1U8KB

Crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 in complex with gp41 peptide leldkwasl
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
234
structure length
228
Chain Sequence
b'RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPCSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVEPKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the HIV-1 Cross Neutralizing Monoclonal Antibody 2F5 in complex with gp41 Peptides and Peptide Mimetics
rcsb
molecule keywords ANTIBODY 2F5 (LIGHT CHAIN)
molecule tags Immune system
total genus 41
structure length 228
sequence length 234
ec nomenclature
pdb deposition date 2004-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u8kB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u8kB01
4BELD 3DROA 2R2CA 2BC4B 5I1AB 3AMKA 4LEOB 3SKJH 1V3LA 5EUOB 5B3JE 3MRRB 3U1SL 1BD2B 1KGCD 1Y0LA 4NQVB 3PUCA 3FHAA 4Z8FH 4M4PA 5HHQA 4FQJL 1VCAA 5K93A 4O2EB 1NGXB 3MCKB 1FIGH 3W5NA 3P30H 2Q76B 5L2KE 5CP7A 4XX1E 1MFDL 2SEBA 1S78C 5DD5H 3FQXA 1KB5B 3AU1A 1NMBH 4WIQA 3V5KA 5I1DB 1CCZA 3ARRA 4DFIA 4NHUB 1D9KC 4JZNA 4E0RB 3OKKA 2JKXA 3E2HC 2CR3A 4X4MA 4X6CE 3VXPB 4GW1A 4HDIA 2IANA 5D5MA 5EU7C 2DQEH 4HXBH 4L8DA 1DP0A 1YJDC 3T0EE 5A16A 3DVNB 4ZAKB 1R24B 3KVQA 4XPGL 4NQUA 4YFDB 5GIRA 1QLFA 1LE9B 5J4MA 4F7CA 2H1PL 1ZMYA 5D8JH 5F6HJ 1DL7H 5IFHL 1FP5A 3FTGB 2MSPA 4AEHL 4NQXA 1VB9A 1MJUH 3C5ZC 3O11A 3O2VL 4P23B 1YQVL 4AG4L 3DHMA 4FXKA 4HS3A 3V0WL 5CKAA 3RI5F 5H35A 3CDGB 5EFIA 4K8RL 4N8PA 4LSTH 1FGVH 2B2XH 3AREC 4QT5B 2VYRE 3SDDC 1CFNB 4NWUH 4PBVC 3RZCB 1I3RB 2HJKA 4XNZC 5D7JC 1XH3B 5EO9B 2GAZB 3BKMH 3QDHA 2IBZY 3X11B 5HGHA 4WW2C 3Q0HA 2ZJSH 3Q48A 1EMTH 4P3CL 3K2MC 3C09C 4CVXB 1T1YB 4Z7WF 2KQNA 3MACL 5ISZA 1OTSC 1KEGH 3OGCB 1Q94A 4K8RD 3GIVA 1OB1A 3QPXH 1H3TA 2GSGA 3M8OH 1QYGH 4WENB 4KK6C 4RDQF 3DETD 3LMJL 4PLJD 5BS0B 3QNZA 1SYSB 3RGVC 3VMPA 1F02I 3DYOA 2DQDH 5C07D 2GW5A 4KKAC 2ORBL 4PGJA 2IEPA 1SJEB 4OZ4A 1CWVA 1V3MA 5IBLD 4UNUA 5KS9F 3H3BC 5I2IB 3ESUF 4MJIE 2B1AL 3RHWF 4G43B 4TNVK 2NY3B 2CK0H 3MSPA 5B3NA 4S1QL 2BNQD 3T2QA 2ADFH 3PP4L 4N0YL 4UAOB 1KTRL 5GGUB 1XGQB 3NPSB 2R4SL 2F53A 3NMEA 3BKJH 2NY7H 3CPLA 3TC9A 1IGCL 5FM5O 1IL1A 5D2NB 4GW5A 3X14B 3GSQA 2AK4B 1NKRA 3BPNB 5IMOB 4OZIB 4WO4A 5T1LD 4H8WH 4QRTB 4OFKA 2FBOJ 1QRNB 4G9FD 4OGXL 1UWGH 2BOBA 4PY7A 5FO7B 3CDFA 3BXNA 3MRJA 3SDYL 2XZAH 5IHLB 3B83A 4L9LB 2R69H 4GMSH 4YHML 5E6IA 4Z5RB 5CZKA 5E1AA 2LU7A 1JGEB 1F6AB 3BD4A 4NKMA 1MCSA 1MHPH 1A1NB 1JZ3A 5I1HL 3JTTB 1U8LB 4O02H 1JTTA 1BM3H 4NBZB 3AFLA 3C87A 1O7SA 3QSKB 2X41A 4YHOH 4N5EC 4ZFFA 5T5FH 2XN9B 4D0DA 3QFJD 2PYFA 3B3IA 2O5XL 1Q9LB 1DQQA 4KRMB 2B4CL 2GTWA 3AB0B 3O8XA 4KDTC 4HH9A 5JPNB 4JPIA 4UDTB 1TETL 1IFHH 4ZAKC 3FQRB 4CUCA 2OJZL 3K4ZA 5F7LB 1PW3A 1JNJA 1A3QA 3S34L 5DDHB 3LV3A 3IDYC 1FNSH 4TSCL 4KI5E 2V7HB 2G2RA 1JN6A 1FC1A 3QIUC 4NQCE 4QHNA 4JY6A 2DL2A 1UADC 5GGQL 1G7PA 2DIAA 3NFSL 3ARGD 4J3WA 1OAYH 3QWRA 3LB6C 3CDCA 3NCJH 4P9MH 4Y1AE 2PTTB 4P57B 3KYNB 5GHWH 1CL7I 3NTCL 3O6KH 4I77L 4LPWA 3ESVF 4BQCA 3FFCA 3ZKQD 4XT1C 5DVLA 3EYFA 5IMKA 1NH6A 1D6VH 4QRPB 1LEIA 4OCSL 4LCWD 1JHTA 2W07A 2OZ4H 5E8NA 1DQDH 3V4PH 4WI6A 5F3HA 1ZVSA 4XC1H 1EA9C 3EOTH 2B7DT 5JO5B 5I73B 1QKZL 4EUPA 2P49B 2EECA 2IADB 3VWKD 4W68A 5EU5B 4ELMA 2UZYB 3WKML 2VB5A 1EHLL 4GMTH 4Y8AA 3UXFA 2WBWB 3U82B 1X5FA 1XR9A 3MCLL 5A3ID 4HUWB 4PJXA 4F33A 4P4KB 3RNQB 4JN1H 3SDAD 1FZKA 2GCYA 4W70A 5I71B 3RVUD 4UAOC 2V7NA 3NPSC 2VXTH 5JIIA 3GMLB 3NBNA 3ULUC 4LPXA 5C0AD 1MHHA 1HXMB 4XVSL 3HI1B 3MOAH 4O51B 2H45A 4CJ1A 4YHZL 5C6TH 1I8MB 4NNXB 1AY1H 5JHDD 3D2UD 2NY4C 4W4OA 5ESQB 4KV5F 2XIDA 4M9OA 1MCRA 3CU1A 4D0BB 2OXGA 2J1KA 1EUTA 2XNAB 1BECA 3HE6A 1U8PA 2GTZA 5DLML 3WO4B 3QA3A 1CFSA 1G1YA 3CVHH 1QR1A 4WEMB 1NEZG 3LRSA 4A6YH 4NQSA 3O3DB 2JTDA 1YNLH 1PG7H 5DJCB 5FCSH 1LO5B 4L9DA 1ORQA 5IJKA 2V2XA 4JHZA 1UJ3A 1A9EB 1WGOA 4OD2B 5DJXA 3KPRD 1R3HB 2WBJD 3T3MF 4W6YB 4JFQB 5AZEH 3KYMB 3AB0C 3IDGA 3G5YA 1XZ0B 3EYUL 5KSAB 4HKBA 4WWKA 2Y5TA 1Q9KB 3QH3A 1WZ1H 2H2SD 4UB0H 3FL7A 1UGNA 4HKZA 5T1KA 3TNNA 1J5OH 3HG1D 2HFFA 4R8WH 3FRUB 2DQGL 1H8OA 4JRWA 4NQEB 5J8OA 5DO2C 4GO6B 3LN9A 1FVCB 4R2GB 4WTZA 2CRYA 1KG0A 3SDXF 3VI4E 4U1MA 2YBRB 2GQHA 3BKYL 3TIEA 3CSGA 4LLQA 4HS6A 2CLRA 3MLXL 1K4DA 5HYFA 4OQTH 2CXGA 2OK0L 3VXNA 2VNCA 2HVJA 2IQ9H 3PNWA 3GFUA 1T0MA 1TZGL 4TSBH 3CFEB 4UV7H 3I2CH 1H3PH 4GRLD 5E6YA 4IRJB 3DTXA 4WHTB 3WHXA 1MY7A 2EDWA 5DK0B 5HHNB 4ZNEE 4YDIL 5I73C 3GSVA 1XT5A 2DJSA 2ZOKA 3QUXD 4OCYL 4UT9L 1JMZA 4M5ZH 1RZGB 2AEIT 3GB7A 3SGEI 1A1OA 3HMXH 4JQXC 3V0VA 2RIKA 1G6RL 1OSZB 4KQ4H 1KLGB 3RIFF 1BX2B 1HEZB 4ODTL 1RFDH 4QGTA 4MAUH 3QEQE 4Y19D 5F70A 1ONQA 4MVBD 5L8KB 3QIBA 1LQSR 1N64L 1F8TH 4N1CA 3B6SA 3RVVC 4JDVA 5IVNA 5C0JB 2VRAA 5I71C 1W72L 1S7XA 3FO2B 4J12A 2D7OA 1L0QA 5C0BA 4IDLA 1Z0NA 4PD4J 3MA7A 4Y4KA 4HKXB 4X80H 5L88L 1T5XA 1VADB 3EOAA 5IEKB 3REWB 1T7VA 3MLUL 3MLYH 3HNSH 2JK5A 1A02N 3OBAA 2WIIB 3MRDB 5IOPB 4U0RB 3MRKA 3O6LH 2YD4A 5J3HD 4KK8C 5F7FA 2PR4H 3WO4C 3VU2A 2F58L 3TBWA 1M6OA 3HZKB 3DI3B 3LIZH 3PGDB 5DQDL 4H0IA 3MOBH 1NC4D 1TQBB 2FO4B 3ZKXC 3QUZD 2LV4A 1XF5B 3GRWL 1OHQA 