 1ETHA 3REGA 1KIFA 1WO8A 3SLGA 2VPQA 1LQTA 3ZHCA 4B3CA 1PGPA 1WDKA 3AJ9A 3FJOA 2IYTA 4BMXA 2F00A 1HFJA 3DBLA 5AMXA 2XKAA 3QX7A 1HYBA 1MVOA 4OLFA 5AWFC 2ZRNA 4DM4A 4E03A 1Z28A 1XU7A 3PHCA 2K4MA 4JHLA 1EA7A 5LOVA 3OQNA 1N5JA 3RNOA 1DCMA 2P9FA 3B6JA 2ZRLA 1NR7A 5TR9A 3NT2A 1N2GA 3P96A 3PFFA 4L07A 3II6X 3M81A 2REOA 3TLEA 2VP4A 5K01A 1E4OA 2HY7A 3BFJA 3OLQA 1SKAA 3CIFA 3FKSD 2VOJA 3HDVA 4DQ0A 1ZGJA 1KF0A 1G7CA 4ZREA 3SVZA 5CBPB 4J8PA 4NENB 1Q14A 1JIXA 3H5LA 4KR6A 2V03A 3PLAE 3OSUA 1ID8A 3BK7A 1JLRA 1ZVJA 3I76A 3M3DA 1Y1PA 2Y92A 2ZE8A 3GFFA 4JP8A 4M55A 3RARA 2FN4A 5KJEA 3IRVA 2QT0A 3KQUA 3ZWXA 4BATA 3C48A 4KR3A 2D1QA 2BI8A 3AEUA 1Q77A 3EUWA 4A6XA 2CDCA 2NSYA 3MGCA 2H1OA 2Q1YA 3VZSA 2PMFA 4EEZA 3EFOA 1IATA 1DBSA 1K7FB 2I8LA 1CZOA 1F2UB 2XCLA 3S28A 3VZRA 2QW0X 4AI6A 1QVVA 3OLCX 4KBGA 4QIHA 2HHHB 1B6RA 1H1LA 1WVMA 2PS1A 4YDQA 3OZWA 1G8PA 1GUBA 4PY2A 4GSKA 1SRRA 1C14A 1RLIA 1Z8NA 2PLAA 2QPTA 1J0EA 3HVUA 2BTOA 1VE6A 5EUMA 3NXKA 2HSJA 2GJ9A 3BMOA 5J40A 1I8TA 2QJRA 4JXXA 2HI0A 3OX1A 2EIHA 4RDCA 1QHSA 4Y98A 1XLWA 1UOEA 2YXDA 4J2HA 1RKQA 2R7KA 3RC8A 3O1HB 4IS3A 4XAQA 3EEFA 2ZYDA 4GLJA 1NV9A 4LWZA 2VOEA 4XR9A 5F78A 1J4AA 4JDUA 3DB2A 3PA6A 3SE0A 3HVKA 3HV2A 4UUNA 2YVUA 2RHWA 4TS9A 3R9XB 2V7VA 2O3SA 1XQYA 4FOOA 4X91A 2FW8A 3DQQA 2JLVA 4HP8A 1C9NA 1EJ2A 3QU5A 3LT2A 1FU4A 3Q3JB 2CJYA 2P4QA 1VSUA 4WK4B 2WTMA 5BN4B 2PUTA 3S4YA 5ALKA 1U3UA 3G23A 3WGZA 2DERA 2BMWA 4E12A 4NFHA 1P5ZB 1YL7A 3S2EA 3E22A 3JQGB 1EESA 3BB3A 1SVIA 4Q4HB 3CVOA 3BCSA 2FSSA 4D8WA 4NJOA 4NZ9A 3M89A 4XYEA 1QQ5A 3G2KA 3LZDA 3ML1A 4IOMA 4V0MA 5EUCA 3GZTB 3SLRA 1XVVA 3P0FA 3THWB 1I7DA 1BS2A 1SIOA 4FIDA 3O4IA 1M2HA 1FDIA 1R6TA 3ID6C 4J0KA 2IEYA 4LV8B 2GZDA 3KHSA 1XK6A 3MWJA 3OZGA 5BYJA 5TC4A 2F7SA 1OXMA 2SNIE 4RTPA 2P69A 1XROA 5EPOA 3T9BA 2F43B 2EEPA 4UTRA 5C18A 3DMTC 2B5VA 2FZVA 1OFUX 2LIVA 3JZFA 4H60A 5FF9A 1U1CA 3BVPA 3FYDA 1EP9A 3IVCA 2HM7A 3P1JA 3A3YA 5DLYA 3C85A 1LDNA 1G9TA 4MWSA 2AX4A 4XRGA 2C4HA 4ZYTA 1O4WA 3T3NA 4O1IA 3F9RA 3PDUA 4F06A 3I4CA 4Q4HA 2QYSA 1REQB 