1U88A

Crystal structure of the 26 kda glutathione s-transferase y7f mutant from schistosoma japonicum complexed with s-octyl glutathione
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
209
structure length
209
Chain Sequence
MSPILGFWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase 26 kDa
publication title Crystallographic and Thermodynamic Analysis of the Binding of S-Octylglutathione to the Tyr 7 to Phe Mutant of Glutathione S-Transferase from Schistosoma japonicum(,)
pubmed doi rcsb
source organism Schistosoma japonicum
molecule tags Transferase
total genus 45
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2004-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1u88A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1u88A01
4EL1A 2F8FA 3IPZA 2KUCA 5DCHA 2J23A 4ZB9A 1J9BA 1SKWB 5FT3A 2HXKA 3GRXA 4G0KA 3WT2A 1KBNA 1PN9A 4EUYA 3IK9A 5J4UA 3NZNA 4KCEA 3GIXA 4X1UA 3ZTLA 1PQNA 3APSA 2VLVA 3L0HA 4OMVA 1Z6NA 3ZLPA 3ZIJA 2LS5A 1M0UA 3ME7A 1XW9A 1A8YA 2JZTA 1GUKA 2VO4A 1WPIA 3SWLA 3PR8A 4XHMA 5AIXA 3DKSA 4ZXGA 4ZL7A 3BD2A 3J7Yb 2WFCA 1U3IA 4MMMA 5IMDA 1EOHA 5AIVA 1USBA 2FA8A 2B5YA 3VI5A 3UMAA 1ZYEA 1TU8A 4XS4B 4KA0A 3KTLA 4NHWA 4K7OA 5J9BA 3CSHA 2GGTA 4O5RA 5G1LA 4WXTA 5C04A 4TKYA 1XIYA 5H5QA 3GYKA 2V6KA 1DBYA 5EY6A 3G7JA 1EV4A 5JCWA 4ZBAA 1ZOFA 1X9MB 2CAIA 1TK0B 3RHBA 2HRFA 3CRTA 1AQVA 3KEBA 6GSVA 2H70A 1WJKA 3FW2A 3EINA 3IAM2 4ILFA 3ME8A 3IC4A 2GSRA 2E2MA 2YZUA 4BL7A 1S3AA 1B4QA 3DD3A 2HLSA 5HQPA 2HT9A 3UVTA 2D2ZA 1OE7A 1B9XC 3IAS2 2GSSA 2VCWA 3G7YA 4DEJA 1DSBA 1PL1A 3GTUA 1NW2A 5EL8A 1ZCPA 4ECBA 4ISDA 2H6YA 4PNFA 1A0RP 1GSQA 4LA1A 3GA4A 1GP1A 1JHBA 3KJYA 2R6KA 3U6VA 3QAWA 4DSSB 4IBPA 3MAKA 2VCZA 4IQ1A 4HU9A 2AB6A 4OD7A 2LQQA 1VRSD 2Z9SA 3IC8A 3MDKA 5DVBA 2HRKA 2PMTA 3MWHA 3HCZA 2VM2A 4PQHA 3EURA 3SBCA 4ZBDA 3I69A 3BCKA 2X99A 2WDUA 3QR6A 2YNXA 2L5OA 3LWAA 1OC9A 3F6FA 2C0EA 3D21A 2MYGA 4I6XA 5B8AA 2X8GA 4HJ2A 4LMVA 3LQ7A 10GSA 2HSYA 4FYCA 1S3DA 1F9MA 2ZUPA 1XW5A 3E0UA 5DJLA 3L78A 3LXZA 1K0OA 1G7EA 3WD6A 1YKCA 2LJAA 2ES7A 5ID2A 3DIEA 4N0ZA 2IMIA 1T1VA 3US3A 5ECKB 2ON7A 2BTOT 1V9WA 1F3BA 4F82A 5D9WA 5HFIA 4GWRA 4HI7A 6GSWA 1HD2A 2H19A 1PX6A 4V1Ag 2K8SA 5D9XA 1X5EA 4HEA2 3TKPA 4PTSA 3NOFA 4TXOA 4EXJA 2HSMB 4KGIA 1EEMA 3IR4A 4EE0A 1LJRA 1SL0B 2HZEA 1WRYA 2KHPA 1X5CA 4ECCA 4BVYA 1TW9A 4XS1A 1XVQA 2R4VA 1G7OA 4AGSA 2FWFA 4MF6A 4NHZA 4G2EA 2R2JA 1ZYQB 3ZFLA 1ILOA 2RUEA 1R5AA 1SK0A 2F9SA 1N2AA 4MZCA 2J9HA 1I5GA 1IYIA 1TP9A 3N9JA 2UZ8A 2V32A 4F9ZA 4MJBA 1THOA 4ZL9A 3WYWA 1VF4A 2FWEA 2C4JA 5H5RA 2OE1A 4HDEA 3EYTA 4AJ8A 1V58A 1XWBA 1Q4JA 3HJMA 1YEPA 1YZXA 1OC8A 1X0RA 5B6NA 4RQXA 4BPYA 3M3MA 4EF0A 3CSIA 5CYYA 3HY2A 1SD8A 4JE1A 2NPBA 2LRTA 1ZL9A 2GSQA 4MF5A 5CRDA 2IN3A 4MLYA 2K6VA 2DJKA 5B6MA 5LNKe 1GULA 5ABRA 3FYGA 1G6YA 2I81A 1X9SB 3VPQA 2L4QA 4KDXA 5JWRB 4PXOA 1R7HA 4F0BA 2O7KA 1KTEA 4OWYA 3BCIA 2GS3A 3EVIA 3QFAC 4MZBA 3DXBA 4L0WA 1G0TA 4CHSA 2X64A 2X8HA 2OE3A 4YQMA 4IS0A 2VL9A 5IMFA 1B9YC 4BWSA 4KSOA 2ZNMA 3C7MA 3DMLA 5IOXA 4EDZA 2OJLA 2QKEA 1TRVA 4TVEA 4GQCA 5G31A 4KF9A 2H0GA 1U88A 4EO3A 1T4YA 4CDOA 2DJ0A 3IBHA 1NHYA 2WGRA 1V57A 3FR3A 5D9VA 4KX4A 3BBYA 3QOUA 5B7CA 4QL9A 2YCDA 1WMJA 1EP7A 1ZGNA 3TKSC 1B8XA 4XCSA 2QSIA 3O3TA 3HD5A 4WF4A 1K0MA 3FEUA 2GT6A 1VF1A 3ZL5A 5GZZB 1SL2B 1O6JA 4L0UA 3DVXA 3TRXA 5AISA 4RI6A 3ERGA 2KP2A 1BEDA 3RPNA 2MMOA 2PVOC 2PU9C 5HR3A 1ACVA 1AXDA 3D6IA 2DJ2A 3KTBA 3KGKA 2LJKA 3GKKA 3IXRA 2JADA 4P3YB 1O73A 1GSSA 3S9FA 3IOSA 4F0CA 2B5XA 2YN1A 2YJ7A 5KEJA 1MD3A 3DGQA 3QD9A 4K1FA 3GH6A 3UIWA 4PX1A 2VLUA 1GSDA 5G5FA 1AW9A 3C8EA 3D22A 5HR1A 1IYHA 2BMXA 1VGLA 4WR5A 2FWGA 5ECLB 5ECNB 20GSA 2FWHA 3TB2A 4OO4A 3O6TA 1BG5A 3GX8A 3FZ9A 4NV2A 4YQVA 2K18A 1SKRB 4YAPA 2I4AA 1Y25A 2PPTA 3TJJA 2C0GA 1A23A 5ECSA 3ZMLA 4HQSA 5IOWA 1AQXA 4IW9A 3W6GA 2HRAA 4KE3A 2V41A 1V2AA 3A5WA 1K0BA 2L6CA 1EP8A 3TJGA 4J56E 4IN0A 1ABAA 3BOAA 5FWGA 3A3TA 4MA9A 2AJQB 2IPAA 5KN3A 1OVNA 2H6XA 3KXOA 3TRQA 4KAEA 2LKUA 2DIYA 3GL3A 4TR1A 1V98A 2TRCP 1TKDB 5A4UA 1TI1A 1BJXA 2B1KA 2YP6A 4JEDA 3F3RA 4IELA 4KH7A 3C1SA 1QFNA 3Q18A 4N11A 4NMUA 4GLTA 5ENUA 2A2SA 4TR0A 3IHQA 4PGTA 1FW1A 3F9UA 1NHOA 3UL3A 5DALB 2OBIA 1TDIA 2PWJA 2XBIA 4EKZA 4MK3A 4IJ3A 1F37A 4G9HA 2IFQA 2C3NA 3MNGA 2YWNA 2OKAA 1SKSB 2P5RA 2C0DA 1T4ZA 1XOBA 2YPMA 4G0LA 5ECQB 2RM5A 3A2WA 5DAKB 2IL3A 4O92A 1GNEA 2YJHA 2PN8A 1OAZA 1I9DA 2R37A 1PGTA 3CBUA 1YEXA 4GRFA 5F8BA 3WT1A 5JCGA 3VWVA 4WBRD 2V2GA 3Q6OA 1YJ6A 3TDGA 1XZOA 2GQLA 2MMAA 2WRTA 3ZMKA 2C1YA 3EWLA 3G7IA 1NM3A 3GH9A 1YKAA 3TUEA 3CMIA 2GQKA 4H86A 3WGXA 1Q98A 2JSYA 2HSNB 1GSUA 1BAYA 1PD21 2FNOA 1K0DA 2HSHA 3TKQA 3EMXA 2FLSA 2REMA 2CZ3A 1TRWA 3HZ8A 5GSSA 3I43A 1PSQA 1K3LA 4WBJA 1GTAA 6GSXA 1YQ1A 2MBTA 1AUCA 3FZ5A 3IRAA 4K0NA 3W8JA 4QQ7A 1Z6MA 4KCAA 3ZITA 2DBCA 2FY6A 4PNGA 2C3QA 3ZVJA 4N30A 2C3TA 3E3EA 1W4VA 2PVQA 2K9FA 3GUSA 1G6WA 5F0GA 3GX0A 2VCXA 3K8NA 1B48A 1M9BA 5IPGA 2VL3A 1XVWA 1EGRA 4WR4A 4NV5A 2NBSA 2CX4A 5ECMB 2FHEA 2GSTA 2PERA 3KD0A 2WJUA 2ALBA 1M99A 4NWYA 2H73A 3C71A 3TKRA 3DVWA 2MBSA 3ZREA 4J2FA 1SK2A 3H8QA 2O85A 3GV1A 3IDVA 4PQ1A 1SYXA 1BYEA 4GCIA 4X43A 4ZB8A 3KP8A 1BQ7A 1WOUA 2VD0A 5EVOA 2E0QA 1X5DA 1PL2A 4FIWA 4BL7B 4FO5A 2C80A 4BWQA 2YWIA 4K0GA 3IA1A 3VWXA 4MH3A 4WEYA 1FAAA 2VLTA 1E6BA 2IMEA 3GTUB 3N5OA 1QGVA 1FHEA 2TIRA 4DSRA 3D4TA 2H0HA 5IO0A 1PA3A 3R2QA 3J7Yk 4JBBA 4Q5RA 1XXUA 2YWOA 2L6DA 2HE3A 5HR2A 4TR3A 7GSSA 3ZZXA 4ULXA 3HVXA 5CRGA 3LEFA 4OCEA 3VLNA 5CP1A 2IWTA 5IMZA 3HZ4A 5F05A 2HRKB 5F06A 2HI7A 1ERUA 5ECOB 4D73A 1YY7A 3CRUA 1K0CA 1OKDA 2R3XA 2H1DA 2YZHA 3KH7A 3NIVA 1DUGA 4NXIA 1OC9B 4G19A 2DIZA 3F3QA 4GTUA 3EC3A 5HFGA 3RDWA 4AJ6A 2B7JA 5DBQA 1VF2A 1Z3EA 1SL1B 2I1UA 4PUAA 3LXTA 5AGYA 2HRNA 3KP9A 5JWQB 2HZFA 4KDYA 3VI7A 1EWXA 5ID2B 2H0IA 4IKHA 4PQIA 5DCGA 1M2AA 3PGTA 2OACA 5IMCA 2JZSA 5KN1A 2DC5A 1GRXA 1U87A 2LSTA 1Z7RA 3L9UA 3MSZA 2JSZA 2DSAA 4I8BA 1S3CA 14GSA 1HNBA 2JL4A 5ECHB 3UOMA 4KNDA 4V1Ap 3D5JA 4TXOB 6GSTA 4I2UA 3QPMA 1MD4A 3ZYWA 5ECRB 4WF5A 2DJ3A 2IMFA 1GH2A 3TRPA 2HZEB 4XTSA 1Z9HA 1YF1A 1A2JA 2CQ9A 19GSA 4KUNA 2CA8A 4LMWA 3TJBA 5INYA 1QUWA 4GQFA 1R5PA 2YOIA 3LORA 2HQTA 4L5OA 4BVYB 2V1MA 4XRDA 4ECJA 3KCMA 1RQMA 4AJ7A 3M9JA 1GL8A 4K8MA 1TRSA 2B5EA 3GKMA 1PKZA 2L5LA 3CTGA 4G0IA 4O7HA 4MH2A 2JU5A 4G10A 2O8VB 4ID0A 5EPFA 4OFTA 3JCML 4WETA 3PINA 5CRHA 2NTOA 6GSUA 3QMXA 5CO3A 4JZQA 4HJMA 3F63A 3KM6A 4Q5NA 2NVLA 2VL2A 5ELAA 2VOCA 1GTBA 3AY8A 3WGDA 2AUVA 4MZWA 4TW5A 1C72A 3ERWA 3VWWA 5IIZA 1WE0A 1GNWA 2KP1A 4E8EA 2OBKA 3VPTA 2H1BA 1N8JA 2LNTA 4POBA 3EU4A 5C00A 2MZCA 1UN2A 2WZ9A 4ACSA 5IM9A 2RIIA 4USSA 2E2GA 5G2ZA 5LCZA 3HDCA 3ZVJD 3GN3A 4KB3A 2PBJA 4GXZA 5DQYA 1O8WA 5GAPD 3FR9A 1F6MC 2L59A 4V2MA 1TTZA 3HXSA 2O89A 4GF0A 1MEKA 2E7PA 1RK4A 4IJIA 4BVXA 2PGTA 4GSNA 2AYTA 3HVSA 3M1GA 2JZRA 2GT5A 3H93A 1M2BA 2RM6A 5CRWA 3M8NA 1JLWA 3GKNA 3ZRDA 1PKWA 4MCUA 2AAWA 2B6MA 5CREA 2V6OA 3LFLA 2QC7A 5GAND 2LUSA 1GUMA 3F4SA 2VM1A 5DQSA 1TK5B 3FR6A 1QMVA 3I6AA 4HOJA 4IGJA 1LBKA 2AV4A 4POKA 3UARA 1SJ6A 1U6TA 1ERWA 1F2EA 3UEMA 3L4NA 3RBTA 3EU3A 4MF7A 2XHFA 1CQHA 4K2DA 1V40A 3HKRA 4OFMA 1FB6A 2AHEA 4MDCA 2XBQA 1BX9A 1FO5A 2LV3A 1HNAA 2HNLA 3VWUA 3FZAA 3C1RA 4XS4A 3D0ZA 1XFLA 5J3RA 4I5QA 1TRUA 1K0AA 5G30A 4HU7A 1GSEA 5J5NA 1DE1A 4L8EA 5D73A 1HQOA 2NDOA 2P31A 2RLIA 22GSA 4GSSA 2TRXA 1FG4A 4ZILA 4POMA 4RI7A 4OO5A 4RQRA 2GQMA 1FVJA 4HUAA 3M0FA 1XPVA 3D4MA 2A2RA 4OFNA 1JZRA 3L9VA 3QAGA 3WGEA 3GNJA 1Z5YE 2DJJA 4TR4A 2VAFA 2LNSA 5D93A 1AQWA 1KNGA 5A4VA 4AF2A 1YDKA 3RHCA 1JZDA 4KW6A 3CSJA 4LL1B 3P8WA 3LJRA 2YV9A 2H1AA 2H1GA 2IMDA 3HHVA 4IQAA 2CVDA 3HA9A 2CVBA 2LRNA 3HJOA 3O76A 1A8LA 2C0FA 1XWGA 2GZPA 1URMA 1ZMAA 4HQZA 4QL7A 4L5LA 4LL4B 4DSSA 4MPGA 4DVCA 1TJDA 1TXXA 4I2TA 2K8VA 2FGXA 1OYJA 3GFKA 4ZL8A 3R3EA 1R4WA 1XWKA 1WIKA 4JR6A 2FUG2 1MDKA 3Q19A 3P7XA 4ML6A 3HYPA 1XBSA 3E9JB 2CV4A 1WWJA 1U3AA 2A4VA 2B7KA 1TU7A 4KSMA 2GZZA 4E8HA 1J08A 2DMMA 2H71A 1PRXA 3DWVA 2ZCTA 4K9ZA 1ST9A 4V2LA 2P5QA 4LLRA 4TR1B 1EGOA 1OC3A 5IPHA 3TJFA 2WULA 3ERFA 1SD9A 4CW9A 1E2YA 5CAXA 3TOTA 2P0GA 4IP1A 1A2LA 1ZZYA 3F4TA 1T00A 1AC1A 3FKFA 3DRNA 4ZBBA 1EV9A 3F0IA 3H1NA 1A24A 2IFQB 2L4CA 4HS1A 4TN8A 2CVKA 3A2XA 4K6XA 2DJ1A 2N5AA 4F03A 4NAXA 2M72A 2HSMA 5E59A 1Z7PA 2F8AA 1AAZA 4IP6A 2CX3A 1HYUA 1MDJA 2BJXA 3FRCA 3IE3A 2XC2A 1ERTA 5D96A 3RPPA 3EE2A 1M2DA 3RAZA 3ZIVA 4I97A 5H5SA 1QXHA 1T7PB 1WP0A 2B3SA 4MJCA 2KOKA 3UAPA 3LG6A 2I3YA 5GSTA 6GSYA 3ISOA 1NSWA 1SK1A 5COHA 2CZ2A 4V2NA 5F07A 1SJIA 3DEXA 1ON4A 2LQOA 3U5RE 3PH9A 1O85A 12GSA 3GKXA 3QCPA 3GURA 1XCCA 3FZ4A 2GZYA 4WKWA 3H79A 3M9KA 5J41A 2GVPA 5E4WA 2VIMA 4DSQA 4MP4A 1JZOA 3IK7A 2GLRA 4O32A 3G9BA 2HFDA 2EIRA 5G1KA 3UJ1A 1KEBA 3F6DA 1AIUA 4YH2A 2IJYA 3P90A 2H72A 1GSYA 4EDYA 3APOA 5DJMA 2EIQA 1M9AA 1H4OA 1HNCA 5B8BA 1JLVA 2H01A 2N5FA 5KN2A 2L57A 4RUVA 4JRRA 2WS2A 3GMFA 5IQYA 1O7UA 1GLQA 3QDNA 4ZIJA 4TRXA 4XIHA 2ON5A 1THXA 3C73A 2LEGA 3Q74A 3LSZA 3VK9A 2PUKC 4GSTA 1B4PA 2H75A 1K3OA 2WCIA 4XS6A 2WB9A 3IV4A 4K7IA 3CXGA 9GSSA 1UVZA 2YANA 2OADA 1SYRA 4JR4A 2F3MA 3ZFBA 3UBKA 3KMOA 2QGVA 2VCQA 3QFBC 3F4RA 2JACA 1TI3A 2M80A 3KMNA 2B1LA 2H8LA 1TK8B 1R26A 3CTFA 4FH8A 3FY7A 2OE0A 4FYBA 2MMNA 3GL5A 1ERVA 3KH9A 5ELGA 4X0XA 2G2QA 2GTUA 1GLPA 4PUFC 1DE2A 1FOVA 2RUFA 2FA4A 1GTIA 2LJRA 4FQUA 1T3BA 1EEJA 2EC4A 1H75A 3ED3A 4BA7A 2M46A 3LGCA 5A5KA 4YQUA 4ZB6A 4Z7XA 2H66A 2VCVA 4HZ2A 4JU5A 4N0VA 3BJ5A 11GSA 2IIYA 5AN1A 4ECIA 3LYKA 1A2MA 1SU9A 3TCOA 4EVMA 4N10A 3UBLA 1EZKA 1QK8A 2CT6A 4YAVA 5CNWA 1VF3A 4D73B 3P2AA 1MDIA 1UC7A 3TKSE 5ECPB 1FVKA 3TKSA 2H74A 4K7NA 5IO2A 1QQ2A 3TOUA 1XWAA 1CQGA 2X8CA 2HYXA 3QAVA 1SJZA 3LYPA 1ML6A 4NPBA 5D8IA 4Q5QA 2XPDA 4HZ4A 1JZWA 3F8UA 3GSSA 1RW1A 4FYUA 6GSSA 3HVVA 1GSFA 3A2VA 3APQA 4Q5FA 1PX7A 2KLXA 2VL2C 5D9TA 5FHIA 2H6ZA 2FCHA 2VCTA 2DMLA 18GSA 2EIOA 2H30A 1YF0A 1UA5A 4PURA 1TOFA 5KN0A 1GWCA 4XRAA 4TOPA 3OR5A 3KZQA 1GTUA 1MTCA 5G5EA 3KIJA 2C8UA 1O8XA 4MABA 3H4KA 2LTKA 4KDUA 3TGZA 1O81A 1XW6A 5HR0A 2VD1A 3PPUA 1LU4A 4TXVA 5L71A 3HJPA 1OE8A 1J0FA 1PMTA 4ML1A 4J57E 1W89A 1A0FA 2GDRA 1SENA 4OCFA 3V1WA 8GSSA 2FD3A 1XOAA 5J9CA 3DYRA 1X9WB 5DALA 2G0FA 3TJKA 4MPFA 1Y6EA 5LD0A 2CAQA 3GSTA 1GUHA 3FHKA 1M7TA 5JWOB 4MJAA 1XWCA 2I9HA 2H76A 1OKTA 1FB0A 5JCUA 4IHUA 17GSA 4EC0A 5HFKA 3EMPA 4F2IA 1T8EB 2N5BA 5DAKA 5ECIB 3GHAA 4POLA 2YV7A 2XPEA 3L9SA 2IMKA 1EOGA 5IMVA 5DDLA 4IVFA 3VURA 16GSA 3I9V2 1K0NA 2LRCA 5A4WA 2VUPA 1JFUA 2DLXA 1K3YA 3UVHA 2MMZA 3W8SA 2R5GA 4BVXB 13GSA 3VFIA 2F51A 3FK8A 2OA7A 1F3AA 2O87A 4MJEA 5IMAA 5BMUA 2YWMA 3CYNA