1XF2A 3MBED 2BCKA 2X09A 5GRUH 2XTJD 3UROR 4KVNH 4OIIH 3GMQA 3L7EB 3GSWB 3JVGC 1ITCA 3OKNA 2J8UA 4XWOD 4OLUH 3HTLX 2HH0H 2VR5A 4X6BA 5L2JB 3EKCA 4J3UA 4BFGA 3ARVA 3MGAA 3HI6H 4P5TD 1AD0B 1SYVB 5ESVA 5EU7E 1MCKA 1I8IB 2COQA 1DEDA 3VXRE 5GZOD 1L4IA 5LXGL 2KZ1B 1GGTA 4UOW0 5IROA 2R1YA 3K8KA 4FFYH 3TO4B 5LQBL 5EBMA 5ICXB 4R2GC 5FA4B 3NCEB 5E8EA 2XKNB 3H9HA 4I1NB 5FYLE 2BRQA 4WFFE 1KJ2B 4FQIH 4W6WB 5IQ9B 5E6ID 4BA8A 4ZFZB 2X4RA 3WV0A 1T4KA 1Z5LA 5C2BH 2C1OB 2Y25A 5FGCE 4L4VB 2QADB 4OV5A 1FVDA 1TCRA 1CG9B 2VIRB 1MFAL 3C5JA 4E5XB 4R4ND 3QCUL 5SWSA 1BAFH 5EC2B 3AXLB 4J3TA 3KPPA 2EXYD 3SOBH 2R1WB 1JVKA 1I9JL 3QG6B 1AGDB 1EEYA 4MA1B 3TN0A 4DK3A 5JOFA 1JYWA 1TPXC 4Z7UF 2O5ZL 3OWEA 1CFQB 4QHMB 2X6MA 4XP5H 4HIXL 4JPKL 3MRPA 4JFZH 1CIUA 4J3OC 3W2DH 5GGTL 3OHXA 4GKNA 2JJWA 4P2QA 4G6JH 2GJ6E 4KK5D 1HH9A 3SE4C 1LK3H 3BSZH 2XFXB 4HFWA 1EFXD 5F8QC 4JKMA 3BPOB 3GMOA 2HVKB 5EZIL 4NZDA 5CINH 3QG7L 5FGRA 4E42A 1TZIB 5JR1H 1ORSB 4QTIH 4Y5VB 2AXFA 3H9ZA 5IMMA 1RV6X 5CLWA 5FB8A 3MNZB 4UIMB 3S5LG 5IB4B 2C5DC 3SO3C 4HMEA 1K6QL 4IOFD 4KY1L 1I85A 5B39B 1Z3GL 3FT3B 2CJUH 4HUVB 2PO6B 1T6WA 4HQQH 4GBXD 3W9EA 3GIZH 3OR6A 4JN2A 4U0RC 3L7FB 4KFZC 2WP3O 4LKXB 3FHQA 4LVNC 4W6XB 3VWKB 5D6DA 2AV7B 5E94A 1RURL 5E7BA 3EYQD 1BREA 3DETC 2PCPA 2ZKHH 4PLJC 5I15H 4Q7DA 1E4KA 1OARH 4I18A 1T80A 5CAYB 3H0TA 4OFIA 4PJAF 3IJHB 4MAYD 2XWTB 4QXUH 1DLFH 3WIHA 2M8XA 2FGWL 3UJIL 2X1PA 4GRMB 5IBLC 4GT7A 3BFOA 4YPGB 2FZ3A 1G6VK 4N0CD 2CIIA 4X9GA 5HI5D 3V5HB 2B0SL 1OAXH 2AKRA 4WFGD 1CTNA 4L3CB 2DQUL 4M1GL 4N5UA 1HHHB 4JGMA 4WFHE 1CD9B 3HMWL 1A64A 3ALWA 2DBJA 4TUOA 3Q6GH 1NCWL 5IJVA 2KBGA 3U7YH 3S6CA 4KQ3L 5HI4D 3UTPD 4F9LC 3D39A 5T3ZL 3TO4C 4KKCD 1NAML 5J1TC 3P73B 2GK0B 4OLYH 4LSUH 4POYA 1KC5L 1KCSH 4P9HC 2YRZA 4ZFGH 3BIKB 2IH3B 1IGYB 3P9MB 3PWJB 5DD3L 1BMGA 3WDHA 4P2YA 1DLHA 5I8KH 3MRBA 5SWZD 1JPST 3Q5OA 2MQ0A 3DUHA 1JF6A 5IIEB 4RGNB 4YXKL 1BBDH 3RBGA 3X13A 2VC2L 3HR5A 1FZOA 3NCBB 4PJFB 3QJFB 3JTSB 5FFLA 5CSGA 1QEWA 2FR4A 3S3JA 5KZCB 1XR8B 2PNDA 4HBQA 5FKPA 4MD5A 1AO7A 4XCCL 3P9LA 1ZHBB 3MRFA 3O3BB 4TPRH 5J6HB 1DBBL 3CDYA 4PJHF 2R0LH 1GGCH 2DQIH 4J3SA 5L7XL 3WS3A 4MA1C 1JBJA 1B0RB 3EJYD 5T1KD 4JRXE 4EN3A 1FNFA 1EHAA 3QZWG 4S0TD 2R4RL 4G6MH 3DROB 4Z18A 3MLZL 2WW8A 3ARGC 5TDOA 5J7CC 3DGGA 4MQTB 4PTTA 1UKSA 4FQ1H 1MCQA 1YEHL 1Y0LB 2CKBH 3SKMA 4LEXL 4BH8A 1UB6A 1T21A 4OLWH 5HHQB 5B38G 2ARJQ 3QCVL 4HBCL 3ES6A 4LASH 3OB8A 4Y5VC 4OF3A 1FRGL 4TVPE 5CP7B 3TBTA 3BYYA 1EEQA 2SEBB 3EZ8A 3O2DH 3AU1B 4JFFE 1RUAL 3V5KB 4HWUA 3ULUE 4GLRH 4JZNB 2L7JA 3OKKB 2PO6C 2MNUA 3BT2H 3LKOA 1FYTA 2XT1B 4GW1B 4HDIB 2IANB 5D5MB 3VWKC 4ZXBA 4L8DB 3MMEA 3OSKA 5A16B 4LP5A 4LSVH 2Z4QA 4RFOL 3SCMA 5FECA 4OUUA 5CEZL 2FB4H 4YO0A 5GIRB 2A6DA 1KENL 1OTTD 4HS8H 1QLFB 4F7CB 3JV5A 1C5DA 4PD4K 5TDNA 4HT1H 4JO3H 3WFCL 2FJGA 3CX5K 4LCCC 1OGTA 4NQXB 2JB5H 3WXVH 2OMNA 2E8ZA 2F5BL 4U49A 3O11B 3SDAC 2Y36H 5T1MA 1JI1A 3RWFA 4HFUL 3RVUC 5CEZD 4FXKB 2A77L 2X1XR 3BGFC 4HS3B 2R56L 5JQ6H 5J9PA 1GPOL 5H35B 5EFIB 5E9DD 5FHBL 3FMGL 1NC2D 1JZ5A 2HJKB 2DQHL 1D6EA 1YEGL 2RAMA 5GGSA 2OS7A 2E7MA 5HGHB 5CZVH 3FQNA 1KN4H 1YMME 4OZHE 5ISZB 5FGBA 4WI2A 5IKCA 1Q94B 1N59A 3GIVB 4AYFA 2GSGB 3NIDF 1QFPA 1JGUL 4OFVA 3QNZB 1QFWL 4C4KT 3D9AL 5EZJA 1RUML 5EA0L 1DBAH 2IFGA 4RGNC 1QBAA 2IG2H 3QDJE 1NEZA 4HUKB 4YDLB 5L9DH 3MUHL 4OZ4B 2XTJB 1WISA 2WBJC 4RWHA 1JFQL 1F13A 1FNLA 5IVXF 5EOQL 4RMWA 5IHUL 1AR2A 5DFTA 4L8SA 5C0CA 5GJTH 1F3JA 3C6SA 5FYKH 4J4PD 3C8HA 1DUYA 2K7QA 4S1DC 2NY2D 1MQKH 4F15B 2F53B 3CPLB 1QNZH 2J88L 3CVIL 1RUKH 2ITDA 5A2IH 1IL1B 2CUIA 4GW5B 3GSQB 5GGRY 1MCWW 4PB0L 1JPTL 3WHE0 4WO4B 2XRAL 3SDCD 1IGML 4HG4J 1J11A 5DYOA 3IDXH 4U6VH 1IILE 2BOBB 1RSFA 1A5FL 2NW3A 4PY7B 4KHTL 3RRQA 4NWTH 2NCMA 3BXNB 1XCQB 1Q0YL 3BZFA 3JV6A 1U93A 1Y6NR 5E6IB 5E1AB 1J8HD 4U1NB 1WFNA 3U7WL 5C0RL 4RCAA 4YDKL 4Y4FD 4PJDA 4HZLA 3OB0K 2A38A 2F19H 1HWHB 1NDGA 4GRLC 4A2LA 5SV4A 2EC9U 4ZFFB 1J18A 2H32A 2AXHA 3CZFA 3GHBH 4JM4L 2AJXL 4I3RL 4BQ8A 4D0DB 2ED8A 2PYFB 1U95B 3B3IB 1DQQB 5IV2A 2GTWB 2APTA 3O8XB 4HH9B 4KKBC 4JPIB 5HYIA 4WNQA 1DN0A 5DUBA 3UBXG 4Z7NF 4MA7L 3LV3B 4WDIA 3DURA 5ALBH 3SEPA 4JO2L 4LLMA 3WS6A 2BRRL 3JWOC 2G2RB 1JN6B 5DJAA 4QHNB 3MA9H 4JY6B 3C6LA 5TPWL 1A6ZA 1LILA 1G7PB 4NZTH 1YJDH 4PJ7E 5JW4Q 1PBYA 4U2YA 2AVGA 3DJ9A 2AEPH 3U0TA 1IC4H 4G8EA 2NY6B 3IDMA 4RFEA 4FQXD 2ZPKH 4LSSH 3O4LA 4CMMA 5IG7A 3FFCB 4OI8A 1QBBA 3EYFB 3VE0A 3WUWG 5IMKB 2HG5A 1V7ML 1LEIB 4N8VB 5KSBE 1JHTB 1SJHA 1X5XA 3LVEA 5E8NB 2KKQA 5DD6A 5F3HB 1I7ZA 1ZVSB 4O2FA 1DQJA 3DXAE 5FUCC 3DSFL 4EUPB 5ITBH 2BHYA 1LNUA 5J3HC 2X70A 2ZG1A 5F7NC 1KGCE 4ELMB 5E2VH 3CK0H 4JFDA 4X9BA 1UCBL 1DBKL 3QUZC 3FONA 3MBEC 1XR9B 1KACB 4PJBF 2ZCHH 3OB0H 4IRZH 3VG9B 2XTJC 4GG6F 2YWZA 3TV3L 4WEBL 4PJXB 4F33B 2AK1H 3KPSD 1ZTXH 3SQOL 2EIZA 5IM7A 3P11H 1NFIA 5LWYH 2IAMA 1FZKB 2GCYB 2YR3A 2LTQC 2NY1B 5IESL 1UKTA 4XWOC 4PJEE 4C57C 2V7NB 4OGAD 3RWCA 5DMYA 4F15C 3H42L 2QQKH 1GH7A 4YHKL 5E8OA 4P5TC 1FLRH 3BP6A 4ETQA 4EI5A 4IOIA 1MHHB 2QQLH 1RU9H 4PIRF 2PTVA 1MI5D 5D71L 1B2WH 1Q9WA 4P4RB 1CXIA 3PWLA 4NJAH 1KXVC 4EIGB 2WLZA 4KJPD 2EYTA 4LCYA 4X4YA 1AP2A 1JGLH 