4CR6A 4V1CI 1NVGA 3IOEA 1NN1A 4M1SA 4OHRA 4RADA 3NJRA 4RMHA 4UEQA 4NYJR 2ZUCA 4E4RA 1HL7A 3KB8A 3H1GA 3EGIA 3UBTA 1XSEA 4RFLA 5KYGA 5ALNA 4XGRA 5CIQA 3G2HA 2ZWMA 4QBGB 3JVIA 3I2HA 3QYAA 1C30B 4NCHA 4AT1A 2BKLA 3F8WA 4CIYA 4ER7A 2QX4A 2CLEB 2OV3A 5DGHA 4B85A 4D57A 2F43A 3LP8A 2DUUA 4PQGA 1Z6QA 3T61A 1XTKA 2Y9PB 3HADA 1FJ2A 2VUUA 1ZESA 4J2OA 4NWIA 4OHUA 4MPPA 3VR4H 1BDIA 3V32A 4MGKR 1SUIA 3NAQA 4OIMA 1UBUS 1W0KD 4HPJB 1SPXA 1VB5A 2UUCB 5M2QA 4L3WA 3V1YA 3ZHVA 2JVJA 3F3KA 3AP3A 4A92A 2VJYA 4OMCA 4TPKA 4CG0A 3F1LA 2JANA 3DMGA 2V1XA 1LUAA 4KMRA 2O2HA 4HH4A 3BIWA 3K6KA 4W5QA 5ILOA 1VJ1A 5AKEA 2J9RA 3U3JA 1Q50A 3GRKA 1I5RA 4C4ZA 4CM3A 5BXYA 1GCIA 4I1UA 2X77A 1MAUA 1EFAA 3ZJUA 3IH5A 1TO1E 4GYJA 3KALA 1O94D 2QWXA 2J32A 4BU0A 3LGXA 3M6LA 2UYHA 3CH6A 1DVRA 2X7XA 5DYNA 3HEAA 2G83A 3W9SA 4BVAA 2BZGA 3LWZA 4MVJG 2XYRA 4ZOBA 5AUNB 4XWKA 2JB9A 3BZWA 2D0DA 3DFZA 4KHZA 3NHZA 4ND6A 4UZSA 5CHEA 4X1KA 2OWEA 4KPEC 1P2BA 1EBBA 2HIGA 4QNMA 2DX7A 3HXLA 2AFHE 4AS2A 3MWDB 1RPTA 1J8DA 1KAHA 4FBGA 3VAYA 4C03A 1BYUA 4GE0A 4LOIA 4C89A 3BX1A 4R3WA 2CVZA 1JDVA 4Y2GA 4EO7A 4IF6A 2B1IA 3KK0A 3QKSA 4HZUA 4R5HA 2WV7A 1SR8A 1UBSB 4RZIA 4QX6A 5AVQA 1RZRA 1NM5A 1O6ZA 3DMFA 1X92A 4HS4A 4TKMA 1GPBA 5FPTA 2A86A 3ZWOA 3ZWWA 3DOFA 2AK3A 1IOVA 4HYTA 2CEAA 4MA5A 3LPDA 4ZFNA 3PNVA 1D2MA 5B1EA 1LKZA 4JOQA 1CWUA 4O5OA 1XJ0A 3E70C 2HKIA 2XEDA 1OXTA 1Z75A 3OZVA 1NL3A 2QZ9A 4RK6A 4WFIA 5HOEA 3LM8A 3R0ZA 3BMCA 4D4HA 3LZ6A 4GGOA 3CZ5A 2D5AA 5TIIA 1YC5A 2YWXA 4DR3B 3TJZA 1BXRA 2NNLD 3LPMA 3GDOA 4JL8A 4M89A 1QYDA 1IBCA 1GG5A 3WMXA 1ZN2A 5FV4A 5E9WA 2HUNA 5EZYF 3WX0A 1OH6A 4KYVA 3AUUA 3WQSB 5FLXA 5IPFA 1LX7A 2NU7A 2OHOA 2Z3ZA 1H2WA 4G1CA 1R0KA 2ZB3A 2JAOA 1JB1A 4BLUA 3HVJA 3MMPA 4PZAA 4WEOA 4Q5IA 4MZDA 1AH2A 1DELA 3N8HA 3UWMA 3U0BA 3VV2A 1T9AA 4KGZA 2WI8A 3EVNA 2BFCA 1Y9ZA 4F9GA 2LCIA 1YASA 3BZBA 4YCMA 1ADBA 1P7CA 2PX6A 3PI6A 4RABA 4DW8A 1NRWA 5C8VA 5HZHA 3SYNA 4RGQA 1T13A 3DOEA 1UPAA 3QPVA 1N2EA 2VDLB 4YASA 1P7ZA 1U5BB 4US1R 4B6QA 4DTCA 4X8LA 1DIBA 2ERYA 2YIDA 1T3TA 