chains in the Genus database with same CATH superfamily
4EL1A 2HSNA 2F8FA 3IPZA 2KUCA 5DCHA 2J23A 4ZB9A 1J9BA 1SKWB 5FT3A 2HXKA 3GRXA 4G0KA 3WT2A 1KBNA 1PN9A 3TU3B 4EUYA 3IK9A 5J4UA 3NZNA 4KCEA 3GIXA 4X1UA 3ZTLA 1PQNA 3APSA 4A5PA 2VLVA 3L0HA 4OMVA 1Z6NA 3ZLPA 3ZIJA 2LS5A 1M0UA 4HSCX 3ME7A 1XW9A 1A8YA 2JZTA 1GUKA 4Z2UA 2VO4A 1WPIA 3SWLA 3PR8A 4XHMA 5AIXA 3DKSA 4ZXGA 4ZL7A 3BD2A 3J7Yb 2WFCA 1U3IA 4MMMA 5IMDA 1EOHA 5AIVA 1USBA 2FA8A 2B5YA 3VI5A 3UMAA 4AKXB 1TU8A 1ZYEA 4XS4B 4KA0A 3KTLA 4CY6A 4NHWA 4K7OA 5J9BA 3CSHA 2GGTA 4O5RA 5G1LA 4WXTA 5C04A 4TKYA 1XIYA 5H5QA 3GYKA 2V6KA 1DBYA 5EY6A 3G7JA 1EV4A 5JCWA 4ZBAA 1ZOFA 1X9MB 2CAIA 2WW3A 1TK0B 3RHBA 2HRFA 3CRTA 1AQVA 3KEBA 6GSVA 2H70A 1WJKA 3FW2A 3EINA 3IAM2 4ILFA 3ME8A 4PI0C 3IC4A 2GSRA 2E2MA 2YZUA 4BL7A 1S3AA 1B4QA 3DD3A 2HLSA 5HQPA 2HT9A 3UVTA 4O5QA 2EFDA 2D2ZA 1OE7A 1B9XC 3IAS2 2GSSA 2VCWA 3G7YA 4DEJA 1DSBA 1PL1A 3GTUA 1NW2A 5EL8A 1ZCPA 4ECBA 4ISDA 2H6YA 4PNFA 1A0RP 1GSQA 4LA1A 3GA4A 1GP1A 1JHBA 3KJYA 2R6KA 3U6VA 3QAWA 4DSSB 4IBPA 3MAKA 2VCZA 4IQ1A 4HU9A 2AB6A 4OD7A 2LQQA 1VRSD 2Z9SA 3IC8A 3MDKA 5DVBA 2HRKA 2PMTA 3MWHA 3HCZA 2VM2A 4PHZC 4PQHA 3EURA 3SBCA 4ZBDA 3I69A 3BCKA 2X99A 2WDUA 3QR6A 2YNXA 2L5OA 3LWAA 1OC9A 3F6FA 2C0EA 3D21A 5J4YA 2MYGA 4I6XA 5B8AA 2X8GA 4HJ2A 4LMVA 3LQ7A 10GSA 2HSYA 4FYCA 1S3DA 1F9MA 2ZUPA 1XW5A 3E0UA 5DJLA 3L78A 3CWGA 3LXZA 1K0OA 1G7EA 3WD6A 1YKCA 2LJAA 2ES7A 5ID2A 3DIEA 4N0ZA 2IMIA 1T1VA 3US3A 5ECKB 2ON7A 2BTOT 1V9WA 1F3BA 4F82A 5D9WA 5HFIA 4W66A 4GWRA 4HI7A 6GSWA 4K5SA 1HD2A 2H19A 1PX6A 4V1Ag 2K8SA 5D9XA 1X5EA 4HEA2 3TKPA 4BIKA 4PTSA 3NOFA 4TXOA 4EXJA 2HSMB 4KGIA 1EEMA 3IR4A 4EE0A 2WZSA 1LJRA 1SL0B 2HZEA 1S3RA 1WRYA 2KHPA 1X5CA 4ECCA 4BVYA 1TW9A 4XS1A 1XVQA 2R4VA 1G7OA 4AGSA 2FWFA 4MF6A 4NHZA 4G2EA 2R2JA 1ZYQB 3ZFLA 1ILOA 2RUEA 1R5AA 1SK0A 2F9SA 1N2AA 4MZCA 2J9HA 1I5GA 1IYIA 3LW9A 1TP9A 3N9JA 2UZ8A 2V32A 4F9ZA 4MJBA 1THOA 4ZL9A 3WYWA 2A2PA 1VF4A 2FWEA 2C4JA 5H5RA 4YKGA 2OE1A 4HDEA 3EYTA 4AJ8A 1V58A 1XWBA 1Q4JA 3HJMA 2X49A 4AI6A 1YEPA 1YZXA 1OC8A 1X0RA 2R0GA 5B6NA 4RQXA 4BPYA 3M3MA 4EF0A 3CSIA 5CYYA 3HY2A 1SD8A 4JE1A 2NPBA 2LRTA 1ZL9A 2GSQA 4MF5A 1ZYPA 5CRDA 2IN3A 4MLYA 2K6VA 1SVMA 2DJKA 5B6MA 5LNKe 1GULA 5ABRA 3FYGA 1G6YA 2I81A 1X9SB 3VPQA 4GDFA 2L4QA 4KDXA 5JWRB 4PXOA 1R7HA 4F0BA 2O7KA 1KTEA 4OWYA 3BCIA 2GS3A 3EVIA 3QFAC 4MZBA 3DXBA 4L0WA 1G0TA 2QA1A 4CHSA 2X64A 2X8HA 2OE3A 4YQMA 4IS0A 2VL9A 5IMFA 5A1NA 1B9YC 4BWSA 4KSOA 2ZNMA 3C7MA 3DMLA 5IOXA 4EDZA 2OJLA 2QKEA 1TRVA 4TVEA 4GQCA 5G31A 1YEWC 4KF9A 2H0GA 1U88A 4EO3A 3CHXC 1T4YA 4CDOA 2DJ0A 3IBHA 1NHYA 2WGRA 1V57A 3FR3A 5D9VA 4KX4A 3BBYA 3QOUA 5B7CA 2WVXA 4QL9A 2YCDA 1WMJA 1EP7A 1ZGNA 3TKSC 1B8XA 2H1LA 4XCSA 2QSIA 3O3TA 3HD5A 4WF4A 1K0MA 3FEUA 2GT6A 1VF1A 3ZL5A 5GZZB 1SL2B 1O6JA 4L0UA 3DVXA 3TRXA 5AISA 4RI6A 3ERGA 2KP2A 1BEDA 3RPNA 5A34B 4QMKA 2MMOA 2PVOC 2PU9C 5HR3A 1ACVA 1AXDA 3D6IA 2DJ2A 3KTBA 3KGKA 2LJKA 3GKKA 3IXRA 2JADA 4P3YB 1O73A 1GSSA 3S9FA 3IOSA 1XG8A 4F0CA 2B5XA 2YN1A 2YJ7A 5KEJA 1MD3A 3DGQA 3QD9A 4K1FA 3GH6A 3UIWA 4PX1A 2VLUA 5J4VA 1GSDA 5G5FA 1AW9A 3C8EA 3D22A 5HR1A 1IYHA 2BMXA 1VGLA 4WR5A 2FWGA 5ECLB 5ECNB 20GSA 2FWHA 3TB2A 4OO4A 3O6TA 1BG5A 3GX8A 3FZ9A 4NV2A 4YQVA 2K18A 1SKRB 4YAPA 2I4AA 1Y25A 2PPTA 3TJJA 2C0GA 1A23A 5ECSA 3ZMLA 4HQSA 5A5HA 5IOWA 1AQXA 4IW9A 3W6GA 1M3JA 2HRAA 4KE3A 2V41A 1V2AA 3A5WA 2DKHA 1K0BA 2L6CA 1EP8A 3TJGA 4J56E 4IN0A 1ABAA 4E68A 3BOAA 5FWGA 3A3TA 4MA9A 1I1IP 2AJQB 2IPAA 5KN3A 1OVNA 2H6XA 4ZB7A 3KXOA 3TRQA 4KAEA 2LKUA 2DIYA 3GL3A 4TR1A 1V98A 2TRCP 1TKDB 5A4UA 1TI1A 1BJXA 2B1KA 2YP6A 4JEDA 3F3RA 4IELA 2WVZA 4KH7A 4Z2TA 3C1SA 3EPTA 1QFNA 3Q18A 4N11A 4NMUA 4GLTA 5ENUA 2A2SA 4TR0A 3IHQA 4PGTA 1FW1A 3F9UA 1NHOA 3UL3A 5DALB 2OBIA 1TDIA 2PWJA 2XBIA 4EKZA 4MK3A 4IJ3A 1F37A 4G9HA 2IFQA 2C3NA 3MNGA 2YWNA 2OKAA 1SKSB 2P5RA 2C0DA 1T4ZA 1XOBA 2QA2A 2YPMA 1Y1UA 4G0LA 5ECQB 2RM5A 3A2WA 5DAKB 4Z2RA 2IL3A 4O92A 1GNEA 2YJHA 2PN8A 4YKFA 2R37A 1OAZA 1I9DA 3CBUA 1PGTA 1YEXA 4GRFA 5F8BA 3WT1A 5JCGA 3VWVA 4WBRD 2V2GA 3Q6OA 1YJ6A 3TDGA 1XZOA 2GQLA 2MMAA 2WRTA 3ZMKA 2C1YA 3EWLA 3G7IA 1NM3A 3GH9A 1YKAA 2O3EA 3TUEA 3CMIA 2GQKA 4H86A 3WGXA 1Q98A 5BMUB 2JSYA 2HSNB 1GSUA 1BAYA 1PD21 2FNOA 1K0DA 2HSHA 3TKQA 3EMXA 2FLSA 2REMA 2CZ3A 1TRWA 3HZ8A 5GSSA 3I43A 3MYDA 1PSQA 1K3LA 4WBJA 1GTAA 6GSXA 1YQ1A 2MBTA 1AUCA 3FZ5A 3IRAA 4K0NA 3W8JA 4QQ7A 1Z6MA 4KCAA 3ZITA 2DBCA 2FY6A 4PNGA 2C3QA 3ZVJA 4N30A 2C3TA 3E3EA 1W4VA 2PVQA 2K9FA 3GUSA 1G6WA 5F0GA 3GX0A 2VCXA 3K8NA 1B48A 1M9BA 5IPGA 2VL3A 1XVWA 1EGRA 4WR4A 4NV5A 4AKIA 2NBSA 2CX4A 5ECMB 2FHEA 1TXUA 2GSTA 2PERA 3HVNA 3KD0A 2WJUA 2ALBA 1M99A 4NWYA 2O36A 2H73A 3C71A 3TKRA 3DVWA 2MBSA 3ZREA 4J2FA 1SK2A 3H8QA 2O85A 3GV1A 3IDVA 4PQ1A 1SYXA 1BYEA 4GCIA 4X43A 4ZB8A 3KP8A 1BQ7A 1WOUA 2VD0A 5EVOA 2E0QA 1X5DA 1PL2A 4FIWA 4BL7B 4FO5A 2C80A 4BWQA 2YWIA 4K0GA 3IA1A 3VWXA 4MH3A 4WEYA 1FAAA 2VLTA 1E6BA 2IMEA 3GTUB 3N5OA 1QGVA 1FHEA 2TIRA 4DSRA 3D4TA 1S4BP 2H0HA 5IO0A 1PA3A 3R2QA 1SVLA 3J7Yk 4JBBA 4Q5RA 1XXUA 2YWOA 2L6DA 2HE3A 5HR2A 4TR3A 7GSSA 3ZZXA 4ULXA 4O5UA 3HVXA 2WVYA 5CRGA 3LEFA 4OCEA 3VLNA 5CP1A 2IWTA 5IMZA 3HZ4A 5F05A 2HRKB 5F06A 2HI7A 1ERUA 5ECOB 2O5VA 4D73A 4ICYA 1YY7A 3MIXA 3CRUA 1K0CA 1OKDA 2R3XA 2H1DA 2YZHA 3KH7A 3FMWA 3NIVA 1DUGA 4NXIA 1OC9B 4G19A 2DIZA 3F3QA 4GTUA 3EC3A 5HFGA 3RDWA 4AJ6A 2B7JA 5DBQA 1VF2A 1Z3EA 1SL1B 2I1UA 4G01A 4PUAA 3LXTA 5AGYA 2HRNA 3KP9A 5JWQB 5KOXA 2HZFA 4KDYA 3VI7A 1EWXA 5ID2B 2H0IA 4IKHA 4PQIA 5DCGA 1M2AA 3PGTA 2OACA 5IMCA 2JZSA 5KN1A 2DC5A 3RFRC 1GRXA 1U87A 2LSTA 1Z7RA 3L9UA 3MSZA 2JSZA 2DSAA 4I8BA 1S3CA 14GSA 1HNBA 2JL4A 5ECHB 3UOMA 4KNDA 4V1Ap 3D5JA 4TXOB 6GSTA 4I2UA 3QPMA 1MD4A 3ZYWA 5ECRB 4WF5A 2DJ3A 2IMFA 1GH2A 3TRPA 2HZEB 4XTSA 1Z9HA 1YF1A 1A2JA 2CQ9A 19GSA 4KUNA 2CA8A 4LMWA 3TJBA 5INYA 1QUWA 4GQFA 1R5PA 2YOIA 3LORA 2HQTA 4L5OA 4BVYB 2V1MA 4XRDA 4ECJA 3KCMA 1RQMA 4AJ7A 3M9JA 1GL8A 4K8MA 1TRSA 2B5EA 3GKMA 1PKZA 2L5LA 3CTGA 4AKHA 4G0IA 4O7HA 4MH2A 2JU5A 4G10A 2O8VB 4ID0A 5EPFA 4OFTA 3JCML 4WETA 3PINA 5CRHA 2NTOA 1ZYNA 6GSUA 3QMXA 5CO3A 4JZQA 4HJMA 3F63A 3KM6A 4Q5NA 2NVLA 2VL2A 5ELAA 2VOCA 1GTBA 3AY8A 3WGDA 2AUVA 4MZWA 4TW5A 1C72A 3ERWA 3VWWA 5IIZA 1WE0A 1GNWA 2KP1A 4E8EA 2OBKA 1N25A 1PFOA 3VPTA 2H1BA 1N8JA 2LNTA 4POBA 3EU4A 5C00A 2MZCA 1UN2A 2WZ9A 4ACSA 5IM9A 2RIIA 4USSA 2E2GA 5G2ZA 5LCZA 3HDCA 3ZVJD 3GN3A 4KB3A 2PBJA 4X4JA 4GXZA 5DQYA 1O8WA 5GAPD 3FR9A 1F6MC 2L59A 4V2MA 1TTZA 3HXSA 2O89A 4GF0A 1MEKA 2E7PA 1RK4A 4IJIA 4BVXA 2PGTA 4GSNA 2AYTA 3HVSA 3M1GA 2JZRA 4EIQA 2GT5A 3H93A 1M2BA 2RM6A 5CRWA 3M8NA 1JLWA 3GKNA 3ZRDA 1PKWA 4MCUA 2AAWA 2B6MA 5CREA 2V6OA 3LFLA 2QC7A 5GAND 2LUSA 1GUMA 3F4SA 5A1NB 2VM1A 5DQSA 1TK5B 3FR6A 1QMVA 3I6AA 4HOJA 4IGJA 1LBKA 2AV4A 4POKA 3UARA 1SJ6A 1U6TA 1ERWA 1F2EA 3UEMA 3L4NA 3RBTA 3EU3A 4MF7A 2XHFA 1CQHA 4K2DA 1V40A 3HKRA 4OFMA 2WVXB 1FB6A 2AHEA 4MDCA 2XBQA 4AKGA 1BX9A 1FO5A 2LV3A 1HNAA 1M3IA 2HNLA 3VWUA 3FZAA 3C1RA 3A5IA 4XS4A 3D0ZA 1XFLA 5J3RA 4I5QA 1TRUA 1K0AA 5G30A 4HU7A 1GSEA 5J5NA 1DE1A 4L8EA 5D73A 1HQOA 2NDOA 2P31A 2RLIA 22GSA 4GSSA 2TRXA 1FG4A 4ZILA 4POMA 4RI7A 4OO5A 4RQRA 2GQMA 1FVJA 4HUAA 3M0FA 1XPVA 3D4MA 2A2RA 1PN0A 4OFNA 1JZRA 1YVLA 3L9VA 3QAGA 3WGEA 3GNJA 1Z5YE 2DJJA 4TR4A 2VAFA 2LNSA 5D93A 1AQWA 1KNGA 5A4VA 4AF2A 1YDKA 3RHCA 2OT3A 1JZDA 4KW6A 3CSJA 4LL1B 3P8WA 3LJRA 2YV9A 2H1AA 2H1GA 2IMDA 3HHVA 4IQAA 2CVDA 3HA9A 2CVBA 2LRNA 3HJOA 3O76A 1A8LA 2R0PA 2C0FA 1XWGA 2GZPA 1URMA 1ZMAA 5A5HB 4HQZA 4QL7A 4L5LA 4LL4B 4DSSA 4MPGA 4DVCA 1TJDA 1TXXA 4I2TA 2K8VA 2FGXA 1OYJA 3GFKA 4ZL8A 3R3EA 1R4WA 1XWKA 1WIKA 4JR6A 2FUG2 1MDKA 3Q19A 3P7XA 4ML6A 3HYPA 1XBSA 3E9JB 2CV4A 1WWJA 1U3AA 2A4VA 2B7KA 1TU7A 4KSMA 2GZZA 4E8HA 1J08A 2DMMA 2H71A 1PRXA 3RGBC 3DWVA 2ZCTA 4N3ZA 4K9ZA 1ST9A 4V2LA 2P5QA 4LLRA 4TR1B 1EGOA 1OC3A 4CY8A 5IPHA 3TJFA 2WULA 3ERFA 1SD9A 4CW9A 1E2YA 5CAXA 3TOTA 2P0GA 4IP1A 1A2LA 1ZZYA 3F4TA 1T00A 1AC1A 3FKFA 3DRNA 4ZBBA 1EV9A 3F0IA 3H1NA 1A24A 2WW1A 2IFQB 2L4CA 4HS1A 4TN8A 2CVKA 1SVOA 3A2XA 4K6XA 2DJ1A 2N5AA 4F03A 4NAXA 2M72A 2HSMA 5E59A 1Z7PA 2F8AA 1AAZA 4IP6A 2CX3A 1HYUA 1MDJA 2BJXA 3FRCA 3IE3A 2XC2A 1ERTA 3CQFA 5D96A 3RPPA 3EE2A 1M2DA 3RAZA 3ZIVA 4I97A 5H5SA 1QXHA 3IHGA 1T7PB 1WP0A 2B3SA 4MJCA 2KOKA 3UAPA 3LG6A 2I3YA 5GSTA 6GSYA 3ISOA 1NSWA 1SK1A 5COHA 2CZ2A 4V2NA 5F07A 1SJIA 3DEXA 1ON4A 2LQOA 3U5RE 3PH9A 1O85A 12GSA 3GKXA 3QCPA 3GURA 1XCCA 3FZ4A 2GZYA 4WKWA 3H79A 3M9KA 5J41A 2GVPA 5E4WA 2VIMA 4DSQA 4MP4A 1JZOA 3IK7A 2GLRA 4O32A 3G9BA 2HFDA 2EIRA 5G1KA 3UJ1A 1KEBA 3F6DA 1AIUA 4YH2A 2IJYA 3P90A 2H72A 1GSYA 4EDYA 3APOA 1BG1A 5DJMA 2EIQA 1M9AA 1H4OA 4PI2C 1HNCA 2EFCA 5B8BA 1JLVA 2H01A 2N5FA 5KN2A 2L57A 5J47A 4RUVA 4JRRA 2WS2A 3GMFA 5IQYA 1O7UA 1GLQA 3QDNA 4ZIJA 4TRXA 4XIHA 2DKIA 2ON5A 1THXA 5J40A 3C73A 2LEGA 3Q74A 3LSZA 3VK9A 