2VXQH 5D1ZA 4M6NL 2G75A 1U8PB 2GTZB 3HE6B 1LDPL 5E6IC 4CN4A 5JHLL 3QA3B 1CFSB 3SPVA 1QR1B 2Z8RA 4NOFA 3LRSB 4KTYA 4NQSB 2ESVA 5EORL 4YX2L 3QEGL 4M7LL 5FM4A 3DYMA 1ORQB 4NQTA 4J3XA 5F1IA 3WDJA 1G7LA 2V2XB 4YAQA 2LFGA 1UJ3B 2EXWD 5J6GA 3RWJA 3AGVA 3O6MH 2DLIA 3P4NA 2OTUA 4YE4H 1I8KA 2J4WL 3IFNH 5L8JB 4IHOA 1S3KH 3D6GA 25C8H 1I7TA 2EXYC 3IDGB 3G5YB 1KB5H 4HKBB 4WWKB 2Y5TB 3QH3B 3LAFA 4OTXH 3IDUA 4HKZB 5T1KB 3TNNB 1RIHL 1L7TL 2HFFB 3L3OA 1KCUH 3LQMA 2O93L 4QF1A 3Q1SH 1GJIA 5C07E 4Q6IC 4KK5C 1YC7A 3PWUA 1KG0B 4OCXH 5CGMA 5IT2H 4U1MB 4LCUA 2B1HH 3V7MA 2YKLH 3TIEB 2NY6C 4LLQB 3MV8E 4HS6B 2CLRB 2YPLA 1KYOJ 4QWWD 3REVA 4U6XA 1UH3A 1G84A 1K4DB 2D4DA 2BNQE 3DX8A 4U6HA 3VXNB 2HVJB 3PNWB 3MV9D 1T0MB 4IOFC 4FMFA 4YXLL 1CDIA 3DRTA 43CAA 5F3BA 4J6RL 3DTXB 3WHXB 1AKJD 3S5LA 2AXGA 3GSVB 2ZOKB 4IS6A 4X4ZA 5D9SA 3RVWC 1FCCA 1U8IA 4MB3A 3GB7B 4G9FE 3TYFA 4HPYH 1INDH 3EYQC 1A1OB 3QHZL 3V0VB 5EBGA 1FZJA 3VXOA 1CE6A 4HPOH 3W0WD 5C71A 3SCMD 4LVHC 1HHKA 1YECL 1HN1A 3HZVA 5ILTH 2JB6A 1ONQB 2VDPL 1G6RA 2XZQH 3QIBB 3MXVH 5HI5C 3B6SB 2VLKA 1UEMA 3LEYL 3RPKA 1OP9A 2HLFD 3KJ4C 4JDVB 1RUQH 2W9DH 1FFNA 2VE6A 1N6QL 4LIQE 3BP4A 4V1DD 4KI1A 3TYGL 1U92A 1S7XB 4TULL 3QFJE 3AS0A 3MLRH 5C0BB 2X4PA 1JK8A 3EO9L 1LDSA 5BOZG 4N1HB 4YWGH 3O0RL 5ID0A 1RVFL 2EDFA 4K3HA 4QYOA 3MA7B 1YEJL 4Y4KB 4OD3H 3A0OA 4XWGH 1T5XB 3B5TA 1PG7W 2YS4A 3EOAB 5J11B 2YRPA 2ZUWA 2NXZB 4RMUA 4DUWA 1FBIL 1RZ8A 1I1AA 2JK5B 1EPFA 3HS0A 1NAKH 4QRRA 2I5YH 3MRKB 4ZSOA 4H1LG 4XMPH 4PPTA 3GBMH 4Z78A 3TBWB 1M6OB 4K9EC 4Y2OA 2G5RA 1PX4A 4TUKH 3ZHLA 1FAIL 2BP3A 3OGOE 1R3JA 5IJKC 4ODVH 1BIIA 1XF2B 4WW1A 1FV1A 2FNBA 2BCKB 1BWWA 5GRXG 3WFEH 3O3EA 4O9HH 2BSTA 1IC5L 3CLEL 4LCWE 4HG4K 5C9JA 3GMQB 3RUGF 3OKNB 1P7QA 2J8UB 4F7EA 3WSQL 4X6BB 3IU4H 2NY0B 4EDWL 1QSFA 5EIQA 3MJ9H 5HGGS 1QO3A 5ESVB 1INEH 4Z7OF 3UPCA 1VFMA 3MUGA 5JIPA 1E28A 3D1MC 1ZLSL 2R1YB 4XPTH 5D7LA 1BJ1J 3QZWA 4WHCA 5EBMB 4XP6L 1HDMA 2AEQL 4AENA 2VL5A 2XWJA 2YK1L 4D2NA 5E8EB 1GZPA 1QOKA 3H9HB 4X99A 2J6EH 1DVFA 3WE6A 4V2CB 1G0XA 1EGJH 2JF1A 3UC0H 2X4RB 3PHOA 3CFIC 5EU3A 5I6XB 1T4KB 3BX7C 1Z5LB 5B38A 5MI0C 3JV4A 1UYWH 2VERN 2YUZA 5LCVH 4OV5B 4U1JA 3R06A 4LVEA 1TCRB 4X7EC 5C0AE 2OL3L 3C60D 3C5JB 5SWSB 3SJVA 2RB8A 1A7PH 1BFVH 3QRGL 3KPPB 4FQ2L 5D72L 1LO0H 2A0LD 4PYGA 5JHDE 1SEBA 3TN0B 1EEYB 1NGYA 5KS9E 1LP9A 1U2HA 2BVPA 1TJGH 3X17A 2Q3AA 4HIJA 1GHFL 2DMCA 2DWDA 3F7PC 3MRPB 1YEIL 2W60A 3OHXB 4GKNB 4EEEA 1E6OL 3V6OA 4P2QB 3I85A 3T4YA 1YYLL 1HH9B 5GXBB 2IGFL 3H9SA 1UB5A 5GSRA 4HFWB 2E8YA 1K8IA 1GIGL 1QBMH 3GMOB 2DI9A 4KUCF 4NC0B 5CHNA 4E42B 2HJFA 4EDXA 1HK6A 2R0ZH 2AXFB 4R90H 1RZFL 2EH8L 2VITA 5E95B 4Y4KC 5IMMB 2WINA 3WFHA 5FB8B 1MCWM 4MNGE 5HHMB 4CADA 1GL4B 5J11C 2DM7A 2R0KL 1NUGA 1FL5A 1S7QA 3DSNA 4P2CG 3V6BR 4OM0H 2QSQA 3HUJA 3HG1E 3FRPG 2P42B 3W9EB 4M00A 5JXEA 4LDLB 3OR6B 1BLNA 3PQYD 4JN2B 1UWEL 1U2CA 2F74A 5E94B 2HKFL 1SY6H 1LO3H 1ROWA 2PCPB 3PL6A 3SKUD 2FECL 5IR1A 4I18B 5D7IA 4X6FA 5I1KL 3H0TB 2CH8A 3IB4A 4JFDD 4U3XA 2NXYB 1F4XL 4G9DA 4OQTA 3BUTA 4XP1H 1HYRC 2CKNA 4LNRA 2FZ3B 3VFGL 2CIIB 3RZWA 2I07A 5K9JH 2AKRB 2NY2C 4RAUA 4RMQA 3IF1A 1CLZH 2NY0C 1JYVA 2VAJA 4TNVF 3KPTA 1MPAH 1JWSA 4ALAH 1F6FB 4K23L 4WU7A 3RL2A 5BV7H 3NCYP 3QEUA 4TUOB 1I9IL 5IJVB 4RZCA 2V5YA 1CYGA 1PZ5A 1IM9D 4HCRH 5IROC 3D39B 2VZOA 5F7EH 2DDQL 2JELH 1C08A 4LMQI 2VR9A 4Y19E 2VSDA 5IB2A 1FGVL 4G8IA 4F8QA 1GOFA 4NZRH 2QQNH 4D9QD 1NAMA 4WI7A 3TCLA 1DLHB 5DUML 3MRBB 4YR6A 2YXMA 4XGZA 2GI7A 3V7AE 2F5AH 4ESKA 1N4XL 3BE1H 3X13B 2X40A 1CK0L 3W9DA 1QFOA 1TJHL 3HR5B 1FZOB 2WUCH 3AS3A 4LLWA 2BY2A 4XNXL 3I6LD 1QEWB 4XHQA 1CLOL 2FR4B 4RISL 4K3EL 3B8YA 1AHWC 4Y7MA 4OV6F 5FKPB 4MD5B 1AO7B 2ICWA 4MWFA 5CBAA 4K71B 4DKEH 3P9LB 3MRFB 1U41A 1CGVA 3WS3B 4GRWB 4Z9KB 3QIWD 5DD1L 5FUCE 1A6AA 4EN3B 1OAQH 5KVEH 3MRNA 1MJ8H 5I8CA 2Y6SD 1MCOH 1MEXL 4FQLH 5DRNA 5E4EB 5TDOB 1Z0MA 4JEGB 3DGGB 4PTTB 4ODBD 3OR7A 4UT7L 3QDGD 4RMSA 2HT3D 3SKMB 4BH8B 1UB6B 5I30L 1T21B 3BEVA 3ZHDA 3ABZA 1YPZF 4TUJA 2QHRH 4M03A 2E6PA 3ULVL 5DJ8A 2VZ1A 2XG4A 1FE8L 3ES6B 3ARUA 3ROLA 3TBTB 1Q38A 4KV5E 4X7CC 4RGOH 2CO7B 4LF3A 4CW1A 1TJIH 5DC0A 1DQLH 1I85C 4KJQD 3QBTB 3WUWA 5D7SL 1LMKA 4R97B 4TOYH 3CMOL 2ID5A 3LKOB 5HHVH 1FYTB 1VGKA 4KDWA 3JXAA 3TVMA 1QHPA 2FX8H 4ODWA 4ZXBB 5D6DC 3MMEB 4U3HA 3L5JA 4ZS7L 5I1GL 2Z4QB 1RZKC 4LGPB 5GISL 3KYOA 4YXHH 1E4KC 5FECB 3MRIA 4OUUB 5FYJU 4I18C 3T3ME 4MD0A 4YHOL 2Z92A 4KUCD 4YO0B 4YQXH 5F1NB 1GGUA 2A6DB 3EFFA 2C9AA 1T1XA 1CE1H 1X5JA 5JUEL 1C5DB 4QOKD 2NXYC 2DQTL 3GSXA 5TDNB 2AJUH 2FJGB 1OGTB 3NVQA 2QR0A 3QDAA 4UIKH 4KVCH 4EOWH 4EXPX 1PSKH 4EBQH 5T1MB 3RWFB 2X42A 2V9RA 1NLBH 4OGAC 2HLAA 3G6JF 4HWZA 4XB7A 5J9PB 4NO0D 3KR3H 3VXQA 1FO0L 1DQMH 3SDXE 1BPVA 1OAYL 1H3UA 1T0PB 1RPQA 1G9MH 1P69B 1D6EB 4NRYA 2ITCA 5GGSB 4OFYA 1S9XA 3FQNB 3EIFA 4KJPC 5I8OH 4JG0H 5DHXB 5IKCB 1JGVL 1N59B 1CN4A 5TQ2L 1CXKA 1IEAA 2ICWI 1VFAA 2E7HA 1CDHA 5J89A 5EZJB 3WLBA 5EU6A 1CU4L 1J1OH 4LSQH 4X5XA 1BVLA 2YXFA 1JGDA 1X5LA 5I74B 3MV8B 1GC1C 3M1BA 1UM4L 4PRPA 4H0HB 1NEZB 2ZG3A 3MV7D 2VL4A 5E6ZA 3NABL 1E27A 3UBXI 3FQTA 2OR9H 4YUEH 5M7QA 4L8SB 3EYSL 4K71C 2C4FT 5C0CB 1F3JB 