1U8OB

Crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 in complex with gp41 peptide eldkhas
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
235
structure length
227
Chain Sequence
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPGAAAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLQTYTCNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY 2F5 (LIGHT CHAIN)
publication title Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine design implications
pubmed doi rcsb
molecule tags Immune system
total genus 38
structure length 227
sequence length 235
ec nomenclature
pdb deposition date 2004-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u8oB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u8oB01
2VITA 4GAYB 4LMQI 1DSFH 3TBVA 2IBBA 3F7VA 1RHHA 4M6ML 2YWYA 3QSKB 3BQUD 4HG4J 3LQAL 3B2UD 3LVEA 4M1GH 2X4RB 4HXAH 1M7XA 3GSOA 4MX7A 5CEZE 1RQ5A 4OJFL 5MEQA 4OLUH 4K8RD 5IB1A 1KIRA 2BNQB 5CAYB 4X5XB 4XPFH 4ELKB 1YYLH 2VZOA 4RAUB 1TZHA 4AEHH 3FQRA 4NN6B 5C07D 3MXWH 3GRWH 5D7IE 1Q9LB 4K9EL 1M7DA 1REIA 2NY5C 2ZPKL 4MXQC 1CDIA 1BF2A 4X4YB 3MC0A 4D9QE 2DLIA 5BQ7B 1R3LA 1E6OH 2ILLA 4PJBB 2CUMA 3MROA 1RVFH 5GGVL 5E8DL 3X12A 5D7LE 5IEHA 1P6AB 3UAJC 4ETQB 1L7IL 3UTPD 1QSZA 5DTFB 3UBXG 2DDQL 2CIKB 4JR9H 2GK0A 4NKMB 1HSAA 3QFDB 4LKCB 2N4IA 3IFOB 5T1KB 1EDQA 3MRHB 3TFKC 5ITFB 4DTGH 5BV7L 3WFDL 3CVHB 4FRWA 2YC1B 4LP5A 4MXQD 3KYKL 1HIML 4R97B 5D1XC 5T3ZD 2YBRA 1K8IB 3HCVB 2XY1A 1OGAB 5ESVB 3ECBB 1AQKH 4A2LA 2DKMA 2B8OT 3T2NH 1YNLL 4HXBL 1T1WA 3GO1H 1QBAA 3VFVA 3UAJD 4ODUB 1HWHB 3MCKA 1PY4A 2PYEE 2I5YL 3BKML 4OF3A 1YPZF 1IGTB 4OLVL 5EUOA 2AJSL 3DX9B 1ACYH 3U0PB 3S9DB 2VXVL 1NC4B 3ZTJG 3TFKD 1J12A 1XGQA 5JPNA 4I3SL 1X3DA 4WY7H 5E95B 3FT4A 5D1XD 3VXRB 4YHLL 2CDFA 4ZXBC 4J1UB 3BW9A 5FYKU 1JK8B 4H25A 1V3KA 4ODWA 3MV8B 4EUPA 3CMOL 5I8EA 5IW6B 1I8KA 5E2UL 5C09A 5ISZE 3SE8L 3E2HC 3QDGD 3S97C 3TBSB 1TVHB 1UJ3C 2WMPA 4H1LA 2E6JA 5CCKH 3QDHA 3QEHB 4GW5A 3MREB 3DXAA 1P7HL 3QT2A 4NO3B 5L2JA 4DQOL 1A14H 5F6HJ 2F53D 4NJ9H 4LL9A 4OZGB 4HIHA 3CFKA 4X5LA 4ZXBD 5HHOB 4PRIE 3IRPX 2ENSA 3GM8A 2Z93A 2WIIA 5DRXB 4O00A 5EN2B 1S9YB 2OP4H 3EDJA 5F1KC 1YMMA 2AGJH 2KPNA 4N0UA 1A9BA 2APXA 1ED3B 3EYOA 4IEFB 4NN7C 1JYWA 4L29A 1NFIB 5J57B 5DD1H 1E6JL 1H9VA 4H5SA 1S9XB 4HC1H 1NANH 4PJBF 3H7BB 2OQJB 3H9YA 4QRTB 2GAZA 3ILQC 4ACPA 2GT9B 1ES0A 1EXUA 5DJ0A 2UY7A 3GEWB 4JFDD 3D9AL 3O2DA 4HLZG 4UDTB 4N8PA 4UIKH 1C8PA 3D18A 3C08H 3MUGB 5GS0L 3L3IB 1G9MH 5AAMA 4DKFH 2IBGA 3VWKA 1MWAL 1NCTA 1CXEA 4HWEL 4MAUH 3KXFD 2BVUA 2V2WA 3W9DB 4OAWA 3D3VD 1Q0XH 2F54D 5DJDA 3BAEH 4DN4L 3WO4C 3HC3L 1U93A 4ESKA 1RAMA 5BRZE 3GSXB 1J9CT 3ILQD 4LSSL 4XPTL 1YNKH 5SWQB 1DLFH 5JLZB 2XN9E 5TJWK 2B0SL 3X14B 3L3OA 1UH2A 4QXWA 2Y06H 3FN0H 1ZLSL 1CXFA 3IDJB 4H8WC 2AXFB 4WTZA 1BREA 4WHCA 3VCLA 4ZPVB 3WDIA 3T0XA 2YD5A 3QXVA 5I18L 5ENWB 3TCLA 1J8HD 2PETA 5JZ7C 3O6FC 1GZQB 1CFVH 3C8KA 1NCBL 5F44A 4CGTA 4L8SA 4WUUA 1FYTB 3GSUB 1VHPA 4MHHI 4LVHB 1Z0MA 1MEXL 2YPKB 5GRJH 3R1GL 2F58H 3DX8B 2FX8H 4ZO7A 4TTGA 2BCKA 4KTEL 3L7EA 4KJWC 4LEXH 4OGXL 5IT2L 3BWAB 5DQDL 1FNEA 3O6KL 2D7QA 2P47B 4EOWH 2Z35B 5GPRA 2KBGA 4I2XE 1DQLL 3KDMB 2FD6L 2ZSVA 3EYVA 4OZGF 1HILB 5C07E 3TO4B 3A67L 4PRPB 4P59L 1PSKL 2DIJA 5JZ7D 3O6FD 5IHUL 3JUZA 1OAXL 3V6BR 4LSRL 3RVTC 3CDCA 4PRAA 5GGRB 1S5HA 2MHAA 2AERT 2DQIH 3CDGB 3WE6B 4GRWB 1RURH 2XACC 1EO8L 3W0WB 2GFBB 2RGSA 5FUOL 3ARDA 4KJWD 2LAGB 1U8QB 1ORQB 3MX0A 5C71A 5CKAA 3VFMB 3ZYJA 3QQ4B 4D9RD 5J9PB 5D71H 1JPFA 5CP3H 4YGAB 5A2KH 3DUSA 4I18B 3TT3L 2X6MA 5IBTL 3RVTD 4OFVA 3RRQA 4JFYB 1R3KB 3X3GH 3B8YA 1HZHL 5IFHL 3RUGA 4RAVA 1TTGA 2NY4B 2KDGA 5EDXA 4NNYB 4AMKL 1P4IL 4K7FA 5JUEL 3D69B 3L3HA 3EJJX 3O6LH 3CFEB 3TM6A 1GZPB 4F7PA 3MGAA 2IFGA 3GM0A 4NCC2 5KG9B 5I1JL 4NUJA 1T3FB 3MA7B 2NY1B 5DZLA 4QGYA 5F7EH 3CZFA 4L4VA 4YFDB 3N9GH 3BP7B 5D7KE 2BNRD 4YBQD 1MOEA 1WIPA 1KFAH 2H8PA 2JIXB 5IBLD 4G6FB 2VABB 4TUOB 3RGHA 2ZKHH 3WCYA 3QDGE 3OXSB 2R2EB 2VUYA 2ZG1A 3TT1L 4G3YH 4QOKB 1XGPA 3BDXA 2VR5A 4PLOB 3MRKB 4UT6L 2JJWA 4YHNA 5HD8C 1OTUC 4TVPL 5FCSH 3KWWA 5ICXB 4EDXB 3E6FA 1A6ZB 1YEKH 5DVNA 1SEBB 5KVGH 1WBXB 2P5EB 4OCRH 3EDKA 1KOAA 2VJXA 4IOIA 4NRYB 2PXYC 4AENB 5DJCA 3WKML 5D93C 4LFHG 3IETB 5H94B 5LJYH 2YUVA 3BYYA 4YDVA 4ZODA 3S36L 3UTSD 3D0VA 4EKXA 4X6CB 2LTQC 3LRSB 5IG7B 3IDIB 4F7EB 4TNVF 5HPMA 1G1CA 2AXGB 4MD5B 1NGWB 3O4LE 3LKSA 2BY2A 2X4TB 3GMRA 3RVVC 3INUL 5F21B 2E9BA 4GRWF 5CZKA 1HI6B 1OTUD 4JFDE 4MJ2A 5DRNB 3MRRB 3O2VL 3V4PH 4W81A 3NFPA 5KN5A 2FO1A 5EC2B 3NCJL 4UV4L 2VDKL 5C08B 5C0ND 2QKIA 1FH5H 4MA1B 1ETZB 2IPKB 2PXYD 4LBEB 4AQOA 4LVNC 4TPRL 2IFFL 3RI5K 2VWEE 3KXFE 3CVHH 3D3VE 4AIOA 3MRBB 2F54E 4QWWC 1UB6A 4Z7OE 4JZOA 5I15H 1EH9A 1A1NB 3WNNA 1NDGA 2I24N 2R39A 3SGDH 5J13C 1JZ4A 2H32B 1A4JB 3RVVD 4L8DA 2LV4A 1IGYB 1SVZA 5E6IA 5EORH 4L5FL 4HFUH 1UACL 4MXVE 2ZNXA 5I6XC 1H3PL 4PRNB 2E7MA 5IOPA 3O8XA 3DXAD 1QPPA 1DBJL 4QLRA 2B5IC 4BKLB 5EB9A 4CNIB 4Z7UB 1DQQA 3N1FC 4ZFGL 2HRLA 4AEFA 3JWOL 1KTRL 4HSQA 2YK1H 3FO0H 5F7DB 4L4TA 3VWKC 4JKKA 2X4SB 3HI6H 1IAIH 3FKUS 4OD3L 4Z0BH 4HX1B 4YHYB 1RZGB 1N5YH 1UADC 2X89A 4JY5L 