4R05A 1VBFA 1Z22A 5ALUA 5EXXA 3WYCA 3GLGE 1TUEA 5A9RA 1MX9A 2DHRA 3K8YA 3WP1B 4BAZA 4TYYA 3DMNA 4H1VA 1D07A 1FTYA 2OCGA 2WAXA 3V4OA 1WOYA 4KZKA 3TEJA 3TIVA 2WAMA 4ARZB 3RU3A 4NXNB 3DM5A 5H5JA 3AF4A 3HV0A 3RK0A 4GQBA 5I6DA 2O3TA 1RPJA 4E7PA 3B2QA 3T9CA 4M9UA 5IDXA 1ZM9A 2VK2A 3I3OA 4WINA 5HK8A 5C2JB 3MAGA 1Y8RA 3B8EA 3V34A 4MI1A 3NTQA 3DFMA 1ZO8A 5SZHB 4NNPA 5ALYA 2N75A 1BFUA 1K88A 2FRDC 3HSSA 3CRQA 3I58A 5T41A 3GZNB 2J3MA 3RO7A 5JNSA 2YOGA 3BD6A 3E8XA 2NN3C 2PTGA 4J0FA 1X1QA 2B98A 1PI3A 3IAFA 1AGRA 3OIYA 4GLLA 4PEVA 1P2FA 4BVKA 3UT0A 4YAJA 2W8ZA 2GZ2A 4XTRA 1QP8A 1W36B 3STXA 1G98A 4W82A 4DIKA 5C3UA 5THKA 2D2VA 3AY6A 2HMSA 2V98A 3LUAA 3HS3A 1I2ZA 4RPHA 4QSHA 4INOA 4L8FA 1C3EA 2PJRA 1E8DA 4BVLA 3SX0A 4BX2A 2VQEB 3AL3A 2TMYA 3FDFA 1NPDA 1ZD2P 2IQ5A 3WDLA 4CODB 1KWKA 2G63A 2YOFA 3WFJA 3IDOA 2PZBA 2X42A 3IFSA 4G63A 5B36A 3I72A 2XIQA 1QPZA 5D5HA 2VDRB 4UREA 2YWFA 3NGMA 4A2CA 3FAKA 5KX5F 3ILHA 4J16A 5I7OA 5ALEA 2B1GA 1H22A 1L8AA 4HLUA 2N3ZA 2P9HA 5BT8A 2LIPA 4A8HA 4LV6A 2QBYB 1RAEA 2JHGA 2O2JA 1N6KA 3IIJA 4M1EA 5AKLA 3EY9A 5J1SB 4NCKA 1IJFA 3L8ZA 2ZSIA 3QHAA 5DE3A 1HO3A 2J09A 2ZJFA 5ER6A 3S7ZA 1TFUA 3TXXA 2GCIA 2FEWB 3DV2A 4F3YA 3F74A 2ZR8A 4G0XA 4IUYA 1VPWA 1UPCA 2FPGB 3T1QA 4JGIA 3E6AA 4MO9A 5EWJA 1S4MA 2YOHA 4QQ8A 1VI5A 3KG2A 2MSLA 1OYYA 1Y1SA 3CR3C 1W85A 3WLEA 4CTMA 4LX0A 2OYSA 5BV8A 3C98A 4C7KA 3MTEA 4YRPA 1ADJA 1M6WA 4PBTA 4QGSA 1ZJWA 3ZHQA 3SCZA 2Q6VA 2ZYWX 1CR1A 1T34A 2I4NA 1F8YA 3N0TA 2FSIA 3VR5D 2X0JA 4EFDA 2WA1A 4RTSA 5IT5A 3KKQA 2CHUA 8ADHA 2CKDA 2G4VA 4C4RA 3IEVA 1X13A 1FPMA 3IIIA 1E92A 2XXAB 2X8BA 3GYBA 5AK0A 3EVGA 4CKEB 4FT2A 1XCBA 2P3QA 1CULC 4QEKA 4IIDA 3GJ5A 3CVVA 4DV3B 3BDIA 4Y6SA 1CIPA 3C5WP 4GP6A 2Q99A 4AU1A 5JJBA 1SG6A 2OGTA 3Q15C 4OBEA 4DDTA 4DYHA 3RIEA 1M0TA 2ZUDA 4LVUA 2ALJA 1MZVA 2RHRA 5JHHB 1VECA 4XFKA 2ZQYA 1R15A 4UBJA 2W7TA 4D9GA 1HKHA 1MV8A 3P4YA 1QC5A 5KNBH 1GT6A 4DBLE 1JR4A 1JEYB 2AXQA 1EDBA 3H11B 3OWXA 3LHFA 3OUUA 3STYA 1ODLA 3JQAA 1V45E 3PX7A 2ORED 3P9SA 5AVUA 3EOBI 3P2IA 4MULA 2PUHA 2YN2A 