3C6SB 5HVGB 3CCHA 1EHXA 3D3VA 1DUYB 3IS0X 5I17A 3KYAA 2MQ3A 1P1ZA 4EN3C 2ITDB 1KTDA 3KJ6H 2JIXD 2YMXL 1UXWA 4UILH 3UAJC 4MXWH 1Z6JT 3F5WA 4CAGA 5E4EC 3LKPA 3MLSH 5DMIL 1W0WA 1JL8A 4BJLA 5DYOB 1S5IH 4OAWA 2NW3B 1FSKC 4JPWH 3ILPA 4DTGH 4ZOEA 1SQ2N 4M5YH 1LO4H 3BZFB 3JV6B 1U93B 1IGFL 1WC7A 1XIWD 2R0WH 5I18H 4QWWC 1RIVL 3PGFL 3B9VA 4WFGE 5JZ7C 1B9ZA 2DI8A 3TZVD 1SEQH 1OPGH 1OLLA 3K2UH 4PJDB 4HZLB 12E8L 1U0QA 4NBXB 4WHYG 1NDGB 5FOBA 1FGNH 4JPVL 3CZFB 2H32B 4R97C 1TNNA 4LPCA 4A6YL 3GI9H 3SJVD 3UTPE 5JTWA 1U8QA 5IV2B 3QCTH 4ZXBC 4GAGH 4ONOA 4WNQB 1DN0B 5DUBB 2P46B 3SCMC 2V5TA 4C56A 4WDIB 4YH6A 1P7HL 4LLMB 3KLHD 3SGDI 4PJIA 5DJAB 3DOSA 2NNAA 1S9VA 4E41D 3C6LB 5SWZE 5IB5A 1A6ZB 3RWGA 4Z7VA 1MLCA 1YNKL 2R29L 4UT6L 5JXAH 1I1YA 4J7RA 2HLFC 2XY1A 1KELL 5GZND 1A7NH 5DTFA 3U0TB 4G8EB 3MV01 3IDMB 5BRZD 2ILLA 4YHYB 4RFEB 1BJ1H 1MY5A 4DGYH 1EZVX 5E2WL 1MFEH 4MA8H 4TTGA 2DMKA 2A74A 3O4LB 5IG7B 4CMMB 3VE0B 2GJJA 4OT1H 1T5WA 5DR5H 1S5HA 2HG5B 4OJFL 4P59H 2PN5A 1SJHB 2YSSA 5KTEL 2P5EA 5DD6B 3QI9A 1I7ZB 4PJ8D 5DRZA 3CAFA 3S37H 4O2FB 5I0DA 1YQ2A 5GGVH 3S36L 5TE7H 1DQJB 4HWNA 1UACL 5FGBC 1LNUB 4KTDH 3ZKMD 4AK1A 2X70B 2VXUH 4K94C 2PXYA 2BVEA 2O5YH 4NN7B 1W8OA 4JGUA 4NUJA 4JFHD 4H1LA 3LY6A 1AGFA 5I74C 3RDTA 4POZD 3FONB 5FXCH 3EO0A 3W39A 1CFVL 2OLDA 3WXWH 1XFPA 2A1WH 4Z7UE 1YEFL 1BEYL 4LSRL 2EIZB 2OX5A 1NFIB 4L8SC 2IAMB 5EU4A 2CSPA 4PLKD 1HI6A 3EW3B 4QHLA 1SBSL 3RWCB 2P5WD 3SKOA 3GO1L 4XPBH 1DFBH 5E8OB 1P2CA 3BP6B 3G6AA 4ISVA 4IOIB 4EI5B 1HKLL 4ETQB 1J8KA 4IIQA 3S37X 3CXHK 5F1KC 4M62L 1LO2L 4AMKL 4CMHB 4M43H 4CVUA 3LDBB 1FYHB 1OP5K 1Q9WB 3MBXL 4APQD 1NFDF 3PWLB 4XVJL 3OKEA 3NCCB 2WSKA 3KXFD 4HSQA 2EYTB 2NY5L 4LCYB 4X4YB 1AP2B 3PWPD 3R1GH 5D1ZB 3P3YA 2G75B 1MCDA 2OJEA 4LPTA 4S1SL 4WCYH 5HDOA 3SPVB 4HF5L 4BSJA 1ZEAL 1ITBB 5I75B 4D8PA 1KULA 4GXVL 5CEZE 4H88H 1K3ZA 2ESVB 3S35L 2GJZA 2FJHA 4YAQB 5F1IB 1G7LB 2F54A 3GZKA 5J6GB 3RWJB 5E9DE 5CCKH 5EO1A 3LKQA 3P4NB 5LGJA 2OTUB 1MREH 1I8KB 1VA9A 2JCCF 4IHOB 3L5XH 1T2QL 1I7TB 3EDDA 4P49A 5GJSL 3HFMH 3ARQA 3RX7A 2BJMH 4U33A 2DM4A 2A0LC 5HYJA 3WFDH 2GHWB 5I16A 3NACH 3ZLQC 2YD5A 1C5BH 35C8H 3IAQA 2EE9A 3WS6C 4OZGF 3DX6A 2Z93A 1MJ7L 1Q1JL 3L3OB 4QGYA 4I2XE 4G6KH 5ENWA 4IMKA 1GAFL 4QF1B 3IRPX 2YPVL 3O9WA 3TM6A 4Q0XH 3BZEA 3PWUB 4LCUB 1BOGA 2B5IC 2V2TA 5ACMA 4YHYC 4JZJA 3JWOH 1X4ZA 3P77A 3I9GL 4PRPE 3BWUC 2AABL 2YPLB 1BZ9A 3REVB 4U6XB 1EEUA 3VA2C 4U6HB 3DX8B 4OM1H 2BXZA 3UZVB 2XQYK 5ANME 4KMTH 1NDMA 3DRTB 43CAB 1MRFH 3MUJA 1BQLL 2H8PA 3GUTA 1OP5H 2B8OT 3S5LB 2AXGB 2IPUK 1BBJA 4IS6B 5D9SB 3HI5H 3VWJA 2XKUA 1U8IB 4U1LA 3TYFB 5BXFA 1FZJB 3FRPA 4PGZA 4TVSa 3VXOB 3KG5A 3KPNA 1CE6B 4NN7C 4GLRI 1QSEA 1HHKB 2X1WL 4HGMA 4G6FB 3HZVB 4AIXA 1BAFL 1N5YL 5C09A 1CL7H 2EDDA 1J8HE 4JO4L 5D93C 4NP4H 2JB6B 4PJHE 1G6RB 2VISA 1N7MH 1DBML 1C1EL 3F6LA 4U6YA 2NW2A 2VLKB 5F72S 1CLCA 1OVZA 5E03A 3U0WH 1FFNB 4FQCH 3RAJL 3BP4B 4MA3A 1NCBH 1U92B 2G60L 3MLWH 4HIEA 4OLVL 4BQ6A 5DFWH 2X4PB 3W2DL 1JK8B 4EI5C 3OZ9L 5ID0B 4QYOB 3UTTD 2Y9RT 5E08L 4CMHC 4XNUH 2P47B 2IMNA 3LDBC 4CVWA 2NR6D 1AFVH 1NMAL 1VEPA 4CDGC 1RZ8B 4OGYL 1I1AB 1MWAL 4K55A 1OAZL 3DX9A 3F7QA 4NQDD 4C56E 3HS0B 4QRRB 4QTIL 5ICYA 1KBGH 4HJJH 4ZSOB 4XMLH 3IETB 5D1ZC 4Z78B 1OTUC 3F7YA 3BDYH 5I75C 1NCAH 3SE8L 4F37K 2C3HA 1B4RA 1FH5L 1R3JB 3FZUD 4K7FA 2BNRE 1BIIB 3FN9A 2EDLA 4DAGH 4WW1B 1FV1B 5FK9A 3WN5C 3E8UL 3MROA 3O3EB 2BSTB 1CXEA 3ZL4H 4K3JL 5HDBF 5C9JB 1AIFA 2R23A 1AXTL 1P7QB 2W0FB 5AZ2H 4F7EB 5KVGL 1F5WA 4JFXB 1QSFB 2CRMA 4AIZA 1I4FA 1QO3B 5KBNC 1G9NL 3NZHH 4TRPH 1U8NA 3DVIA 3MUGB 1R3IL 4MNQA 1E28B 4Y5XA 5SX4I 5T1DH 1L6XA 2WWMD 1DBJH 3EDFA 5D7LB 3QZWB 3BRFA 3UYOD 1HDMB 3U83A 4Q97A 1KOAA 2VDKL 2VL5B 1GOHA 2XWJB 4AENB 2GKIA 4KZEH 1GZPB 5DI8A 4BFBD 1QZ1A 4LLDA 4X99B 3T3PF 3WE6B 1DVFB 3IXTA 5CILL 3KPSE 6FABL 2ZG2A 3C08H 3CFDA 4PUBH 4RX4A 3PHOB 5EU3B 4PRHA 5H2BA 2UVFA 5MP6L 5B38B 3JV4B 5DSCA 4DGVL 1A6UH 2XA8H 2IJ0C 1IQWL 4TNWK 5TH2A 1FPTL 3ROOA 4L3EA 1J0ZA 2UWEA 4U1JB 2ZUQB 3R06B 4MJ5A 1TVHA 4H8WC 4OSUH 3BKCH 1J0YA 2X2YA 1WBYA 4R3SA 3H3PH 4UTAL 4KRPB 1MI5E 5T5NF 5K9QG 4X9IA 4DN3H 4K3GA 5D2LA 1CF8H 1CVSC 1SEBB 3BMWA 1NGYB 1LP9B 5IVXE 4DN4H 2BVPB 4M7LT 3S98A 4HIJB 2FX7L 4EUPH 2DWDB 2FWOA 3CFJA 5JW3H 1KB9K 3INUL 2W60B 3RY5A 4TPRL 4G42A 2H3NA 4L4TD 2IFFH 4I8DA 3T4YB 1MAMH 5TDPA 1MELA 1Z9MA 2R8SH 5GS2H 5GSRB 3H9SB 1UB5B 3ZT6A 5FYLH 1K8IB 1NBVL 2WMPA 1R5VA 3MXWH 4BSVA 5SX5K 3UMTA 4Z95H 1FORH 2F54E 5CHNB 1OAUL 2HJFB 2X4OA 4EDXB 2VAAA 1XEDA 1FDLH 3QUYA 1VKXA 2VITB 3HC4L 4KGLA 5HVWA 1AQKH 2DM2A 4NYLA 2WINB 3WFHB 5J56B 4CADB 1IT9H 1DSFH 2DLFH 2VDOH 1S7QB 3WDIA 2D7QA 4HW6A 1I1AC 5MEQA 3HUJB 5F96L 5IBTH 1PGRB 1ZVYA 3LEVL 2CQVA 1YYML 4OLXL 1B6UA 3UTSA 1BLNB 1G7IA 1H5BA 1O5DT 4OLZH 2F74B 4UDUA 1NL0L 1F90H 3PL6B 4PRID 2PXYD 5IR1B 5D7IB 1MCIA 4K07A 4X6FB 2ZZUT 2AJ3A 2UZIL 2VDQH 1C5CL 4H20H 5HHXH 2CIKA 4G9DB 2Q1EA 3RWDA 1LWRA 1ZV5A 2RCSH 5DJYA 2YEZA 4LNRB 4Z7NE 5D1QA 3MLVL 2I07B 1J1XL 1CLYL 5MERA 2APXA 1RIUL 3MV9E 1BHGA 4U1IA 4K7PY 3P9WB 2Y23A 4RAUB 5E2TH 5B21A 3IF1B 2I60L 3ZDZF 3T1WA 1A2YA 3NAAL 3ARFD 1MIEH 1F4YL 4X7SH 4JG1L 4WU7B 3RL2B 