5DS8B 5C3TA 3Q6GH 1LP9A 5IHZA 2CIIB 3HE7A 3OL2A 5T33H 3IJHB 3IDGA 3T4AA 3NCYP 4TVPE 4BSVB 4OV5B 1CLOL 1AGDB 4LCIL 4HKXB 4NRZB 1UEYA 5C70A 4JE4B 1SBSH 4GG6E 1TFHA 4PJFE 5D2NA 4BFIA 5HJ3B 4DWHA 1QR1A 4GKNB 1VPOH 5IBUG 4DJMA 1QG3A 1FP5A 3GHBH 3VWKD 3LEXA 4ZUUA 1BVZA 5HHMD 1PKQB 5F1IA 5C92A 3U7WH 2VISA 4C56B 1SYSB 1GGCL 1F02I 1AJ7L 2XZQL 3NFNA 1TCMA 4X6CF 4LLYB 2EH7H 4XWOC 4TULL 1UXSB 3PQYA 3HMXL 3MV7D 5HHNB 2PTVA 1NJ9B 4L8SC 1MIML 1B88A 3ULSA 4C59B 4YGVA 3WS3A 2PO6C 2ZUQB 4NZDA 4UUJA 3I6LD 3UPRA 1T1XA 1UQSB 4FTVB 3GUTB 4TSAH 2AI0H 3MUY1 1WLHA 4OGAC 4FQLH 4UV7L 3TBWB 4DK3A 3FB6B 1RY7B 1JF6A 1FV1B 4M00A 1S8DA 3EYSL 4XVUC 4MXWL 4GXUN 5C0AA 3FOMA 4XWOD 5TDPA 3NZHL 3QNXA 5D8JH 3FQUA 2PO6D 4FQJL 4MWFA 3BZEB 4F57L 5JW3H 1KCRL 3IAQA 1WAAF 1U92B 5LG1A 1RFDL 4X7FC 3VFGL 1YEEL 3CSBA 4OGAD 2L4OA 3O4OC 2CLVA 3H3KA 3F6IA 4GJTB 5DK0A 3WUWB 1BBDL 3L5WA 4Z7UF 3QNYA 4XVUD 3UYRL 3QXDB 4X98B 5IB2B 5EZOH 3NMEA 3SJVB 4XAWH 4HPYH 1VFAA 4X7TB 3LKNA 3QUKA 1N7MH 5HI3C 3ZE1F 2W9EH 1J0IA 3QG6B 5L7XL 5TPWL 5DD6A 3MRQB 4U1JB 3QPXH 2GCYA 3G5VB 1J1OH 4FQHB 4Q9BA 43CAB 4OFYD 1T03H 2BNUB 5EU6A 2OTUA 5KVDL 3DPBA 2GKIA 1UH3A 3VI4F 1BQUA 4P2YA 1N4XL 3QUZB 1NAKL 3V52H 1XF2B 4A6YB 4OZHB 4UQ2B 2W1NA 3OKNA 1A7RH 3PABA 1S7WA 1YEFL 4NKQB 3RKPA 1RIVL 4X8JB 3WHXB 2NXYC 1EJOH 1INDH 2Y25A 1HXYB 5JA9A 4XNUH 1WIOA 1A7OL 5F96H 2OYPA 1FE8H 1YEDB 2VLKB 5HI3D 3CC5A 2X7LA 3OB0K 4OZFB 3IF1A 2VXUL 3GJEA 3MUHL 5EUOE 3U4BL 5CZVL 4GRWH 4ZFOB 1M05B 4JFFD 1KELH 1MRCL 3QIBC 4EQ2A 4HUUA 2HVJA 3HNVH 1W2KT 3LS5H 4KI5F 1MF2H 3HZMB 5C0IB 3UTZB 3NTCL 5F7LB 4JG0H 1W72A 4MLIA 1B2WL 4JRXB 2ITCB 5FYJD 5D2LB 2EXWD 3V8OA 2QADB 3LMJH 4NHCL 4L4VD 1S7RB 3PL6A 5C6TH 4XCFH 4BZYA 1P84K 4BJLA 5GSVB 3MLWH 3VH8A 3ZSSA 4KK8C 3B9EA 3WD5L 1R24A 5C09E 1MJJB 5KAQF 3P73B 2P4AB 2XT1B 1LO0H 4ZOBA 1CS6A 3KNBB 1KIPB 5C0CB 5F9DC 1N0XL 5K9OB 1ZTXH 3AGVA 4P23A 5ESQA 3QIBD 3NA4A 2KH2B 4ZPTA 5GS3A 1GIGL 3DXAE 5E1AB 4PJEB 5T1DH 2VO5A 1HHJA 3BE1H 4GAGH 3EOBB 4PJ5A 2OM5A 5LCVH 5F9JA 4ZMAT 4BA8A 2VERN 4CW1A 3MGOA 3SQOH 3QCUL 5TGBA 1BVLB 2X4PA 4BZ1H 1QFWM 5A2JH 1NGZB 1YC7A 1YMME 4N0UE 5DWUH 2BP3A 3MV11 4LCCB 3FB7A 4R4FL 2HN7A 2ADJA 4JREB 2DWEA 3DYPA 3GJFH 5CD5C 1AO7B 2WQ8A 4R96A 2BSTB 3OAZH 4GW4A 3K2UL 4MYWB 4Z7WA 1QBLL 2DM3A 2FWOB 4ZFFB 3WUZA 2DBLH 2CR3A 5TE7L 2FNBA 4JHBA 5LWYH 4OGYL 2ATPA 4JY6B 5A40E 4N8CH 1OWRM 1UEMA 5D72L 3O8XC 1C5DB 3BT2H 2V5SA 3G6DH 1LK2A 1S78C 3PNWB 2OR9L 2EIEA 3MGTB 4RGNC 5TE4H 3L3GA 4QRRA 4OZHF 1RUQH 3NH7H 5HHME 5IHLB 1N8ZB 4DCQB 1CL7L 5CIPA 3NIGF 4WO4A 4P99A 3HI5L 4NJAH 4U1GB 4NN5C 2AJVL 5CD5D 2Q76A 1A1MB 3HE7C 4G8EB 5HDBE 1DQDL 1P4BL 1IMHC 5EZJB 5E9DA 3I6LE 1EEQA 4NQXB 1J05A 4PGBB 4L3CB 1NPUA 4KJYB 4MNGA 4OCSL 1NFKA 2HH0H 3O8XD 2J8UA 4KKCC 4P2QB 3PHOB 1XIWA 1ZHNA 2VAAA 5D2NC 1S78D 5EOCH 4RGND 4FFYH 2GW5A 5T3XD 5D7SH 3MO1B 3DSFL 3P9MB 5DGRA 4Z5RA 1BFOB 2D7TL 1HYSC 4IMLB 1A5FH 5D2LF 1JGLL 1UM4H 5EPMA 5K59F 1AP2A 4GOSA 2L0DA 1D5ZA 2WANA 4O2EA 3VI3F 2X89D 3G04B 4WUUE 1WBYB 2BMKB 2B4CL 5I19L 3HE7D 3FOLB 3HRZA 1LE5A 5IV2A 1S5IL 4JFED 3T0EC 3QRGL 2YOCA 3O2WH 4KKCD 2RHEA 4Y2DA 5ERWA 4PJEF 1N26A 5IGXH 1F58H 4LSQH 3HNSH 1GPOL 1HYSD 2OL3B 2QLVB 2XZAH 3MRGA 1KEML 1T4KB 1LO2H 5BS0B 1PYWB 4GQ9L 2SEBA 3CXHK 3WLWC 1CLZH 5ID1B 4XCEA 4S10A 4PGCA 5L8LB 1LEIA 4C83B 2FL5B 3T0ED 1E28B 5ITBH 1FGVL 1ROWA 4Q2ZB 1A21A 4ZS7H 1G7MB 4XZUA 3ZT7A 1ZLUH 1UWXH 2ICWI 3CFBA 4K3EH 1OM3L 4XP1L 2GJJA 5GGTL 3BD3A 4Z7QE 1BECA 1KXQE 3WLWD 4RGOH 4IS6A 1KIQB 3IFLL 5AYQA 2WLYA 4U7KA 4X99A 1IT9H 4HWZB 3NCBB 1IAOB 3RUGE 4MD4A 3EO1A 4CUCA 1H0DB 3V9FA 1IQDB 1OP3H 3B9KB 5EZIH 5HBBA 3U2SA 1P4LA 4XC1L 2RIKA 3GSNB 1I4FB 2FCBA 3QI9B 3T0BA 4XNYH 2YZ1A 2QQKL 2IGFH 1H15B 3RDTB 2Z31B 5BZDB 3ZTNH 2FHCA 3I2CH 4IIQA 1L6XA 2R4SL 5FYJE 5MHSD 1DANT 5LAXB 1KN2H 4L4VE 3DIFB 5CLWA 4RFOL 5SV3A 4XBGA 4OM1H 1IGFH 4D3CL 4JFXB 1OQOA 1VGKA 1MHCA 3QEUB 4OF6A 4UB0L 1QSEB 4EI5C 3RWGB 4NQCA 5DQ9B 5DFWH 4HHAB 3VXSA 3S3SA 3CLFL 4QHLA 3U1SH 2F8XC 4XVTL 4BK4A 4ONOA 2F19L 4G9FA 1G7HA 3RWJB 3TJEL 3P9WB 4WU5B 1BZ9A 5CWSA 5EBMA 1FDLL 1ORSB 2I9TB 1U8NA 5CJOH 2FATL 3ARBA 1JGVL 2B39A 5FEBA 4YIQA 4HMEA 3BZDA 2EZ0D 1EV2E 3WNOA 4MJID 5CHNA 4CN1A 5I1DB 1BX2A 1DDHA 1MFBL 1JHLL 1KPUB 4WUKL 4JFHD 5IUSA 4M7KL 4ZO9A 4R4NC 3MRCB 3PGFL 2DI9A 3VFTB 2J3SA 1T83A 4EI6A 1LK3H 4XNZB 1QLRB 5DEFA 3M17B 3C2SA 4ZSOA 4HEME 3SKMB 4AH2A 3UJJH 1LDPH 3VU2A 2XTJB 1OGTB 4FOMA 4UT9H 4JKPH 4PRBB 3MFFB 3HFML 1RIUH 5D1ZB 3VXTB 1MVUA 2IAMB 3ESUF 1FO0A 1D5BA 2EDBA 4A6YH 3PWNB 3D2UA 5FECB 3HAEB 1F4AA 3FO2B 2E3VA 3GNMH 3Q6FA 1KYOJ 3MJ6A 1DQJB 4R4ND 3V5KA 1KCUH 5IR1B 1CXHA 4OM0L 1HDMA 1YN7B 1Y18B 4Y19D 5I74C 2EDOA 1DFBH 2VH5H 1W0VA 2DQGL 3BH9B 2I60L 3MLYL 3VFPA 5JA8B 1GSMA 2E9IA 5J6HB 4R26L 4P23D 4Y4HA 4OZFH 3RWIA 3FONA 1EAPB 4B7IA 4BQ6A 5J12B 2AKRA 2XQBH 2VLRA 2YXFA 3AU1B 1YJDL 2VQTA 2O61B 1KB9J 4BSJA 4PJ5D 1FL6A 2ITDB 4YWGL 5T3XE 2LE9A 4LRNH 4U1NA 3TIEA 3X13B 3I3BA 3C09C 1NGQL 3EYUH 4R2GC 4HKJA 1U8HA 1UWGL 3GKWH 4OD1L 2IJ0C 5E94B 4L4TE 1QRNA 1MCPH 2OJEB 2FJFB 1U58B 3ZDZF 4ISVB 3OJDB 4XVJH 1I9IH 2OZ4H 5F9WC 1UKQA 2ORBH 4M93C 1AXTH 1LP9E 3K4DA 4AM0A 