2PUKC 4GSTA 1B4PA 2H75A 1K3OA 2WCIA 4XS6A 2WB9A 3IV4A 4K7IA 3CXGA 9GSSA 1UVZA 2YANA 2OADA 1SYRA 4JR4A 2F3MA 3ZFBA 3UBKA 3KMOA 2QGVA 2VCQA 3QFBC 3F4RA 2JACA 1TI3A 2M80A 2EFHA 3KMNA 2B1LA 2H8LA 1TK8B 1R26A 3CTFA 4FH8A 3FY7A 2OE0A 4FYBA 2MMNA 3GL5A 1ERVA 3KH9A 5ELGA 4X0XA 2G2QA 2GTUA 1GLPA 5KOWA 4PUFC 1DE2A 1FOVA 5A34A 2RUFA 2FA4A 1GTIA 1FOHA 2LJRA 4FQUA 1T3BA 1EEJA 2EC4A 1H75A 3ED3A 4BA7A 2M46A 3LGCA 5A5KA 4YQUA 4ZB6A 4Z7XA 2WW2A 1BF5A 2H66A 2VCVA 4HZ2A 4JU5A 4N0VA 3BJ5A 11GSA 2IIYA 5AN1A 4K2XA 4ECIA 3LYKA 1A2MA 1SU9A 3TCOA 4EVMA 4N10A 3UBLA 1EZKA 1QK8A 2CT6A 4YAVA 5CNWA 1VF3A 4D73B 3P2AA 1MDIA 1UC7A 3TKSE 5ECPB 1FVKA 3TKSA 2H74A 4K7NA 5IO2A 1QQ2A 3TOUA 1XWAA 1CQGA 2X8CA 2HYXA 3QAVA 1SJZA 2A4HA 2R0CA 3LYPA 5BRTA 1ML6A 4EIPA 4NPBA 5D8IA 4Q5QA 2XPDA 4HZ4A 1JZWA 3F8UA 3GSSA 1RW1A 4FYUA 6GSSA 3HVVA 1GSFA 3A2VA 3APQA 4Q5FA 1PX7A 2KLXA 2VL2C 5D9TA 5FHIA 4MNNA 2H6ZA 2FCHA 2VCTA 2DMLA 18GSA 2EIOA 2H30A 1YF0A 1UA5A 4PURA 1TOFA 5KN0A 1GWCA 4XRAA 4TOPA 3OR5A 3KZQA 1GTUA 1MTCA 5G5EA 3KIJA 2C8UA 1O8XA 4MABA 3H4KA 2LTKA 3HMJG 4KDUA 3TGZA 1O81A 1XW6A 5HR0A 2VD1A 3PPUA 1LU4A 4TXVA 5L71A 3HJPA 1OE8A 1J0FA 1PMTA 4ML1A 4J57E 1W89A 1A0FA 2GDRA 1SENA 4OCFA 3V1WA 8GSSA 2FD3A 1XOAA 5J9CA 3DYRA 2EFEA 1X9WB 5DALA 2G0FA 3TJKA 2UV8G 4MPFA 1Y6EA 5LD0A 2CAQA 3GSTA 1GUHA 3FHKA 4FXYP 1M7TA 5JWOB 4MJAA 1XWCA 2I9HA 2VKZG 2H76A 1OKTA 1FB0A 5JCUA 4IHUA 17GSA 2X4AA 4EC0A 5HFKA 3EMPA 4F2IA 1T8EB 2N5BA 5DAKA 5ECIB 2WW0A 3GHAA 4POLA 2YV7A 4K5RA 2XPEA 3L9SA 2IMKA 1EOGA 5IMVA 5DDLA 4IVFA 3VURA 16GSA 3I9V2 1K0NA 2LRCA 5A4WA 2VUPA 1JFUA 2DLXA 1K3YA 3UVHA 2MMZA 3W8SA 2R5GA 4BVXB 13GSA 3VFIA 2F51A 3FK8A 2OA7A 1F3AA 2O87A 4MJEA 5IMAA 5BMUA 2YWMA 3CYNA
chains in the Genus database with same CATH topology
4EL1A 2HSNA 2F8FA 3IPZA 2KUCA 5DCHA 2J23A 4ZB9A 1J9BA 1SKWB 5FT3A 2HXKA 3GRXA 4G0KA 3WT2A 1KBNA 1PN9A 3TU3B 4EUYA 3IK9A 5J4UA 3NZNA 4KCEA 3GIXA 4X1UA 3ZTLA 1PQNA 3APSA 4A5PA 2VLVA 3L0HA 4OMVA 1Z6NA 3ZLPA 3ZIJA 2LS5A 1M0UA 3ME7A 1XW9A 1A8YA 2JZTA 1GUKA 4Z2UA 2VO4A 1WPIA 3SWLA 3PR8A 4XHMA 5AIXA 3DKSA 4ZXGA 4ZL7A 3BD2A 3J7Yb 2WFCA 1U3IA 4MMMA 5IMDA 1EOHA 5AIVA 1USBA 2FA8A 2B5YA 3VI5A 3UMAA 4AKXB 1TU8A 1ZYEA 4XS4B 4KA0A 3KTLA 4CY6A 4NHWA 4K7OA 5J9BA 3CSHA 2GGTA 4O5RA 5G1LA 4WXTA 5C04A 4TKYA 1XIYA 5H5QA 3GYKA 2V6KA 1DBYA 5EY6A 3G7JA 1EV4A 5JCWA 4ZBAA 1ZOFA 1X9MB 2CAIA 1TK0B 3RHBA 2HRFA 3CRTA 1AQVA 3KEBA 6GSVA 2H70A 1WJKA 3FW2A 3EINA 3IAM2 4ILFA 3ME8A 3IC4A 2GSRA 2E2MA 2YZUA 4BL7A 1S3AA 1B4QA 3DD3A 2HLSA 5HQPA 2HT9A 3UVTA 4O5QA 2EFDA 2D2ZA 1OE7A 1B9XC 3IAS2 2GSSA 2VCWA 3G7YA 4DEJA 1DSBA 1PL1A 3GTUA 1NW2A 5EL8A 1ZCPA 4ECBA 4ISDA 2H6YA 4PNFA 1A0RP 1GSQA 4LA1A 3GA4A 1GP1A 1JHBA 3KJYA 2R6KA 3U6VA 3QAWA 4DSSB 4IBPA 3MAKA 2VCZA 4IQ1A 4HU9A 2AB6A 4OD7A 2LQQA 1VRSD 2Z9SA 3IC8A 3MDKA 5DVBA 2HRKA 2PMTA 3MWHA 3HCZA 2VM2A 4PQHA 3EURA 3SBCA 4ZBDA 3I69A 3BCKA 2X99A 2WDUA 3QR6A 2YNXA 2L5OA 3LWAA 1OC9A 3F6FA 2C0EA 3D21A 5J4YA 2MYGA 4I6XA 5B8AA 2X8GA 4HJ2A 4LMVA 3LQ7A 10GSA 2HSYA 4FYCA 1S3DA 1F9MA 2ZUPA 1XW5A 3E0UA 5DJLA 3L78A 3CWGA 3LXZA 1K0OA 1G7EA 3WD6A 1YKCA 2LJAA 2ES7A 5ID2A 3DIEA 4N0ZA 2IMIA 1T1VA 3US3A 5ECKB 2ON7A 2BTOT 1V9WA 1F3BA 4F82A 5D9WA 5HFIA 4W66A 4GWRA 4HI7A 6GSWA 4K5SA 1HD2A 2H19A 1PX6A 4V1Ag 2K8SA 5D9XA 1X5EA 4HEA2 3TKPA 4PTSA 3NOFA 4TXOA 4EXJA 2HSMB 4KGIA 1EEMA 3IR4A 4EE0A 1LJRA 1SL0B 2HZEA 1WRYA 2KHPA 1X5CA 4ECCA 4BVYA 1TW9A 4XS1A 1XVQA 2R4VA 1G7OA 4AGSA 2FWFA 4MF6A 4NHZA 4G2EA 2R2JA 1ZYQB 3ZFLA 1ILOA 2RUEA 1R5AA 1SK0A 2F9SA 1N2AA 4MZCA 2J9HA 1I5GA 1IYIA 3LW9A 1TP9A 3N9JA 2UZ8A 2V32A 4F9ZA 4MJBA 1THOA 4ZL9A 3WYWA 2A2PA 1VF4A 2FWEA 2C4JA 5H5RA 4YKGA 2OE1A 4HDEA 3EYTA 4AJ8A 1V58A 1XWBA 1Q4JA 3HJMA 2X49A 4AI6A 1YEPA 1YZXA 1OC8A 1X0RA 2R0GA 5B6NA 4RQXA 4BPYA 3M3MA 4EF0A 3CSIA 5CYYA 3HY2A 1SD8A 4JE1A 2NPBA 2LRTA 1ZL9A 2GSQA 4MF5A 1ZYPA 5CRDA 2IN3A 4MLYA 2K6VA 1SVMA 2DJKA 5B6MA 5LNKe 1GULA 5ABRA 3FYGA 1G6YA 2I81A 1X9SB 3VPQA 4GDFA 2L4QA 4KDXA 5JWRB 4PXOA 1R7HA 4F0BA 2O7KA 1KTEA 4OWYA 3BCIA 2GS3A 3EVIA 3QFAC 4MZBA 3DXBA 4L0WA 1G0TA 2QA1A 4CHSA 2X64A 2X8HA 2OE3A 4YQMA 4IS0A 2VL9A 5IMFA 5A1NA 1B9YC 4BWSA 4KSOA 2ZNMA 3C7MA 3DMLA 5IOXA 4EDZA 2OJLA 2QKEA 1TRVA 4TVEA 4GQCA 5G31A 4KF9A 2H0GA 1U88A 4EO3A 1T4YA 4CDOA 2DJ0A 3IBHA 1NHYA 2WGRA 1V57A 3FR3A 5D9VA 4KX4A 3BBYA 3QOUA 5B7CA 4QL9A 2YCDA 1WMJA 1EP7A 1ZGNA 3TKSC 1B8XA 2H1LA 4XCSA 2QSIA 3O3TA 3HD5A 4WF4A 1K0MA 3FEUA 2GT6A 1VF1A 3ZL5A 5GZZB 1SL2B 1O6JA 4L0UA 3DVXA 3TRXA 5AISA 4RI6A 3ERGA 2KP2A 1BEDA 3RPNA 5A34B 4QMKA 2MMOA 2PVOC 2PU9C 5HR3A 1ACVA 1AXDA 3D6IA 2DJ2A 3KTBA 3KGKA 2LJKA 3GKKA 3IXRA 2JADA 4P3YB 1O73A 1GSSA 3S9FA 3IOSA 4F0CA 2B5XA 2YN1A 2YJ7A 5KEJA 1MD3A 3DGQA 3QD9A 4K1FA 3GH6A 3UIWA 4PX1A 2VLUA 5J4VA 1GSDA 5G5FA 1AW9A 3C8EA 3D22A 5HR1A 1IYHA 2BMXA 1VGLA 4WR5A 2FWGA 5ECLB 5ECNB 20GSA 2FWHA 3TB2A 4OO4A 3O6TA 1BG5A 3GX8A 3FZ9A 4NV2A 4YQVA 2K18A 1SKRB 4YAPA 2I4AA 1Y25A 2PPTA 3TJJA 2C0GA 1A23A 5ECSA 3ZMLA 4HQSA 5A5HA 5IOWA 1AQXA 4IW9A 3W6GA 2HRAA 4KE3A 2V41A 1V2AA 3A5WA 2DKHA 1K0BA 2L6CA 1EP8A 3TJGA 4J56E 4IN0A 1ABAA 4E68A 3BOAA 5FWGA 3A3TA 4MA9A 2AJQB 2IPAA 5KN3A 1OVNA 2H6XA 4ZB7A 3KXOA 3TRQA 4KAEA 2LKUA 2DIYA 3GL3A 4TR1A 1V98A 2TRCP 1TKDB 5A4UA 1TI1A 1BJXA 2B1KA 2YP6A 4JEDA 3F3RA 4IELA 4KH7A 4Z2TA 3C1SA 3EPTA 1QFNA 3Q18A 4N11A 4NMUA 4GLTA 5ENUA 2A2SA 4TR0A 3IHQA 4PGTA 1FW1A 3F9UA 1NHOA 3UL3A 5DALB 2OBIA 1TDIA 2PWJA 2XBIA 4EKZA 4MK3A 4IJ3A 1F37A 4G9HA 2IFQA 2C3NA 3MNGA 2YWNA 2OKAA 1SKSB 2P5RA 2C0DA 1T4ZA 1XOBA 2QA2A 2YPMA 1Y1UA 4G0LA 5ECQB 2RM5A 3A2WA 5DAKB 4Z2RA 2IL3A 4O92A 1GNEA 2YJHA 2PN8A 4YKFA 2R37A 1OAZA 1I9DA 1PGTA 3CBUA 1YEXA 4GRFA 5F8BA 3WT1A 5JCGA 3VWVA 4WBRD 2V2GA 3Q6OA 1YJ6A 3TDGA 1XZOA 2GQLA 2MMAA 2WRTA 3ZMKA 2C1YA 3EWLA 3G7IA 1NM3A 3GH9A 1YKAA 3TUEA 3CMIA 2GQKA 4H86A 3WGXA 1Q98A 5BMUB 2JSYA 2HSNB 1GSUA 1BAYA 1PD21 2FNOA 1K0DA 2HSHA 3TKQA 3EMXA 2FLSA 2REMA 2CZ3A 1TRWA 3HZ8A 5GSSA 3I43A 3MYDA 1PSQA 1K3LA 4WBJA 1GTAA 6GSXA 1YQ1A 2MBTA 1AUCA 3FZ5A 3IRAA 4K0NA 3W8JA 4QQ7A 1Z6MA 4KCAA 3ZITA 2DBCA 2FY6A 4PNGA 2C3QA 3ZVJA 4N30A 2C3TA 3E3EA 1W4VA 2PVQA 2K9FA 3GUSA 1G6WA 5F0GA 3GX0A 2VCXA 3K8NA 1B48A 1M9BA 5IPGA 2VL3A 1XVWA 1EGRA 4WR4A 4NV5A 4AKIA 2NBSA 2CX4A 5ECMB 2FHEA 1TXUA 2GSTA 2PERA 3KD0A 2WJUA 2ALBA 1M99A 4NWYA 2H73A 3C71A 3TKRA 3DVWA 2MBSA 3ZREA 4J2FA 1SK2A 3H8QA 2O85A 3GV1A 3IDVA 4PQ1A 1SYXA 1BYEA 4GCIA 4X43A 4ZB8A 3KP8A 1BQ7A 1WOUA 2VD0A 5EVOA 2E0QA 1X5DA 1PL2A 4FIWA 4BL7B 4FO5A 2C80A 4BWQA 2YWIA 4K0GA 3IA1A 3VWXA 4MH3A 4WEYA 1FAAA 2VLTA 1E6BA 2IMEA 3GTUB 3N5OA 1QGVA 1FHEA 2TIRA 4DSRA 3D4TA 2H0HA 5IO0A 1PA3A 3R2QA 1SVLA 3J7Yk 4JBBA 4Q5RA 1XXUA 2YWOA 2L6DA 2HE3A 5HR2A 4TR3A 7GSSA 3ZZXA 4ULXA 4O5UA 3HVXA 5CRGA 3LEFA 4OCEA 3VLNA 5CP1A 2IWTA 5IMZA 3HZ4A 5F05A 2HRKB 5F06A 2HI7A 1ERUA 5ECOB 2O5VA 4D73A 4ICYA 1YY7A 3MIXA 3CRUA 1K0CA 1OKDA 2R3XA 2H1DA 2YZHA 3KH7A 3FMWA 3NIVA 1DUGA 4NXIA 1OC9B 4G19A 2DIZA 3F3QA 4GTUA 3EC3A 5HFGA 3RDWA 4AJ6A 2B7JA 5DBQA 1VF2A 1Z3EA 1SL1B 2I1UA 4G01A 4PUAA 3LXTA 5AGYA 2HRNA 3KP9A 5JWQB 5KOXA 2HZFA 4KDYA 3VI7A 1EWXA 5ID2B 2H0IA 4IKHA 4PQIA 5DCGA 1M2AA 3PGTA 2OACA 5IMCA 2JZSA 5KN1A 2DC5A 1GRXA 1U87A 2LSTA 1Z7RA 3L9UA 3MSZA 2JSZA 2DSAA 4I8BA 1S3CA 14GSA 1HNBA 2JL4A 5ECHB 3UOMA 4KNDA 4V1Ap 3D5JA 4TXOB 6GSTA 4I2UA 3QPMA 1MD4A 3ZYWA 5ECRB 4WF5A 2DJ3A 2IMFA 1GH2A 3TRPA 2HZEB 4XTSA 1Z9HA 1YF1A 1A2JA 2CQ9A 19GSA 4KUNA 2CA8A 4LMWA 3TJBA 5INYA 1QUWA 4GQFA 1R5PA 2YOIA 3LORA 2HQTA 4L5OA 4BVYB 2V1MA 4XRDA 4ECJA 3KCMA 1RQMA 4AJ7A 3M9JA 1GL8A 4K8MA 1TRSA 2B5EA 3GKMA 1PKZA 2L5LA 3CTGA 4AKHA 4G0IA 4O7HA 4MH2A 2JU5A 4G10A 2O8VB 4ID0A 5EPFA 4OFTA 3JCML 4WETA 3PINA 5CRHA 2NTOA 1ZYNA 6GSUA 3QMXA 5CO3A 4JZQA 4HJMA 3F63A 3KM6A 4Q5NA 2NVLA 2VL2A 5ELAA 2VOCA 1GTBA 3AY8A 3WGDA 2AUVA 4MZWA 4TW5A 1C72A 3ERWA 3VWWA 5IIZA 1WE0A 1GNWA 2KP1A 4E8EA 2OBKA 1N25A 3VPTA 2H1BA 1N8JA 2LNTA 4POBA 3EU4A 5C00A 2MZCA 1UN2A 2WZ9A 4ACSA 5IM9A 2RIIA 4USSA 2E2GA 5G2ZA 5LCZA 3HDCA 3ZVJD 3GN3A 4KB3A 2PBJA 4X4JA 4GXZA 5DQYA 1O8WA 5GAPD 3FR9A 1F6MC 2L59A 4V2MA 1TTZA 3HXSA 2O89A 4GF0A 1MEKA 2E7PA 1RK4A 4IJIA 4BVXA 2PGTA 4GSNA 2AYTA 3HVSA 3M1GA 2JZRA 4EIQA 2GT5A 3H93A 1M2BA 2RM6A 5CRWA 3M8NA 1JLWA 3GKNA 3ZRDA 1PKWA 4MCUA 2AAWA 2B6MA 5CREA 2V6OA 3LFLA 2QC7A 5GAND 2LUSA 1GUMA 3F4SA 5A1NB 2VM1A 5DQSA 1TK5B 3FR6A 1QMVA 3I6AA 4HOJA 4IGJA 1LBKA 2AV4A 4POKA 3UARA 1SJ6A 1U6TA 1ERWA 1F2EA 3UEMA 3L4NA 3RBTA 3EU3A 4MF7A 2XHFA 1CQHA 4K2DA 1V40A 3HKRA 4OFMA 1FB6A 2AHEA 4MDCA 2XBQA 4AKGA 1BX9A 1FO5A 2LV3A 1HNAA 2HNLA 3VWUA 3FZAA 3C1RA 3A5IA 4XS4A 3D0ZA 1XFLA 5J3RA 4I5QA 1TRUA 1K0AA 5G30A 4HU7A 1GSEA 5J5NA 1DE1A 4L8EA 5D73A 1HQOA 2NDOA 2P31A 2RLIA 22GSA 4GSSA 2TRXA 1FG4A 4ZILA 4POMA 4RI7A 4OO5A 4RQRA 2GQMA 1FVJA 4HUAA 3M0FA 1XPVA 3D4MA 2A2RA 1PN0A 4OFNA 1JZRA 1YVLA 3L9VA 3QAGA 3WGEA 3GNJA 1Z5YE 2DJJA 4TR4A 2VAFA 2LNSA 5D93A 1AQWA 1KNGA 5A4VA 4AF2A 1YDKA 3RHCA 2OT3A 1JZDA 4KW6A 3CSJA 4LL1B 3P8WA 3LJRA 2YV9A 2H1AA 2H1GA 2IMDA 3HHVA 4IQAA 2CVDA 3HA9A 2CVBA 2LRNA 3HJOA 3O76A 1A8LA 2R0PA 2C0FA 1XWGA 2GZPA 1URMA 1ZMAA 5A5HB 4HQZA 4QL7A 4L5LA 4LL4B 4DSSA 4MPGA 4DVCA 1TJDA 1TXXA 4I2TA 2K8VA 2FGXA 1OYJA 3GFKA 4ZL8A 3R3EA 1R4WA 1XWKA 1WIKA 4JR6A 2FUG2 1MDKA 3Q19A 3P7XA 4ML6A 3HYPA 1XBSA 3E9JB 2CV4A 1WWJA 1U3AA 2A4VA 2B7KA 1TU7A 4KSMA 2GZZA 4E8HA 1J08A 2DMMA 2H71A 1PRXA 3DWVA 2ZCTA 4N3ZA 4K9ZA 1ST9A 4V2LA 2P5QA 4LLRA 4TR1B 1EGOA 1OC3A 4CY8A 5IPHA 3TJFA 2WULA 3ERFA 1SD9A 4CW9A 1E2YA 5CAXA 3TOTA 2P0GA 4IP1A 1A2LA 1ZZYA 3F4TA 1T00A 1AC1A 3FKFA 3DRNA 4ZBBA 1EV9A 3F0IA 3H1NA 1A24A 2IFQB 2L4CA 4HS1A 4TN8A 2CVKA 1SVOA 3A2XA 4K6XA 2DJ1A 2N5AA 4F03A 4NAXA 2M72A 2HSMA 5E59A 1Z7PA 2F8AA 1AAZA 4IP6A 2CX3A 1HYUA 1MDJA 