1U84A

Crystal structure of apc36109 from bacillus stearothermophilus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
81
structure length
81
Chain Sequence
GQQLNRLLLEWIGAWDPFGLGKDAYDVEAASVLQAVYETEDARTLAARIQSIYEFAFDEPIPFPHCLKLARRLLELKQAAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Crystal Structure of APC36109 from Bacillus stearothermophilus
rcsb
source organism Geobacillus stearothermophilus
molecule tags Structural genomics, unknown function
total genus 29
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2004-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08958 DUF1871 Domain of unknown function (DUF1871)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.20 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Apc36109-like domain 1u84A00
1U84A 3R2XC
chains in the Genus database with same CATH superfamily
3N5NX 2NOEA 2NOHA 1NGNA 4NZGA 2JPSA 4EVVA 1KG6A 3CWTA 3CWSA 3CW7A 3R2XC 3OYKA 3L2VA 1LWVA 3CVSA 4UNFA 1KO9A 3OYJA 3OH6A 5AN4A 1MUYA 1PU8A 4E7JA 5DPKA 1LWYA 1KG7A 2XHIA 1PU7A 4B21A 1RRSA 4E7LA 1YQLA 3OGDA 1P59A 1LMZA 5KN8A 1ORNA 1PVSA 4UOBA 5FRNA 2JHNA 4PIIA 1YQMA 1KG5A 4EW4A 5KN9A 1NKUA 4IKFA 2V75A 2NOBA 3F10A 1WEIA 1KG4A 4E9FA 3S3MA 4EW0A 1M3QA 3S3NA 3OY9A 3KTUA 5CHZA 1M3HA 2YG8A 3FHFA 3OYDA 4EA5A 1XQPA 1FN7A 1VRLA 4BDZA 1KEAA 2JHJA 3G0QA 4BE0A 3IH7A 3OH9A 3OYFA 1EBMA 4AIAA 3OYMA 1LWWA 1YQRA 2I5WA 3OYHA 4ZTFA 1WEGA 3L2WA 3OS2A 1DIZA 4BE1A 4ZTJA 3F0ZA 3L2QA 3I0XA 4B22A 2NOLA 3S3OA 4EJYA 1KG3A 4BDYA 2NOZA 1PU6A 3NNQA 1N3CA 3OYCA 2OFIA 3L2RA 4AI5A 1XQOA 3OYGA 3OYEA 3S6IA 2NOFA 1MUDA 3CVTA 2ABKA 3OYBA 4E7IA 5FROA 4AI4A 2YG9A 1ORPA 3OS1A 1MPGA 4YPHA 4E9EA 2NOIA 4YOQA 4BACA 4DK9A 3CWUA 3OYIA 3FHGA 1U84A 4E7HA 1MUNA 4EA4A 2H56A 4EJZA 2W03A 1WEFA 3LCNA 1KG2A 1KQJA 4B23A 4E7KA 2OFKA 1N3AA 1P7MA 3L2UA 4YPRA 3VW4A 3OYNA 3OYLA 3CWAA 4B24A 4HSBA 1YQKA 3N0UA 1N39A 3OS0A 3I0WA 3D4VA 3KNTA 1XG7A 3FSPA 2JG6A 1RRQA 1HU0A 2W04A 5FRMA 3IHOA 4E9HA 4OFHA 3OYAA 4OFEA 4E9GA 4BE2A 4OFAA
chains in the Genus database with same CATH topology
1U84A 3R2XC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U84 A;  3R2X C; 
#chains in the Genus database with same CATH topology
 3N5N X;  2NOE A;  2NOH A;  1NGN A;  4NZG A;  2JPS A;  4EVV A;  1KG6 A;  3CWT A;  3CWS A;  3CW7 A;  3R2X C;  3OYK A;  3L2V A;  1LWV A;  3CVS A;  4UNF A;  1KO9 A;  3OYJ A;  3OH6 A;  5AN4 A;  1MUY A;  1PU8 A;  4E7J A;  5DPK A;  1LWY A;  1KG7 A;  2XHI A;  1PU7 A;  4B21 A;  1RRS A;  4E7L A;  1YQL A;  3OGD A;  1P59 A;  1LMZ A;  5KN8 A;  1ORN A;  1PVS A;  4UOB A;  5FRN A;  2JHN A;  4PII A;  1YQM A;  1KG5 A;  4EW4 A;  5KN9 A;  1NKU A;  4IKF A;  2V75 A;  2NOB A;  3F10 A;  1WEI A;  1KG4 A;  4E9F A;  3S3M A;  4EW0 A;  1M3Q A;  3S3N A;  3OY9 A;  3KTU A;  5CHZ A;  1M3H A;  2YG8 A;  3FHF A;  3OYD A;  4EA5 A;  1XQP A;  1FN7 A;  1VRL A;  4BDZ A;  1KEA A;  2JHJ A;  3G0Q A;  4BE0 A;  3IH7 A;  3OH9 A;  3OYF A;  1EBM A;  4AIA A;  3OYM A;  1LWW A;  1YQR A;  2I5W A;  3OYH A;  4ZTF A;  1WEG A;  3L2W A;  3OS2 A;  1DIZ A;  4BE1 A;  4ZTJ A;  3F0Z A;  3L2Q A;  3I0X A;  4B22 A;  2NOL A;  3S3O A;  4EJY A;  1KG3 A;  4BDY A;  2NOZ A;  1PU6 A;  3NNQ A;  1N3C A;  3OYC A;  2OFI A;  3L2R A;  4AI5 A;  1XQO A;  3OYG A;  3OYE A;  3S6I A;  2NOF A;  1MUD A;  3CVT A;  2ABK A;  3OYB A;  4E7I A;  5FRO A;  4AI4 A;  2YG9 A;  1ORP A;  3OS1 A;  1MPG A;  4YPH A;  4E9E A;  2NOI A;  4YOQ A;  4BAC A;  4DK9 A;  3CWU A;  3OYI A;  3FHG A;  1U84 A;  4E7H A;  1MUN A;  4EA4 A;  2H56 A;  4EJZ A;  2W03 A;  1WEF A;  3LCN A;  1KG2 A;  1KQJ A;  4B23 A;  4E7K A;  2OFK A;  1N3A A;  1P7M A;  3L2U A;  4YPR A;  3VW4 A;  3OYN A;  3OYL A;  3CWA A;  4B24 A;  4HSB A;  1YQK A;  3N0U A;  1N39 A;  3OS0 A;  3I0W A;  3D4V A;  3KNT A;  1XG7 A;  3FSP A;  2JG6 A;  1RRQ A;  1HU0 A;  2W04 A;  5FRM A;  3IHO A;  4E9H A;  4OFH A;  3OYA A;  4OFE A;  4E9G A;  4BE2 A;  4OFA A; 
#chains in the Genus database with same CATH homology
 1U84 A;  3R2X C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...