2Z1NA 4B74A 1IUNA 5HKLA 3CKMA 3FFTA 1VRWA 5I51A 4EHNA 4JXKA 3VU1A 3N87A 4CDRA 2FK7A 2FOIA 2YIJA 4JZYA 2J0EA 3BWDD 1LDMA 4QFDA 4YJ2F 1GFSA 1GSOA 5DM4A 4XRRA 4JK3A 3C7DB 2A94A 1BGXT 1NF3A 5JASA 1H6DA 4RF5A 5D3ZA 3NM6B 1M1YA 3ZDDA 1S89A 2VP0A 2PKQP 4OLJA 1UEXC 2NG1A 4XLLA 4IV0A 2OD7A 5JALA 3BRWA 1EM8A 2BE9A 3SHWA 2I9KA 1MO3A 1RZ3A 1ILWA 3BD8A 1B00A 3O31A 1KE1A 5YASA 4OQNA 1W1WA 4L9SA 5AIAA 2OV6A 4C6RA 4HKTA 1ZKMA 1UBEA 1MEEA 4FFDA 3O4JA 3K70B 1NOIA 1ZBDA 3WFZA 4AJJA 2Z3VA 1NBMA 3IT3A 1U8YA 4L76A 1YI8A 1NX6A 1T3SA 1TZJA 4HYQA 2GHQA 2C07A 2XKBA 2PRYA 3B51X 3QBVA 4P22A 4GLFA 3KVNA 3Q3VA 2WYUA 1EI9A 3BG5A 3PBKA 2H52A 4G4SO 2ISQA 2R3SA 1Z6YA 4M54A 4OJNA 1YL5A 3OEED 4Y1FA 3EA0A 2CZGA 1SUSA 4FHCA 1Y48E 5AKIA 1LSJA 3BEDA 2GBLA 5DNCA 4W5RA 4HLDA 2FFHA 3O8DA 2AYZA 2QVCA 3KAQA 2ZSKA 1QC5B 1JEYA 4RHUA 4ZYWA 3OT1B 3ZHYA 4IZHA 2QAJA 3FGNA 1F1JA 5LUAA 3THYA 1P7PA 3FPGA 3OOEA 5EMHA 3ETEA 3EAGA 2DFDA 3DKRA 5KWIA 1TVKB 4KLAA 4OHFA 4HF7A 4RK0A 4F1KA 2HXGA 3QXJA 1QK5A 1AKNA 3VZPA 4EQ6B 2EKQA 1QRRA 1KXZA 3LD9A 2XWSA 1CP2A 3A05A 3MM4A 1YZQA 3OZDA 1ES9A 1HT2E 1R64A 1X9IA 1I7NA 3FMVA 4K05A 5EA2A 3U09A 4MDEA 2F8TA 4JXZA 5A5VA 3FYCA 1MRSA 4DC9A 3TFOA 1OW3B 1PL6A 2FFJA 1IN8A 2HLPA 1QRAA 1XOIA 1KJ8A 2GD6A 5BT9A 3V3KA 1KDYA 3L7IA 2JATA 2M6SA 1YZGA 2CJWA 2HWUA 3EQ9A 4I4TB 5CCDA 1WNFA 1LPOA 3RVOA 2F55A 2WHRA 2H5JA 2Q6OA 4GKVA 4CEIA 2AMJA 2ATVA 1NJ2A 3U0VA 2G9UA 3V4VB 4ND5A 2RE8A 3O1JC 1OX5A 1NW7A 1P74A 3MPOA 1B8OA 3WTBA 4CQNA 3TQRA 1PQUA 1ZUD1 1PDWA 1L4HA 2FZWA 2BFNA 4GGMX 3K9CA 3OJCA 3FOBA 3L04A 3VR5H 3X2FA 5E9JA 1TLLA 3D4BA 1R0YA 3OTGA 3NT4A 3QEMB 4I4NA 1RR6A 1QXSA 2E6KA 1GP2A 1S02A 3EXFA 1Z2OX 4UE2A 4NMXB 3EBOA 5EERA 1W36C 3YASA 3VVCA 1K6MA 5GPBA 3B48A 3QUCA 3B5EA 3V8MA 1GY8A 4WFKA 3U7EB 3EG5A 3M9XA 4HLQB 5JQGA 2R00A 3LUKA 3AF5A 1E5VA 1I0LA 2GT1A 1N25A 2PZFA 2QN1A 2WJ3A 5C1IA 3NKFA 4O5AA 1C3OB 4EBBA 1B15A 3KT0A 1TQ2A 3PUKA 3OLVA 1GEEA 5JD6A 1H6BA 3CNOA 2W0SA 2UYYA 3ESCA 5FBWB 3V4SA 8LDHA 1OD6A 1WETA 2H8GA 1HE4A 1OBOA 4B45A 4G86A 2IS1A 2HSWA 