3QAZB 4FFVC 3AREA 5E2VL 2B1AL 3GIVA 2GJZA 3L95A 1G0XA 1D5MB 1EAJA 1AKJD 2ZCHL 3F6LA 1UCBL 3I75A 1MHEB 5D2NE 5I71B 2C4FU 1A9EB 3FJTA 3HS0A 3E6HA 4R2GD 4HK0B 4PLKC 1RV6X 4NQUA 2VSDA 4QRRD 4L9LB 3MRJA 5FGBC 2NCMA 2VIRA 1UT9A 3L7FA 5DJ6A 3F7YB 4OCNC 2K7QA 5HGBB 4HK3J 3C2AL 4YPGA 3EIFA 2P24B 1QKZL 3FB8A 3PQYE 2EYRB 2QSCL 5IKCA 5GHWH 2XPGB 2P5WB 1IQWH 5H37H 1I9JH 4NYLA 4TUKH 5E9DD 1CR9L 3V7AE 1TZIB 5DRZA 32C2A 2AP2A 1ZWIB 2UUDH 4PLKD 4Y2DC 4Z9KB 2ICES 5FOBA 2CUHA 1MLCB 4HS3B 1FNGA 4KDVA 4WDIB 1R3HA 3QNZB 1X5FA 5ADOH 4D0DB 3VXOB 4M9PA 2DQCH 1E4XL 4O51B 3UEZA 1IEAB 5C0AE 2HA1A 4OF7A 1XCTB 3CXDL 2A83B 3KPRA 3ZHLA 2W0KA 4ODVL 2QBWA 3MLVH 5DFVC 4J7RA 4ODXB 1W0WB 1YPZA 5DJ8A 1QBBA 2XWBA 3DHJA 4P5TB 1I1AC 3QR2A 2Q8BH 4R7DB 5E24E 2H6PB 2MCPL 5E6YA 3CPLB 4WCYL 5C7XH 1JMXA 3NAAH 3RY4A 2VZSA 3HUJB 3PGCB 1CICB 4R6UA 1PY9A 4Y2DD 4F3FB 5MHSE 5JXAL 4CADB 2R1WA 4Z7NF 5C0DB 2K7PA 6CGTA 2YD1A 4F9LC 1HH9A 1DBAL 3RTQA 4ZUSB 2VZUA 2V7HA 3TBTA 2IMNA 5IVXA 3HZKB 2BRQA 1OT1A 1B6UA 5IK3B 4G7YH 5KSAC 2PR4L 4GAYA 5DFVD 4LHUA 2WV3A 5JW4M 3KPMB 4YHKL 1JTPA 1I1AD 4OLEA 4X4MA 2E9JA 1AY1L 5C0BB 5IJKC 4FG6C 3VRLF 4ONHB 4JB9L 4U1HB 4MVBC 5D70L 1A64A 1KJ2L 3VXPB 4QTIH 4R90L 1CF8L 4R8WL 3IU4H 5EU6E 3ZDYF 4X5XA 4MQ7B 4K3JL 5CILL 4ELKA 35C8L 4JGJA 4D9LL 3L5XH 4RAUA 4Y4FB 1OHQA 1ZA6A 2NYYC 1TITA 1FG9C 4L4JA 5LGKA 4U6YA 1MCNA 3NFSH 3OX8B 4KVNL 1CLYL 1EBPA 3CGTA 2FB4L 3GMLB 1Q9LA 5KSAD 4FP8L 4JFHE 4X4YA 1FRGH 3Q1SL 5BQ7A 3ORJA 4S11A 1QUNA 4FG6D 1NAMB 2KL6A 3U7YH 1SMAA 3AC0A 4MVBD 3VFRB 1Z5LB 4ETQA 4OLXL 5DTFA 4M48H 2CIKA 3T77B 1H8OA 1DUZA 1X5AA 4LKCA 5GISH 3O6MH 1VGEL 5EA0H 1A6TA 2NYYD 3IFOA 5T1KA 3MRHA 5ITFA 5MP6L 5CEXB 5E2WL 1U3HB 2X4NB 4NQVB 2EEAA 3HCVA 1K8IA 5ESVA 1OGAA 3D25A 4ODSL 1YY9C 4NQCD 1KNOA 5K9JH 1DSFL 3VXSD 4ODUA 2HLAB 3LKOB 4PJ8C 3FT3A 4HH8A 3RIFK 1IGTA 1A3LH 2IANB 4BH8B 4FQQB 4G9FD 3WXWH 5C1MB 3GSNH 4GBXB 3LH2L 4UOW0 3U0PA 4OLUL 4PJ5E 1NC4A 1IM9B 3HUJF 3C5JB 3KYOA 3OV6A 3GKZA 1I9RH 3PDOA 4FFWC 1RZIB 3B5GA 1AFVH 2XQYG 4AEHL 5I17B 5TDOB 1G9NC 3MXWL 2O93L 1JK8A 3GRWL 1B0RB 3MV8A 4LRIC 3ILPB 4BQ9A 1YY9D 2AXHA 1W0YT 1IC7L 3BZ4A 3WHE0 4BFBD 1OTTC 4PRHD 1P53A 3S6CA 4K94C 2IG2L 1TVHA 4PJ8D 5J3HC 4BFGA 4Z7WE 1E6OL 4ODHH 3QA3B 1FNSH 5HHXH 1RVFL 3PWPA 1F3DJ 3V6ZB 3MRLA 3GB7B 1MCCA 2WUBH 1AGBA 3QUMB 3MREA 1UFUA 2EDJA 3BPLB 4NNXA 5CP7B 1MFAL 4FFWD 4KMLB 3QIWC 4QRRE 3BP5A 4DTGL 4QHMB 4IRJC 5D7JB 3ABZA 3RHWK 5DRXA 5FAAA 4CVWA 5EN2A 1CL7I 1S9YA 2CD0A 3M1BB 4YNYB 3Q2CA 4HZLB 1ED3A 3MR9B 1AQKL 1NFIA 4MNHB 3T2NL 1S9XA 3GO1L 5DD0H 1KGCD 4N9GB 1FZJA 5E9DE 3AREC 2OQJA 2NZ9C 3UTQB 1AR2A 2KZ1B 4QRTA 4JO3H 4G7VH 4MNGE 2ADFH 1CU4H 4RZCB 2D7OA 2J8UE 2VLRD 3LKQA 5B38A 3CX2A 1ACYL 1I7RB 1XGTB 4UDTA 4KQ4H 4X7EC 3MUGA 3QIWD 2GHWB 1QFOA 1NUDA 3BPNB 4JM4H 1MI5D 2AEIT 4I5BA 1CGVA 5I30H 1MJ8H 2I9LA 2XWTB 4WY7L 3P0VH 1QRND 3TA3B 4M7JH 1X4YA 5FGCB 2DQJH 4QCIB 3W9DA 3HAEH 3MJ9H 1PG7H 1MCWM 2PW1B 1E4KC 1GC1C 4S1QH 2O5XH 3ARED 2NZ9D 1Z2KA 3AB0C 5GSRB 2X5PA 1RZKC 1DZBA 1K6QH 5CCKL 4NM4H 5CGTA 5DF0A 5EU7C 4JANB 4XP6H 1PKOA 4Y5XB 1S7UB 4OZ4A 3L3JB 1CFNA 1BWWA 4I9WE 4HIIB 1A14L 4NJ9L 1G6VK 3IDJA 1AC6A 2AXFA 5B3NA 1LD9B 5INDA 3SGKA 4L8BB 3MTRA 1FIGH 4TOYH 5ENWA 2OP4L 1GZQA 2AGJL 5EFIB 4MAYB 1FYTA 3GSUA 5A2FA 5DD1L 5JHLL 4OFIA 2ZUWA 2YPKA 2FH6A 3CX5K 4IHOB 4HC1L 1NCDH 1V5JA 2W65B 1A4KA 2A77H 3DX8A 3V5HA 4JO4L 1RUMH 3NCYS 1FC2D 5DMGC 2CRZA 2YSSB 5HGAA 3CFJB 1JJUA 2CK0H 4OQTH 2Z35A 3C08L 5IFJB 1G9ML 3TO4A 1HILA 4PRPA 4DKFL 3RTQC 1FO0L 1DN0B 4RFNC 5K9KB 3LQZB 4WI9A 1Q0XL 4KRLB 5GGRA 1YZZA 3BAEL 5HGDB 3CDGA 3UTOA 1OARH 1SJEB 3WE6A 1NLDH 4KZEH 4S1DC 1BP3B 5HVGB 1N6QL 1BQLH 3W0WA 2H9GB 2G2RB 1YNKL 5BCAA 3ULVF 4E41D 1ORQA 1PGRB 4LLWA 4RIRB 5H35B 2IPUG 3TWCL 3VFMA 2DTSA 4DGYH 1QFWH 3QQ4A 2VYRE 4HUWB 5J9PA 5IROA 3GK8H 1C5CH 3TN0B 3M8OH 3D39A 3SDCC 2Y06L 4OBRA 3RTQD 4LHJB 2HLFC 4I18A 2X1WL 1DQTA 2QQQA 5L6YL 2IH3A 1X6LA 1IFHH 1HH6B 4JFYA 1R3KA 4DAGH 2J5LB 1CE1H 1CD8A 2C4XA 4LHUD 4NQCE 3WIFB 3X11B 1F4XH 1CFVL 1C7TA 4JY4B 5ALCH 3VXSE 4S1DD 4LGPB 1OF2A 5BVPH 4WHYH 4XH2B 3FN3A 5SX5K 3D69A 4WI3A 4LPVA 4AIXA 5KOMC 4G9FE 5SV4A 3RGVC 3NIDE 1GZPA 4XRCB 4C4KT 5GRJL 1XGRA 2F58L 2RFXA 1ND0B 2WINA 5KG9A 2VKXA 3DUUA 5J0BA 1T3FA 2FX8L 3QBTB 3W39B 4J3TA 1EERB 4NQDB 2Y36L 4LEXL 1OOAA 3SDCD 3N1GC 5EWIH 1NKRA 4EOWL 4KHXH 2HLFD 1OW0A 4LNVA 2AEQH 1DR9A 5KANI 2P44B 4IDJH 5J6GB 3ZHKA 4HQQL 4JHAH 5ANMB 4R97C 1I3VA 2JIXA 1FORL 2VABA 2W60B 4TUOA 1G7QB 4TRPH 5C8JB 1RK0B 3IDYC 3OXSA 2DF3A 4OIIH 4U49A 1RJZB 2DQIL 3H0TA 3VRJB 4HUNB 1RURL 4QOKA 4ZSOE 3Q3GB 4D0BB 3MRKA 4WFEE 1I7UB 1CT8A 4LSDA 1Z0NA 2R29H 3D5OF 1Y6MR 5ICXA 4EDXA 4NNPH 1SEBA 5DRWB 1WBXA 4LPCA 2FLBT 3MFGB 2ZZUT 4IBLT 4AENA 5D71L 3IETA 5H94A 5J89A 2DL9A 2AJYL 3BPCA 1OGAD 1B0WA 4X6CA 5HYIA 3FCTA 3ZE0F 1NL0H 2NY0C 3IDIA 2D3VA 3NGBB 3IDMB 4F7EA 1KGCE 3NVQA 3OAUH 4OUUB 2AXGA 4MD5A 1NGWA 1NAMH 2XA3A 1AD0A 2X4TA 3FMGH 1DEEB 3O6LL 4S1SH 2VLRE 3RNQB 1HI6A 2V17H 4JCLA 5KAQG 4M61B 4PB0H 5DRNA 1KT2A 3MRRA 5C6PB 3DO7A 3B9DA 2VNCA 3T0DA 3IJYB 5EC2A 1B6DA 3QJHA 1YA5A 5C08A 1ETZA 2IPKA 4LBEA 2QQNH 3WHE1 1YNTB 3MACL 1CFSB 