2BJXA 3FRCA 3IE3A 2XC2A 1ERTA 5D96A 3RPPA 3EE2A 1M2DA 3RAZA 3ZIVA 4I97A 5H5SA 1QXHA 3IHGA 1T7PB 1WP0A 2B3SA 4MJCA 2KOKA 3UAPA 3LG6A 2I3YA 5GSTA 6GSYA 3ISOA 1NSWA 1SK1A 5COHA 2CZ2A 4V2NA 5F07A 1SJIA 3DEXA 1ON4A 2LQOA 3U5RE 3PH9A 1O85A 12GSA 3GKXA 3QCPA 3GURA 1XCCA 3FZ4A 2GZYA 4WKWA 3H79A 3M9KA 5J41A 2GVPA 5E4WA 2VIMA 4DSQA 4MP4A 1JZOA 3IK7A 2GLRA 4O32A 3G9BA 2HFDA 2EIRA 5G1KA 3UJ1A 1KEBA 3F6DA 1AIUA 4YH2A 2IJYA 3P90A 2H72A 1GSYA 4EDYA 3APOA 1BG1A 5DJMA 2EIQA 1M9AA 1H4OA 1HNCA 2EFCA 5B8BA 1JLVA 2H01A 2N5FA 5KN2A 2L57A 5J47A 4RUVA 4JRRA 2WS2A 3GMFA 5IQYA 1O7UA 1GLQA 3QDNA 4ZIJA 4TRXA 4XIHA 2DKIA 2ON5A 1THXA 5J40A 3C73A 2LEGA 3Q74A 3LSZA 3VK9A 2PUKC 4GSTA 1B4PA 2H75A 1K3OA 2WCIA 4XS6A 2WB9A 3IV4A 4K7IA 3CXGA 9GSSA 1UVZA 2YANA 2OADA 1SYRA 4JR4A 2F3MA 3ZFBA 3UBKA 3KMOA 2QGVA 2VCQA 3QFBC 3F4RA 2JACA 1TI3A 2M80A 2EFHA 3KMNA 2B1LA 2H8LA 1TK8B 1R26A 3CTFA 4FH8A 3FY7A 2OE0A 4FYBA 2MMNA 3GL5A 1ERVA 3KH9A 5ELGA 4X0XA 2G2QA 2GTUA 1GLPA 5KOWA 4PUFC 1DE2A 1FOVA 5A34A 2RUFA 2FA4A 1GTIA 1FOHA 2LJRA 4FQUA 1T3BA 1EEJA 2EC4A 1H75A 3ED3A 4BA7A 2M46A 3LGCA 5A5KA 4YQUA 4ZB6A 4Z7XA 1BF5A 2H66A 2VCVA 4HZ2A 4JU5A 4N0VA 3BJ5A 11GSA 2IIYA 5AN1A 4K2XA 4ECIA 3LYKA 1A2MA 1SU9A 3TCOA 4EVMA 4N10A 3UBLA 1EZKA 1QK8A 2CT6A 4YAVA 5CNWA 1VF3A 4D73B 3P2AA 1MDIA 1UC7A 3TKSE 5ECPB 1FVKA 3TKSA 2H74A 4K7NA 5IO2A 1QQ2A 3TOUA 1XWAA 1CQGA 2X8CA 2HYXA 3QAVA 1SJZA 2A4HA 2R0CA 3LYPA 5BRTA 1ML6A 4EIPA 4NPBA 5D8IA 4Q5QA 2XPDA 4HZ4A 1JZWA 3F8UA 3GSSA 1RW1A 4FYUA 6GSSA 3HVVA 1GSFA 3A2VA 3APQA 4Q5FA 1PX7A 2KLXA 2VL2C 5D9TA 5FHIA 4MNNA 2H6ZA 2FCHA 2VCTA 2DMLA 18GSA 2EIOA 2H30A 1YF0A 1UA5A 4PURA 1TOFA 5KN0A 1GWCA 4XRAA 4TOPA 3OR5A 3KZQA 1GTUA 1MTCA 5G5EA 3KIJA 2C8UA 1O8XA 4MABA 3H4KA 2LTKA 3HMJG 4KDUA 3TGZA 1O81A 1XW6A 5HR0A 2VD1A 3PPUA 1LU4A 4TXVA 5L71A 3HJPA 1OE8A 1J0FA 1PMTA 4ML1A 4J57E 1W89A 1A0FA 2GDRA 1SENA 4OCFA 3V1WA 8GSSA 2FD3A 1XOAA 5J9CA 3DYRA 2EFEA 1X9WB 5DALA 2G0FA 3TJKA 2UV8G 4MPFA 1Y6EA 5LD0A 2CAQA 3GSTA 1GUHA 3FHKA 1M7TA 5JWOB 4MJAA 1XWCA 2I9HA 2VKZG 2H76A 1OKTA 1FB0A 5JCUA 4IHUA 17GSA 2X4AA 4EC0A 5HFKA 3EMPA 4F2IA 1T8EB 2N5BA 5DAKA 5ECIB 3GHAA 4POLA 2YV7A 4K5RA 2XPEA 3L9SA 2IMKA 1EOGA 5IMVA 5DDLA 4IVFA 3VURA 16GSA 3I9V2 1K0NA 2LRCA 5A4WA 2VUPA 1JFUA 2DLXA 1K3YA 3UVHA 2MMZA 3W8SA 2R5GA 4BVXB 13GSA 3VFIA 2F51A 3FK8A 2OA7A 1F3AA 2O87A 4MJEA 5IMAA 5BMUA 2YWMA 3CYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EL1 A;  2F8F A;  3IPZ A;  2KUC A;  5DCH A;  2J23 A;  4ZB9 A;  1J9B A;  1SKW B;  5FT3 A;  2HXK A;  3GRX A;  4G0K A;  3WT2 A;  1KBN A;  1PN9 A;  4EUY A;  3IK9 A;  5J4U A;  3NZN A;  4KCE A;  3GIX A;  4X1U A;  3ZTL A;  1PQN A;  3APS A;  2VLV A;  3L0H A;  4OMV A;  1Z6N A;  3ZLP A;  3ZIJ A;  2LS5 A;  1M0U A;  3ME7 A;  1XW9 A;  1A8Y A;  2JZT A;  1GUK A;  2VO4 A;  1WPI A;  3SWL A;  3PR8 A;  4XHM A;  5AIX A;  3DKS A;  4ZXG A;  4ZL7 A;  3BD2 A;  3J7Y b;  2WFC A;  1U3I A;  4MMM A;  5IMD A;  1EOH A;  5AIV A;  1USB A;  2FA8 A;  2B5Y A;  3VI5 A;  3UMA A;  1ZYE A;  1TU8 A;  4XS4 B;  4KA0 A;  3KTL A;  4NHW A;  4K7O A;  5J9B A;  3CSH A;  2GGT A;  4O5R A;  5G1L A;  4WXT A;  5C04 A;  4TKY A;  1XIY A;  5H5Q A;  3GYK A;  2V6K A;  1DBY A;  5EY6 A;  3G7J A;  1EV4 A;  5JCW A;  4ZBA A;  1ZOF A;  1X9M B;  2CAI A;  1TK0 B;  3RHB A;  2HRF A;  3CRT A;  1AQV A;  3KEB A;  6GSV A;  2H70 A;  1WJK A;  3FW2 A;  3EIN A;  3IAM 2;  4ILF A;  3ME8 A;  3IC4 A;  2GSR A;  2E2M A;  2YZU A;  4BL7 A;  1S3A A;  1B4Q A;  3DD3 A;  2HLS A;  5HQP A;  2HT9 A;  3UVT A;  2D2Z A;  1OE7 A;  1B9X C;  3IAS 2;  2GSS A;  2VCW A;  3G7Y A;  4DEJ A;  1DSB A;  1PL1 A;  3GTU A;  1NW2 A;  5EL8 A;  1ZCP A;  4ECB A;  4ISD A;  2H6Y A;  4PNF A;  1A0R P;  1GSQ A;  4LA1 A;  3GA4 A;  1GP1 A;  1JHB A;  3KJY A;  2R6K A;  3U6V A;  3QAW A;  4DSS B;  4IBP A;  3MAK A;  2VCZ A;  4IQ1 A;  4HU9 A;  2AB6 A;  4OD7 A;  2LQQ A;  1VRS D;  2Z9S A;  3IC8 A;  3MDK A;  5DVB A;  2HRK A;  2PMT A;  3MWH A;  3HCZ A;  2VM2 A;  4PQH A;  3EUR A;  3SBC A;  4ZBD A;  3I69 A;  3BCK A;  2X99 A;  2WDU A;  3QR6 A;  2YNX A;  2L5O A;  3LWA A;  1OC9 A;  3F6F A;  2C0E A;  3D21 A;  2MYG A;  4I6X A;  5B8A A;  2X8G A;  4HJ2 A;  4LMV A;  3LQ7 A;  10GS A;  2HSY A;  4FYC A;  1S3D A;  1F9M A;  2ZUP A;  1XW5 A;  3E0U A;  5DJL A;  3L78 A;  3LXZ A;  1K0O A;  1G7E A;  3WD6 A;  1YKC A;  2LJA A;  2ES7 A;  5ID2 A;  3DIE A;  4N0Z A;  2IMI A;  1T1V A;  3US3 A;  5ECK B;  2ON7 A;  2BTO T;  1V9W A;  1F3B A;  4F82 A;  5D9W A;  5HFI A;  4GWR A;  4HI7 A;  6GSW A;  1HD2 A;  2H19 A;  1PX6 A;  4V1A g;  2K8S A;  5D9X A;  1X5E A;  4HEA 2;  3TKP A;  4PTS A;  3NOF A;  4TXO A;  4EXJ A;  2HSM B;  4KGI A;  1EEM A;  3IR4 A;  4EE0 A;  1LJR A;  1SL0 B;  2HZE A;  1WRY A;  2KHP A;  1X5C A;  4ECC A;  4BVY A;  1TW9 A;  4XS1 A;  1XVQ A;  2R4V A;  1G7O A;  4AGS A;  2FWF A;  4MF6 A;  4NHZ A;  4G2E A;  2R2J A;  1ZYQ B;  3ZFL A;  1ILO A;  2RUE A;  1R5A A;  1SK0 A;  2F9S A;  1N2A A;  4MZC A;  2J9H A;  1I5G A;  1IYI A;  1TP9 A;  3N9J A;  2UZ8 A;  2V32 A;  4F9Z A;  4MJB A;  1THO A;  4ZL9 A;  3WYW A;  1VF4 A;  2FWE A;  2C4J A;  5H5R A;  2OE1 A;  4HDE A;  3EYT A;  4AJ8 A;  1V58 A;  1XWB A;  1Q4J A;  3HJM A;  1YEP A;  1YZX A;  1OC8 A;  1X0R A;  5B6N A;  4RQX A;  4BPY A;  3M3M A;  4EF0 A;  3CSI A;  5CYY A;  3HY2 A;  1SD8 A;  4JE1 A;  2NPB A;  2LRT A;  1ZL9 A;  2GSQ A;  4MF5 A;  5CRD A;  2IN3 A;  4MLY A;  2K6V A;  2DJK A;  5B6M A;  5LNK e;  1GUL A;  5ABR A;  3FYG A;  1G6Y A;  2I81 A;  1X9S B;  3VPQ A;  2L4Q A;  4KDX A;  5JWR B;  4PXO A;  1R7H A;  4F0B A;  2O7K A;  1KTE A;  4OWY A;  3BCI A;  2GS3 A;  3EVI A;  3QFA C;  4MZB A;  3DXB A;  4L0W A;  1G0T A;  4CHS A;  2X64 A;  2X8H A;  2OE3 A;  4YQM A;  4IS0 A;  2VL9 A;  5IMF A;  1B9Y C;  4BWS A;  4KSO A;  2ZNM A;  3C7M A;  3DML A;  5IOX A;  4EDZ A;  2OJL A;  2QKE A;  1TRV A;  4TVE A;  4GQC A;  5G31 A;  4KF9 A;  2H0G A;  1U88 A;  4EO3 A;  1T4Y A;  4CDO A;  2DJ0 A;  3IBH A;  1NHY A;  2WGR A;  1V57 A;  3FR3 A;  5D9V A;  4KX4 A;  3BBY A;  3QOU A;  5B7C A;  4QL9 A;  2YCD A;  1WMJ A;  1EP7 A;  1ZGN A;  3TKS C;  1B8X A;  4XCS A;  2QSI A;  3O3T A;  3HD5 A;  4WF4 A;  1K0M A;  3FEU A;  2GT6 A;  1VF1 A;  3ZL5 A;  5GZZ B;  1SL2 B;  1O6J A;  4L0U A;  3DVX A;  3TRX A;  5AIS A;  4RI6 A;  3ERG A;  2KP2 A;  1BED A;  3RPN A;  2MMO A;  2PVO C;  2PU9 C;  5HR3 A;  1ACV A;  1AXD A;  3D6I A;  2DJ2 A;  3KTB A;  3KGK A;  2LJK A;  3GKK A;  3IXR A;  2JAD A;  4P3Y B;  1O73 A;  1GSS A;  3S9F A;  3IOS A;  4F0C A;  2B5X A;  2YN1 A;  2YJ7 A;  5KEJ A;  1MD3 A;  3DGQ A;  3QD9 A;  4K1F A;  3GH6 A;  3UIW A;  4PX1 A;  2VLU A;  1GSD A;  5G5F A;  1AW9 A;  3C8E A;  3D22 A;  5HR1 A;  1IYH A;  2BMX A;  1VGL A;  4WR5 A;  2FWG A;  5ECL B;  5ECN B;  20GS A;  2FWH A;  3TB2 A;  4OO4 A;  3O6T A;  1BG5 A;  3GX8 A;  3FZ9 A;  4NV2 A;  4YQV A;  2K18 A;  1SKR B;  4YAP A;  2I4A A;  1Y25 A;  2PPT A;  3TJJ A;  2C0G A;  1A23 A;  5ECS A;  3ZML A;  4HQS A;  5IOW A;  1AQX A;  4IW9 A;  3W6G A;  2HRA A;  4KE3 A;  2V41 A;  1V2A A;  3A5W A;  1K0B A;  2L6C A;  1EP8 A;  3TJG A;  4J56 E;  4IN0 A;  1ABA A;  3BOA A;  5FWG A;  3A3T A;  4MA9 A;  2AJQ B;  2IPA A;  5KN3 A;  1OVN A;  2H6X A;  3KXO A;  3TRQ A;  4KAE A;  2LKU A;  2DIY A;  3GL3 A;  4TR1 A;  1V98 A;  2TRC P;  1TKD B;  5A4U A;  1TI1 A;  1BJX A;  2B1K A;  2YP6 A;  4JED A;  3F3R A;  4IEL A;  4KH7 A;  3C1S A;  1QFN A;  3Q18 A;  4N11 A;  4NMU A;  4GLT A;  5ENU A;  2A2S A;  4TR0 A;  3IHQ A;  4PGT A;  1FW1 A;  3F9U A;  1NHO A;  3UL3 A;  5DAL B;  2OBI A;  1TDI A;  2PWJ A;  2XBI A;  4EKZ A;  4MK3 A;  4IJ3 A;  1F37 A;  4G9H A;  2IFQ A;  2C3N A;  3MNG A;  2YWN A;  2OKA A;  1SKS B;  2P5R A;  2C0D A;  1T4Z A;  1XOB A;  2YPM A;  4G0L A;  5ECQ B;  2RM5 A;  3A2W A;  5DAK B;  2IL3 A;  4O92 A;  1GNE A;  2YJH A;  2PN8 A;  1OAZ A;  1I9D A;  2R37 A;  1PGT A;  3CBU A;  1YEX A;  4GRF A;  5F8B A;  3WT1 A;  5JCG A;  3VWV A;  4WBR D;  2V2G A;  3Q6O A;  1YJ6 A;  3TDG A;  1XZO A;  2GQL A;  2MMA A;  2WRT A;  3ZMK A;  2C1Y A;  3EWL A;  3G7I A;  1NM3 A;  3GH9 A;  1YKA A;  3TUE A;  3CMI A;  2GQK A;  4H86 A;  3WGX A;  1Q98 A;  2JSY A;  2HSN B;  1GSU A;  1BAY A;  1PD2 1;  2FNO A;  1K0D A;  2HSH A;  3TKQ A;  3EMX A;  2FLS A;  2REM A;  2CZ3 A;  1TRW A;  3HZ8 A;  5GSS A;  3I43 A;  1PSQ A;  1K3L A;  4WBJ A;  1GTA A;  6GSX A;  1YQ1 A;  2MBT A;  1AUC A;  3FZ5 A;  3IRA A;  4K0N A;  3W8J A;  4QQ7 A;  1Z6M A;  4KCA A;  3ZIT A;  2DBC A;  2FY6 A;  4PNG A;  2C3Q A;  3ZVJ A;  4N30 A;  2C3T A;  3E3E A;  1W4V A;  2PVQ A;  2K9F A;  3GUS A;  1G6W A;  5F0G A;  3GX0 A;  2VCX A;  3K8N A;  1B48 A;  1M9B A;  5IPG A;  2VL3 A;  1XVW A;  1EGR A;  4WR4 A;  4NV5 A;  2NBS A;  2CX4 A;  5ECM B;  2FHE A;  2GST A;  2PER A;  3KD0 A;  2WJU A;  2ALB A;  1M99 A;  4NWY A;  2H73 A;  3C71 A;  3TKR A;  3DVW A;  2MBS A;  3ZRE A;  4J2F A;  1SK2 A;  3H8Q A;  2O85 A;  3GV1 A;  3IDV A;  4PQ1 A;  1SYX A;  1BYE A;  4GCI A;  4X43 A;  4ZB8 A;  3KP8 A;  1BQ7 A;  1WOU A;  2VD0 A;  5EVO A;  2E0Q A;  1X5D A;  1PL2 A;  4FIW A;  4BL7 B;  4FO5 A;  2C80 A;  4BWQ A;  2YWI A;  4K0G A;  3IA1 A;  3VWX A;  4MH3 A;  4WEY A;  1FAA A;  2VLT A;  1E6B A;  2IME A;  3GTU B;  3N5O A;  1QGV A;  1FHE A;  2TIR A;  4DSR A;  3D4T A;  2H0H A;  5IO0 A;  1PA3 A;  3R2Q A;  3J7Y k;  4JBB A;  4Q5R A;  1XXU A;  2YWO A;  2L6D A;  2HE3 A;  5HR2 A;  4TR3 A;  7GSS A;  3ZZX A;  4ULX A;  3HVX A;  5CRG A;  3LEF A;  4OCE A;  3VLN A;  5CP1 A;  2IWT A;  5IMZ A;  3HZ4 A;  5F05 A;  2HRK B;  5F06 A;  2HI7 A;  1ERU A;  5ECO B;  4D73 A;  1YY7 A;  3CRU A;  1K0C A;  1OKD A;  2R3X A;  2H1D A;  2YZH A;  3KH7 A;  3NIV A;  1DUG A;  4NXI A;  