3ZXXA 2V7PA 1FP4B 2PX8A 2Z98A 3A9RA 1SG9A 2ZDQA 3HDQA 1NKSA 3GPIA 1QQTA 4G37A 4EVQA 1G0OA 2HBQA 1AQYA 3K7EA 5CD9A 1WEHA 1U99A 1X7YB 1YXMA 2WEKA 3ZWQA 2BCJQ 2ACVA 1W47A 5J3JA 5JNVA 1W4ZA 2I6FA 3L7CA 3ZTTA 1KYXA 2JFPA 1J33A 1NLUA 3S29A 4PICA 2BY4A 4GWLA 4OQLA 2OB1A 3AEYA 3JRWA 3C6ZA 1TZMA 2JD2A 4X5OA 2CXPA 5LQAA 1F8XA 3LVQE 5BR1A 3KKOA 4J1TA 5EHXA 1WCYA 2D6FA 2JF0A 1KFCB 4MRVA 4YJGA 4NR0A 4CM8A 1A4IA 1JKFA 4HK4A 2ACKA 5I7WA 1BC5A 2E21A 3CT6A 1ZK1A 3K9WA 1F48A 5B6IA 1W2HA 3FJ1A 4G1VA 4HGNA 4JI0B 1GAEO 2YHAA 4IV8A 4O2LA 3KU1A 2VJAA 4L4XA 3T52A 1K7CA 1RKXA 1W59A 4EYKA 2QTVA 3NATA 4RKEA 3KCNA 3MA0A 1ESZA 1S2NA 2Z4TA 4NESA 1L9XA 5E6UB 2ERXA 2YRWA 4OFXA 2P3SA 5HG0A 3ZWCA 1WHSB 2JIQA 3LXRA 2PGDA 4B40A 1J0AA 5HRAA 5L4NA 3H9JA 3U7QB 1JAZA 4A23A 4A15A 3HJTA 3ZJTA 2P5YA 4WL0A 1SIWA 3UANA 1K4YA 1HSZA 1RYBA 1Y3IA 2J3JA 3EZ7A 1HI9A 3F6YA 1Z6PA 3MINA 3JZIA 4I1VA 5EPEA 5GIPE 1G6HA 4ZTUB 4R2XA 1IZ9A 1QHFA 3A06A 4I1OA 4QGFA 2OBYA 2HUPA 1KEUA 3SDBA 1L7NA 4B4WA 1Y6ZA 3LHDA 2RIPA 3A9VA 2WIFA 4B87A 4FDTA 2JLWA 4V0NA 5AJVB 4TMXA 4LJ9A 3IBCA 2Q2VA 1WE2A 4TGLA 2G77B 3ANSA 3IDQA 3OE5A 5IW8A 1EX6A 1U04A 4F93B 4K28A 4B5KA 1P77A 2VSNA 4II2A 1UZUA 1WV1A 1U3TA 2L17A 5C8YB 3BILA 3V46A 2H4ZA 2PUCA 3W3AH 1J2RA 4P4SA 2P62A 4PFSA 1GARA 1R0RE 3DR5A 1M9NA 3R5XA 5L53A 2NZWA 4HNAA 4QYSA 5K3FA 1U7PA 5CDSA 2CVHA 5LZ2A 4R6XA 2NXWA 2O8DB 1G8AA 4BGEA 1HBJA 1PV1A 3HU3A 4EA8A 3FOCA 2HCFA 1BU5A 3TL3A 5B3JC 4EATA 5LZ9A 1J9GA 3HB1A 3LUJA 3RREA 4KWCA 2D1TA 2DUMA 3GLHE 3TGWA 4L8GA 3S8YA 1FW6A 2XXAA 1SU4A 3I34X 1K6JA 2BGIA 3GEHA 4R8LA 4W1QA 3VO1A 4DNPA 1H66A 3IUSA 4UCWA 1EVJA 1Q84A 4MV6A 3P4XA 5U4XA 4I55A 5HGXA 3H2JA 1HORA 1JLSA 3KX2A 4MLDA 5K0TA 1DOHA 1EUCB 3EMDA 4NJEB 2NP6A 3VPBA 2P2YA 1DC5A 2AL7A 4FW9A 5EIWA 1M5RA 2G9ZA 2ZS9A 1YIAA 4IOKA 1TI7A 1UFOA 2BBWA 3WNZA 2HHAA 1CUAA 1O6BA 1JZTA 1M5UA 1TCBA 4I9UA 5EP1A 3EQ6A 1BJKA 3AR6A 1DAPA 4QVGA 1G7SA 5HCNA 2ADMA 4DUPA 4AO8A 4NULA 1VB3A 1VE7A 1WPXA 2A67A 4HUTA 1IBLB 3GRAA 4TYMA 5B3KA 5DM1A 5JY6A 2AN3A 3EIUA 3Q7SA 1EDEA 