1U8OA 1V8HA 1ZT4B 3BO8A 1QRNE 3RY5A 1DBBH 4GKOA 2VR9A 1EHLH 5F7EL 2BVOB 1SJHB 1MIEL 3BSZH 1J0ZA 3MRBA 2NXZB 3N9GL 3VDCA 2NY0D 3PJSB 3ZYZA 3BEVA 3QXWA 1KFAL 2HVKB 4JQVA 3WUWG 2DQDH 4EVNB 5HVFB 2H32A 3D85B 1FZMB 1A4JA 5HHPB 2BOCB 3LS4H 2X1PA 3KPOA 1JNLH 3PWPD 2WBJB 3RA7H 1ODAA 4G3YL 4QHKI 3WFBH 1PG7X 5DK3A 4PRNA 4NT6A 1RHFA 4OIAA 2A6IB 4BKLA 4N0CC 4CNIA 4Z7UA 4JLRA 3EYQC 5KVGL 4QNPE 1KXTB 1I1YA 4OCRL 1MFEH 1ERNA 1D5IH 5F7DA 2ATKB 3PP3K 5LGJB 2Z8WC 4X80H 2X4SA 1NDMA 1M7IB 3PGDB 4HX1A 1RZGA 2BVQA 2ZOLB 4Q9QH 5IVZB 3UJIH 1AGFB 3TLRA 4U6VH 2CIIA 4X4XA 3IJHA 2FBOJ 1UWEH 4G6KH 1F8TH 3SE3C 3P4OA 4BSVA 1AXIB 4JJHA 1Z9MA 4LVOC 4OV5A 4Q6IB 4L8CB 5EU7E 2Y07H 4HKXA 4NRZA 5IVNA 4BQBA 5EO0B 4N0CD 1A7NH 2X4UB 1IARB 4P9HL 5CJQH 3EYQD 5HJ3A 5IIEB 1IAKB 2YD2A 2ZCLH 3V4PL 4GKNA 1IRAY 5SWZD 3SHSA 1OWWA 3QUYC 4LDEB 2ZUVA 4OZFG 4FZEH 4GRMB 3WO3B 5TH2A 4KV5F 2MFNA 4NUGH 4IRSA 1I7ZB 3CVHL 1N2RA 3KPRE 3SGKC 4C56A 1SYSA 1OL0A 2EEDA 5CSGA 1YPZE 3IDUA 3U82B 5HHNA 1NJ9A 3S4SB 3PWUA 5TDNA 5HYEA 4HKBB 1UA6H 2MSPA 5DI8A 4FMKA 4M43H 5DHVB 1JBJA 4C57C 3T65B 5EORL 4HFUL 2YPVH 3VDAA 5FV1L 5L88H 3GUTA 2MPAH 4PV8B 4JM2C 4MB3A 4BQ8A 3QUYD 4KTYA 4Z8FL 3TBWA 4PRDB 3FB6A 2CK2A 2W9LA 1EEZA 1FV1A 1NUGA 5IVXE 3FO0L 1WICA 4PP2B 3AM8A 4QYOB 1T0MB 3Q0HA 3HI6L 5EO1B 2VQ1B 1IAIL 3EGSB 2EE9A 1G6RA 2VSCA 5JPMB 1FYTD 4X4ME 1PG7W 3VE0B 1TETH 3Q6GL 3BZEA 5T33L 1R0AH 2OK0H 3ULUF 3OJ2C 4WU7B 4QHUB 3T0VA 2GEEA 1U92A 2BK8A 4JM2D 4P46B 4U2YA 1SBSL 2HP4A 4M3JA 4GRLA 5JW4N 4UQ3B 5EIQA 1ADQH 1JF1B 4UBDC 3N85H 3FO9B 1OTSC 3WUWA 3PV7A 2X4QB 3FQNB 4G6AC 3QXDA 1NCAH 3H2WA 4WW2B 4R0LB 5I73C 3BIBX 3SJVA 4HDIB 1BFTA 2JJSC 3LDBB 3U7WL 5FA4A 4X7TA 4Z78B 4G6MH 5BO1H 4P9MH 1QLEH 2QHLA 3EO9H 3QG6A 4LCWB 1L7TH 3CUPB 4R9HA 3MRQA 1H8NA 4QRUB 1XGYH 3W0WD 3QDMB 3G5VA 4FQHA 4U0QB 3H9HA 3HRPA 4NKIH 4CDGC 4UBDD 3TPKA 1CGUA 2BNUA 3KPSA 3BRGC 4TSAL 4KROC 2AI0L 3W2DL 1TZGH 2OSLB 3QUZA 4KJQC 4NHUA 3VW3H 4G6AD 4K07A 4OZHA 1BFVH 4FQLL 3S35H 3D39D 2AXJA 1WZ1H 2XG5A 5HYJD 1OW0C 4PLNC 5HSFA 1OGAE 4I13B 3BJ91 2YS4A 3CU1A 5HY9B 1XR8B 1DCLA 1YEDA 5B39B 4HGKC 2NY4D 1K5NA 1QBMH 2ZCKH 4MA7L 1HEZA 2VXQL 5D8JL 5T1LB 4XNXH 5JW3L 3DETD 1JPGB 1F97A 1M05A 3HZYB 4KRPC 5GJTH 5HGHB 3VFUB 4NWTH 2ADGB 5JORB 1F6AB 1F13A 3HG1B 3MOAH 1CBVH 4KROD 3BP4A 4RMTA 3UTZA 5C0IA 3DRTA 4KJQD 1X5XA 1F11A 2KZWA 4WGVB 4JRXA 2R0WH 2NY1D 5DJAB 2ITCA 3DNKA 4LASH 3SY0B 4P2OC 1CDGA 1S7RA 4F8QA 2LABA 1UJTA 3MV8E 4GT7A 2A0LC 5GSVA 1OAQH 5DYOB 4BH7A 1EGJH 2JIXD 3DROA 5EZOL 4XAWL 3P73A 3P3YA 3KLAA 4JZJC 5C0CA 1KIPA 5K9OA 3P77B 5IF0B 3QRFM 2NTSP 2W9EL 3KYMB 3PWPE 4K3HA 4KRPD 5GRZA 1QSFB 5T1MB 4R3SB 3QIUB 5IQ7L 4YHMH 3PWVB 2BVPB 4PJEA 3QPXL 1O7VA 1GHFL 4ZTPH 1T03L 2H26B 4E0RB 3R8BB 5INCB 2CKBB 4G8GA 2PNDA 1EZVX 3K4AA 1CD0A 3IDXL 3MNWB 2P8LA 3V52L 1XH3B 2DLEA 1OCWH 1BVLA 1A7RL 2A0LD 5DZOA 4DKAA 5CGYC 5E8PB 1NGZA 1FFPB 3V0WH 1EJOL 2CLZB 5IFAH 2C9AA 4LCCA 5JHDD 4WW2F 4XNUL 5HHVL 3T4YB 5F96L 1FE8L 1VEMA 3QG7H 5IM7B 1ZLVK 1AO7A 4JQVC 3LD8B 1DLHA 2BSTA 1KN4L 3UMTA 2FWOA 2MNUA 3TYFA 4ZFFA 5GIRB 1T2JA 2NNAA 4NBZB 4JY6A 1KELL 2AK4D 4YO0A 3QXAA 1WTGT 3JXAA 3HNVL 3LS5L 4NP4H 3GMOB 1MF2L 1T5WB 5C0FA 3V4VL 4JG0L 3Q5TA 4U3CA 1M1SA 3MGTA 5CGYD 4J4PC 1N8ZA 1MCSA 4DCQA 3G6JB 3LMJL 4OCXH 3T0WA 5F6IB 3R06A 1QZ1A 4XCFL 5LBSH 4KY1H 3MOQA 3MLWL 2PF6A 1F4YH 1LO0L 1A1MA 5DMJB 5FUCC 1ZTXL 5EZJA 4NQXA 2WWKO 4PGBA 1K4CB 4KJYA 4Q9RL 3QYCA 2FECL 5I16A 1MQKH 3SDDA 5T1DL 3OGCB 3BE1L 4GAGL 3QDJB 3FQXB 5LCVL 2I25N 3J8F7 4J4PD 3MO1A 3P9MA 2BHZA 4MDJB 3SQOL 1P7QD 2J7LA 1BFOA 4IMLA 2GSIA 4BZ1L 1TTUA 2OR8A 4B5EA 1JGDA 4IRSC 2EDNA 5DWUL 2Q3ZA 5JW4Q 1FYTE 2BMKA 1D5XB 4JPIB 3FOLA 1KG0A 2BFVH 4KQ3H 4XCYB 3ULUH 3U9PH 3MNVB 4D2NA 2FX9L 4TNWK 2DBLL 3VJ6B 1RUAH 1IBGL 5LWYL 4NFBA 5E4EB 4Z95H 5TQ0H 1BZQK 4JJ5B 2XRAH 1AHWC 3DVGB 4J23A 3BT2L 2G60H 3NABH 4PRPE 2OL3A 3G6DL 3FRUB 5JO5B 3T8XB 2IQ9H 1ZOXA 1T4KA 5TE4L 1RUQL 3NH7L 1N5AA 4IRSD 2DICA 3GMQA 3SDXB 5ID1A 3AM8C 1IGIL 2MQCA 5FYKH 1ZT1A 1XF5B 5BVJA 4NJAL 3LCYA 1MQ8A 1DQMH 2GTZB 4C83A 4OI9A 2FL5A 2KKQA 4LHQB 3OR7B 3IVKA 1I1RA 4YXLH 3W0WE 1H5BC 3HAEG 4Q2ZA 5I1HH 1HSBA 4YC2C 3QHFH 5AWNH 3HB3C 2HT4C 5EZLB 3MBXH 2HH0L 5IEKB 3P0GB 2PCPA 4JRYD 4GRLC 3D39E 1FAIH 4YDJB 4FFYL 2PUQT 3QCTH 5MENB 3PE9A 4AY0A 3QO1B 1KIQA 1A5FL 5EU3B 4HWZA 1DEDA 1UKTA 3G6JF 5E7BA 1AGCA 3S35X 1IQDA 2RCSH 4H20H 1FCCA 3B9KA 1TQCC 3PHSA 3H6JA 2YD6A 5LXGL 4MGXA 2FEEL 3DGGA 1TQBC 3GSNA 3HB3D 1I4FA 2HT4D 2BX5A 2HJFA 5DHVH 1H15A 3O2WL 4ZS6C 2DBJA 4GRLD 2OLDA 5IMLB 3W9EB 1TENA 3GSWB 2DMBA 2VXTL 5GGSY 5IGXL 3HC4H 2BSED 1F58L 3LN5A 3HNSL 4NDMB 3BKCL 4XPBH 4RMQA 4XXDB 2XZAL 2GTWA 1WC7B 2Y6SC 1A7PH 1DBML 1CLZL 4U1IB 4MJ5B 2BVEA 1QO3B 2ID5A 3BEWB 2J6EA 3U0TA 5DQ9A 4N0FB 1JNNH 2JJTA 1MNUH 4HHAA 3C60C 4OFPA 4CU8A 2J4WL 4QOKE 3D1MC 3GMMB 5F8RC 4WU5A 4ZS6D 1OSZA 3AS3A 4MS8C 3B3IB 3KPSD 2AJXH 1U2HA 1WZMA 3MLUH 3QUZD 1QYGH 4OZIB 1KJVA 4AEIH 4XP9L 2MKWA 2AJUH 5ACZA 1A6PA 5I1IH 4RGOL 4X6CE 1IKNC 2HJKB 1RZJL 1XR9B 5BXFB 3M07A 5C0JB 2IQAB 1IT9L 3SDXF 3P4NB 3MRCA 3KPPB 3C60D 2NY6C 1NC2A 3VFTA 3CFCL 4KUCD 2Q7YB 5EZIL 1QLRA 3M17A 1JGUH 