1K8DA 2Y5EA 3QEUB 5E2JA 5GS0H 4LARL 4RZCB 1S7VA 2AJVL 1J0JA 3W0WE 1PZ5B 3IDNA 5GS1A 1MF2L 4PB9H 3KLSA 4YC2B 3OAUL 1C08B 2NTSP 1QLEL 2D0GA 3TPKA 4LCIL 2BY1A 1DVFC 5IB2B 1XIWC 3G04A 4G8IB 4DVBA 3UX9B 1BQUA 1D5ZA 1NAMB 1WTLA 5SX5H 1RUPH 3TCLB 4L1DA 4YR6B 1ZK9A 1L7IL 4XGZB 5DD0L 4V1DE 5TFSH 4HC1L 4J8RA 3W9DB 1G7MA 2NX5E 1HYSD 1A3RH 1I3VA 4KRPC 2ICWB 4MWFB 5CBAB 2Y07H 1V05A 3C2AH 4MX7A 4PJBE 2WUBH 2FSEA 4GG6E 2JE8A 2PYEA 4NM8H 3RVTC 1A7RH 1A6AB 4QCIA 4PJGA 3KLHC 2VXSH 4MJ6A 3EFDH 3MRNB 3GM8A 5I8CB 4G7YH 5H8DA 5DRNB 5DURB 4LQFH 4WUUA 3GI8H 3V6OC 5FYKL 2BFVL 3G5ZA 5GZNC 3OR7B 5DWUH 4EZMA 1RUKL 1D5MA 3BEVB 4HV8A 3TBVA 4BZ2H 3BOVA 4TUJB 2QSCL 2VH5L 2YHGA 1W2KT 2CLZA 5DJ8B 5FF6A 1Q0XL 3ROLB 1CBVH 3GNMH 2VDML 1X5YA 3K3QA 4I5BA 1RI8A 5FYKD 2YD2A 4OI7A 2CGRL 1D5IL 5EUOF 4LF3B 4CW1B 5HHOD 3LQAL 2Y06H 4KTEH 4PJ8C 3V4UH 4HLZG 3L1OH 5CEXA 2Z31D 3WUWB 1JNLL 4JKLA 5C1MB 4ODXA 5JXEC 5CJ8A 1VGKB 3MNWA 4TQEL 3TVMB 3K4DA 4ODWB 2MCPH 4RWYH 5IFJA 4HWEL 3DYPA 4XCFH 3PL6C 1GXEA 4OB5H 3KYOB 3C8DA 5KVFL 1HZHH 3MRIB 4MD0B 2Z92B 3QXUA 5MEOA 1JPSH 1OWWA 3EFFB 1T1XB 1T83A 4Q6YA 1EO8H 4DOHB 4JRYA 3FO9A 3GSXB 1PY9A 5IGXL 1YEEL 1NJ9A 4NUGH 1MFNA 2QR0B 1CR9L 1WEJH 4F3FA 1KEML 2Q7NA 3U0PA 3U6RA 1IMHC 1EUUA 3B9AA 4ZDHA 1A3LL 3B9KD 3UYRH 2HP4A 4YHIA 5DEGA 2HLAB 4F9PA 4HWZB 2X4NA 4KK9C 2UWEE 1JRHL 4G7VL 4U7KA 1TCMA 3QDMD 1KXQE 2VLRA 5E5RB 5DXWA 3U7AA 1HIML 3W5MA 3FT2A 3RTQA 1ACYL 4NRYB 3T09A 4APQC 2ITCB 3SE9H 5EBWA 4ZTPL 4YC2C 1S9XB 1FO0A 3MX0A 4ONFL 3A67H 2N4IA 1PEZA 2IADA 2EH7L 4XHJC 3BQUA 1IEAB 1BF2A 1PFCA 1VFAB 3B2VH 3WLBB 5EU6B 3EAKA 4X5XB 1BVLB 1JGDB 4X6DA 4TTDD 3M1BB 4XBEH 3PHQA 4PRPB 4JY5H 4M6OH 5AUMA 4GG8A 1ZKAA 3I50H 2FJFA 1E27B 3C5ZD 1TMCB 1MAKA 3FQTB 5C92A 1E4WL 5MEND 1U8HA 3IKKA 4ORZC 4Q9RH 5CSZA 2DJUA 4F8TA 2VTFA 4JFEA 3VFMA 1PKQA 3CCHB 2VDLH 1X7QA 3D3VB 5GS3A 1IE5A 5EZOH 5I17B 1A14L 2OR7A 3PQYE 2AAVA 1P1ZB 4O51A 5AWNH 1SY6A 1KTDB 3S97C 4DVRH 5DT1L 3QWQB 4MNQD 3F5WB 3LKPB 4O5LH 4WFED 1W0WB 4NN6B 1RJYA 4N0UA 5ADOH 4OAWB 2CDEA 3ILPB 2ERJB 2Y7QA 5BJTA 2BVUA 4K2UL 1Q72H 1QPPA 1WC7B 2YD1A 4KAQL 4ONHA 2HTLC 3TH4T 3A6CL 4OZIF 5JA8B 3WFBH 4KKAD 3CFCH 3TWCH 4F7PA 1A1MA 1S7RA 3X3FH 4Z6AT 4NZUL 1RHHA 3TH3T 1A6WH 2JJTA 5FOBB 5IQ7H 4JR9H 5LKNA 1RZJL 1BWMA 4NM4H 4HCRA 5I9QB 1XZ0A 2FL5A 4Y89A 1U8QB 1QD0A 5CP3A 3DI2B 4YDVA 1A7BA 3S9DB 4ZPVA 4PJ5A 2NTFA 2LE9A 4C56B 1JNNL 2GT9A 4AL8L 3VXSA 3IFNL 1BGXL 3RUGE 3VH8G 2DWEA 4FZ8H 4NQEA 4PJIB 2J5LC 4D9QE 2NNAB 1S9VB 4RFNB 3W82A 1BD2D 1KB5L 3D25A 3NCFB 4FZEH 4G8GA 3RWGB 4HH8A 4UQ2A 1FG2A 1MLCB 4Z7VB 4ZD3L 3OPZL 2DLHA 3TA3A 1RZKH 3VD5A 1I1YB 2H41A 5DTFB 4Z7OE 3GKWH 4GH7B 3I6LE 4PJ9A 4P2RA 3BPCA 3WIHH 1PLGH 2RHEA 4WI3A 3V6FA 4S0SD 1WITA 2A74B 1WVZA 4LLAA 3U9PH 1T5WB 1IAIH 4IDJL 1S5HB 1INQA 3A6BH 1W8NA 2B1HL 2DQCL 2NR6C 2YSSB 1CGSH 2P5EB 4N5ED 4QNPF 3QI9B 5DRZB 5TQ0H 2WP3T 4R0LA 3T08A 1RQ5A 2XWBA 1YN7A 3BJ91 3NCYS 4BQBA 3KPLA 4Y16A 4ZAKD 1JHKL 3F58L 2FHBA 3FO0L 5KVMC 2EDOA 3ARTA 2PXYB 4PY8I 2HWZH 3QDGE 1UM5L 4NUJB 4ZO7A 1RULL 1CZ8H 4H1LB 1AGFB 3RDTB 4NO3A 4UINL 3HC3H 3UZQA 3EO0B 2BY3A 3W39B 5E2UL 1O7VA 3LN5A 5A43C 1PEWA 1KIPA 5HYQA 1JP5A 5D1QD 4P23D 1HQ4A 4F2MA 4NCDA 3EHBD 5EU4B 5JORA 4QY8A 1HI6B 2YWYA 4N8VG 5HDQL 4YEEA 1KIUA 1QBLH 4QHLB 3SKOB 5FIEA 1TVBA 4DGIL 1P2CB 3G6AB 4ISVB 3WL9A 3OJ2C 4IIQB 1NEUA 2FATH 3RZCD 1E6JH 4N8CL 4EUPG 2HRPL 1HHIA 5GGRA 2WWMC 3P40A 4FQPA 3VW3L 3MRDA 2VDRL 4KPHL 3OKEB 1CDYA 1AE6H 4GRWH 4QOKE 2ERJC 4KGJA 2BSED 3IFOA 4I3SL 5D1XA 4UZGA 3HZKA 2OJEB 4TVPL 5BS0D 43C9A 5E70A 1JHLH 4EJ1C 2CDFA 4D8PB 4MCZA 1CVRA 2DF3A 2GJZB 2FJHB 3ULUL 5L2KA 3RQ3A 2F54B 2ICCA 5EO1B 3LKQB 5LGJB 2APWA 1T22A 3T0DA 5F6IC 2NY3D 1OAKL 1MRDL 3R0MA 2QKIA 5HYJB 4FQJH 3ZDYF 2D2OA 4X6CA 5I16B 3T0AA 2AK4D 3T0EA 1MFDH 3DX6B 3ARSA 2Z93B 4Y4HA 5D70L 2FHCA 5I76A 4XXDA 1QRND 4PGDA 5ENWB 1OW0A 1DZBA 1L0YA 1ZLVK 3O9WB 3EOBA 1TTFA 2BK8A 1J88A 1EV2E 1BOGB 2V2TB 3MV7E 5FA3A 3C5SA 3JWDL 3G9VA 4LSPL 4JZJB 5DRXA 3P77B 2QEJA 1OP3K 1BZ9B 1PKOA 3LKSA 1JE6A 4XPGH 8FABA 4NFCA 1FFRA 3GHEL 3QO1A 2DQFA 2N56A 5DVKA 3VXME 1OOAA 3SGKA 2H1PH 3G6DL 1UKQA 4M7KL 1OT2A 1NDMB 3MRLA 2XN9D 5IFHH 4AEHH 2H8PB 3GUTB 1N5AB 1BBJB 3O2VH 1YQVH 3VWJB 4KJWC 4U1LB 1A0QL 4AG4H 5INCA 1CDJA 5BXFB 2PXYC 5C08E 5EZLA 3KPNB 3V0WH 2APBA 1QSEB 1F6LL 4JKPH 3BGMA 2LAGB 1CFQA 4K8RH 3RDTC 1TIUA 7CGTA 2FYYA 4F7MA 5C09B 5T33H 5IFAL 3HRPA 4KC3B 4JCMA 5DO2D 2VR4A 2EICA 2VISB 3E6HA 2AI0L 1ETZA 4QHUA 3QULA 3B5HA 4P3CH 1U8KA 1T0NA 2VDNL 4U6YB 2NW2B 1YUHA 5ADPL 3MACH 5E8PA 5J12C 2NX5B 4MA3B 4MJIA 4WI4A 4LHQB 3ARFC 4HIEB 2XPGA 2ZOLA 2DTML 2GITA 5ALCL 3LMJH 3AMLA 5L6YL 3Q3GA 1YDPA 4IIQC 4MXVF 4QRPD 3FN0L 4C54A 2NQCA 1YPZE 2ORBH 1MFBL 1KCKA 5TF0A 4LKCA 3X12A 3DX9B 1ULVA 1ZLVH 2RBLA 2B1AH 3BRDA 4E41E 5ICYB 3FCTA 4S1QH 3PP4H 7FABL 3VI3F 1IBGL 1FNEA 5GPRA 1MWAA 3O41A 4XPAH 1HNFA 2R4SH 1KPUA 3F7YB 4JJ5A 4ZO9A 1IGCH 1OP3H 3PXHA 5K9OA 1WLHA 3TIDA 5BRZE 4PRBA 4K7FB 1G7JA 4JANA 5FK9B 2D0FA 4S2SA 4P4KD 3PIQA 2AGJL 4OGXH 3RVVD 5IB1A 4KHXL 5F7KC 4B5EA 1IGTA 2ZCKL 3MJGX 4ODSL 3EJZC 3DV4A 1B0WA 1AIFB 3SDYH 2R23B 4DZBA 4MLIA 1U3HA 3PJSA 4YHMH 3A6OA 