1OC9 B;  4G19 A;  2DIZ A;  3F3Q A;  4GTU A;  3EC3 A;  5HFG A;  3RDW A;  4AJ6 A;  2B7J A;  5DBQ A;  1VF2 A;  1Z3E A;  1SL1 B;  2I1U A;  4PUA A;  3LXT A;  5AGY A;  2HRN A;  3KP9 A;  5JWQ B;  2HZF A;  4KDY A;  3VI7 A;  1EWX A;  5ID2 B;  2H0I A;  4IKH A;  4PQI A;  5DCG A;  1M2A A;  3PGT A;  2OAC A;  5IMC A;  2JZS A;  5KN1 A;  2DC5 A;  1GRX A;  1U87 A;  2LST A;  1Z7R A;  3L9U A;  3MSZ A;  2JSZ A;  2DSA A;  4I8B A;  1S3C A;  14GS A;  1HNB A;  2JL4 A;  5ECH B;  3UOM A;  4KND A;  4V1A p;  3D5J A;  4TXO B;  6GST A;  4I2U A;  3QPM A;  1MD4 A;  3ZYW A;  5ECR B;  4WF5 A;  2DJ3 A;  2IMF A;  1GH2 A;  3TRP A;  2HZE B;  4XTS A;  1Z9H A;  1YF1 A;  1A2J A;  2CQ9 A;  19GS A;  4KUN A;  2CA8 A;  4LMW A;  3TJB A;  5INY A;  1QUW A;  4GQF A;  1R5P A;  2YOI A;  3LOR A;  2HQT A;  4L5O A;  4BVY B;  2V1M A;  4XRD A;  4ECJ A;  3KCM A;  1RQM A;  4AJ7 A;  3M9J A;  1GL8 A;  4K8M A;  1TRS A;  2B5E A;  3GKM A;  1PKZ A;  2L5L A;  3CTG A;  4G0I A;  4O7H A;  4MH2 A;  2JU5 A;  4G10 A;  2O8V B;  4ID0 A;  5EPF A;  4OFT A;  3JCM L;  4WET A;  3PIN A;  5CRH A;  2NTO A;  6GSU A;  3QMX A;  5CO3 A;  4JZQ A;  4HJM A;  3F63 A;  3KM6 A;  4Q5N A;  2NVL A;  2VL2 A;  5ELA A;  2VOC A;  1GTB A;  3AY8 A;  3WGD A;  2AUV A;  4MZW A;  4TW5 A;  1C72 A;  3ERW A;  3VWW A;  5IIZ A;  1WE0 A;  1GNW A;  2KP1 A;  4E8E A;  2OBK A;  3VPT A;  2H1B A;  1N8J A;  2LNT A;  4POB A;  3EU4 A;  5C00 A;  2MZC A;  1UN2 A;  2WZ9 A;  4ACS A;  5IM9 A;  2RII A;  4USS A;  2E2G A;  5G2Z A;  5LCZ A;  3HDC A;  3ZVJ D;  3GN3 A;  4KB3 A;  2PBJ A;  4GXZ A;  5DQY A;  1O8W A;  5GAP D;  3FR9 A;  1F6M C;  2L59 A;  4V2M A;  1TTZ A;  3HXS A;  2O89 A;  4GF0 A;  1MEK A;  2E7P A;  1RK4 A;  4IJI A;  4BVX A;  2PGT A;  4GSN A;  2AYT A;  3HVS A;  3M1G A;  2JZR A;  2GT5 A;  3H93 A;  1M2B A;  2RM6 A;  5CRW A;  3M8N A;  1JLW A;  3GKN A;  3ZRD A;  1PKW A;  4MCU A;  2AAW A;  2B6M A;  5CRE A;  2V6O A;  3LFL A;  2QC7 A;  5GAN D;  2LUS A;  1GUM A;  3F4S A;  2VM1 A;  5DQS A;  1TK5 B;  3FR6 A;  1QMV A;  3I6A A;  4HOJ A;  4IGJ A;  1LBK A;  2AV4 A;  4POK A;  3UAR A;  1SJ6 A;  1U6T A;  1ERW A;  1F2E A;  3UEM A;  3L4N A;  3RBT A;  3EU3 A;  4MF7 A;  2XHF A;  1CQH A;  4K2D A;  1V40 A;  3HKR A;  4OFM A;  1FB6 A;  2AHE A;  4MDC A;  2XBQ A;  1BX9 A;  1FO5 A;  2LV3 A;  1HNA A;  2HNL A;  3VWU A;  3FZA A;  3C1R A;  4XS4 A;  3D0Z A;  1XFL A;  5J3R A;  4I5Q A;  1TRU A;  1K0A A;  5G30 A;  4HU7 A;  1GSE A;  5J5N A;  1DE1 A;  4L8E A;  5D73 A;  1HQO A;  2NDO A;  2P31 A;  2RLI A;  22GS A;  4GSS A;  2TRX A;  1FG4 A;  4ZIL A;  4POM A;  4RI7 A;  4OO5 A;  4RQR A;  2GQM A;  1FVJ A;  4HUA A;  3M0F A;  1XPV A;  3D4M A;  2A2R A;  4OFN A;  1JZR A;  3L9V A;  3QAG A;  3WGE A;  3GNJ A;  1Z5Y E;  2DJJ A;  4TR4 A;  2VAF A;  2LNS A;  5D93 A;  1AQW A;  1KNG A;  5A4V A;  4AF2 A;  1YDK A;  3RHC A;  1JZD A;  4KW6 A;  3CSJ A;  4LL1 B;  3P8W A;  3LJR A;  2YV9 A;  2H1A A;  2H1G A;  2IMD A;  3HHV A;  4IQA A;  2CVD A;  3HA9 A;  2CVB A;  2LRN A;  3HJO A;  3O76 A;  1A8L A;  2C0F A;  1XWG A;  2GZP A;  1URM A;  1ZMA A;  4HQZ A;  4QL7 A;  4L5L A;  4LL4 B;  4DSS A;  4MPG A;  4DVC A;  1TJD A;  1TXX A;  4I2T A;  2K8V A;  2FGX A;  1OYJ A;  3GFK A;  4ZL8 A;  3R3E A;  1R4W A;  1XWK A;  1WIK A;  4JR6 A;  2FUG 2;  1MDK A;  3Q19 A;  3P7X A;  4ML6 A;  3HYP A;  1XBS A;  3E9J B;  2CV4 A;  1WWJ A;  1U3A A;  2A4V A;  2B7K A;  1TU7 A;  4KSM A;  2GZZ A;  4E8H A;  1J08 A;  2DMM A;  2H71 A;  1PRX A;  3DWV A;  2ZCT A;  4K9Z A;  1ST9 A;  4V2L A;  2P5Q A;  4LLR A;  4TR1 B;  1EGO A;  1OC3 A;  5IPH A;  3TJF A;  2WUL A;  3ERF A;  1SD9 A;  4CW9 A;  1E2Y A;  5CAX A;  3TOT A;  2P0G A;  4IP1 A;  1A2L A;  1ZZY A;  3F4T A;  1T00 A;  1AC1 A;  3FKF A;  3DRN A;  4ZBB A;  1EV9 A;  3F0I A;  3H1N A;  1A24 A;  2IFQ B;  2L4C A;  4HS1 A;  4TN8 A;  2CVK A;  3A2X A;  4K6X A;  2DJ1 A;  2N5A A;  4F03 A;  4NAX A;  2M72 A;  2HSM A;  5E59 A;  1Z7P A;  2F8A A;  1AAZ A;  4IP6 A;  2CX3 A;  1HYU A;  1MDJ A;  2BJX A;  3FRC A;  3IE3 A;  2XC2 A;  1ERT A;  5D96 A;  3RPP A;  3EE2 A;  1M2D A;  3RAZ A;  3ZIV A;  4I97 A;  5H5S A;  1QXH A;  1T7P B;  1WP0 A;  2B3S A;  4MJC A;  2KOK A;  3UAP A;  3LG6 A;  2I3Y A;  5GST A;  6GSY A;  3ISO A;  1NSW A;  1SK1 A;  5COH A;  2CZ2 A;  4V2N A;  5F07 A;  1SJI A;  3DEX A;  1ON4 A;  2LQO A;  3U5R E;  3PH9 A;  1O85 A;  12GS A;  3GKX A;  3QCP A;  3GUR A;  1XCC A;  3FZ4 A;  2GZY A;  4WKW A;  3H79 A;  3M9K A;  5J41 A;  2GVP A;  5E4W A;  2VIM A;  4DSQ A;  4MP4 A;  1JZO A;  3IK7 A;  2GLR A;  4O32 A;  3G9B A;  2HFD A;  2EIR A;  5G1K A;  3UJ1 A;  1KEB A;  3F6D A;  1AIU A;  4YH2 A;  2IJY A;  3P90 A;  2H72 A;  1GSY A;  4EDY A;  3APO A;  5DJM A;  2EIQ A;  1M9A A;  1H4O A;  1HNC A;  5B8B A;  1JLV A;  2H01 A;  2N5F A;  5KN2 A;  2L57 A;  4RUV A;  4JRR A;  2WS2 A;  3GMF A;  5IQY A;  1O7U A;  1GLQ A;  3QDN A;  4ZIJ A;  4TRX A;  4XIH A;  2ON5 A;  1THX A;  3C73 A;  2LEG A;  3Q74 A;  3LSZ A;  3VK9 A;  2PUK C;  4GST A;  1B4P A;  2H75 A;  1K3O A;  2WCI A;  4XS6 A;  2WB9 A;  3IV4 A;  4K7I A;  3CXG A;  9GSS A;  1UVZ A;  2YAN A;  2OAD A;  1SYR A;  4JR4 A;  2F3M A;  3ZFB A;  3UBK A;  3KMO A;  2QGV A;  2VCQ A;  3QFB C;  3F4R A;  2JAC A;  1TI3 A;  2M80 A;  3KMN A;  2B1L A;  2H8L A;  1TK8 B;  1R26 A;  3CTF A;  4FH8 A;  3FY7 A;  2OE0 A;  4FYB A;  2MMN A;  3GL5 A;  1ERV A;  3KH9 A;  5ELG A;  4X0X A;  2G2Q A;  2GTU A;  1GLP A;  4PUF C;  1DE2 A;  1FOV A;  2RUF A;  2FA4 A;  1GTI A;  2LJR A;  4FQU A;  1T3B A;  1EEJ A;  2EC4 A;  1H75 A;  3ED3 A;  4BA7 A;  2M46 A;  3LGC A;  5A5K A;  4YQU A;  4ZB6 A;  4Z7X A;  2H66 A;  2VCV A;  4HZ2 A;  4JU5 A;  4N0V A;  3BJ5 A;  11GS A;  2IIY A;  5AN1 A;  4ECI A;  3LYK A;  1A2M A;  1SU9 A;  3TCO A;  4EVM A;  4N10 A;  3UBL A;  1EZK A;  1QK8 A;  2CT6 A;  4YAV A;  5CNW A;  1VF3 A;  4D73 B;  3P2A A;  1MDI A;  1UC7 A;  3TKS E;  5ECP B;  1FVK A;  3TKS A;  2H74 A;  4K7N A;  5IO2 A;  1QQ2 A;  3TOU A;  1XWA A;  1CQG A;  2X8C A;  2HYX A;  3QAV A;  1SJZ A;  3LYP A;  1ML6 A;  4NPB A;  5D8I A;  4Q5Q A;  2XPD A;  4HZ4 A;  1JZW A;  3F8U A;  3GSS A;  1RW1 A;  4FYU A;  6GSS A;  3HVV A;  1GSF A;  3A2V A;  3APQ A;  4Q5F A;  1PX7 A;  2KLX A;  2VL2 C;  5D9T A;  5FHI A;  2H6Z A;  2FCH A;  2VCT A;  2DML A;  18GS A;  2EIO A;  2H30 A;  1YF0 A;  1UA5 A;  4PUR A;  1TOF A;  5KN0 A;  1GWC A;  4XRA A;  4TOP A;  3OR5 A;  3KZQ A;  1GTU A;  1MTC A;  5G5E A;  3KIJ A;  2C8U A;  1O8X A;  4MAB A;  3H4K A;  2LTK A;  4KDU A;  3TGZ A;  1O81 A;  1XW6 A;  5HR0 A;  2VD1 A;  3PPU A;  1LU4 A;  4TXV A;  5L71 A;  3HJP A;  1OE8 A;  1J0F A;  1PMT A;  4ML1 A;  4J57 E;  1W89 A;  1A0F A;  2GDR A;  1SEN A;  4OCF A;  3V1W A;  8GSS A;  2FD3 A;  1XOA A;  5J9C A;  3DYR A;  1X9W B;  5DAL A;  2G0F A;  3TJK A;  4MPF A;  1Y6E A;  5LD0 A;  2CAQ A;  3GST A;  1GUH A;  3FHK A;  1M7T A;  5JWO B;  4MJA A;  1XWC A;  2I9H A;  2H76 A;  1OKT A;  1FB0 A;  5JCU A;  4IHU A;  17GS A;  4EC0 A;  5HFK A;  3EMP A;  4F2I A;  1T8E B;  2N5B A;  5DAK A;  5ECI B;  3GHA A;  4POL A;  2YV7 A;  2XPE A;  3L9S A;  2IMK A;  1EOG A;  5IMV A;  5DDL A;  4IVF A;  3VUR A;  16GS A;  3I9V 2;  1K0N A;  2LRC A;  5A4W A;  2VUP A;  1JFU A;  2DLX A;  1K3Y A;  3UVH A;  2MMZ A;  3W8S A;  2R5G A;  4BVX B;  13GS A;  3VFI A;  2F51 A;  3FK8 A;  2OA7 A;  1F3A A;  2O87 A;  4MJE A;  5IMA A;  5BMU A;  2YWM A;  3CYN A; 
#chains in the Genus database with same CATH topology
 4EL1 A;  2HSN A;  2F8F A;  3IPZ A;  2KUC A;  5DCH A;  2J23 A;  4ZB9 A;  1J9B A;  1SKW B;  5FT3 A;  2HXK A;  3GRX A;  4G0K A;  3WT2 A;  1KBN A;  1PN9 A;  3TU3 B;  4EUY A;  3IK9 A;  5J4U A;  3NZN A;  4KCE A;  3GIX A;  4X1U A;  3ZTL A;  1PQN A;  3APS A;  4A5P A;  2VLV A;  3L0H A;  4OMV A;  1Z6N A;  3ZLP A;  3ZIJ A;  2LS5 A;  1M0U A;  4HSC X;  3ME7 A;  1XW9 A;  1A8Y A;  2JZT A;  1GUK A;  4Z2U A;  2VO4 A;  1WPI A;  3SWL A;  3PR8 A;  4XHM A;  5AIX A;  3DKS A;  4ZXG A;  4ZL7 A;  3BD2 A;  3J7Y b;  2WFC A;  1U3I A;  4MMM A;  5IMD A;  1EOH A;  5AIV A;  1USB A;  2FA8 A;  2B5Y A;  3VI5 A;  3UMA A;  4AKX B;  1TU8 A;  1ZYE A;  4XS4 B;  4KA0 A;  3KTL A;  4CY6 A;  4NHW A;  4K7O A;  5J9B A;  3CSH A;  2GGT A;  4O5R A;  5G1L A;  4WXT A;  5C04 A;  4TKY A;  1XIY A;  5H5Q A;  3GYK A;  2V6K A;  1DBY A;  5EY6 A;  3G7J A;  1EV4 A;  5JCW A;  4ZBA A;  1ZOF A;  1X9M B;  2CAI A;  2WW3 A;  1TK0 B;  3RHB A;  2HRF A;  3CRT A;  1AQV A;  3KEB A;  6GSV A;  2H70 A;  1WJK A;  3FW2 A;  3EIN A;  3IAM 2;  4ILF A;  3ME8 A;  4PI0 C;  3IC4 A;  2GSR A;  2E2M A;  2YZU A;  4BL7 A;  1S3A A;  1B4Q A;  3DD3 A;  2HLS A;  5HQP A;  2HT9 A;  3UVT A;  4O5Q A;  2EFD A;  2D2Z A;  1OE7 A;  1B9X C;  3IAS 2;  2GSS A;  2VCW A;  3G7Y A;  4DEJ A;  1DSB A;  1PL1 A;  3GTU A;  1NW2 A;  5EL8 A;  1ZCP A;  4ECB A;  4ISD A;  2H6Y A;  4PNF A;  1A0R P;  1GSQ A;  4LA1 A;  3GA4 A;  1GP1 A;  1JHB A;  3KJY A;  2R6K A;  3U6V A;  3QAW A;  4DSS B;  4IBP A;  3MAK A;  2VCZ A;  4IQ1 A;  4HU9 A;  2AB6 A;  4OD7 A;  2LQQ A;  1VRS D;  2Z9S A;  3IC8 A;  3MDK A;  5DVB A;  2HRK A;  2PMT A;  3MWH A;  3HCZ A;  2VM2 A;  4PHZ C;  4PQH A;  3EUR A;  3SBC A;  4ZBD A;  3I69 A;  3BCK A;  2X99 A;  2WDU A;  3QR6 A;  2YNX A;  2L5O A;  3LWA A;  1OC9 A;  3F6F A;  2C0E A;  3D21 A;  5J4Y A;  2MYG A;  4I6X A;  5B8A A;  2X8G A;  4HJ2 A;  4LMV A;  3LQ7 A;  10GS A;  2HSY A;  4FYC A;  1S3D A;  1F9M A;  2ZUP A;  1XW5 A;  3E0U A;  5DJL A;  3L78 A;  3CWG A;  3LXZ A;  1K0O A;  1G7E A;  3WD6 A;  1YKC A;  2LJA A;  2ES7 A;  5ID2 A;  3DIE A;  4N0Z A;  2IMI A;  1T1V A;  3US3 A;  5ECK B;  2ON7 A;  2BTO T;  1V9W A;  1F3B A;  4F82 A;  5D9W A;  5HFI A;  4W66 A;  4GWR A;  4HI7 A;  6GSW A;  4K5S A;  