3QPUA 2GD2A 1NNI1 4UHDA 1HTBA 3IAAA 3KL4A 3RVKA 5BN5A 2KYRA 2Z9BA 3H2GA 3OPNA 2DPGA 3UK1A 4BFVA 2DCUA 4P5DA 4FJ0A 2R6ZA 3N8GA 1P2VA 2DXIA 2ZLBA 3EHDA 2W6QA 5AHKA 1XCGB 3S7TA 1OB2A 1A04A 3AVUA 2ZI3A 4B32A 4BUCA 3PHBE 2HRZA 1TQHA 1A8SA 4MQEA 1PSZA 3A4VA 1GRNA 2R5FA 3MERA 3R6WA 4M38A 5ECDA 5DHQA 5JS2A 4CM1A 5IT4A 2KPOA 5DSTA 1VYVA 1N75A 3U3ZA 3B3GA 4BNNA 4TLMB 3SG0A 4W5JA 3QVJA 3EH2A 5CDFA 3AM1A 1CUZA 1FP2A 1QKKA 3DSRA 4M9SA 3DE6X 1GRQA 2EX0A 3TQQA 4YCNA 5KCZA 1XZJA 4HRXA 1L3CA 3QBDA 4J1TC 1OLUA 2EFEB 5JAIA 1MABB 5KCMA 1ZM7A 3RBXA 5IBQA 5ALXA 3CF2A 5BUQA 4HDMA 3CS3A 3C5VA 1AVTA 1T3LA 1K2VN 2ZJYA 2I6QA 4DUGA 4D4KA 5ICFA 1C7RA 4RFSA 2JEYA 1LBSA 2PANA 4IXDA 1LD3A 4LRTB 5CGQB 2J6CA 4JUFA 2XLBA 5ARBA 1LSSA 1ACMA 1PZHA 3D7KA 4YHHB 2IDKA 3U4GA 5ALDA 2Q9AA 4BOYA 1DB3A 1FCJA 5G0VA 4CCAA 5FTMA 3IJ5A 4ARSA 1RAHA 1CCWA 3P19A 5KU7A 5E1DA 5K3AA 5L8VA 2QRNA 4CKWB 1T1IA 3UMRA 4UASA 3VHRA 1Q1GA 1W76A 4PSKA 1EG7A 3F4KA 4WRRA 3UCEA 4GOLD 1YA8A 2DWQA 4NQRA 1NW5A 4UMEA 3TAHA 4F8EA 4CCSA 1ZOPA 5ESRA 5E0KB 3KJZA 5SV2A 3GGSA 2MSKA 4GO1A 3IT1A 3PD0A 4JLVA 5FB3A 2DTXA 4G2NA 4GXQA 5KQPA 1N5DA 3KD3A 4OQQA 2B20A 1YWGO 3GZNA 3TSOA 3H9GA 2Z8ZA 4G5HA 1ZCZA 4MQEB 1R3DA 1VRCA 2JHFA 4ZIRA 2IXTA 1OA0A 3F8TA 4NP6A 3CPSA 3QW4B 1DBQA 3TPZA 4OLAA 3D4PA 2BFWA 1TRKA 1J22A 3E58A 2RGUA 1F7VA 1MT0A 3H7AA 1LVGA 4JQZA 2HDHA 3QXSA 3HPQA 1FJHA 1HA3A 1G5TA 1HURA 2WPDA 2XBUA 1MFPA 3Q6MA 3DWFA 1CB7A 4FDAA 4H0CA 1SG0A 3FX2A 4CCYA 4FMPA 1QONA 3AL0C 3OMXA 1YVUA 1AS2A 1TT5A 3EZ6A 4OHVA 5I9LA 5HXAA 2I6SA 3AY7A 4G5YA 2NACA 4GR4A 3TN7A 1PR6A 4XWOA 3NEPX 4XCXA 2O8FA 1MDBA 1OT3A 3B60A 3INGA 4HI0E 2G76A 1QZTA 3QFFA 4Q3DA 5EJ4A 1KVUA 3HCCA 4O1HA 2O1WA 3LHIA 2ODPA 3Q5DA 2ZJAA 3GDFA 1TX4B 2SKCA 3L7YA 3MD0A 3DLHA 1NAHA 3F7MA 2Q62A 4NV3A 3TW8B 1XJCA 2FPPA 3I64A 5HS6A 1DEHA 4KWHA 1SZJG 2WIAA 4U7PB 4BKRA 5JNTA 3U1BA 2CV1A 2WDPA 2FWJA 5TSDA 3HU2A 2EL7A 4GPBA 4BFTA 5CRIA 4FLEA 4BC1A 4K5QA 2RGNC 4DIOA 3EVZA 5LP6C 3F0TA 2DZDA 1AJEA 3G0BA 2G82A 2J5QA 1T2DA 5AK3A 1Q0QA 5C80A 3L0SA 2I87A 