3A6CL 5D1QB 4MS8D 3NPSC 5CINH 3SKMA 4XNYL 2IGFL 4WHYG 5C08E 3MFFA 3ZTNL 3I2CL 3VXTA 4GLRI 1ZMYA 1NGXA 4KH2A 4NQEB 2Z9TA 4JDTH 1KN2L 3PWNA 1SVCP 3FO2A 5IB5B 4YR6A 4UT7H 3TESA 1DQJA 3JWNC 4OM1L 3ROLB 1YN7A 2NY6D 1IGFL 3SKJH 3DWTA 5C0CD 1RD6A 2JELH 3BKYH 4LLAA 1GGYA 4HJGB 3BH9A 4PJ9B 5MERB 1JZ3A 4NIKB 3V4UL 1QHPA 1FZOA 3U1SL 5J6HA 3I85A 1FLTX 1EAPA 2QEJA 2OI9B 3AU1A 1RIHH 1OP9A 1F6FB 2YPLD 2O61A 1NSNL 3EOAB 1OB1B 2Z92B 4Z7UE 3U4AA 1O5DT 3VXQB 3KLSA 3OKMB 4G8GD 3IKCB 4KXZI 2ITDA 5CJOL 5ECJE 3X13A 4HFWA 3HR6A 1BOGB 1CN4A 2YD8A 2FJFA 3TNMB 1U58A 3V5DA 3ZKXB 2VDOL 4FQXB 5B8CB 3ZE1E 4XNMB 3NCCB 4HW6A 5FUCE 3QCVH 4HCRA 5HHQA 5ICZB 1A6AB 4YZFE 3H7LA 2R69H 5BOPA 2CRMA 1LK3L 5EUKB 3UZQA 2GI7A 3SKOA 4C55A 3QWRD 3MBEC 1MHEA 3KJ4B 3MRPB 3VI4E 1A9EA 3S37L 1LDPL 3DARA 4P3DB 4U1LA 3CIQA 3BUYB 4UT9L 3SDDC 4JKPL 5D5MB 4HK0A 2FJHB 1RIUL 2CKBH 3T09A 2MKLC 1YEIH 4X6DB 4OZIF 4L9LA 3VG9C 4A6YL 1T20B 4C56E 3LKPA 3F7YA 3GNML 4F2MA 4XCNB 4K3GA 4F9PA 4B41A 1GCFA 2P24A 5DURB 1KCUL 3C9NB 5SWSB 2EYRA 2OBGA 2PN5A 4QXTA 4FNLH 1DFBL 2VH5L 2XPGA 2P5WA 1U8LB 1PAMA 4XC3H 1TZIA 3CK0L 4KZDH 4FTVE 4PBVC 2IADA 3CH1B 2RR3A 3KJ6H 2XQBL 1ZWIA 3SDDD 4ZFOL 3ZL4H 1BOYA 1U42A 5IHBA 1QLFA 2Y7QB 3NZ8B 1AR1C 4LRNL 1MLCA 2EIDA 4WDIA 3QNZA 4YUEH 3EYUL 4LSTH 2NY2C 3GKWL 2D9CA 4AEEA 2F74B 4W4OA 1MCPL 1N59B 1IEAA 1N64H 4NZUH 3UO1H 1I8MB 1XCTA 2A83A 4X0KB 4XVJL 3IU3A 5E1HB 1I9IL 3DRQA 1V7NH 2OZ4L 1AXTL 5C0EB 1W0WA 3MLSH 4P5TA 3JV6B 2ICEB 5E8EA 4R7DA 3PV6A 2H6PA 3CAFA 2EIBA 4O4YH 4PD4K 4XPGH 1UM5L 5D7LB 5DJYB 2NX5B 3PGCA 3EDDA 4JDZB 2RBLA 5ESAB 4L3AA 4F3FA 1Q9WB 4NKOB 2R56L 4QHNB 1AR1D 5C0DA 4PJDB 3I9GH 4LLQB 5I9QC 1ZHBB 2NY2D 3DX7A 4HUKB 4NRXA 1SJVA 1WFUA 3SJVE 3HZKA 4FS0A 4X9BA 2M2DA 3IKKA 5IK3A 3D0LB 2WLZA 1VFBB 5DJ2B 5L0QC 5D7IA 1A02N 2VLJB 4XBPA 3GBMH 3TNNB 1FN4B 3CMGA 4GKSB 5GHWL 4U1HA 1IQWL 3ZE2F 3FT2B 2FYYA 1I9JL 1A47A 4TUKL 3VXPA 5EBWB 4P4RA 3KPSE 4HAFA 3OXRB 5IB3B 2YD7A 2UYLB 4MQ7A 5F3HB 4Y8AA 2EDTA 4OZHE 2CMRH 3B6SB 3V6FB 4Y4FA 2D4FA 3U36B 3OTTA 3NIGE 3B43A 3OX8A 4JN1H 4RDQF 5D5MF 3WJJA 2PW2A 4X6DF 2XV6B 2DJ4A 4N1HB 4Y5VB 2DQCL 4ZOEA 1ZV5A 3LOWA 1HXMB 4QO1A 2MMXA 5FO7B 2EDHA 1YUHA 1NAMA 3WMSA 3JSSA 3MLVL 4Y4KB 5GRVL 3SGJA 3VFRA 1AIFA 3TF7C 1Z5LA 5F70A 2Q8BL 3VXMB 3SE9H 3T77A 2ESVB 2C5DC 5C7XL 1TPXB 3NAAL 3TYGH 2F15A 4JRXE 3QFJB 4PG2A 5D2LE 5K59E 2V7NB 5CEXA 5K93A 3T2OA 3VI3E 3HNTH 1SY6A 3QQ3B 1X5ZA 3O9WB 4G8FB 1LGVA 2GUOA 4YHPA 1JPSH 2JB6A 5C0CE 1U3ZA 2AEPH 2BC4B 4X6FA 4MQXC 4KUZH 2HLAA 3LKOA 1KJ2B 2IANA 3TCXA 4BH8A 4FQQA 4PJEE 4GBXA 3S5LB 4KI1A 4NFCA 1HINH 4QTIL 1NCWH 1NMCB 3FL7A 4HF5H 4K71B 4G8GE 1IM9A 4P57B 4UINH 2XTJC 3C5JA 3IU4L 3RL1B 5A2IH 5I1KH 2BRRL 1J5OH 4XHJC 2P46B 4PJDF 1RZIA 4NC0B 3IXAB 3ZO0A 1RK1B 1NBVH 2LU3A 3NFSL 5TDOA 1F4HA 5F3BA 2X1XR 4DGVH 3O41B 1TJHH 2OL3L 1UZ6F 2VLMD 3L5JA 4K23L 4W6YB 5MI0C 5E5MB 3LRGA 3ZKNC 4MQXD 1FRGL 3MLZH 1AO7E 1NC2D 3BJLA 3QA3A 4WWKC 1JN6B 4P5MB 4GQPH 3TO2A 2X9YA 3V6ZA 4WW1B 4M48L 2YN3A 3QUMA 1MRFH 3FN9A 2XTJD 3RP1A 4BSWB 4YJZL 5GISL 3QUXC 5CP7A 5EA0L 4XHJD 2W9DL 5L8JB 2V2TA 3NIFE 1RZFH 4QHMA 2VRAA 3RZCB 2VLLB 3M1BA 1MCWW 1UYWH 5A16B 4PJCA 5HVHB 4Y1AB 1I85C 2BY0A 5DSCB 1RZ8B 5JW5A 3VXUB 4MNHA 2AJZB 3QPQD 1X5KA 4WWKD 5K9JL 1YEHH 5EIIB 3UTQA 2CO6B 2W38A 1MSPA 2C1OB 4MZ3A 4NO2A 4RZCA 4ZG1A 3WXWL 4TYUA 3WNMA 3MRDB 1T80A 3GSNL 4CMHC 1I7RA 1XGTA 4D8PB 4RGMB 4MA3B 3QEGL 3OR6B 1AXSA 5DVLA 1MJ7H 3K81A 3RWFB 4N68A 3E3QC 4KJPC 5EH1A 3TA3A 1AFVL 4QCIA 3MNZB 3FO1B 4XHQA 3F62A 1P69B 2M1KA 5J8OA 5IESH 5FYLD 1JPST 3QH3A 4F9PC 4P0DA 1X7QA 4L3EA 1H3UA 1S7TB 4DFHA 3TZVA 2NY7H 4U7SA 3S7GA 4ODHL 1FNSL 5HHXL 3ARSA 1KCSL 1H3WM 2XZCH 2WUBL 4S1RH 4FXLA 1CFTB 5MEPB 4HUXB 4Y5XA 1F3RB 4P3CH 4HIIA 1FCGA 3P9LA 3MJ7A 3RU8H 3SE4A 3N06B 1TXKA 4E5XB 3JV0A 1T7XA 2F5AH 2DL2A 4U6TA 5AAWA 2XA8H 3QQ9C 1SBBA 1WCBA 1CE6B 4W4OC 3NA9H 1ZAGA 1IEBA 4LAQH 1QNZH 2XG4A 4PR5A 2IEPA 1XCQB 2K3TA 4IHOA 4R7NB 2A6KB 5DD0L 2W65A 3MJ8B 1IAIM 2D9QB 2YMXH 2VR4A 1JV5B 4G7VL 3OF6A 4YK4C 1VENA 4RX4A 2ADFL 2DQUH 1CU4L 4AQ1B 1XF3B 2YSSA 3CFJA 3LAFA 4N1CA 2C3GA 4KQ4L 5JIHA 3JWDC 5LKNA 2EDXA 3L3DB 3MYZA 4JM4L 1MWAA 2OJZH 5I30L 1MJ8L 3QQ9D 4LARH 1HN1A 3SN6N 2YEZA 1DN0A 5D1XB 5K9KA 1YQVL 4M7JL 5KTEH 2DQJL 2VDLH 1IE5A 1VFOA 1PG7L 3GZKA 4S1QL 2O5XL 2DQHH 1SJEA 4U6HB 1BVKB 3IGAB 3LN4A 1ONQB 4JZNB 1K6QL 2G2RA 5D96C 1DVFC 4NM4L 5H35A 5DK2B 1H3VA 3ARVA 4WJ5A 2Q7NA 4XP6L 4YFEA 4HUWA 2X42A 3RWEA 3RL2B 3TN0A 5CEZH 2F9BT 2F53B 4QRSB 3ZDZE 3VWJC 4QXUH 1R3IH 4ZXBB 1QA9B 3WJJC 4RMVA 1G0DA 5DGQA 3VGBA 3CVIL 1KC5H 3D48R 1FIGL 1WWWX 4GUPB 4TOYL 1U8JB 3X11A 4JY4A 3FHQA 1I8IB 5LQBL 12E8H 1KB5B 2P7TB 3E2HB 4XH2A 4G9DA 1RMFH 4D9QD 4PYHA 1UJ3B 3C6LA 1JWSB 4XRCA 1NCDL 1HQ4A 1DVFD 2DTMH 2A77L 1CDBA 1ND0A 3U79A 2YRZA 4WV1C 2ICWB 2J12B 2XY2A 5C0GB 3W39A 4KPHH 4JQXC 1QFPA 4JFDB 4NQDA 2XWJB 3O81A 5KVFH 2CK0L 2COQA 4OQTL 3VWJD 2D2OA 4YDKH 4PG2C 3B2VH 3WN5C 4ZUVB 5JQ6H 4RBPH 1BZ7B 2BSSA 5J6GA 4N8VB 2H1PL 3JTSA 1ZT7A 3P4MB 2W60A 4JVPA 3VGAC 2DQFB 3I02B 3D3VB 4I48B 4NN7B 2F54B 1RK0A 3T1FB 4P4KA 1L0QA 1RJZA 5E08H 3VRJA 3LQAC 1HOCB 1OARL 3MRIA 1NLDL 1QFUH 