1TTUA 4PGBA 5AYUL 4LHUA 5C0IA 4GKOA 2X4SA 1S9YA 2BSRA 1A6VH 1I4FB 4AIZB 3RGHA 2H32H 1U8NB 5I1HH 3HE7A 4FQQA 2IALA 2C3GA 4MNQB 4Y5XB 3EUUA 3G6JE 4IMKC 4JFHE 3QPQC 4NQCA 3FB8A 2MWCA 3CXDL 3LH2L 4Y0GA 5DI8B 4LLDB 4YNYA 2O5XH 1X6LA 5HHPA 4KK8D 2B4CH 1T6VN 3IXTB 4YHLL 4J2XA 5F88A 1TETH 2OJZH 4I48A 3CFDB 3S34H 5H2BB 4PRHB 4Y1AA 2AV1A 1UENA 3ISWA 4FFVD 4TSCH 3L95A 4F57L 5DSCB 2QSTA 4XNYL 5TH2B 2P5WE 1BZ7A 3CUPA 3ROOB 3JTSA 3GSUA 4L3EB 3L5HA 2UWEB 4YGAB 2Z31C 5K9KA 1PJ9A 1L9MA 2XOTA 5F8RC 1B90A 4MJ5B 5GGQH 1TVHB 2X9WA 3NFSH 3LRGA 3HB3D 2VZUA 4YZFF 1WBYB 4R3SB 4OCMC 2F5AL 2B39A 5KSAD 1NCCL 3BE1L 5D2LB 1QA9A 2WIMA 4ENED 5BVJA 4G80A 3RWHA 3NTCH 4I77H 3KXFE 2WUCL 5BO1L 4CJ0A 2EDBA 3K0WA 4OCRL 3PWPE 2FIKA 2VUYA 2OP4L 4OCSH 4LLVA 4NQED 5F7DA 3ARDA 3V95A 3GMRA 2FWOB 3CFJB 4DKEL 1F2XK 4Y88A 1UA6L 4G42B 2H3NB 4R2GD 1N0XL 4G8GD 4BZYA 3JSSA 5TDPB 1NKOA 2WV3A 2XZZA 5B8CA 4PR5A 1QKZH 3B9KC 5KVEL 1R5VB 4BSVB 4EI6A 5DMJB 2WQ8A 2ICWJ 4FQLL 2NLJA 5EG6C 5L0QB 3WIIH 2X4OB 3JUZA 1VKXB 2VAAB 3WKMH 3QUYB 1ERNA 4FXGA 2FEDD 3MC0A 2ADGA 1RD6A 1EHLH 4WY7L 4NYLB 3MCLH 5F7YC 3FN3A 4IRJD 4TN9A 3BGAA 5DJ6A 3TEUA 5MEQB 4XP4L 3FB7A 2R39A 3HRZA 3BYTA 3UTSB 1G7IB 1H5BB 4KWUA 1NGQL 2V2WA 1KXTB 2W0LA 1WAAF 4UDUB 5MEPA 1OGAA 2EDYA 4YBHA 4UNTA 3KYKL 1VEMA 1T89A 4IJ3C 4TTDC 5FUOL 3SBWA 4XVSH 2AJ3B 4TOYL 4ZOAA 2Y1VA 3ZTNL 1I7UA 3N85H 1XGYL 2CIKB 3DMMA 1Y6MR 3RWDB 5HYSG 5DJYB 4YHZH 2YEZB 3RY6A 4UBDD 4GOSA 5D1QB 1VENA 5MERB 4U1IB 4IMLA 5CJXA 1QQDA 3CX2A 2E27L 3CJJA 4JFYA 3S3PA 3U4AA 5DLMH 3NOIA 1A2YB 4LLYA 3N9GL 3P4OA 1K8DB 5GRWA 1S7VB 4JM2A 4Y5XC 3IDNB 4JQVA 5GS1B 1EX0A 4HJGA 4AQ1B 3TJEL 5FAAA 1UXSA 3NGBB 2E6JA 3G04B 5I66A 2ZCLL 3EYUH 2UUDK 4DVBB 1JZ4A 1JPFB 1D5ZB 4C4KO 4M48H 3RU8L 1D5BB 2DQGH 4J8RB 4P2OA 5K59F 3E3QE 1G7MB 5JW4R 1QFUL 5F9JA 1X3DA 3UTTE 1EO5A 4L8BA 4C83A 3RJQB 4JFPA 1F11A 4HC1A 3G5XA 5KW9L 3PDGA 1ZT7A 5AG8A 3S7GA 3BKYH 3GMPA 4MX7B 4ZNEA 1KJVA 2FSEB 3BP5A 1XF4A 2PYEB 3WJJA 4NQDE 1S7WA 3MLXH 4P9HL 1KJ2L 4M93C 4OCLC 4QCIB 3H7BA 3NA4A 4PJGB 4NGHL 3IU3A 3MREA 5C0EA 4MJ6B 1OM3L 4PJFF 2OK0H 4XI5D 5A2FA 4Y4HD 3RBSA 1TZGH 4WUUB 3TO4D 3GBNL 3KWWA 3QEQA 4MLSA 5HI3C 3HAEG 3VH8A 5F1SA 3G5ZB 1XCQA 4LIQL 5CKGA 4YDIH 4C58B 3SE3A 1D5MB 4OCYH 3TBVB 4HV8B 4UT9H 4JB9L 4U1NA 3PG2A 3OF6A 1FC2D 2CLZB 5FF6B 3WCYA 1G6RH 1GGIL 2ED9A 3QUYC 4I5BB 1A7OL 1YY9C 4R9HA 5FOJA 4ODTH 4L4VD 3RVXC 2QADD 1CXLA 3AAZA 5CEXB 4P48A 1U95A 4ODXB 1N64H 5ICZA 3MNWB 1H5BC 1RMFL 1KLFA 5IFJB 1I8LA 1W72H 3K2UL 4OBSA 4IRSA 3QAZB 2ATPA 1CQKA 2UUDH 2JCCE 1I1CA 2JLLA 2PUQT 5MEOB 2XICA 4JRYB 3FO9B 2EIEA 5C8JA 5L88H 4K7PL 1NJ9B 3I84A 4GAYA 5D1QC 3MLUH 4P23C 5D5MF 4F3FB 3EHBC 5BCAA 4OZGE 3U0PB 1UH4A 3U6RB 4ZDHB 5MHSD 4OCWL 4YHIB 5DEGB 1FFPA 3E0GA 4MMXC 2X4NB 2F58H 4MMZC 4TSAL 2Z8VC 1AQDA 3ARBA 3ZTJG 5DQDH 4N8VA 3RZCC 3L3IA 4JKKA 1D9KA 1P4IL 5JW4N 4PV8A 2VLRB 3VDCA 3VFPA 1AGBA 4NRXA 1MCFA 5GS1C 3FT2B 3RTQB 3RIFK 4D9RE 2ZUXA 3C9NA 5EBWB 2PO6D 3VXRA 2R15A 1FO0B 5DEZA 4I4WA 4MA8L 4HJ0D 1N6UA 2FLRT 4OT1L 3BQUB 5DUPL 1F58L 3U36A 3B4NA 5C3TA 4L4TE 5FV2A 3N0PB 2FH6A 4O4YL 3EO1A 3VG0H 3BW9A 3MPCA 4X6DB 4ZG1A 2ADIA 3PHQB 2EIBA 3TPUA 5LXGH 5AUMB 4GG8B 3T2NL 2FJFB 5TF1L 5LQBH 1NBQA 2O5YL 2NY3C 3S88L 1U8HB 3MYJA 1B6DA 5CSZB 1DQTA 4L5FL 3E6FA 4JFEB 3VFMB 2O26U 3FQWA 1PKQB 3AREA 3CSPA 4P46A 1N3NA 1X7QB 3SDDA 1NLDH 5D2NC 3OX8A 4UV4L 3BD5A 3BPNC 2XZCL 3QFDA 4WW2A 1HILB 3QXTA 4NFDA 3VFOA 5C08B 4P4RA 4LRNL 4PRIE 1MNUL 4NKIL 2R9HD 2C26A 2EZ0D 4K3DL 1MFAH 1RJYB 4N0UB 2FBJL 1OGAE 4N0RA 2CDEB 4U7MA 3QCUH 5DK2A 2Y7QB 4L9LC 1U6AL 3RGVA 5BJTB 4LRIC 2GJ6A 3MLTA 2YC1A 4ONHB 4NRZA 1I9JH 1WT5C 2DMBA 1DANT 4LAJH 3N1MC 4F7PB 4RGND 1A1MB 2Y72A 2O5ZH 5IWLA 1ZS8A 1S7RB 1RHHB 3H8NA 4HIXH 5BV7B 2VLMD 4JPKH 5TJWK 4I0PA 1NGZA 1IC7L 3DHJA 2DLEA 5KZCD 4KZDL 1AJ7L 2X89A 2FL5B 5JW4M 2IC2A 4G5ZL 1SBBA 1UCTA 1RZ7L 4S1DD 4WJ5A 3QAZC 3NH7L 4YDVB 4LGRB 5EZIH 4ZPVB 4KUZL 2GY7B 4PJ5B 3QNYA 2NTFB 4YK4B 2D7TL 2GT9B 4L29A 3VXSB 1VACA 5C0ND 5HDBE 3GGWA 1T83C 5KSUA 2DWEB 1G7QA 5CJOH 2VZTA 4OZFG 5F9OL 3AUVA 1K6QH 1IGIL 4KY1H 2AQ1A 2EEDA 5FO9A 3OQ3B 3I3EA 3D25B 4X4XA 1Z3GH 4G8GB 4YDJA 4UQ2B 1FG2B 4HMDA 3TA3B 3FT4A 2I25N 1PG7X 1H8NA 5EOTA 4PJ9B 1RURH 3BPCB 4P2RB 3ZE1F 4F9PC 3V6FB 4U1GB 3FOLA 5KSVA 1U3YA 2EDRA 2EDQA 4NC1E 3T3PE 1INQB 1UC6A 1M7XA 2FGWH 3RTQC 3UJIH 3VGAB 5IEHA 4BFIA 3JWOL 4R0LB 5DZLA 2W9EL 2XWBB 2B0SH 1YN7B 2IAND 4WWID 4JJHA 1OCWL 4KKBD 4XMKL 2DQUH 4M1GH 3EBAA 3BQUC 4CGTA 3KPLB 4Y16B 1ZOXA 1I9EA 3STLA 1D7FA 3CFBA 3QIUA 3HMWH 2HFGL 2FEEL 3O6FA 5E5MA 4NO3B 3Q5TA 1NCWH 4LLUA 5BQ7A 4MCYA 3W11C 5DJ2A 4PJCA 3UJTL 3UPAA 3T8XA 4KQ3H 4LU5L 4XVTL 1DN2A 4F37F 5HVHB 4P4KC 2F8OA 3LN5B 1KIPB 2F8VA 5FYKE 4YBQD 1J9CT 5T3ZH 5HYQB 1NAMH 1OSPL 1WBXA 1WFUA 5D7KD 1HQ4B 4F2MB 4XAKD 1J86A 1CXHA 4DW2L 1B0GA 5HHOE 1KC5H 5JORB 4ELMF 1KCRL 4QY8B 5DFVC 1WZLA 4AY0A 3QHTC 5CJQL 5DD3H 3H3KA 2EDTA 5AAWA 4GAJL 1TVBB 3CX5J 3WL9B 5CMAA 3N1FC 1UH2A 4P99A 1HHIB 1R3KA 2VUOA 5GGRB 4PJXF 4YXKH 2VC2H 4JRXA 1BVZA 2HFEA 3UTQA 3RP1A 1EJOL 4YBLB 3QEHA 5ISZD 5F21B 3IFOB 4JDTL 5D1XB 2I27N 3TT3L 4XCCH 5LGKA 2LAAA 4XNUL 1DBBH 43C9B 1CFBA 