2QMUA 5AFSA 5FOQA 5TF4A 1Y63A 4EL0A 4MYDA 1IIRA 1CK4A 1J2JA 5KOHB 4IKPA 3ADBA 1T5HX 1QOPB 2I3AA 5CDGA 5EKTA 3B52X 3PTZA 3DMDA 3MWLA 1I36A 5F3WB 4FQ8A 3BXPA 5EAIA 3ZHXA 2QTLA 4E94A 4LOAA 1E4EB 4R7ZA 4C7OA 1G8HA 1T3HA 5JT1A 1CR0A 1OVMA 4FVTA 1NUHA 4MVYA 4KSBA 1ZH0A 1YQGA 4RHXA 5DIFA 1T0UA 2IEAA 2H16A 4Y2JA 5D51S 4AMBA 4MVJP 3AHHA 2VT7A 3IQIX 2WJIA 5FI1B 1P80A 2R65A 4NICA 3CWZA 4AXBA 4XCQA 1WEKA 1HF3A 1BE8A 4TMYA 1EP1B 4CLHA 4K9SA 1E0SA 1E1KA 3GFTA 1U8CB 1Q2UA 4KPUA 2G7ZA 2Y1KA 4MUNA 4D4LA 4MPRA 1SQ5A 4ZVNA 1P1IA 3IUNA 4RWZA 1Y8QA 1C3XA 1ZA2A 1OHHA 1Q2XA 2GRJA 4I0WB 2C58A 2ANCA 1IY2A 2ONCA 3FSGA 4QYIA 5AT1A 2OYCA 1E69A 4I4LA 4RFVA 1A8QA 1ZGZA 2YZ2A 3PQFA 1NT4A 2QSZA 4TQ9A 3DJFA 1PX0A 5CJPA 1KARA 3JQEA 2R87A 4D3SA 4RQAA 3W5BA 4ISCA 5GWXA 2L42A 1JSXA 1LNQA 1HT3A 3ZE2B 4JSRA 4IDOA 1DQZA 2C4KA 1TIKA 4P4NA 4W5OA 4XOIA 3G1UA 3GAAA 1CUVA 4EO9A 1XMOB 1X3LA 2DFLA 3PIIA 3G9XA 3BD9A 2WYVA 3LW8A 4V0LA 4DVGA 1K8ZB 4W7HA 4ZA2A 5EP4A 1KP2A 3BJIC 2M6KA 2IEGA 1MB2A 2OV2A 2XQJA 4DA6A 1J8QA 1VGVA 4MKZA 1COWA 3FSEA 3TJMA 3HYRA 3ROEA 4IJKA 2HA0A 5JVDF 5CTAA 2WICA 4X9XA 1DINA 2ZK7A 3HZHA 2B2NA 2IBSA 4G0MA 2C78A 2G9NA 2NM0A 5DF1A 3A6HA 4FE7A 4HUQA 1KZ7B 3RVMA 3TLYA 5GJWC 4PAQA 3H83A 4Y9TA 3E82A 3X43A 5KYWA 1FVFA 3HPRA 4R2LA 1RWMA 2A78A 3MRSA 1QE0A 4FB4A 2IYZA 2AEMA 4DJAA 3JYNA 2RAPA 3A6FA 3AR7A 3D2BA 3IRUA 3B3QA 3K1ZA 1ESMA 3L1JA 3NM5A 4ODIA 4OP2A 4X65B 1US8B 2R7NA 3T7AA 4GAEA 1T1SA 3VPHA 3U7HB 3UFXB 3OPQA 2HMVA 4Y2XA 4OHXA 2WJAA 3T54A 1JPUA 3H2HA 5EMLA 5GV7A 4FD2A 4ALIA 2FG7C 3AR9A 4F2HA 5AKYA 5ARCA 4ZQIA 3VO8A 4BFCA 1XEWX 2PH1A 1Y9JA 3K53A 1LLFA 1UAYA 4Q19A 1T4GA 1WTCA 3OECA 2WG0A 4WBXC 2OAP1 3SR0A 2BW0A 3G8BA 3G68A 4MPJA 2OCLA 1EWQA 4MV1A 4PV7A 1QG2A 2YNMC 3N74A 3DT8A 3ECAA 1MZPA 4LY0A 4ETIA 2XUFA 1X1CA 1VYHA 3I6ZA 3SS9X 3KZMA 4TRMA 2CLOB 2NUBA 3BRCA 3CV3A 4KQMA 2X3UA 5JPDA 2C5FA 4OA5A 3CRZA 4OB7A 2P3OA 3JSAA 3KQNA 2NNWB 3ZI0A 3DNMA 1EFVA 1TFRA 2HJVA 3GLQA 4F4CA 3FDXA 3EPKA 1F14A 4JYZA 2VBFA 1PVVA 1EDDA 3AEXA 2BJWA 4OV6B 5CK4A 2EFHB 2NQ2C 