1HD2 A;  2H19 A;  1PX6 A;  4V1A g;  2K8S A;  5D9X A;  1X5E A;  4HEA 2;  3TKP A;  4BIK A;  4PTS A;  3NOF A;  4TXO A;  4EXJ A;  2HSM B;  4KGI A;  1EEM A;  3IR4 A;  4EE0 A;  2WZS A;  1LJR A;  1SL0 B;  2HZE A;  1S3R A;  1WRY A;  2KHP A;  1X5C A;  4ECC A;  4BVY A;  1TW9 A;  4XS1 A;  1XVQ A;  2R4V A;  1G7O A;  4AGS A;  2FWF A;  4MF6 A;  4NHZ A;  4G2E A;  2R2J A;  1ZYQ B;  3ZFL A;  1ILO A;  2RUE A;  1R5A A;  1SK0 A;  2F9S A;  1N2A A;  4MZC A;  2J9H A;  1I5G A;  1IYI A;  3LW9 A;  1TP9 A;  3N9J A;  2UZ8 A;  2V32 A;  4F9Z A;  4MJB A;  1THO A;  4ZL9 A;  3WYW A;  2A2P A;  1VF4 A;  2FWE A;  2C4J A;  5H5R A;  4YKG A;  2OE1 A;  4HDE A;  3EYT A;  4AJ8 A;  1V58 A;  1XWB A;  1Q4J A;  3HJM A;  2X49 A;  4AI6 A;  1YEP A;  1YZX A;  1OC8 A;  1X0R A;  2R0G A;  5B6N A;  4RQX A;  4BPY A;  3M3M A;  4EF0 A;  3CSI A;  5CYY A;  3HY2 A;  1SD8 A;  4JE1 A;  2NPB A;  2LRT A;  1ZL9 A;  2GSQ A;  4MF5 A;  1ZYP A;  5CRD A;  2IN3 A;  4MLY A;  2K6V A;  1SVM A;  2DJK A;  5B6M A;  5LNK e;  1GUL A;  5ABR A;  3FYG A;  1G6Y A;  2I81 A;  1X9S B;  3VPQ A;  4GDF A;  2L4Q A;  4KDX A;  5JWR B;  4PXO A;  1R7H A;  4F0B A;  2O7K A;  1KTE A;  4OWY A;  3BCI A;  2GS3 A;  3EVI A;  3QFA C;  4MZB A;  3DXB A;  4L0W A;  1G0T A;  2QA1 A;  4CHS A;  2X64 A;  2X8H A;  2OE3 A;  4YQM A;  4IS0 A;  2VL9 A;  5IMF A;  5A1N A;  1B9Y C;  4BWS A;  4KSO A;  2ZNM A;  3C7M A;  3DML A;  5IOX A;  4EDZ A;  2OJL A;  2QKE A;  1TRV A;  4TVE A;  4GQC A;  5G31 A;  1YEW C;  4KF9 A;  2H0G A;  1U88 A;  4EO3 A;  3CHX C;  1T4Y A;  4CDO A;  2DJ0 A;  3IBH A;  1NHY A;  2WGR A;  1V57 A;  3FR3 A;  5D9V A;  4KX4 A;  3BBY A;  3QOU A;  5B7C A;  2WVX A;  4QL9 A;  2YCD A;  1WMJ A;  1EP7 A;  1ZGN A;  3TKS C;  1B8X A;  2H1L A;  4XCS A;  2QSI A;  3O3T A;  3HD5 A;  4WF4 A;  1K0M A;  3FEU A;  2GT6 A;  1VF1 A;  3ZL5 A;  5GZZ B;  1SL2 B;  1O6J A;  4L0U A;  3DVX A;  3TRX A;  5AIS A;  4RI6 A;  3ERG A;  2KP2 A;  1BED A;  3RPN A;  5A34 B;  4QMK A;  2MMO A;  2PVO C;  2PU9 C;  5HR3 A;  1ACV A;  1AXD A;  3D6I A;  2DJ2 A;  3KTB A;  3KGK A;  2LJK A;  3GKK A;  3IXR A;  2JAD A;  4P3Y B;  1O73 A;  1GSS A;  3S9F A;  3IOS A;  1XG8 A;  4F0C A;  2B5X A;  2YN1 A;  2YJ7 A;  5KEJ A;  1MD3 A;  3DGQ A;  3QD9 A;  4K1F A;  3GH6 A;  3UIW A;  4PX1 A;  2VLU A;  5J4V A;  1GSD A;  5G5F A;  1AW9 A;  3C8E A;  3D22 A;  5HR1 A;  1IYH A;  2BMX A;  1VGL A;  4WR5 A;  2FWG A;  5ECL B;  5ECN B;  20GS A;  2FWH A;  3TB2 A;  4OO4 A;  3O6T A;  1BG5 A;  3GX8 A;  3FZ9 A;  4NV2 A;  4YQV A;  2K18 A;  1SKR B;  4YAP A;  2I4A A;  1Y25 A;  2PPT A;  3TJJ A;  2C0G A;  1A23 A;  5ECS A;  3ZML A;  4HQS A;  5A5H A;  5IOW A;  1AQX A;  4IW9 A;  3W6G A;  1M3J A;  2HRA A;  4KE3 A;  2V41 A;  1V2A A;  3A5W A;  2DKH A;  1K0B A;  2L6C A;  1EP8 A;  3TJG A;  4J56 E;  4IN0 A;  1ABA A;  4E68 A;  3BOA A;  5FWG A;  3A3T A;  4MA9 A;  1I1I P;  2AJQ B;  2IPA A;  5KN3 A;  1OVN A;  2H6X A;  4ZB7 A;  3KXO A;  3TRQ A;  4KAE A;  2LKU A;  2DIY A;  3GL3 A;  4TR1 A;  1V98 A;  2TRC P;  1TKD B;  5A4U A;  1TI1 A;  1BJX A;  2B1K A;  2YP6 A;  4JED A;  3F3R A;  4IEL A;  2WVZ A;  4KH7 A;  4Z2T A;  3C1S A;  3EPT A;  1QFN A;  3Q18 A;  4N11 A;  4NMU A;  4GLT A;  5ENU A;  2A2S A;  4TR0 A;  3IHQ A;  4PGT A;  1FW1 A;  3F9U A;  1NHO A;  3UL3 A;  5DAL B;  2OBI A;  1TDI A;  2PWJ A;  2XBI A;  4EKZ A;  4MK3 A;  4IJ3 A;  1F37 A;  4G9H A;  2IFQ A;  2C3N A;  3MNG A;  2YWN A;  2OKA A;  1SKS B;  2P5R A;  2C0D A;  1T4Z A;  1XOB A;  2QA2 A;  2YPM A;  1Y1U A;  4G0L A;  5ECQ B;  2RM5 A;  3A2W A;  5DAK B;  4Z2R A;  2IL3 A;  4O92 A;  1GNE A;  2YJH A;  2PN8 A;  4YKF A;  2R37 A;  1OAZ A;  1I9D A;  3CBU A;  1PGT A;  1YEX A;  4GRF A;  5F8B A;  3WT1 A;  5JCG A;  3VWV A;  4WBR D;  2V2G A;  3Q6O A;  1YJ6 A;  3TDG A;  1XZO A;  2GQL A;  2MMA A;  2WRT A;  3ZMK A;  2C1Y A;  3EWL A;  3G7I A;  1NM3 A;  3GH9 A;  1YKA A;  2O3E A;  3TUE A;  3CMI A;  2GQK A;  4H86 A;  3WGX A;  1Q98 A;  5BMU B;  2JSY A;  2HSN B;  1GSU A;  1BAY A;  1PD2 1;  2FNO A;  1K0D A;  2HSH A;  3TKQ A;  3EMX A;  2FLS A;  2REM A;  2CZ3 A;  1TRW A;  3HZ8 A;  5GSS A;  3I43 A;  3MYD A;  1PSQ A;  1K3L A;  4WBJ A;  1GTA A;  6GSX A;  1YQ1 A;  2MBT A;  1AUC A;  3FZ5 A;  3IRA A;  4K0N A;  3W8J A;  4QQ7 A;  1Z6M A;  4KCA A;  3ZIT A;  2DBC A;  2FY6 A;  4PNG A;  2C3Q A;  3ZVJ A;  4N30 A;  2C3T A;  3E3E A;  1W4V A;  2PVQ A;  2K9F A;  3GUS A;  1G6W A;  5F0G A;  3GX0 A;  2VCX A;  3K8N A;  1B48 A;  1M9B A;  5IPG A;  2VL3 A;  1XVW A;  1EGR A;  4WR4 A;  4NV5 A;  4AKI A;  2NBS A;  2CX4 A;  5ECM B;  2FHE A;  1TXU A;  2GST A;  2PER A;  3HVN A;  3KD0 A;  2WJU A;  2ALB A;  1M99 A;  4NWY A;  2O36 A;  2H73 A;  3C71 A;  3TKR A;  3DVW A;  2MBS A;  3ZRE A;  4J2F A;  1SK2 A;  3H8Q A;  2O85 A;  3GV1 A;  3IDV A;  4PQ1 A;  1SYX A;  1BYE A;  4GCI A;  4X43 A;  4ZB8 A;  3KP8 A;  1BQ7 A;  1WOU A;  2VD0 A;  5EVO A;  2E0Q A;  1X5D A;  1PL2 A;  4FIW A;  4BL7 B;  4FO5 A;  2C80 A;  4BWQ A;  2YWI A;  4K0G A;  3IA1 A;  3VWX A;  4MH3 A;  4WEY A;  1FAA A;  2VLT A;  1E6B A;  2IME A;  3GTU B;  3N5O A;  1QGV A;  1FHE A;  2TIR A;  4DSR A;  3D4T A;  1S4B P;  2H0H A;  5IO0 A;  1PA3 A;  3R2Q A;  1SVL A;  3J7Y k;  4JBB A;  4Q5R A;  1XXU A;  2YWO A;  2L6D A;  2HE3 A;  5HR2 A;  4TR3 A;  7GSS A;  3ZZX A;  4ULX A;  4O5U A;  3HVX A;  2WVY A;  5CRG A;  3LEF A;  4OCE A;  3VLN A;  5CP1 A;  2IWT A;  5IMZ A;  3HZ4 A;  5F05 A;  2HRK B;  5F06 A;  2HI7 A;  1ERU A;  5ECO B;  2O5V A;  4D73 A;  4ICY A;  1YY7 A;  3MIX A;  3CRU A;  1K0C A;  1OKD A;  2R3X A;  2H1D A;  2YZH A;  3KH7 A;  3FMW A;  3NIV A;  1DUG A;  4NXI A;  1OC9 B;  4G19 A;  2DIZ A;  3F3Q A;  4GTU A;  3EC3 A;  5HFG A;  3RDW A;  4AJ6 A;  2B7J A;  5DBQ A;  1VF2 A;  1Z3E A;  1SL1 B;  2I1U A;  4G01 A;  4PUA A;  3LXT A;  5AGY A;  2HRN A;  3KP9 A;  5JWQ B;  5KOX A;  2HZF A;  4KDY A;  3VI7 A;  1EWX A;  5ID2 B;  2H0I A;  4IKH A;  4PQI A;  5DCG A;  1M2A A;  3PGT A;  2OAC A;  5IMC A;  2JZS A;  5KN1 A;  2DC5 A;  3RFR C;  1GRX A;  1U87 A;  2LST A;  1Z7R A;  3L9U A;  3MSZ A;  2JSZ A;  2DSA A;  4I8B A;  1S3C A;  14GS A;  1HNB A;  2JL4 A;  5ECH B;  3UOM A;  4KND A;  4V1A p;  3D5J A;  4TXO B;  6GST A;  4I2U A;  3QPM A;  1MD4 A;  3ZYW A;  5ECR B;  4WF5 A;  2DJ3 A;  2IMF A;  1GH2 A;  3TRP A;  2HZE B;  4XTS A;  1Z9H A;  1YF1 A;  1A2J A;  2CQ9 A;  19GS A;  4KUN A;  2CA8 A;  4LMW A;  3TJB A;  5INY A;  1QUW A;  4GQF A;  1R5P A;  2YOI A;  3LOR A;  2HQT A;  4L5O A;  4BVY B;  2V1M A;  4XRD A;  4ECJ A;  3KCM A;  1RQM A;  4AJ7 A;  3M9J A;  1GL8 A;  4K8M A;  1TRS A;  2B5E A;  3GKM A;  1PKZ A;  2L5L A;  3CTG A;  4AKH A;  4G0I A;  4O7H A;  4MH2 A;  2JU5 A;  4G10 A;  2O8V B;  4ID0 A;  5EPF A;  4OFT A;  3JCM L;  4WET A;  3PIN A;  5CRH A;  2NTO A;  1ZYN A;  6GSU A;  3QMX A;  5CO3 A;  4JZQ A;  4HJM A;  3F63 A;  3KM6 A;  4Q5N A;  2NVL A;  2VL2 A;  5ELA A;  2VOC A;  1GTB A;  3AY8 A;  3WGD A;  2AUV A;  4MZW A;  4TW5 A;  1C72 A;  3ERW A;  3VWW A;  5IIZ A;  1WE0 A;  1GNW A;  2KP1 A;  4E8E A;  2OBK A;  1N25 A;  1PFO A;  3VPT A;  2H1B A;  1N8J A;  2LNT A;  4POB A;  3EU4 A;  5C00 A;  2MZC A;  1UN2 A;  2WZ9 A;  4ACS A;  5IM9 A;  2RII A;  4USS A;  2E2G A;  5G2Z A;  5LCZ A;  3HDC A;  3ZVJ D;  3GN3 A;  4KB3 A;  2PBJ A;  4X4J A;  4GXZ A;  5DQY A;  1O8W A;  5GAP D;  3FR9 A;  1F6M C;  2L59 A;  4V2M A;  1TTZ A;  3HXS A;  2O89 A;  4GF0 A;  1MEK A;  2E7P A;  1RK4 A;  4IJI A;  4BVX A;  2PGT A;  4GSN A;  2AYT A;  3HVS A;  3M1G A;  2JZR A;  4EIQ A;  2GT5 A;  3H93 A;  1M2B A;  2RM6 A;  5CRW A;  3M8N A;  1JLW A;  3GKN A;  3ZRD A;  1PKW A;  4MCU A;  2AAW A;  2B6M A;  5CRE A;  2V6O A;  3LFL A;  2QC7 A;  5GAN D;  2LUS A;  1GUM A;  3F4S A;  5A1N B;  2VM1 A;  5DQS A;  1TK5 B;  3FR6 A;  1QMV A;  3I6A A;  4HOJ A;  4IGJ A;  1LBK A;  2AV4 A;  4POK A;  3UAR A;  1SJ6 A;  1U6T A;  1ERW A;  1F2E A;  3UEM A;  3L4N A;  3RBT A;  3EU3 A;  4MF7 A;  2XHF A;  1CQH A;  4K2D A;  1V40 A;  3HKR A;  4OFM A;  2WVX B;  1FB6 A;  2AHE A;  4MDC A;  2XBQ A;  4AKG A;  1BX9 A;  1FO5 A;  2LV3 A;  1HNA A;  1M3I A;  2HNL A;  3VWU A;  3FZA A;  3C1R A;  3A5I A;  4XS4 A;  3D0Z A;  1XFL A;  5J3R A;  4I5Q A;  1TRU A;  1K0A A;  5G30 A;  4HU7 A;  1GSE A;  5J5N A;  1DE1 A;  4L8E A;  5D73 A;  1HQO A;  2NDO A;  2P31 A;  2RLI A;  22GS A;  4GSS A;  2TRX A;  1FG4 A;  4ZIL A;  4POM A;  4RI7 A;  4OO5 A;  4RQR A;  2GQM A;  1FVJ A;  4HUA A;  3M0F A;  1XPV A;  3D4M A;  2A2R A;  1PN0 A;  4OFN A;  1JZR A;  1YVL A;  3L9V A;  3QAG A;  3WGE A;  3GNJ A;  1Z5Y E;  2DJJ A;  4TR4 A;  2VAF A;  2LNS A;  5D93 A;  1AQW A;  1KNG A;  5A4V A;  4AF2 A;  1YDK A;  3RHC A;  2OT3 A;  1JZD A;  4KW6 A;  3CSJ A;  4LL1 B;  3P8W A;  3LJR A;  2YV9 A;  2H1A A;  2H1G A;  2IMD A;  3HHV A;  4IQA A;  2CVD A;  3HA9 A;  2CVB A;  2LRN A;  3HJO A;  3O76 A;  1A8L A;  2R0P A;  2C0F A;  1XWG A;  2GZP A;  1URM A;  1ZMA A;  5A5H B;  4HQZ A;  4QL7 A;  4L5L A;  4LL4 B;  4DSS A;  4MPG A;  4DVC A;  1TJD A;  1TXX A;  4I2T A;  2K8V A;  2FGX A;  1OYJ A;  3GFK A;  4ZL8 A;  3R3E A;  1R4W A;  1XWK A;  1WIK A;  4JR6 A;  2FUG 2;  1MDK A;  3Q19 A;  3P7X A;  4ML6 A;  3HYP A;  1XBS A;  3E9J B;  2CV4 A;  1WWJ A;  1U3A A;  2A4V A;  2B7K A;  1TU7 A;  4KSM A;  2GZZ A;  4E8H A;  1J08 A;  2DMM A;  2H71 A;  1PRX A;  3RGB C;  3DWV A;  2ZCT A;  4N3Z A;  4K9Z A;  1ST9 A;  4V2L A;  2P5Q A;  4LLR A;  4TR1 B;  1EGO A;  1OC3 A;  4CY8 A;  5IPH A;  3TJF A;  2WUL A;  3ERF A;  1SD9 A;  4CW9 A;  1E2Y A;  5CAX A;  3TOT A;  2P0G A;  4IP1 A;  1A2L A;  1ZZY A;  3F4T A;  1T00 A;  1AC1 A;  3FKF A;  3DRN A;  4ZBB A;  1EV9 A;  3F0I A;  3H1N A;  1A24 A;  2WW1 A;  2IFQ B;  2L4C A;  4HS1 A;  4TN8 A;  2CVK A;  1SVO