3WFEH 4KZEL 1NCNA 3K74B 4D0BA 3DI3B 1BQLL 1I7UA 2XTJE 1HNGA 4FABL 2PYED 1JVKA 5FHAL 3L5IA 2D0HA 3OKDB 3WJLA 2XNAB 1I8LA 5CEYB 4DGYL 1QFWL 3S4SG 5I8KH 3GK8L 1C5CL 3CCHB 3M8OL 4KVCH 5FKPB 3RIAF 1FLRH 4MD0A 1IFHL 4M1DH 4JKMA 5HVWA 4DAGL 1CE1L 3WO4B 2MQ0A 1J8HB 1YQ2A 3IDMA 1F4XL 5ALCL 5B4MD 1AD9A 4OUUA 2YN5A 5BVPL 1EZVY 1DEEA 5ISZD 4BZ2L 1RJLB 3RNQA 4F37F 5ETUB 4M61A 1JPTH 1V05A 4Z7NE 1TMCB 1CGTA 1IM9D 5DUPH 1HHIB 3IJYA 3L6FB 5BV7C 1YNTA 5EWIL 1A2YB 1BIHA 3TBYB 4KHXL 2BVOA 1SJHA 5A1AA 2AEQL 4PRID 2ZPKH 4JHAL 5F7HA 1ZA3B 3BFOA 5JOEA 3O6FB 1IM3B 3VRLE 1EUUA 4EVNA 1BWMA 3D85A 4TRPL 2BOCA 4OIIL 5GGVH 1ZLWH 4JQIL 5KSVB 5DMKB 2WBJA 3ARFC 5M94B 1BGXH 1GL4B 3EDFA 2A6IA 1BMGA 2R29L 4NNPL 2XKNA 4PJIB 4Y8DC 3E3QE 4YBLC 5BZWA 4F7CB 1A0QH 3WFDH 4X5WB 4TN9A 3K1DA 1EFXA 1N6UA 5LGJA 3KYKH 1M7IA 3GHEH 2APTA 2ZOLA 3T1WA 4ODTH 5FDWA 5IVZA 5ACMA 2GITA 1AGFA 1NL0L 2X41A 2P5WE 1EEYA 3TBVB 3OAUL 4Z7OF 3ARFD 1Q72L 3BKMH 4L8CA 3TZVC 1NAML 3ARQA 3MA9H 3FMGL 4YHOL 5BRZD 3A6BL 3BQUC 4S1SL 2V17L 5EO0A 2X4UA 4PB0L 2W59A 5B39G 5IB1B 1T7YA 2P48B 4K8RC 2XN9D 2WBKA 4JPKH 4H88H 3SE4C 2QQNL 4YHLH 1DBBL 1W8NA 3NCFB 3TA3D 1EHLL 1X44A 1I7ZA 4K3DH 4KK9C 2E5EA 3BSZL 3OJMB 2BNRB 1SY6L 2CDGA 3ZMRA 1I3GL 2B1HH 3CFDB 2UZYB 3GSVB 3QJFB 3QXUA 2DLFH 4L3ED 2DQDL 3BDYH 3S4SA 3KVQA 3TZVD 2ZNWA 3RZWA 1R3LB 1EMTH 4DKEH 4HKBA 4WTXA 5DHVA 4U4BA 3X12B 3T65A 5IEHB 3RA7L 4GAJL 3WFBL 1EA9C 3C5ZA 3C8DA 2CRYA 4K8RH 5FFLA 4PRDA 3MRFB 3RBSA 4KK9D 4NO0A 1D5IL 5B3JE 2OTWB 4QYOA 4X80L 2GY5A 5EO1A 3G6AA 2VQ1A 4YX2H 3BESR 5IW1B 3UTSB 4Q9QL 3WIIH 2X09A 3UJIL 5I0ZA 5HPOA 3OWEA 4WU7A 1UWEL 4LIQE 4QHUA 3MCKB 4GAFB 4Z7VB 3OF6D 1G0YR 4LLDA 2Y07L 4RX4D 4P46A 1HHHA 2J8HA 3S98A 1A7NL 5GS0D 1JF1A 2GYSA 3K2MC 3QUML 2ZCLL 3U7AA 2X4QA 5CJXA 2EC9T 1XGQB 1DL7L 3FQNA 2DYPD 4PJIF 4FZEL 1XAUA 4GG8B 5HI4C 4UMGA 1AGEB 2PXYB 2YD4A 5D93B 3ZKMC 2FLRT 4R0LA 1JRHL 4HDIA 4NUGL 3BW9B 2HKHH 5DLMH 2NY5H 4Z78A 1PX4A 2LTQB 3HMXA 5T3ZH 4RRPG 1I8KB 4LCWA 3P2TA 3SBWA 3CUPA 5CKGA 2EKSA 4QRUA 3C6LC 5I1LB 1UA6L 2X4OA 1JYNA 1T66C 4M43L 2VZ1A 5IMMB 3ULVL 2YPVL 4GW5B 5L88L 2MPAL 4X8XA 3GGWA 3QP3A 3DXAB 2OSLA 3FRPG 3KLHC 1OY3B 2XQYK 5HI4D 3UCRA 1ZLSH 3PXHA 5DJXA 4LVNB 4XB8A 3ZKMD 2HFTA 1EVTC 1LQSR 2AQ1A 2Z93B 3UX9B 2AQ2A 4FMFA 5HY9A 1NMAL 4G6JH 5ID0A 5D7KD 5B39A 1NCBH 1TLKA 5J13B 3SCMA 1RUKL 5T1LA 2R1YB 4L29B 2NTFB 1M71B 5FB8B 4P4KC 3C6LD 1TETL 2IANE 1R0AL 2OK0L 2R23B 1T66D 3MZTA 4TNVK 1JPGA 5HGHA 3MRMA 2ADGA 5I6XB 1F6AA 2GAZB 4K55A 1ES0B 3OPZH 4ZTOL 3KLHD 1SMOA 2B5IB 2APFA 2Y5EA 4G80B 4NQDD 1ADQL 5DJAA 5CMAB 4G8IB 3VFWB 1JNHB 4JO1H 3SY0A 3FTGB 4OV6F 1S3KH 2VB5A 4HBQA 4PTUB 5JNYB 3V8CA 3VWKB 1NCAL 5DYOA 3RVUC 3LEYH 4LSRH 4OAWB 3DHMA 2VWEC 5TF1H 4G6ML 1LDSA 1HWGB 4P4KD 2HTLD 5BO1L 2DS4A 3P77A 1QOKA 1U93B 4P9ML 1QLEL 1KB5H 3KYMA 3MV7B 1QSFA 3EO9L 5T1MA 4R3SA 3QIUA 4OQ1A 4CVUA 3PWVA 4YH6A 3VGHA 3O4LD 4Z7VF 1A1OB 5BW7A 4NKIL 2H26A 4E0RA 5INCA 2CKBA 4U31A 1FC1A 3MNWA 4HWBH 4J3XA 5AZEH 1F45A 4F7TB 3QO0B 1BFVL 2EDYA 5CD3A 3OKLB 4AT6B 2JKXA 4M03A 1WZ1L 4PJCE 4QRPB 5E8PA 3TT3H 4YHZL 1FFPA 3RVUD 2CR6A 3UBXA 4XPAH 2DM4A 2VL4A 4YAQB 3T4YA 1HZHH 4ERSH 2ZWLT 5FO9B 5IM7A 4TTDC 4DZ8A 3OKEA 1QBML 2ZCKL 3EFDH 2ZUYA 1U8IA 4L8SB 1P4IH 3ULVE 4TSBL 5CBEA 2PO6B 4XNXL 1HCFX 5GIRA 1UENA 3JV4B 5GJTL 3OQ3B 2ZJSH 3OAZK 4W70A 4NWTL 2WNGA 4MHHG 3MOAL 1CBVL 3SKUD 3GMOA 1T5WA 3O3AB 2C4FT 5JW4R 4RRPA 2R0WL 4XWGH 4KMQA 4PJAB 3UYOD 3OBAA 2ZSVB 3EYVB 3G6JA 5FGCE 3ZKQD 3MCG1 1OAUH 4ORGB 2HG5A 2Z4QA 3C6SA 1OAQL 1EGJL 4JG1H 4HS6B 4TTDD 1WEJL 3FFDA 4L3EE 4J6RH 4RA3A 3D85D 3FRPA 4PRAB 3MOBL 1G9EA 2MHAB 4U6XA 1H3TA 4LSVH 1K4CA 1B0GB 3VXNA 5DHYA 3ZKSD 2XICA 3U46B 4TVPD 1KBGH 4YHML 2CPCA 3OGCA 3QDJA 3B4NA 3FFCA 5I1EH 5DC0A 1V3JA 5HYQB 2VDPL 3E8UH 1IL1B 1EFXD 1OCWL 3G5XA 4G5ZH 4H8WH 3DUSB 2YZ8A 8FABB 3V0WL 3WDJA 3S36H 5IFAL 6FABH 3FAXA 1D5XA 1HK6A 5FDYA 5SX5H 4RAVB 3OKKB 3QG7L 5FF6B 3WIHH 2G5BB 4K7FB 3F65A 1CDUA 2IPUK 3DBXA 5IB4B 3VJ6A 4JFFB 5HDBF 4Z6AT 1DUYA 3C5ZC 1KF9B 4NP4L 3DVGA 2VDKH 3CNKA 3FRUA 3JWOC 3T8XA 5JO5A 2FGWH 4TPRH 1C16B 2NXYB 3SDXA 4L4VB 4OCXL 5HDLA 5LBSL 4KY1L 5IVOA 1XF5A 4YBQC 2GTZA 2H8PB 1XF4B 4MLSA 4OFDA 3OR7A 1F4YL 4AIZB 3HPLB 4U05A 5IBLC 4HKZB 1MJUH 1FAKT 4RISH 4OTXH 3QIBB 5EZLA 3C5ZD 1DP0A 4UIMB 1BD2B 4ZAKA 5IEKA 3DURA 4YHNB 2Q86A 1MQKL 4OKDA 4LNRB 1NLBL 4YDJA 5CJXC 4NO0D 3QO1A 4PJAF 5E00B 4Q0XH 5EU3A 2LFGA 4IOIB 5DJCB 3D0VB 2VDRL 3GJFB 1MCKA 3BPOC 4KQ3L 3VGEA 3U30C 5JDSB 1OP3K 4ZOAA 4LKXA 2UZIH 3SBWC 3ULUL 3U9PL 2ADIA 5EOQH 3LKSB 2Q8AH 5GS1A 4NQDE 5IMLA 3W9EA 4PJXB 1RUAL 4Z95L 5TQ0L 4F33B 3ARRA 4UNVA 5KN5B 4OKVB 2XRAL 4GMTH 2QJDA 1MY7A 3NABL 4NDMA 2VZVA 1WFOA 2GJ6A 4HBCL 1TCRB 4XXDA 3GMPB 2IQ9L 3R0NA 5C0NC 3AS0A 2BDNH 1U91B 4U1IA 3PHQA 1KCVH 1QO3A 1AJ7H 2XFXA 4RDQG 3BEWA 5FYKL 1VA9A 4N0FA 5DUBB 1NDGB 4TULH 1UC6A 3AMLA 3SCMC 4OBSA 3EUUA 4APQA 3PXJA 4YXLL 4L8DB 5I66B 1FL3B 3SKNB 2NLJA 5AWNL 3B3IA 1I7TB 1S7SA 3MBXL 5GGTA 3O8XB 3KYAA 4KV5E 4OZIA 1DQQB 4RGNB 1U0QA 1FAIL 1UXWB 1ZK9A 3WFHA 2D31B 3QCTL 4O2FA 2W0PA 2HJKA 1XR9A 1WFNA 5BXFA 5C0JA 3ROOB 4CJ1A 2A74B 3ES6A 2MJWA 3P4NA 4HGWB 4NN5B 