2HAZA 5L7XH 2CDFB 1AFVL 4FFVC 4PLNC 4MCZB 1WCBA 4BQ9A 4FRWA 3VGGA 3O4OB 2R4RH 5L2KB 5F7WC 1CDCA 3L3JA 5BV7C 2JJTC 4RDQG 3MLZH 2CLVA 1IARB 4JFFA 3HB3C 3QDME 4F7TA 3JZ7A 1YEHH 1T22B 5KSAC 2VLJE 1MIML 3N1GC 4LEXH 2QKIB 2N1KA 2F53D 4ENEC 4X6CB 3QCVH 3WHE1 4NKDA 4ZPTA 1ES0B 2MHAA 1FRGH 1E0OB 15C8L 4LOUD 4WO4D 3T0EB 3TGXA 3WJLA 5CJ5A 4Y4HB 5I76B 1RUAH 4XXDB 4PGDB 3ZDZE 3GK8L 2V17L 1ZA3A 2ARWA 3EOBB 3TA3C 3N50A 3IAGC 5I1JL 5FA3B 2X05A 3C5SB 3N1QC 2VABA 5DRXB 2X7LA 4PJ9C 4QRUA 4Q9BA 4U1GC 2A9ML 5MENE 4RFOH 3LKSB 2FEDC 8FABB 1KENH 2E6QA 2DQFB 3QO1B 2DLGA 3VFNA 3BN9D 4IRJC 3OAYK 3VGAC 4UUJA 3WFCH 3MRLB 4NT6A 3SGDH 2F5BH 2W38A 2R2BA 3O8XD 4HFUH 4WFEE 1YMHA 1A6UL 5INCB 1YMMA 4OZHA 2R56H 1NSNL 2CDGA 1P7KA 5EZLB 3OKMA 1GPOH 5ID1A 1KCVL 3BGMB 4XCNA 3K81A 3K4AA 5FHBH 4OSUL 3BKCL 2FYYB 3K74B 4F7MB 2BZDA 1CXFA 1HCFX 3FMGH 3H3PL 1R5IA 3NFNA 1XMWA 2DQHH 1F97A 4UBDC 1YEGH 3F65A 3E6HB 1ETZB 3BIBX 3QWRD 3QULB 4QHUB 3QDJA 4CKVX 2ZUUA 1U8KB 1T0NB 5GRJL 4UNVA 5I1CL 1YUHB 2NY6D 4IM8A 5HYSA 2MPAL 2R1XA 5E8PB 1CIDA 2BDNH 3MV11 3QYCA 2DYPA 4MJIB 1CI5A 4M7JH 3MODL 3VXUE 2K9UA 2XPGB 2ZOLB 1JGUH 3FFCD 2GITB 1BVKA 4QO1A 4JVPA 1QFWH 3Q3GB 1J0HA 4X8JA 2P7TA 1YDPB 3D9AH 3GKZA 4XNQA 1RUMH 5EA0H 2IQAA 1B4JL 2K7PA 4JZOA 4MQSB 4YBLC 4LKCB 5TE4L 3X12B 1JFQH 1CS6A 1GSMA 5EOQH 5A40E 5IHUH 3RVWD 5D1XC 1WCQA 2J8HA 5EUOE 3NA9L 1BD2E 3SGJC 5FEBA 3FCTB 2W92A 3I6GB 5HVFB 1FNEB 1MWAB 3O41B 5FUZL 5GS2D 1KPUB 3FOMA 3NPZB 4JJ5B 4FNLL 3V7AG 2J88H 1TQBC 3CVIH 2NY5C 5K9OB 2M26A 2V9TA 3TIDB 3RX5A 4PB0H 4PRBB 1O0VA 1I1RA 1JPTH 3LZFL 2XRAH 4LFHD 1G7JB 1R0AL 4JANB 1P84J 1ZLWK 3UTZA 4FTVE 1QTYT 4S2SB 1IGMH 3PIQB 3OAYH 4LPYA 5AYQA 3BAEL 1A5FH 1G9MC 4KHTH 4CNIA 5IB1B 2NY1D 2APFA 2OQJA 1IGTB 1TTGA 4F58L 1IQDA 3P0YL 3DV4B 4DZBB 1U3HB 3PJSB 3WBDA 3KAAA 4H20L 1MRCL 2DS4A 4MS8D 4PGBB 5C0IB 4LHUB 2FHFA 2X4SB 1S9YB 2BSRB 5LGHL 4JHWL 3U7WH 5ABDE 5C0RH 1G1CA 4B50A 2VN7A 4XI5C 3HE7B 4FQQB 2IALB 4Y4HC 4K9EL 3BDXA 2OXHA 1UZ6F 3ZHKA 3STBA 1VGEL 3D85A 4NQCB 3FB8B 2J8UF 2AJXH 4I3RH 4JM4H 4WTWA 3TNMA 1MIEL 4X7SL 3L9RA 4U1HA 4XP9L 4YNYB 5HHPB 2ICEA 3HE6D 4PJ7A 3THML 3HAEA 5F88B 5DMKA 1IEBA 2IPTL 4PJCE 3BVNA 4GSDL 4I48B 5TGBA 4MA7H 4Y1AB 2AV1B 32C2A 2MOVA 3W81A 4JO2H 2QADC 4Z7QF 3L95B 3SGKC 2BRRH 4KXZH 1BZ7B 2DM3A 3CUPB 3GSUB 4AH2A 3JVGA 5K9KB 5TPWH 5GS0D 5KSBA 1MCPL 4DJMA 3ARYA 4RMRA 1WICA 4WWKD 5IF0A 3DXAA 2H2PC 4PYHA 1QA9B 5DVOA 5BVJB 4G80B 3RWHB 1I3GL 3UJJL 1A6TA 1A3RL 3K1KC 5BW7A 2FIKB 3JBG7 5CGTA 1V7MH 4I0CC 5BS0E 4LLVB 3HNTL 3ARDB 5F7DB 3GMRB 1KJ3L 2BSSA 2X4TB 2RGSA 4Z0BL 1ZLWH 2XXMB 4XC3H 1FVEA 4S10A 1UVQA 3DSFH 5B8CB 4PR5B 4H1LH 3BPOC 3RA7L 2QTEA 4EI6B 4MJ4A 2NLJB 4FXGB 4PJEA 3O2WL 2ADGB 1UCBH 1DBKH 5C86A 5D2NE 2E7LA 5DJ6B 2D9CA 2AK4E 4FMKA 3U46A 1ZT4A 2M2DA 4OZIE 3TV3H 3Q5YA 4KJYA 4WEBH 3FB7B 5DRWA 4HJ0C 3HRZB 3SQOH 5HGBA 1QRNE 1IAII 4Z77A 5IESH 2V2WB 5KVDL 2ENYA 3VRIA 2IBZX 5MEPB 1OGAB 4GQ9L 3RX8A 3TFKC 1IRAY 5F1NA 4KTEL 1HH6A 3L1OL 4YHKH 3WMSA 1GZQA 4YHPA 3LCYA 2AJSL 1M05A 2D7MA 1I7UB 3SE4A 4ETYA 3DMMB 1M4KA 2H26A 5IBUG 5DQJA 5D71H 3QIBD 5AEAA 1L9NA 2WBKA 3EYVA 4OB5L 2XA3A 2A9NL 4OD1L 1I7RA 1YN6A 5KJRL 4IMLB 5CIPA 1QQDB 2XN9E 1U3HC 4JFYB 2LABA 4N0FA 4M6NH 5C0BD 1LDPH 5ETUA 5JHLH 2APVA 3ZT5A 3NCMA 4WUKL 4LLYB 5BVPL 3LKRA 3P4OB 3M07A 3MJ7A 4Y4KD 4OI9A 5EORH 4YX2H 3QEGH 3OKYA 4M7LH 4JM2B 2NXZD 3ILQD 2J12B 2R9HC 4X5WA 5DJ0A 3VFTA 4KI5C 2EZ0C 1NFKA 1GGBL 1SM3L 5C0DB 1QP1A 5EB9A 4HJGB 2J4WH 4R4FL 2WM0A 4XBPA 1UXSB 5C07A 2VMFA 3HLAA 5I66B 4PTUA 4QNPE 1MFCL 4JQIL 3CLFL 4OF6A 1MOEA 3MV8A 1RIHH 5E4IA 4PV9A 1L7TH 5C7XL 3A67L 3UDWC 3QP3A 1U3JA 4PREA 4P2OB 4M3KB 3U4BL 4U4BA 2BNQA 5F9JB 3KDMA 4QRPE 1VPOL 4L8BB 3LRHA 4C83B 5HYEA 4JFPB 1F11B 3G5XB 5SX4H 1ZT7B 2OR8A 3CSYA 3GMPB 5T1LA 1FZMA 1KJVB 2NY0D 3BP5B 1XF4B 2CPCA 1S7WB 4G9FA 3VFRB 3H7BB 4PBWD 4F9LA 5C0NC 3IU3B 3MREB 5C0EB 3ARDC 4N9OB 4KROB 4YXLH 1L6ZA 3KWWB 4J6RH 3QEQB 3VH8B 1WBZA 1QUNA 4OZFA 1U8OA 2LU4A 2AERT 5B8CC 4GRWF 4B0MM 4PY8J 4U31A 4BZ1L 2YD7A 3ZT7A 5DHYB 3X3GL 5ADOL 3I6KA 3QFJA 5HPOA 4PRAA 4D3CL 2D03L 3AAZB 3WD5L 1MJJA 2VDPH 5SWSD 2X4QA 1KIQA 4QRSA 5ICZB 4P0DA 5BMFL 3WFBL 3LEYH 2XKSA 1N6QH 4IRSB 2YA2A 4O58L 3TYGH 4TULH 3TN0D 2ATPB 5EIIA 4DEPB 4RAVA 3EO9H 3L5WA 3ARGA 1T89C 1ADQL 3SBWC 3O0RH 1RVFH 1ZVHA 4YGVA 1YEJH 4CRPA 3C8KA 3DMMC 5C8JB 1JJUA 3ZDYE 3HNVL 4P2QD 1FBIH 1WWBX 3RY6C 4YBQC 4GAYB 4ZFOL 4QXGL 1BZQK 4YEFA 1AI1L 5BZWA 2EEAA 4CBPA 4Y5YA 1PY4A 4QTHA 1SVCP 3DUUA 4LCWA 1FFPB 1C7TA 3QQ3A 3VGBA 5CUSL 3LD8B 1AQDB 3ARBB 3MNVB 4O00A 3QB7C 1YEKL 3L3IB 4BSWA 1D9KB 1YNTA 1NBZA 5HHMD 4PV8B 1FAIH 4JM2C 3VFPB 5F9WB 1QRKA 1AGBB 2CMRL 4NRXB 1GRWA 2BY0A 1F42A 4X9FA 4JQVC 4LAQL 3C9NB 1IAIM 4GW4A 5M95B 3VXRB 1P84K 4I4WB 1IC5H 3CLEH 2HYMA 1S7TA 1OQXA 2HTKD 4HWBL 3U36B 1U8MA 2NYYC 1URLA 2VO5A 3A6BL 3WSQH 4OF8A 2FIRT 4X5LA 1PX3A 5IW1A 1CGSL 4LCCA 3GJEA 4L4JA 5FYJL 3EO1B 3BW9B 4L3AA 1NCTA 4ZUTA 2NXYD 2E9IA 2ADIB 4YDLC 4MSWA 4P2OC 3TPUB 1ZLSH 3B5GA 3EOYG 3HPJA 5JDJA 5FGCB 2WNGA 4XP6H 2AEQH 2YK1H 3MYJB 4UTBL 4ODHL 4LSDA 5C0AA 3IFLL 3WKNA 5I1IL 3E6FB 3F8UB 5FYJD 3FQWB 1T03L 3AREB 4YFEA 4P46B 