A;  3A2X A;  4K6X A;  2DJ1 A;  2N5A A;  4F03 A;  4NAX A;  2M72 A;  2HSM A;  5E59 A;  1Z7P A;  2F8A A;  1AAZ A;  4IP6 A;  2CX3 A;  1HYU A;  1MDJ A;  2BJX A;  3FRC A;  3IE3 A;  2XC2 A;  1ERT A;  3CQF A;  5D96 A;  3RPP A;  3EE2 A;  1M2D A;  3RAZ A;  3ZIV A;  4I97 A;  5H5S A;  1QXH A;  3IHG A;  1T7P B;  1WP0 A;  2B3S A;  4MJC A;  2KOK A;  3UAP A;  3LG6 A;  2I3Y A;  5GST A;  6GSY A;  3ISO A;  1NSW A;  1SK1 A;  5COH A;  2CZ2 A;  4V2N A;  5F07 A;  1SJI A;  3DEX A;  1ON4 A;  2LQO A;  3U5R E;  3PH9 A;  1O85 A;  12GS A;  3GKX A;  3QCP A;  3GUR A;  1XCC A;  3FZ4 A;  2GZY A;  4WKW A;  3H79 A;  3M9K A;  5J41 A;  2GVP A;  5E4W A;  2VIM A;  4DSQ A;  4MP4 A;  1JZO A;  3IK7 A;  2GLR A;  4O32 A;  3G9B A;  2HFD A;  2EIR A;  5G1K A;  3UJ1 A;  1KEB A;  3F6D A;  1AIU A;  4YH2 A;  2IJY A;  3P90 A;  2H72 A;  1GSY A;  4EDY A;  3APO A;  1BG1 A;  5DJM A;  2EIQ A;  1M9A A;  1H4O A;  4PI2 C;  1HNC A;  2EFC A;  5B8B A;  1JLV A;  2H01 A;  2N5F A;  5KN2 A;  2L57 A;  5J47 A;  4RUV A;  4JRR A;  2WS2 A;  3GMF A;  5IQY A;  1O7U A;  1GLQ A;  3QDN A;  4ZIJ A;  4TRX A;  4XIH A;  2DKI A;  2ON5 A;  1THX A;  5J40 A;  3C73 A;  2LEG A;  3Q74 A;  3LSZ A;  3VK9 A;  2PUK C;  4GST A;  1B4P A;  2H75 A;  1K3O A;  2WCI A;  4XS6 A;  2WB9 A;  3IV4 A;  4K7I A;  3CXG A;  9GSS A;  1UVZ A;  2YAN A;  2OAD A;  1SYR A;  4JR4 A;  2F3M A;  3ZFB A;  3UBK A;  3KMO A;  2QGV A;  2VCQ A;  3QFB C;  3F4R A;  2JAC A;  1TI3 A;  2M80 A;  2EFH A;  3KMN A;  2B1L A;  2H8L A;  1TK8 B;  1R26 A;  3CTF A;  4FH8 A;  3FY7 A;  2OE0 A;  4FYB A;  2MMN A;  3GL5 A;  1ERV A;  3KH9 A;  5ELG A;  4X0X A;  2G2Q A;  2GTU A;  1GLP A;  5KOW A;  4PUF C;  1DE2 A;  1FOV A;  5A34 A;  2RUF A;  2FA4 A;  1GTI A;  1FOH A;  2LJR A;  4FQU A;  1T3B A;  1EEJ A;  2EC4 A;  1H75 A;  3ED3 A;  4BA7 A;  2M46 A;  3LGC A;  5A5K A;  4YQU A;  4ZB6 A;  4Z7X A;  2WW2 A;  1BF5 A;  2H66 A;  2VCV A;  4HZ2 A;  4JU5 A;  4N0V A;  3BJ5 A;  11GS A;  2IIY A;  5AN1 A;  4K2X A;  4ECI A;  3LYK A;  1A2M A;  1SU9 A;  3TCO A;  4EVM A;  4N10 A;  3UBL A;  1EZK A;  1QK8 A;  2CT6 A;  4YAV A;  5CNW A;  1VF3 A;  4D73 B;  3P2A A;  1MDI A;  1UC7 A;  3TKS E;  5ECP B;  1FVK A;  3TKS A;  2H74 A;  4K7N A;  5IO2 A;  1QQ2 A;  3TOU A;  1XWA A;  1CQG A;  2X8C A;  2HYX A;  3QAV A;  1SJZ A;  2A4H A;  2R0C A;  3LYP A;  5BRT A;  1ML6 A;  4EIP A;  4NPB A;  5D8I A;  4Q5Q A;  2XPD A;  4HZ4 A;  1JZW A;  3F8U A;  3GSS A;  1RW1 A;  4FYU A;  6GSS A;  3HVV A;  1GSF A;  3A2V A;  3APQ A;  4Q5F A;  1PX7 A;  2KLX A;  2VL2 C;  5D9T A;  5FHI A;  4MNN A;  2H6Z A;  2FCH A;  2VCT A;  2DML A;  18GS A;  2EIO A;  2H30 A;  1YF0 A;  1UA5 A;  4PUR A;  1TOF A;  5KN0 A;  1GWC A;  4XRA A;  4TOP A;  3OR5 A;  3KZQ A;  1GTU A;  1MTC A;  5G5E A;  3KIJ A;  2C8U A;  1O8X A;  4MAB A;  3H4K A;  2LTK A;  3HMJ G;  4KDU A;  3TGZ A;  1O81 A;  1XW6 A;  5HR0 A;  2VD1 A;  3PPU A;  1LU4 A;  4TXV A;  5L71 A;  3HJP A;  1OE8 A;  1J0F A;  1PMT A;  4ML1 A;  4J57 E;  1W89 A;  1A0F A;  2GDR A;  1SEN A;  4OCF A;  3V1W A;  8GSS A;  2FD3 A;  1XOA A;  5J9C A;  3DYR A;  2EFE A;  1X9W B;  5DAL A;  2G0F A;  3TJK A;  2UV8 G;  4MPF A;  1Y6E A;  5LD0 A;  2CAQ A;  3GST A;  1GUH A;  3FHK A;  4FXY P;  1M7T A;  5JWO B;  4MJA A;  1XWC A;  2I9H A;  2VKZ G;  2H76 A;  1OKT A;  1FB0 A;  5JCU A;  4IHU A;  17GS A;  2X4A A;  4EC0 A;  5HFK A;  3EMP A;  4F2I A;  1T8E B;  2N5B A;  5DAK A;  5ECI B;  2WW0 A;  3GHA A;  4POL A;  2YV7 A;  4K5R A;  2XPE A;  3L9S A;  2IMK A;  1EOG A;  5IMV A;  5DDL A;  4IVF A;  3VUR A;  16GS A;  3I9V 2;  1K0N A;  2LRC A;  5A4W A;  2VUP A;  1JFU A;  2DLX A;  1K3Y A;  3UVH A;  2MMZ A;  3W8S A;  2R5G A;  4BVX B;  13GS A;  3VFI A;  2F51 A;  3FK8 A;  2OA7 A;  1F3A A;  2O87 A;  4MJE A;  5IMA A;  5BMU A;  2YWM A;  3CYN A; 
#chains in the Genus database with same CATH homology
 4EL1 A;  2HSN A;  2F8F A;  3IPZ A;  2KUC A;  5DCH A;  2J23 A;  4ZB9 A;  1J9B A;  1SKW B;  5FT3 A;  2HXK A;  3GRX A;  4G0K A;  3WT2 A;  1KBN A;  1PN9 A;  3TU3 B;  4EUY A;  3IK9 A;  5J4U A;  3NZN A;  4KCE A;  3GIX A;  4X1U A;  3ZTL A;  1PQN A;  3APS A;  4A5P A;  2VLV A;  3L0H A;  4OMV A;  1Z6N A;  3ZLP A;  3ZIJ A;  2LS5 A;  1M0U A;  3ME7 A;  1XW9 A;  1A8Y A;  2JZT A;  1GUK A;  4Z2U A;  2VO4 A;  1WPI A;  3SWL A;  3PR8 A;  4XHM A;  5AIX A;  3DKS A;  4ZXG A;  4ZL7 A;  3BD2 A;  3J7Y b;  2WFC A;  1U3I A;  4MMM A;  5IMD A;  1EOH A;  5AIV A;  1USB A;  2FA8 A;  2B5Y A;  3VI5 A;  3UMA A;  4AKX B;  1TU8 A;  1ZYE A;  4XS4 B;  4KA0 A;  3KTL A;  4CY6 A;  4NHW A;  4K7O A;  5J9B A;  3CSH A;  2GGT A;  4O5R A;  5G1L A;  4WXT A;  5C04 A;  4TKY A;  1XIY A;  5H5Q A;  3GYK A;  2V6K A;  1DBY A;  5EY6 A;  3G7J A;  1EV4 A;  5JCW A;  4ZBA A;  1ZOF A;  1X9M B;  2CAI A;  1TK0 B;  3RHB A;  2HRF A;  3CRT A;  1AQV A;  3KEB A;  6GSV A;  2H70 A;  1WJK A;  3FW2 A;  3EIN A;  3IAM 2;  4ILF A;  3ME8 A;  3IC4 A;  2GSR A;  2E2M A;  2YZU A;  4BL7 A;  1S3A A;  1B4Q A;  3DD3 A;  2HLS A;  5HQP A;  2HT9 A;  3UVT A;  4O5Q A;  2EFD A;  2D2Z A;  1OE7 A;  1B9X C;  3IAS 2;  2GSS A;  2VCW A;  3G7Y A;  4DEJ A;  1DSB A;  1PL1 A;  3GTU A;  1NW2 A;  5EL8 A;  1ZCP A;  4ECB A;  4ISD A;  2H6Y A;  4PNF A;  1A0R P;  1GSQ A;  4LA1 A;  3GA4 A;  1GP1 A;  1JHB A;  3KJY A;  2R6K A;  3U6V A;  3QAW A;  4DSS B;  4IBP A;  3MAK A;  2VCZ A;  4IQ1 A;  4HU9 A;  2AB6 A;  4OD7 A;  2LQQ A;  1VRS D;  2Z9S A;  3IC8 A;  3MDK A;  5DVB A;  2HRK A;  2PMT A;  3MWH A;  3HCZ A;  2VM2 A;  4PQH A;  3EUR A;  3SBC A;  4ZBD A;  3I69 A;  3BCK A;  2X99 A;  2WDU A;  3QR6 A;  2YNX A;  2L5O A;  3LWA A;  1OC9 A;  3F6F A;  2C0E A;  3D21 A;  5J4Y A;  2MYG A;  4I6X A;  5B8A A;  2X8G A;  4HJ2 A;  4LMV A;  3LQ7 A;  10GS A;  2HSY A;  4FYC A;  1S3D A;  1F9M A;  2ZUP A;  1XW5 A;  3E0U A;  5DJL A;  3L78 A;  3CWG A;  3LXZ A;  1K0O A;  1G7E A;  3WD6 A;  1YKC A;  2LJA A;  2ES7 A;  5ID2 A;  3DIE A;  4N0Z A;  2IMI A;  1T1V A;  3US3 A;  5ECK B;  2ON7 A;  2BTO T;  1V9W A;  1F3B A;  4F82 A;  5D9W A;  5HFI A;  4W66 A;  4GWR A;  4HI7 A;  6GSW A;  4K5S A;  1HD2 A;  2H19 A;  1PX6 A;  4V1A g;  2K8S A;  5D9X A;  1X5E A;  4HEA 2;  3TKP A;  4PTS A;  3NOF A;  4TXO A;  4EXJ A;  2HSM B;  4KGI A;  1EEM A;  3IR4 A;  4EE0 A;  1LJR A;  1SL0 B;  2HZE A;  1WRY A;  2KHP A;  1X5C A;  4ECC A;  4BVY A;  1TW9 A;  4XS1 A;  1XVQ A;  2R4V A;  1G7O A;  4AGS A;  2FWF A;  4MF6 A;  4NHZ A;  4G2E A;  2R2J A;  1ZYQ B;  3ZFL A;  1ILO A;  2RUE A;  1R5A A;  1SK0 A;  2F9S A;  1N2A A;  4MZC A;  2J9H A;  1I5G A;  1IYI A;  3LW9 A;  1TP9 A;  3N9J A;  2UZ8 A;  2V32 A;  4F9Z A;  4MJB A;  1THO A;  4ZL9 A;  3WYW A;  2A2P A;  1VF4 A;  2FWE A;  2C4J A;  5H5R A;  4YKG A;  2OE1 A;  4HDE A;  3EYT A;  4AJ8 A;  1V58 A;  1XWB A;  1Q4J A;  3HJM A;  2X49 A;  4AI6 A;  1YEP A;  1YZX A;  1OC8 A;  1X0R A;  2R0G A;  5B6N A;  4RQX A;  4BPY A;  3M3M A;  4EF0 A;  3CSI A;  5CYY A;  3HY2 A;  1SD8 A;  4JE1 A;  2NPB A;  2LRT A;  1ZL9 A;  2GSQ A;  4MF5 A;  1ZYP A;  5CRD A;  2IN3 A;  4MLY A;  2K6V A;  1SVM A;  2DJK A;  5B6M A;  5LNK e;  1GUL A;  5ABR A;  3FYG A;  1G6Y A;  2I81 A;  1X9S B;  3VPQ A;  4GDF A;  2L4Q A;  4KDX A;  5JWR B;  4PXO A;  1R7H A;  4F0B A;  2O7K A;  1KTE A;  4OWY A;  3BCI A;  2GS3 A;  3EVI A;  3QFA C;  4MZB A;  3DXB A;  4L0W A;  1G0T A;  2QA1 A;  4CHS A;  2X64 A;  2X8H A;  2OE3 A;  4YQM A;  4IS0 A;  2VL9 A;  5IMF A;  5A1N A;  1B9Y C;  4BWS A;  4KSO A;  2ZNM A;  3C7M A;  3DML A;  5IOX A;  4EDZ A;  2OJL A;  2QKE A;  1TRV A;  4TVE A;  4GQC A;  5G31 A;  4KF9 A;  2H0G A;  1U88 A;  4EO3 A;  1T4Y A;  4CDO A;  2DJ0 A;  3IBH A;  1NHY A;  2WGR A;  1V57 A;  3FR3 A;  5D9V A;  4KX4 A;  3BBY A;  3QOU A;  5B7C A;  4QL9 A;  2YCD A;  1WMJ A;  1EP7 A;  1ZGN A;  3TKS C;  1B8X A;  2H1L A;  4XCS A;  2QSI A;  3O3T A;  3HD5 A;  4WF4 A;  1K0M A;  3FEU A;  2GT6 A;  1VF1 A;  3ZL5 A;  5GZZ B;  1SL2 B;  1O6J A;  4L0U A;  3DVX A;  3TRX A;  5AIS A;  4RI6 A;  3ERG A;  2KP2 A;  1BED A;  3RPN A;  5A34 B;  4QMK A;  2MMO A;  2PVO C;  2PU9 C;  5HR3 A;  1ACV A;  1AXD A;  3D6I A;  2DJ2 A;  3KTB A;  3KGK A;  2LJK A;  3GKK A;  3IXR A;  2JAD A;  4P3Y B;  1O73 A;  1GSS A;  3S9F A;  3IOS A;  4F0C A;  2B5X A;  2YN1 A;  2YJ7 A;  5KEJ A;  1MD3 A;  3DGQ A;  3QD9 A;  4K1F A;  3GH6 A;  3UIW A;  4PX1 A;  2VLU A;  5J4V A;  1GSD A;  5G5F A;  1AW9 A;  3C8E A;  3D22 A;  5HR1 A;  1IYH A;  2BMX A;  1VGL A;  4WR5 A;  2FWG A;  5ECL B;  5ECN B;  20GS A;  2FWH A;  3TB2 A;  4OO4 A;  3O6T A;  1BG5 A;  3GX8 A;  3FZ9 A;  4NV2 A;  4YQV A;  2K18 A;  1SKR B;  4YAP A;  2I4A A;  1Y25 A;  2PPT A;  3TJJ A;  2C0G A;  1A23 A;  5ECS A;  3ZML A;  4HQS A;  5A5H A;  5IOW A;  1AQX A;  4IW9 A;  3W6G A;  2HRA A;  4KE3 A;  2V41 A;  1V2A A;  3A5W A;  2DKH A;  1K0B A;  2L6C A;  1EP8 A;  3TJG A;  4J56 E;  4IN0 A;  1ABA A;  4E68 A;  3BOA A;  5FWG A;  3A3T A;  4MA9 A;  2AJQ B;  2IPA A;  5KN3 A;  1OVN A;  2H6X A;  4ZB7 A;  3KXO A;  3TRQ A;  4KAE A;  2LKU A;  2DIY A;  3GL3 A;  4TR1 A;  1V98 A;  2TRC P;  1TKD B;  5A4U A;  1TI1 A;  1BJX A;  2B1K A;  2YP6 A;  4JED A;  3F3R A;  4IEL A;  4KH7 A;  4Z2T A;  3C1S A;  3EPT A;  1QFN A;  3Q18 A;  4N11 A;  4NMU A;  4GLT A;  5ENU A;  2A2S A;  4TR0 A;  3IHQ A;  4PGT A;  1FW1 A;  3F9U A;  1NHO A;  3UL3 A;  5DAL B;  2OBI A;  1TDI A;  2PWJ A;  2XBI A;  4EKZ A;  4MK3 A;  4IJ3 A;  1F37 A;  4G9H A;  2IFQ A;  2C3N A;  3MNG A;  2YWN A;  2OKA A;  1SKS B;  2P5R A;  2C0D A;  1T4Z A;  1XOB A;  2QA2 A;  2YPM A;  1Y1U A;  4G0L A;  5ECQ B;  2RM5 A;  3A2W A;  5DAK B;  4Z2R A;  2IL3 A;  4O92 A;  1GNE A;  2YJH A;  2PN8 A;  4YKF A;  2R37 A;  1OAZ A;  1I9D A;  1PGT A;  3CBU A;  1YEX A;  4GRF A;  5F8B A;  3WT1 