4N0YH 4P2RB 4KDTA 3NZHH 3SCMD 2RCSL 4PY7A 4H20L 3DUHA 1ZGLP 15C8H 4UTBL 4WFFD 2APVA 1VADB 5C09D 4FQJH 1RJYB 3HE7B 4F57H 3CU7A 1F4WH 5D1QA 4JFEB 5I8CB 1F6LL 1INQB 4X4ZA 4AYFA 4H1LH 2D4DA 3Q5YA 5D2NB 3FAWA 5J11C 4W4NA 1QR1B 1FL5A 3HC4L 3H3PL 4I8DA 1YY8A 2R0LH 4XPBL 1KJMB 2BXYA 5IB5A 3LEXB 4YEFA 4M62H 3ROLA 1A7PL 3ULUE 1CDCA 1YMMD 4O9HH 5ILTH 4HJGA 4PJ9A 3TPUB 1JNNL 5KVEH 1MNUL 2GK2A 4PBWD 3T0EB 2ICWJ 1FSKC 2JK5B 2NPLX 5A3IC 4UUJB 1CG9A 5J4MA 3EOAA 1OB1A 1S7QA 4NQTA 2Z92A 3VXQA 3OKMA 3IKCA 4TQEL 5F1OB 2AJXL 3MLUL 2R9HC 1FJ1B 3HC0A 4HPOH 3AUVA 2IPTH 4PJXF 4V2CB 4LF3B 1QYGL 1BOGA 1FFOB 2XI9A 3O2DH 2AJUL 3ARGA 5FYKE 3OB8A 3TNMA 3WDHA 5I1IL 4FQXA 4FQPA 2V5RA 1B4RA 5F9AC 1J1PH 1C7SA 5ACLA 4OSUH 5ABDE 1RUPL 5ICZA 1A6AA 5TDPB 1R6VA 2UY6A 4HJ0C 4RFEB 4XMPH 5K9QG 5EUKA 2VXUH 5A3ID 4MWFB 3S36X 3FB5A 4Y16A 1VCAA 3NACH 5CZVH 4BUGA 4M8VA 1MRCH 5CINL 3I3DA 2R9HD 2HWZL 3BUYA 1QVOB 5D5MA 1RU9H 2FJHA 4CRPA 4X6DA 1NCUA 5DK0B 1R3JB 1BF8A 1WGOA 1PEWA 4JDTL 4NHCH 3THML 2VQUA 1T20A 3MMEB 4FQIL 3RWDB 2BHUA 4X9IA 4XCNA 4JFQA 4UT7L 5KJRH 3WD5H 1U6AL 3Q5OA 3C9NA 3HE6A 4HJ0D 2D0FA 5SWSA 3SKJL 4F7MA 1VFAB 4M6OH 1LE9B 2XKUA 4WUUD 2JELL 1U8LA 3ZTJH 4NZRH 4R4BA 1ZSDB 1U36A 2DWDB 5DUMH 4Z0XB 4IOSD 4Y5YA 1KTDB 4KAQH 1YDPB 1RIHL 2ZG2A 1NCCH 1UG9A 3ARDC 1JYVA 3FFCD 4BM7A 5GGSB 3NZ8A 2DKUA 2D7PA 3QCUH 2YKLH 2UUDK 4WI2A 2P8PA 1T6VN 2F74A 1KULA 3S5LG 4MJIB 1K8DB 2QHRL 3MV9A 4X0KA 3IAPA 1X4ZA 4EI5B 3QCVL 3JV6A 3CC5B 2ICEA 3EYFA 4F15C 2R69L 3K2UH 1XZ0B 1EO7A 3IF1B 5IP4A 1NUNB 5GGQH 2DAVA 5DJYA 2NX5A 3OZ9H 5TE7H 4JDZA 5DEGA 1Q9WA 3ARDD 3EO0B 5D72H 1OAZH 2HVJB 4ZAKC 2DRUA 5EU5A 3VD3A 4OCWH 3VFNB 1ZHBA 2CKBL 1WCQA 4LSPH 1Q9OA 1YEIL 3SO3C 2CGRH 1GVIA 2EEBA 4GSDL 4JHWH 2EXWC 1CL7H 1WUNT 3BDBA 4M7ZC 1VFBA 1T7ZA 1QQDA 2CSPA 5CUSH 3VH8B 5TQ2H 4LPXA 2VLJA 2YUXA 4LCWE 4JPVL 3TNNA 4Y19B 4FNLL 1FN4A 2WBWB 4GKSA 4LOUC 1BAFH 4HLZH 3FT2A 1JWMB 3DX6A 1DQDH 3EFFB 1A7QH 4WI7A 2EDDA 4DZBA 1CFQB 4XC3L 5EBGA 5IB3A 5ESQB 4KZDL 1W8OA 4LQFH 2UYLA 3KJ6L 4ZAKD 5F3HA 3GSRA 2AV1B 5GS1C 3I50L 3B6SA 1JWUA 3ZL4L 2DMCA 3BMWA 1TJIH 4PJ5B 3U36A 5J06A 5TGBB 3HN3A 1T21A 2D7TH 4YUEL 1G7LA 2X4PB 4LSTL 5FYJH 3OKYA 1HXMA 1N64L 4NZUL 3UO1L 7FABH 3IXTB 5FO7A 1ZLVH 1V7NL 3FB7B 4WFFE 4HT1H 2DWEB 4LOUD 4Y4KA 3C5SB 3GIZH 4ZDHA 3MLSL 3LB6C 3TVMA 3VXMA 4R96B 4GW4B 4APQC 2ESVA 3IJSA 4O4YL 1BIIB 4XPGL 2GSGB 4CVXB 1AKJB 1MHPH 2J88H 5HTSA 2G75B 3QFJA 4BK5A 5AG9A 3QXTA 1D6VH 3JVGA 1LO5B 3I9GL 2P8MB 2V7NA 1GPOH 1WVZA 3C09B 2BOBA 2GJ6D 1V3MA 4R2GB 1F5WA 4QRRB 3QQ3A 4UOJA 2Y5TB 3O9WA 2WWKT 5GJSH 4EN3A 2WWMC 2ENYA 5F9WB 4DUVA 4M93B 2DQTH 4I0PA 1WT5A 2IMMA 2Q6WA 3BVNB 3LB6D 3GBNH 1QSFE 3GBML 4M9OA 4APQD 3HHRB 1KJ2A 3AFLA 5BJTA 5E9DB 3S5LA 3TV3H 5E0QA 1J05B 1RZ7H 5E6IC 2YWZA 4Y2OA 2DIAA 4P57A 4MNGB 1ACZA 5FIEA 1OM3H 3RL1A 5FHBH 2CMRL 2VAAB 4XCCH 3IXAA 1RK1A 2NW3B 4JN1L 4M6AA 3QHZH 5FK9A 4RA0C 3O41A 4KU1A 4XXCA 3MLPA 1E27B 2WWMD 1OAYH 2FSEB 4UDUB 3PWLB 1WWBX 5I75C 1D5ZB 4LQ1A 1X9QA 2Y72A 4P5MA 3HRZB 4PG9B 4ZFZA 5IV2B 4ZUTB 1NGPH 4WW1A 3BP6B 3ZDXF 5E6ID 1Q0YH 3UTTA 3SE9L 3HKFA 3SPVB 1MCOL 4PJGA 4JAMB 3TYGL 2HKFH 4Y2DB 3VFOB 2R4SH 3BRFA 3TJHC 4U0RC 2C3VB 2UWEB 3G6JE 3E1F1 3RZCA 1X5LA 3BD4A 3HNTL 3LSOB 5T3XH 1IKFH 4KK5D 1QHOA 3ARGC 3U0WH 4L4TD 1RZ8A 1JPSL 3HI1B 1KLGA 4BFEA 4WEBH 2LVEA 3WFZA 1LNUB 1P1ZB 1I1AB 4POZC 5EIIA 1LEIB 4WHTB 4XVTH 2C1OA 3TJEH 3HTLX 3MRDA 4Y16C 1LILA 1EBAA 2N7AA 4O02H 3QDJE 1HINL 5F88B 4D8PA 1NCWL 3FFCE 1FGNH 4MA3A 2G9HA 3TJHD 2D0GA 1ZVHA 2EDFA 4M5ZL 3CFBB 5I1KL 3IRZA 3PG2A 3VDBA 1J5OL 4OLZH 3GRWA 5EU4A 3ARGD 1NBVL 1T22A 1UGNA 3STLB 3IFPB 3WS6A 4DGVL 4FQXD 1TJHL 1MFBH 3MNZA 4IS6B 1F3JA 4J8RA 4PJHA 2VC2H 1JHLH 2V2XB 4X99B 5KSAB 1TNNA 1LO3L 4MD4B 4POZD 3HE6C 4FQ1L 2L7UA 3PQYD 5F93C 1J87A 1CD1B 3VD9A 4N8VG 3SO5A 1P4LB 3BD5A 4Y16D 4NCDA 5MEPA 1YJDC 1CFTA 4LFHD 4HUXA 4KTDL 4Y5YC 1ZVSA 1MRFL 2WW8A 4H26B 1MCIA 4LCYA 1NFDA 5CJ8A 1RZFL 3N1PC 4M5YH 3SDXE 1OP5K 3ZLQC 2E7CA 3F58L 3CH8A 1CE6A 1UYWL 1PD6A 1U3JA 3HE6D 2PKDA 4Q74A 1C1EH 5C0AD 1MHCB 1XCQA 5D4QA 4OD2A 4R7NA 2AJ3B 4P48A 1FVCB 3MJ8A 3MLYH 4QHLB 1JV5A 4YDIH 4FZ8H 3RNKB 3WXVH 4N9OB 1XF3A 1YJDH 1BZ9B 5CWSB 2EC9U 1CK0L 3L3DA 5SX4I 5MENE 1MJ7L 1IGMH 3DMMA 1ZANH 1NGQH 3HR5A 3BH8A 3WSQH 5JR1L 1QP1A 5KVMC 2UWEF 5D1XA 1OAKH 2EZ0C 3V0VB 3MV9D 5EIVA 2R15A 1PDKA 5IESL 4PRHB 1BVKA 3IGAA 4PJ8B 2ED7A 1ONQA 2NY7L 4JZNA 1JL8A 5DJZA 5DEFB 3LIZH 5DK2A 1VSCA 1WZKA 2XZCL 4S1RL 4POUB 2VDMH 3U6RB 3K3QA 4P3CL 3RL2A 5EU6D 4K2UH 2F53A 2GJ6E 4QRSA 4ZYKA 4UAOC 5T5NF 2YA1A 2HT3C 1CI5A 4ZXBA 1QA9A 3BGMB 4DEPC 4WI5A 3V0AC 2XA8L 1BBJA 1NMBL 3K0WA 4GUPA 3VA6A 4FXGA 1CYGA 4Z18A 1U8JA 3ZHDA 5DMIH 4PGZA 3PL6C 4LLMB 4RMSA 3NA9L 1I8IA 1QKZH 1KB5A 4IDLA 4LAQL 4HC1A 5FM5O 1UJ3A 2QSCH 1JWSA 1UZ8A 1MFCH 3AS2A 4ZOCA 1CR9H 2JJUA 1UB5B 3TVMC 1IZJA 2YMXL 3UXFA 1Z9OA 1FYHB 2ICWA 3FONB 2DQUL 2JTDA 1MCDA 1KJ3H 2AKRB 4P23C 4HWBA 4OZIE 1YECH 2XWJA 1SQ2N 3QIWB 1J0JA 4WFGD 1JNJA 2HT3D 4PV9A 3JVGC 1MI5B 4IRJB 2A73A 1BZ7A 4Q9CA 4MA8H 2OJZL 1W72H 2ZSWA 3MRNA 4XAKE 4N8VA 5CS7A 5DZNA 4M8QA 1E4XH 2EIZB 1QRNB 3PL6D 5KTEL 3P4MA 3CXDH 3I02A 2VDLL 