2R1UA 3UMJA 4ER5A 4QXAA 1BQEA 3TTWA 1Y3AA 3KNZA 2WSSA 1UKCA 3ED1A 1E4YA 4IUCS 2RI1A 1OI3A 3DDSA 4FFLA 1U65A 5HCUA 1KZHA 4YEDA 5MFZA 2BFFA 3T1TA 2D3TA 2W2MA 2YBEA 1I3OA 1KYTA 3QSGA 4HAZA 4UEJA 1NQTA 3IXLA 4ROTA 1ILEA 1WDMA 2XDQB 1RXYA 3DE1X 1GWNA 1R5NA 3KDPA 4M36A 2VXBA 2YWCA 4LZJA 1U9IC 1Z0UA 5GVRA 2FA9A 2QD1A 3KEGA 5EMNA 2BR3A 5JCOA 4ESEA 3UFXA 1G6OA 2AUNA 4MRMA 5JCJA 4CETA 2PWBA 2DJIA 2YHBA 1F2VA 1NXTA 4IGFA 2VYVD 1CG6A 2VHTA 4CMBA 2AZTA 4XX0A 5TMPA 1QHEA 4PX2A 5AW9A 4AQ7A 2B83A 3IC5A 3OIGA 1B43A 1D2HA 2OQ2A 2HQ1A 1GR1A 3QHPA 1T15A 5FI3A 3OU7A 3VYRB 1XT6A 2H57A 3H5RA 4JT8A 1KMIY 4MCAA 1PS8A 4UU7A 4LRYA 5EJGA 4CR8A 4RMGA 4E31A 1XP5A 1DX4A 2VEOA 1BGVA 1ZCAA 2W6ZA 1C7FA 3A2LA 1D3AA 2A0WA 1GTVA 3IDSA 2R1VA 2C4WA 1TMYA 3LPCA 4EL5A 5DBEX 4GP9A 4Q1FA 3DA8A 4DANA 4PO8A 1CRPA 2GSDA 1MENA 2VL7A 3JD3A 1ZEJA 3CO0S 3KCQA 4RYDA 1Q0TA 2H7CA 5FEUA 1XF9A 4EHFA 1U7WA 3C3CA 2RH9B 4ENQA 4RY2A 3DXFA 5IABA 1FE8A 3OFNA 1SA0B 4WK2B 1O5TA 4XEHA 3VNAA 1OE0A 3VNVA 2JASA 2W6ID 4CU5A 2ZT6A 4HEQA 3SEZA 2ZGVA 4B3JA 1E94E 2C54A 3LLMA 4K6HA 1EJBA 3GWGA 3IB3A 3N0VA 4RL4A 4R8MA 3AFHA 5AM2A 1EA5A 3IP1A 4FFBA 4IJMA 2H9YA 5A71A 4RPLA 2RGDA 2GBPA 4WPGA 5E1OA 3DKIA 2C5AA 2WD8A 1NIJA 2ZJ3A 5IAOA 4B2IA 1ZH8A 2NO5A 4JLBA 3VH4A 3W7VA 3FYSA 3OVMA 1UJBA 3R0XA 3REOA 4DKXA 3DZBA 4F6RA 1OU4A 3D2LA 1WW8A 4YPVA 5E9QA 3R5SA 5JZOA 4MYUA 4RPJA 1RM5A 1O58A 1E9EA 2NTYC 2QN8A 4LDJA 1UPBA 5FPKA 1L5VA 1JNYA 1NRJB 2DB3A 4WNCA 2CLLB 1FDWA 1B76A 1KZ1A 4DGSA 3DLCA 2JGMA 5C5EA 1Q1EA 1ZUIA 1HLGA 4WNIA 1LPPA 2RKWA 3B3AA 4FOPA 3GUUA 1VCHA 2ZI4A 4GF5A 3AC0A 3W9YA 3WHLA 3E5MA 4GC5A 4U8HA 3FNBA 3UB4A 4FYKA 1EH5A 4S3MA 5DN6A 4CFZA 4L8LA 3VX3A 3PXDA 2H5EA 1KIAA 4D02A 4LDAA 3FRIA 3ZXIA 1TKAA 1XKLA 2IXGA 2JJ2D 2LP4Y 2P6PA 2XUDA 3AKEA 2BGUA 5DTRA 1P72A 1NFRA 4MJ3A 4I9NA 4KK3A 3CW8X 4JLNA 1K6EA 3V4LA 5CFOA 4YXFA 1XU4A 1T2UA 5KVAA 4FFNA 5AI6A 1PR1A 1EUZA 3IAUA 4NBSA 4OQDA 3NHFA 3PTAA 1SQ0A 3GAFA 3JQ7A 4P3XA 4LGCA 1V7CA 1AK9A 2F4NA 3H5IA 3HUDA 3LUCA 3QV2A 3W5DA 4XTCS 4AN4A 2AQHA 2YY5A