A;  5JCG A;  3VWV A;  4WBR D;  2V2G A;  3Q6O A;  1YJ6 A;  3TDG A;  1XZO A;  2GQL A;  2MMA A;  2WRT A;  3ZMK A;  2C1Y A;  3EWL A;  3G7I A;  1NM3 A;  3GH9 A;  1YKA A;  3TUE A;  3CMI A;  2GQK A;  4H86 A;  3WGX A;  1Q98 A;  5BMU B;  2JSY A;  2HSN B;  1GSU A;  1BAY A;  1PD2 1;  2FNO A;  1K0D A;  2HSH A;  3TKQ A;  3EMX A;  2FLS A;  2REM A;  2CZ3 A;  1TRW A;  3HZ8 A;  5GSS A;  3I43 A;  3MYD A;  1PSQ A;  1K3L A;  4WBJ A;  1GTA A;  6GSX A;  1YQ1 A;  2MBT A;  1AUC A;  3FZ5 A;  3IRA A;  4K0N A;  3W8J A;  4QQ7 A;  1Z6M A;  4KCA A;  3ZIT A;  2DBC A;  2FY6 A;  4PNG A;  2C3Q A;  3ZVJ A;  4N30 A;  2C3T A;  3E3E A;  1W4V A;  2PVQ A;  2K9F A;  3GUS A;  1G6W A;  5F0G A;  3GX0 A;  2VCX A;  3K8N A;  1B48 A;  1M9B A;  5IPG A;  2VL3 A;  1XVW A;  1EGR A;  4WR4 A;  4NV5 A;  4AKI A;  2NBS A;  2CX4 A;  5ECM B;  2FHE A;  1TXU A;  2GST A;  2PER A;  3KD0 A;  2WJU A;  2ALB A;  1M99 A;  4NWY A;  2H73 A;  3C71 A;  3TKR A;  3DVW A;  2MBS A;  3ZRE A;  4J2F A;  1SK2 A;  3H8Q A;  2O85 A;  3GV1 A;  3IDV A;  4PQ1 A;  1SYX A;  1BYE A;  4GCI A;  4X43 A;  4ZB8 A;  3KP8 A;  1BQ7 A;  1WOU A;  2VD0 A;  5EVO A;  2E0Q A;  1X5D A;  1PL2 A;  4FIW A;  4BL7 B;  4FO5 A;  2C80 A;  4BWQ A;  2YWI A;  4K0G A;  3IA1 A;  3VWX A;  4MH3 A;  4WEY A;  1FAA A;  2VLT A;  1E6B A;  2IME A;  3GTU B;  3N5O A;  1QGV A;  1FHE A;  2TIR A;  4DSR A;  3D4T A;  2H0H A;  5IO0 A;  1PA3 A;  3R2Q A;  1SVL A;  3J7Y k;  4JBB A;  4Q5R A;  1XXU A;  2YWO A;  2L6D A;  2HE3 A;  5HR2 A;  4TR3 A;  7GSS A;  3ZZX A;  4ULX A;  4O5U A;  3HVX A;  5CRG A;  3LEF A;  4OCE A;  3VLN A;  5CP1 A;  2IWT A;  5IMZ A;  3HZ4 A;  5F05 A;  2HRK B;  5F06 A;  2HI7 A;  1ERU A;  5ECO B;  2O5V A;  4D73 A;  4ICY A;  1YY7 A;  3MIX A;  3CRU A;  1K0C A;  1OKD A;  2R3X A;  2H1D A;  2YZH A;  3KH7 A;  3FMW A;  3NIV A;  1DUG A;  4NXI A;  1OC9 B;  4G19 A;  2DIZ A;  3F3Q A;  4GTU A;  3EC3 A;  5HFG A;  3RDW A;  4AJ6 A;  2B7J A;  5DBQ A;  1VF2 A;  1Z3E A;  1SL1 B;  2I1U A;  4G01 A;  4PUA A;  3LXT A;  5AGY A;  2HRN A;  3KP9 A;  5JWQ B;  5KOX A;  2HZF A;  4KDY A;  3VI7 A;  1EWX A;  5ID2 B;  2H0I A;  4IKH A;  4PQI A;  5DCG A;  1M2A A;  3PGT A;  2OAC A;  5IMC A;  2JZS A;  5KN1 A;  2DC5 A;  1GRX A;  1U87 A;  2LST A;  1Z7R A;  3L9U A;  3MSZ A;  2JSZ A;  2DSA A;  4I8B A;  1S3C A;  14GS A;  1HNB A;  2JL4 A;  5ECH B;  3UOM A;  4KND A;  4V1A p;  3D5J A;  4TXO B;  6GST A;  4I2U A;  3QPM A;  1MD4 A;  3ZYW A;  5ECR B;  4WF5 A;  2DJ3 A;  2IMF A;  1GH2 A;  3TRP A;  2HZE B;  4XTS A;  1Z9H A;  1YF1 A;  1A2J A;  2CQ9 A;  19GS A;  4KUN A;  2CA8 A;  4LMW A;  3TJB A;  5INY A;  1QUW A;  4GQF A;  1R5P A;  2YOI A;  3LOR A;  2HQT A;  4L5O A;  4BVY B;  2V1M A;  4XRD A;  4ECJ A;  3KCM A;  1RQM A;  4AJ7 A;  3M9J A;  1GL8 A;  4K8M A;  1TRS A;  2B5E A;  3GKM A;  1PKZ A;  2L5L A;  3CTG A;  4AKH A;  4G0I A;  4O7H A;  4MH2 A;  2JU5 A;  4G10 A;  2O8V B;  4ID0 A;  5EPF A;  4OFT A;  3JCM L;  4WET A;  3PIN A;  5CRH A;  2NTO A;  1ZYN A;  6GSU A;  3QMX A;  5CO3 A;  4JZQ A;  4HJM A;  3F63 A;  3KM6 A;  4Q5N A;  2NVL A;  2VL2 A;  5ELA A;  2VOC A;  1GTB A;  3AY8 A;  3WGD A;  2AUV A;  4MZW A;  4TW5 A;  1C72 A;  3ERW A;  3VWW A;  5IIZ A;  1WE0 A;  1GNW A;  2KP1 A;  4E8E A;  2OBK A;  1N25 A;  3VPT A;  2H1B A;  1N8J A;  2LNT A;  4POB A;  3EU4 A;  5C00 A;  2MZC A;  1UN2 A;  2WZ9 A;  4ACS A;  5IM9 A;  2RII A;  4USS A;  2E2G A;  5G2Z A;  5LCZ A;  3HDC A;  3ZVJ D;  3GN3 A;  4KB3 A;  2PBJ A;  4X4J A;  4GXZ A;  5DQY A;  1O8W A;  5GAP D;  3FR9 A;  1F6M C;  2L59 A;  4V2M A;  1TTZ A;  3HXS A;  2O89 A;  4GF0 A;  1MEK A;  2E7P A;  1RK4 A;  4IJI A;  4BVX A;  2PGT A;  4GSN A;  2AYT A;  3HVS A;  3M1G A;  2JZR A;  4EIQ A;  2GT5 A;  3H93 A;  1M2B A;  2RM6 A;  5CRW A;  3M8N A;  1JLW A;  3GKN A;  3ZRD A;  1PKW A;  4MCU A;  2AAW A;  2B6M A;  5CRE A;  2V6O A;  3LFL A;  2QC7 A;  5GAN D;  2LUS A;  1GUM A;  3F4S A;  5A1N B;  2VM1 A;  5DQS A;  1TK5 B;  3FR6 A;  1QMV A;  3I6A A;  4HOJ A;  4IGJ A;  1LBK A;  2AV4 A;  4POK A;  3UAR A;  1SJ6 A;  1U6T A;  1ERW A;  1F2E A;  3UEM A;  3L4N A;  3RBT A;  3EU3 A;  4MF7 A;  2XHF A;  1CQH A;  4K2D A;  1V40 A;  3HKR A;  4OFM A;  1FB6 A;  2AHE A;  4MDC A;  2XBQ A;  4AKG A;  1BX9 A;  1FO5 A;  2LV3 A;  1HNA A;  2HNL A;  3VWU A;  3FZA A;  3C1R A;  3A5I A;  4XS4 A;  3D0Z A;  1XFL A;  5J3R A;  4I5Q A;  1TRU A;  1K0A A;  5G30 A;  4HU7 A;  1GSE A;  5J5N A;  1DE1 A;  4L8E A;  5D73 A;  1HQO A;  2NDO A;  2P31 A;  2RLI A;  22GS A;  4GSS A;  2TRX A;  1FG4 A;  4ZIL A;  4POM A;  4RI7 A;  4OO5 A;  4RQR A;  2GQM A;  1FVJ A;  4HUA A;  3M0F A;  1XPV A;  3D4M A;  2A2R A;  1PN0 A;  4OFN A;  1JZR A;  1YVL A;  3L9V A;  3QAG A;  3WGE A;  3GNJ A;  1Z5Y E;  2DJJ A;  4TR4 A;  2VAF A;  2LNS A;  5D93 A;  1AQW A;  1KNG A;  5A4V A;  4AF2 A;  1YDK A;  3RHC A;  2OT3 A;  1JZD A;  4KW6 A;  3CSJ A;  4LL1 B;  3P8W A;  3LJR A;  2YV9 A;  2H1A A;  2H1G A;  2IMD A;  3HHV A;  4IQA A;  2CVD A;  3HA9 A;  2CVB A;  2LRN A;  3HJO A;  3O76 A;  1A8L A;  2R0P A;  2C0F A;  1XWG A;  2GZP A;  1URM A;  1ZMA A;  5A5H B;  4HQZ A;  4QL7 A;  4L5L A;  4LL4 B;  4DSS A;  4MPG A;  4DVC A;  1TJD A;  1TXX A;  4I2T A;  2K8V A;  2FGX A;  1OYJ A;  3GFK A;  4ZL8 A;  3R3E A;  1R4W A;  1XWK A;  1WIK A;  4JR6 A;  2FUG 2;  1MDK A;  3Q19 A;  3P7X A;  4ML6 A;  3HYP A;  1XBS A;  3E9J B;  2CV4 A;  1WWJ A;  1U3A A;  2A4V A;  2B7K A;  1TU7 A;  4KSM A;  2GZZ A;  4E8H A;  1J08 A;  2DMM A;  2H71 A;  1PRX A;  3DWV A;  2ZCT A;  4N3Z A;  4K9Z A;  1ST9 A;  4V2L A;  2P5Q A;  4LLR A;  4TR1 B;  1EGO A;  1OC3 A;  4CY8 A;  5IPH A;  3TJF A;  2WUL A;  3ERF A;  1SD9 A;  4CW9 A;  1E2Y A;  5CAX A;  3TOT A;  2P0G A;  4IP1 A;  1A2L A;  1ZZY A;  3F4T A;  1T00 A;  1AC1 A;  3FKF A;  3DRN A;  4ZBB A;  1EV9 A;  3F0I A;  3H1N A;  1A24 A;  2IFQ B;  2L4C A;  4HS1 A;  4TN8 A;  2CVK A;  1SVO A;  3A2X A;  4K6X A;  2DJ1 A;  2N5A A;  4F03 A;  4NAX A;  2M72 A;  2HSM A;  5E59 A;  1Z7P A;  2F8A A;  1AAZ A;  4IP6 A;  2CX3 A;  1HYU A;  1MDJ A;  2BJX A;  3FRC A;  3IE3 A;  2XC2 A;  1ERT A;  5D96 A;  3RPP A;  3EE2 A;  1M2D A;  3RAZ A;  3ZIV A;  4I97 A;  5H5S A;  1QXH A;  3IHG A;  1T7P B;  1WP0 A;  2B3S A;  4MJC A;  2KOK A;  3UAP A;  3LG6 A;  2I3Y A;  5GST A;  6GSY A;  3ISO A;  1NSW A;  1SK1 A;  5COH A;  2CZ2 A;  4V2N A;  5F07 A;  1SJI A;  3DEX A;  1ON4 A;  2LQO A;  3U5R E;  3PH9 A;  1O85 A;  12GS A;  3GKX A;  3QCP A;  3GUR A;  1XCC A;  3FZ4 A;  2GZY A;  4WKW A;  3H79 A;  3M9K A;  5J41 A;  2GVP A;  5E4W A;  2VIM A;  4DSQ A;  4MP4 A;  1JZO A;  3IK7 A;  2GLR A;  4O32 A;  3G9B A;  2HFD A;  2EIR A;  5G1K A;  3UJ1 A;  1KEB A;  3F6D A;  1AIU A;  4YH2 A;  2IJY A;  3P90 A;  2H72 A;  1GSY A;  4EDY A;  3APO A;  1BG1 A;  5DJM A;  2EIQ A;  1M9A A;  1H4O A;  1HNC A;  2EFC A;  5B8B A;  1JLV A;  2H01 A;  2N5F A;  5KN2 A;  2L57 A;  5J47 A;  4RUV A;  4JRR A;  2WS2 A;  3GMF A;  5IQY A;  1O7U A;  1GLQ A;  3QDN A;  4ZIJ A;  4TRX A;  4XIH A;  2DKI A;  2ON5 A;  1THX A;  5J40 A;  3C73 A;  2LEG A;  3Q74 A;  3LSZ A;  3VK9 A;  2PUK C;  4GST A;  1B4P A;  2H75 A;  1K3O A;  2WCI A;  4XS6 A;  2WB9 A;  3IV4 A;  4K7I A;  3CXG A;  9GSS A;  1UVZ A;  2YAN A;  2OAD A;  1SYR A;  4JR4 A;  2F3M A;  3ZFB A;  3UBK A;  3KMO A;  2QGV A;  2VCQ A;  3QFB C;  3F4R A;  2JAC A;  1TI3 A;  2M80 A;  2EFH A;  3KMN A;  2B1L A;  2H8L A;  1TK8 B;  1R26 A;  3CTF A;  4FH8 A;  3FY7 A;  2OE0 A;  4FYB A;  2MMN A;  3GL5 A;  1ERV A;  3KH9 A;  5ELG A;  4X0X A;  2G2Q A;  2GTU A;  1GLP A;  5KOW A;  4PUF C;  1DE2 A;  1FOV A;  5A34 A;  2RUF A;  2FA4 A;  1GTI A;  1FOH A;  2LJR A;  4FQU A;  1T3B A;  1EEJ A;  2EC4 A;  1H75 A;  3ED3 A;  4BA7 A;  2M46 A;  3LGC A;  5A5K A;  4YQU A;  4ZB6 A;  4Z7X A;  1BF5 A;  2H66 A;  2VCV A;  4HZ2 A;  4JU5 A;  4N0V A;  3BJ5 A;  11GS A;  2IIY A;  5AN1 A;  4K2X A;  4ECI A;  3LYK A;  1A2M A;  1SU9 A;  3TCO A;  4EVM A;  4N10 A;  3UBL A;  1EZK A;  1QK8 A;  2CT6 A;  4YAV A;  5CNW A;  1VF3 A;  4D73 B;  3P2A A;  1MDI A;  1UC7 A;  3TKS E;  5ECP B;  1FVK A;  3TKS A;  2H74 A;  4K7N A;  5IO2 A;  1QQ2 A;  3TOU A;  1XWA A;  1CQG A;  2X8C A;  2HYX A;  3QAV A;  1SJZ A;  2A4H A;  2R0C A;  3LYP A;  5BRT A;  1ML6 A;  4EIP A;  4NPB A;  5D8I A;  4Q5Q A;  2XPD A;  4HZ4 A;  1JZW A;  3F8U A;  3GSS A;  1RW1 A;  4FYU A;  6GSS A;  3HVV A;  1GSF A;  3A2V A;  3APQ A;  4Q5F A;  1PX7 A;  2KLX A;  2VL2 C;  5D9T A;  5FHI A;  4MNN A;  2H6Z A;  2FCH A;  2VCT A;  2DML A;  18GS A;  2EIO A;  2H30 A;  1YF0 A;  1UA5 A;  4PUR A;  1TOF A;  5KN0 A;  1GWC A;  4XRA A;  4TOP A;  3OR5 A;  3KZQ A;  1GTU A;  1MTC A;  5G5E A;  3KIJ A;  2C8U A;  1O8X A;  4MAB A;  3H4K A;  2LTK A;  3HMJ G;  4KDU A;  3TGZ A;  1O81 A;  1XW6 A;  5HR0 A;  2VD1 A;  3PPU A;  1LU4 A;  4TXV A;  5L71 A;  3HJP A;  1OE8 A;  1J0F A;  1PMT A;  4ML1 A;  4J57 E;  1W89 A;  1A0F A;  2GDR A;  1SEN A;  4OCF A;  3V1W A;  8GSS A;  2FD3 A;  1XOA A;  5J9C A;  3DYR A;  2EFE A;  1X9W B;  5DAL A;  2G0F A;  3TJK A;  2UV8 G;  4MPF A;  1Y6E A;  5LD0 A;  2CAQ A;  3GST A;  1GUH A;  3FHK A;  1M7T A;  5JWO B;  4MJA A;  1XWC A;  2I9H A;  2VKZ G;  2H76 A;  1OKT A;  1FB0 A;  5JCU A;  4IHU A;  17GS A;  2X4A A;  4EC0 A;  5HFK A;  3EMP A;  4F2I A;  1T8E B;  2N5B A;  5DAK A;  5ECI B;  3GHA A;  4POL A;  2YV7 A;  4K5R A;  2XPE A;  3L9S A;  2IMK A;  1EOG A;  5IMV A;  5DDL A;  4IVF A;  3VUR A;  16GS A;  3I9V 2;  1K0N A;  2LRC A;  5A4W A;  2VUP A;  1JFU A;  2DLX A;  1K3Y A;  3UVH A;  2MMZ A;  3W8S A;  2R5G A;  4BVX B;  13GS A;  3VFI A;  2F51 A;  3FK8 A;  2OA7 A;  1F3A A;  2O87 A;  4MJE A;  5IMA A;  5BMU A;  2YWM A;  3CYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...