4I48A 4EN3C 1KACB 3T1FA 4I0PC 3IDNB 1WT5C 4Y4KD 2DQHL 2RAMA 4AM0B 4NGHH 3AREB 3TVMD 4LGSB 4HIEB 3B5HA 1CGSH 3VXMD 5EC1A 5LVEA 2GJZB 4XTRC 3P0YH 3OKOB 1I3RB 5FO8B 3S88H 3OKDA 3I75B 1R5VB 1XFPA 2XNAA 4JRWA 2EYTB 3O45B 4MJ4A 4UTAH 2Q87A 3UZVB 4L9DA 3CCHA 5CEZL 2ERJC 4OUOA 4PGDA 2R1XB 4XMKH 1INEH 4KKLC 4QXUL 5FKPA 1QEWB 1R3IL 4YQXH 4W68A 5E2TH 4I3RL 3MRJB 1SEQH 1VEPA 4PBXA 1KC5L 2VIRB 4EN3D 2A9ML 2FH8A 1P9MA 1F90L 2DI7A 4I0PD 1J8HA 3TH2T 2VE6A 4YHKH 5E6ZA 1AQDA 4YPGB 4WO4C 12E8L 3M45A 5GRYA 3AB0B 1RMFL 4MJ6B 5GGVY 4XTRD 4RMUA 1RJLA 1WQVT 1Y6KR 2WUCH 5ETUA 4NYLB 2X9WA 2DTML 5F71A 4R8WH 2RQ8A 3TC9A 1HHIA 3L6FA 4HV8B 2D03H 5C3LD 1GOHA 3H9ZA 4D9LH 5KVFL 1A2YA 4KKLD 1D9KA 4YDKL 4YFLI 1XIWC 25C8H 3B2VL 1Z3GL 3TBYA 5KSUB 1FHGA 3LQMA 5JQ6L 1NUFA 2R0KH 3T3MF 1ZA3A 4PP1C 3O6FA 1IM3A 1BEYL 2X70B 4WO4D 2CH8A 5CIPH 4RNRB 3K7UA 4M7LH 2R8SH 4QKXB 3FQTA 5E08L 5KSVA 3RPIB 2XWBB 4OLXH 1QFUL 3UTTD 4Y7MA 2L7JA 5EOCJ 2G5RA 1BQSA 4E41B 5D5ME 5DVOA 4PJIA 4Y88A 1MRDH 4X6DE 1XIWD 2DLGA 2IF7A 3MLXL 4X5WA 5CP3A 3EW3B 3CLEL 5I8KL 4KVCL 5E2WH 3RTQB 5DR5L 2HTKC 1FG2B 4PP1D 4RFNB 3WS6C 5IVXB 5SWSE 1NEUA 1Q8MA 4LLUA 4M1DL 1P5VA 4PFEA 4ODSH 3RY6A 1PFCA 2C1PA 2EYSB 4LHUB 1T1ZA 4OF8A 4NPYA 2B2XH 3VRIA 1HQRA 1WTLA 1U8KB 3JBG7 3WLBA 1VFUA 3S96A 1FFNB 1JPTL 3LH2H 2A6JB 2EDKA 1MHHB 4TSCH 4U1SB 5DUPL 2DQEH 4PY8I 1GGBH 1G7IB 3SDCB 1MCLA 2FBJH 4I9WD 3RWHB 1ZA6B 2HTKD 4U6YB 2FZ3A 3MV9E 4LU5L 3NBNA 4QNPF 2HYMA 1I3UA 2BNRA 1AI1H 5H2BB 3CFDA 3GSVA 3QJFA 1IC7H 4P5KB 1U8MB 4AZ8A 5J1AB 3HLAB 2IG2H 4TVSa 4WHDA 3RGVB 1K2DB 2NX5E 2X4RA 1ULVA 1WWCA 3EZ8A 1BGXL 4PJDE 4KWUA 1DUZB 2BNQA 1JZ2A 4HH9B 1MFAH 3W5MA 1A6TB 2R2BB 4IIQC 1UZ6E 2VZ3A 3MRFA 1A0QL 3DMMC 2OTWA 1UM6H 4Q97A 4EZMA 3E0GA 3LY6A 3GHEL 1J0KA 5ALBH 5C0RH 5IW1A 3UTSA 1GOGA 1OLZA 4GMSH 2VLJE 4YXHH 3D25B 4ODTL 2M26A 2JJVA 5F7MC 3UBXI 3IDYB 1BJMA 4M7LT 1KNOB 4PJBA 4N90D 4IJ3C 1CIDA 4P2CG 2E27H 4WTZG 4Z7VA 3FT3B 4FQ2H 3W81A 3MA9L 4MNQB 3ET9F 2FR4B 4NKMA 3QFDA 4WFGE 2WM0A 4HIXH 1OPGH 4JPKL 3DMMD 3KYOB 4GG8A 4H88L 1AGEA 2PXYA 3CDFA 3PDOB 5JMRA 3CVHA 4DGIH 3ARBC 2Y9RT 3TH4T 2YC1A 3B5TA 4K3DL 3LHPH 5TE6L 2O5YH 1BFSA 2R4RL 2NY0B 3ECBA 5IVXF 2B1HL 5E5UB 4QHKJ 1KTLB 5DO2C 3BZ4B 2DLFL 4XT1C 3BDYL 4DVBB 3VD7A 3VXME 2ESVE 5I1LA 3VMPA 1EMTL 3FQWB 4DKEL 1X4XA 1T83C 4NQSB 4M1GL 3PWPB 2WIMA 2XXCB 3MRLB 5IMMA 4HXAL 3DX9A 4JDVB 1AGBB 3QFJE 4CMMB 1FNFA 1E4WH 2ZUXA 5CFHA 1TNMA 4NNXB 2H2SC 5C2BH 3S8WA 5AUMB 4K8RL 1G9MC 4XPFL 3ARBD 1YYLL 3STZB 3BP5B 1D3CA 3VXRA 2VZTA 1GGUA 4J1UA 3LKRB 3AROA 1K4DB 4DN3H 1CZ8H 4YX2L 5DO2D 1MCJA 5E8NB 3PDDA 5IW6A 3WIIL 2R1YA 1MCEA 2P49B 2NTFA 1M71A 5FB8A 5JHLH 3TBSA 2R23A 1FZJB 3RPKA 4JO4H 5FOJA 1WISA 3QEHA 2JLLA 4Y4HC 3LKQB 4JR9L 4WFED 4G80A 5B38B 2H2SD 1TIUA 4G8IA 4JO2H 1GAFH 1JNHA 4NO3A 5CMAA 3VFWA 3VD5A 2V6HA 3KPNB 4OZGA 5SWZB 3FTGA 4I5BB 5DVKA 2I9LB 5HHOA 4PTUA 5JNYA 1MREH 4DOHB 2C7UB 3D2UD 1FO0H 4HS8H 1G9NH 1BM3H 1MAMH 2HKHL 1XF1A 1DE4B 5DLML 2NY5L 1P9MC 5T3ZL 3MODH 5KZCD 4K94H 3MV7A 4LVOB 3UTTE 1N6QH 1YMHB 3H7BA 4MMZC 2BZDA 2YD9A 4Y4HD 3ALXA 3ZYOA 2GT9A 4PJGE 1A1OA 3BOVA 3TWCH 4OZ4B 5KSBB 3QUYB 4JHZA 1CFNB 4F7TA 3DI2B 3QO0A 2LAAA 3L3IA 3OKLA 4AT6A 4WI6A 1D9KC 4Y1AE 4QRPA 4DK6A 5L6YH 2Y23A 5INDB 4XP5H 3VXUE 4YAQA 4I77H 3GSQB 4G6JL 1X5JA 2A2QT 5FO9A 3P11H 2PO6A 2EE2A 3GSXA 3DVFA 3JV4A 1A4KB 5SWQA 3V5HB 1WK0A 5JLZA 2BXZA 4JM2B 2VAJA 3OPZL 3O3AA 2Y36H 4MSWB 5HGAB 1AC0A 3X14A 4PJAA 1V7MH 1D9KD 4O2CB 4YDLC 4Y0GA 4J2XA 3OHXB 4JO1L 1S3KL 4PJHE 4ORGA 1L9MA 4HQQH 2LU4A 4LDLB 1JMZA 4PD4J 5I1CH 5IMOB 4ZPVA 4HS6A 1FORH 3LEYL 1D7FA 5TF1L 3RY6C 1GC1H 4JFPB 2ZUTA 2FIKB 1KB5L 4RAHA 1OSPH 3UTPE 1B0GA 1RZKH 3U46A 2NY3C 4UNUA 4WNQB 3I6KB 4OFYA 1HHKB 1NFDE 4LLWB 3BWAA 4HWBL 5HYQA 4UIKL 4RWHA 5AZEL 1IL1A 3KDMA 3D39B 9CGTA 5T3ZE 5HYJB 5I73B 8FABA 1VESA 4GS7C 2AJYH 4EEEA 2IH3B 4MAUL 4XPAL 1SJXA 2M8XA 4I3GA 2BJMH 3KPRD 4ERSL 1RJCA 3OKKA 4N90E 5FF6A 3EFDL 2G5BA 1L9NA 1OF2B 5GRWA 5CZXC 2NY3D 1VERA 5F7UA 3MXVH 3LN9A 4MB5A 2GFBA 5IB4A 1XGRB 4JFFA 2ZJSL 2RFXB 1DLFL 2WINB 1U8QA 3DUUB 4KROB 4GLRH 2F5BH 1MAJA 3MACH 4XWGL 5KSBF 4MMXC 3UP1A 1C16A 3H9SB 3FN0L 1MIEH 1OAUL 3BXNB 4NN6C 5I0DA 3K1KC 4QF1B 4ZUWB 4XBEH 4X7SH 3BRDA 4JG1L 3WEXB 1XF4A 1T1YB 4J6RL 4AIZA 5KANG 3HPLA 1E4JA 3H8NA 3J7HA 3L3KB 2A6DB 4HKZA 4NNYA 5CZXD 2CDEB 3B9VA 2ZG3A 3H0TB 4LSVL 4KRPB 3CFEA 5L8KB 3QIBA 4P9HC 1BD2A 1KBGL 4UIMA 1CT8B 5L9DH 2BNQD 4KXZH 4NM8H 2F53E 4LNRA 1CTOA 1QR4A 4JM2F 3BN9C 3MA7A 1T0NB 5I1EL 1JF5A 5GGUB 4P2OB 3E8UL 5E00A 4YE4H 4G5ZL 4H8WL 3BP7A 5H8DA 3V7AG 2EE6A 1F42A 4QGTA 3BPCB 6FABL 3P4LA 4QRQB 5JHDB 3GJFA 3FCTB 4JZJB 3CFIC 3EDEA 1QD0A 3AS1A 5F9OH 5JDSA 3N1QC 5FM8A 2R2EA 3WIHL 3F12B 4P3WA 1AD0B 4QXGH 4PTTB 1SYVB 5HD8D 5KS9B 4P9HH 4PJXA 5DDHB 1Q1JH 4UNTA 3BN9D 1KT2B 2AK4B 4F33A 1JCKA 3DO7B 1A6ZA 4OKVA 5T1KD 2P5EA 3QJHB 3ARZA 1TCRA 3GMPA 2DI8A 1U8OB 2FGWL 1HNFA 3BO8B 3EOTH 4NRYA 1U91A 3RQ3A 3T3PF 1FIEA 2H45A 1Y0LB 3QWOB 5L2KB 1T7WA 1EX0A 3T04D 1A6UH 3W82A 3BEVB 3LRSA 5DUBA 4UOW1 3X3GL 5IG7A 5I66A 1MJUL 1RULH 2E8ZA 1FL3A 3KPOB 4V1DB 3SKNA 4RISL 3F5WB 4OTXL 4ONGH 1I7TA 4NT6B 1NC4D 4Z8FH