1N3NB 1GOGA 3SDDB 3WJJC 1TVDA 5T3XH 5ERWA 3OX8B 3QWOA 4NNPL 1VFUA 2MKWA 4LOUC 4WO4C 3LOWA 3V4VL 3QFDB 5JHDA 4WW2B 3D2UA 3LS4L 4LDOB 5KS9A 5E0QA 3VFOB 3C09B 4BK5A 3D39D 4KROC 1GC1L 2DB8A 1ZE3C 2OL3H 4CU8A 2LVEA 4X0KA 5E00A 5KOMC 3VJ6A 4MXVE 2DQJL 5DK2B 2X10A 2DBLH 3RGVB 1ACZA 3SE3C 3QRGH 1AD9A 1VEOA 4D9LL 2GJ6B 3MLTB 1T1WA 2B20A 2YC1B 4FQ2H 4NRZB 5FCUL 1K3IA 3D69A 5F89A 1PYWA 1P5UA 1ZWIA 3KPRA 2WBJA 4YHNA 3BN9C 1AE6L 1V7NL 1ZS8B 1QSVA 4DQOL 4XB8A 3ME0A 1GHFH 3TESA 3U4EB 3VI3E 4I0PB 1NGZB 1E6OH 4MNGA 1JHLL 1AO7D 1YYLH 3O8XC 1I1FA 2K1MA 1A9BA 2IGFH 3L3DA 1GIGH 3HG1A 2KQMA 4WJ5B 4IRSC 5HY9A 3OKOA 4DEPC 3ZZ1A 3QNYB 4PJDF 4EN3D 4XBGA 5I19L 2HKHH 4L29B 1RZFH 1VACB 2EH8H 3GGWB 4FN0A 5KSUB 3UAJD 1G7QB 4FQHA 3DIFA 2R0KH 1F4HA 5FO9B 4ZTOL 4Q74A 2YA1A 4X4XB 4YDJB 1K85A 3LPFA 3DVGA 5A2KH 4RGMB 1C12A 3FT4B 3HPLB 1FJ1A 4FTVB 1UWEH 3V79C 2VQUA 5EOTB 4PFEA 4BUHA 2HKFH 4MD4A 1X6NA 5JZ7D 2Q7YA 3FOLB 3LD8C 4GRLA 4DKFL 2EC8A 3ARBC 5I1KH 5KSVB 2ICES 3UYPA 1P4BL 3TLRA 4XPHL 1WWAX 4AEIL 4J1UA 3QUXA 2VLLA 5F9WC 4NPYA 1F4XH 5C2UB 5IEHB 1MUJA 1GYAA 2EE6A 4NIKB 4BFIB 1NCUA 1FYTD 4JY4A 2DIJA 5DGQA 3L5IA 3VFGH 4EKXA 4ZXBD 3IDYB 3IDJA 4OF5A 1CD1A 1OY3B 4Y19A 3STLB 3CFBB 3QIUB 2EKJA 4YZFE 1T3FA 2FD6L 4K23H 4BFEA 1U8JA 3O6FB 5E5MB 1I9IH 4LLUB 5BOPA 5BQ7B 3KPOA 4MCYB 4GFTB 3VG9C 5DJ2B 4PJCB 2Q8AL 3T8XB 2IF7A 1C16A 3WIFA 1A7QL 4DK6A 2YUWA 3TF7C 4L4VE 1QACA 4R26H 1WBXB 2NY1C 2DDQH 4G6AC 3MRMA 3PABA 4JKPL 3RKPA 2ZNXA 3TT1L 1B0GB 4P46C 5HPMB 4JHBA 4MS8C 5T33L 4XRCA 1NCDL 4FFZL 5DUMH 1E4XL 1W72A 1ZANH 1T20A 4K94L 3LS5L 5CMAB 2PW1A 4PS4L 4WHYH 1N4XH 3G5VA 1QVOA 1R3KB 2HN7A 5I1EL 2PETA 4JRXB 4PG2A 2HFEB 1CK0H 1DCLA 1TJHH 4M1DH 3UTQB 4W4OC 4MDJA 4XNXH 3QEHB 3V8OA 1CLOH 5D96B 3GMNA 4K3EH 4RISH 3QUKA 3IETA 4ERSL 1UM6L 3HE6C 1NC4A 1TNMA 3QUZA 4LNVA 3O81A 5B22A 3MBEA 1OF2A 4XPFH 3MYZA 5DD1H 5JPMA 1QR4A 3MV8D 1J05A 1WCBB 3S3SA 5MHSE 3NIFF 5IWLC 1UJ3C 2EDXA 1KLUA 2GUOA 3VD4A 1WAAE 1MEXH 3L3JB 4I0PC 5GS0C 2CLVB 2FX9L 1LVEA 3QJHA 4JFFB 2YOCA 4G3YL 4M6ML 3VRJA 3WNMA 1U58A 4XPAL 1WSST 4U1SA 4F7TB 3GRWA 4IBLT 4UT7H 2W0FA 5C0CD 4WWKC 4P5TA 5I30H 5E99L 4KKLC 2KPNA 4JFXA 4AM0A 5EOCL 3ULVH 4NKDB 1RZJC 2DD8L 1FE8H 4ZPTB 3VMNA 2QBWA 3JUYA 4FP8L 3DBXA 2MHAB 3OAZK 5DS8A 4PP1D 2IH1A 2XQBL 4NJ9L 4F80A 2NY4B 2YZ1A 2WWKO 4P3DA 4BYHA 4DUXA 1ZA3B 5D7SH 3GM0A 4RGMC 1CT8A 3CMOH 1MCBA 2BERA 4POUB 3VDBA 5J1SC 1A6VL 3NN8A 4OF0A 2VABB 2X7LB 4QRUB 5DJZA 4ZS7H 5I1GH 4OLEA 5GISH 4Z7WE 3P0VL 5LG1A 3R8QA 5EWIL 1LE5A 3RNKA 3VFNB 3WO3B 5JUEH 1RJZA 3ELAT 2DQTH 5CD3A 1T04A 5CEYA 4DCQA 5DJDA 3SDXA 4UUJB 4NT6B 2VXVL 4XAWL 2R2BB 1S9KC 2FEEI 5E8DL 5K59E 1YMHB 1YMMB 4OZHB 3UEZA 2CDGB 1P7KB 3KPMA 1KN2L 1KSRA 3MCG1 3OKMB 5ID1B 1TDQA 1M71A 3O6FC 4XCNB 5IP4A 5J1AA 1FO0H 4WRLA 3GSNL 4Q6IA 1LHZA 4JCLA 4S1RL 3C6LD 1R5IB 3NFNB 1EFXA 2YD6A 3QIBC 2A2QT 3HR6A 4ONGL 4RGNE 3QDJB 2HT4D 5LBSL 2ZSVA 5TE6L 3QUML 3HZMA 4PJFE 3KNBA 5GGTA 5HYSB 2VLME 2R1XB 3KPRE 2EDKA 2DYPB 4BUGA 1JGVH 2HJLA 4I0KA 2NZIA 5TQ2H 3SKJL 3O4LD 4NZJA 4HGWA 1BVKB 2CUMA 3PWVA 4KMLB 4X8JB 2P7TB 1CU4H 2YN3A 4GBXA 4XNQB 1NPUA 2NXZC 3ILQC 3OAZH 3Q6FA 1UM4H 4Z8FL 2IQAB 1Z9OA 1FIGL 4GXUN 3P30L 3NABH 4JZOB 4U7SA 5D96C 3WIIL 5DD5L 1NANI 1NMBL 3EYSH 5F71A 4OF7A 4MAYA 2Z8WC 3KLDA 2Q86A 2FCBA 3IRZA 3FOMB 3S4SG 3ALXA 5DMGD 4R7DA 3EZJB 2DQEL 2YMXH 4HXBL 3H6JA 3QXVA 3V2AR 1KIRA 5CS7A 1ZGLA 3UTZB 5DMIH 2EC9T 1HE7A 3LHPH 2CR6A 4CNIB 2IAMD 1DTUA 2OQJB 1IQDB 5BZDA 3AS1A 1NCNA 5D8JL 3CIQA 1IGFH 1DL7L 3N85L 4X4ME 3V52H 5C6WH 1BIHA 1RIVH 3PGFH 4EI5D 1MJUL 2IANE 5D5ME 3RJDA 4H26A 3WJLC 1OQOA 12E8H 3QT2A 4JKWA 1J1PH 5CP3H 3D85B 4JPVH 4R96A 5IHZB 2ZSWA 3TNMB 4LSTL 5SWZA 2B2XL 3L9RB 4U1HB 4NWUL 5D1ZD 2ICEB 4PJ7B 3CXHJ 1HWGB 2Z9TA 3HAEB 3ZKXB 1OTUD 3IGAA 5DMKB 1IEBB 3BKML 5I6XC 5D7KE 1MVUA 3BVNB 4XAKE 1BF8A 2ZJSL 5TGBB 1EAJA 1EMTL 2ESVD 32C2B 4M8VA 3BEWA 2PKDA 2VOTA 3JWDC 4M1CC 1KEGL 4ORGA 3OXRA 3HZYA 3QPXL 3M8OL 4AH2B 1QYGL 5KSBB 3NFPB 2R2HA 1YNKH 2R29H 4UT6H 2DQDL 2W65A 3V8CA 1KELH 4M48L 1J87A 5IF0B 3DXAB 3TN0C 3GBLA 4M6AA 5E2WH 4GXUM 2FO1A 5ISZE 4MJ2A 1JTPA 3BH8A 3MRQA 1A6TB 1DE4A 2CK0L 4HGKC 4OJFH 1IAOB 2ADFL 5KTEH 1CD0A 1HHGA 3BKJL 2NY7L 2WAHA 2BXYA 2BSSB 3S36H 1FVEB 5DVNA 1UVQB 3T04D 2XTJE 2M1KA 1UACH 4H8WL 2G9HA 1HOCA 4Z7UA 2WK2A 2BHUA 3LN4A 1LP9F 5B4MD 2YPLD 5GRYA 2XY2A 1UT9A 1UWGL 4PJEB 1LEKA 5F9DC 2F53E 2XZAL 4JREB 4XVUC 2R69L 4GMSL 1CFVH 3U46B 1JF1A 1ZT4B 1MHEA 4RQQA 1MHPL 4KJYB 1IM3A 1OD7A 5DRWB 5I8EA 1YEFH 1BEYH 4LSRH 5HGBB 1FAKT 1TPXB 5AG9A 5CJBA 4Z77B 1T7ZA 2HTKC 4O02L 2C7UA 3VFVA 2ATKA 3VRIB 1BM3L 1SBSH 5T5FL 1HH6B 3GO1H 4G6FD 4FG6C 1GZQB 3ULSA 4DZ8A 1HKLH 4YHPB 4WVRA 1M05B 4M62H 1LO2H 3S36X 4AMKH 3MJ8A 3HUJF 4LGSB 2H26B 1IFHL 5CBEA 5DQJB 3MBXH 4XVJH 3EYVB 2VLKD 4D0CA 1FNSL 5EBLA 5E9DA 1I7RB 1YN6B 2VZ3A 2NY5H 5CIPB 2Y4SA 4PJAA 4N0FB 5D7IF 1NC2A 1UG9A 1II4E 1FFQA 4BH7A 5ETUB 3OXSA 4S1SH 3SO3B 4HF5H 1ZEAH 3LKRB 1A4JA 4GXVH 3MJ7B 1NQBA 5IVZA 3S35H 3NCJL 4WI5A 4P9ML 2Q6WA 4X5WB 5DJ0B 4I9WD 3ZE1E 3VFTB 1I1AD 5GHWL 3O6KL 4LVNB 4PG9A 4I2XA 1IKFH 1JF5A 5E56A 4QRRD 4AJ0A 4XBPB 4DWHA 3QHFH 1T2QH 1DDHA 1D6VL