1U8OB

Crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 in complex with gp41 peptide eldkhas
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
235
structure length
227
Chain Sequence
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPGAAAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLQTYTCNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine design implications
pubmed doi rcsb
molecule tags Immune system
molecule keywords ANTIBODY 2F5 (LIGHT CHAIN)
total genus 38
structure length 227
sequence length 235
ec nomenclature
pdb deposition date 2004-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u8oB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u8oB01
4LSDA 3GSWB 5C0JA 3HC0A 3B9EA 4XPTL 1NCNA 1PG7W 4G6MH 2Y36H 5INDA 3INUH 3B6SB 4ZD3L 1DQQA 2CIIB 4FRWA 2VAAB 4Y19E 1I9RH 5CJBA 4K3DL 4LLDB 5T3XE 5HHPB 2WQ8A 1MQKH 3HHRB 5SWSE 3WE6B 3L3JA 3EFFB 4R7NB 4R4ND 4QRRA 4O9HL 1NBVH 1CE6B 1LK2B 2OTWB 4JY5L 2JK5B 5FYJH 3IRZA 1T3FA 3FOMB 4KV5F 2OXHA 2XG5A 5EUOE 4M61A 3TC9A 3DYPA 4NZJA 1QNZH 4WFGE 5DSCA 1DSFH 4DW2L 1IL1A 1K4CA 2I26N 4R26L 1MCEA 3RKDC 1OOAA 3OKKB 1BF8A 1FFRA 3ROLA 2Z8RA 2L7JA 1LK3L 1XGTB 4GKOA 5KSAA 3DRQB 4ORZC 3X13B 1CGSH 3VFPB 1BIIB 1QFWH 5CZVL 4RRPA 2W9DH 1HOCB 2YN5A 5HGDA 4DUVA 1SY6L 1A0QH 1IAIM 2X44D 1JTPA 4PRPA 4JM4H 3SO3C 3B2VH 1J12A 1AKJD 4P2CG 3DBXA 2IBBA 2R39A 3FQXB 3NBNA 2FZ3B 4NBXB 4UAOC 4JFEB 1N5YL 1AQKL 5CSBA 1VHPA 4M02A 4KKNA 3F7YA 4OFYA 1BBJA 1LO3H 4JO3L 5IW6A 3CXHJ 1NBVL 1C8PA 4LF3B 3EJZC 3QWQB 2WINB 4ERSH 1WFNA 3CFBB 5EOTA 4JY5H 3UPCA 4FXGA 1URLA 2H26A 3OJVC 4WFGD 5IMLA 2XA8L 3U4BL 1ZOXA 1I7UA 1F6FB 2DKUA 1T5WA 4JDZB 3LQAH 4XP9L 3TNNA 1KELH 5EORL 5DK0A 4JFFB 3O6FB 3KXFE 4Y88A 2GEEA 3OX8A 1YY9C 3K4DA 2R0ZH 4NNPH 1N7ML 4CMHC 2DQFB 2XWTA 4M7ZC 3L3OB 4ZUVB 4LU5H 4MHHI 5M7QA 3QP3A 5DD5H 1A5FH 4MCYB 3LD8B 3DECA 4CVWA 1J11A 1CYGA 2ATKA 2XIDA 4I3SL 3GKWL 1XGTA 2JJWA 2OBGA 3HR5A 5DJ2A 4O51B 3VXSD 4NJ9L 5KSBB 1YPZF 2WNGA 1W8NA 5C0BA 3V7AG 3VGBA 1ZTXH 3OG6B 4NQEB 5HHQB 3GBMH 1MCFA 1MJUH 4NKIL 2Z91A 4Y5YB 1HN1A 1J87A 4RFNC 2SEBB 3BX7C 2K7QA 5D6DA 2YA1A 2YBRA 4JFQA 4XCCH 4M62L 4HKJA 2V9RA 4L4JA 4G9FE 2FRGP 2GJZB 4JM2C 2QJDA 1CDCA 1JF1B 3F7QA 1BZQK 5AYQA 4TVPL 3CH1B 4W70A 4ZO9A 3DX9A 5CD5C 1NSNH 1RZGB 2FB4H 2EDXA 4WWKA 4HS8H 1F4YL 1IT9H 4I5BB 5FUZH 2AK4B 1CDUA 3DUUB 3TJHC 4U1NA 5HYIA 5JHDB 5JO5B 5I1IL 4TSAL 1I1YB 3FRPG 4FQXC 5F96H 2Z31B 2ICWJ 1OQOA 4S1SH 1QR4A 4XPHH 1XGUB 4N90D 4NZRL 1PYWB 3D0VB 2IANB 2FATL 4MNQD 5GS0H 1B90A 1IC5L 1WCQA 3WBDA 1WWAX 3KG5A 1DLHA 4JRYD 2MNUA 2Z31A 2V2XA 2HLAA 5IMKA 4Y5YA 3QDGB 1WITA 2J8UB 3L9RA 5J11B 3IKCB 3WXWH 3ZHLA 5K9QI 3VXUD 1BX2B 2DM4A 5D93C 5D70L 3T0EC 4XBGB 4LEXH 3DPBA 5ISZA 2CKBA 4HIIA 5CUSH 1MLBB 3N1FC 5F89B 2R2BB 3TBWA 1NSNL 3J8F7 5I9QC 1ZA3A 3KPPB 2AS5M 4L4VD 2OSLA 1N59A 3CDYA 4PJGA 2VH5H 2EXYC 4X9BA 2HVJA 2KZWA 3BKMH 4N9GB 1F3JB 5FUOH 1F90L 3L3KA 3HE6D 3AREA 1UXSA 1DEEA 1BOGA 5GGQL 3HUJA 3PV7A 5B8CC 4N0CC 3C2AH 1U8NB 1LEIB 2GY7B 5CINH 4JDTH 1T1WB 5EOCL 4OLWL 4YDIL 5IVZB 3LS4H 5J1TC 1NAMH 3ARVA 3BW9B 1N64H 1QPPA 2X9XA 3D3VD 3CUPB 5JORB 2A9NL 3RWEB 5GGTL 1ND0A 4IRJD 1QSEE 4Z7UA 3GSVB 4J3WA 4QRTB 5HHXH 5F1KC 1A6AA 4LP4A 2X89A 4EI5C 3TBTA 1HZHH 1IZKA 3OHXB 2Y9RT 1QEWB 4U1GB 1EHAA 1QFUL 4TNWK 3QUMH 3BH8A 5DMIH 1IBGL 4KHXH 2EIDA 3BKYH 5EOQL 3AUVA 4XP1L 5D5ME 1LNUA 1KJ3H 5GGRA 3OAYK 4ZS6D 1RIVH 2CK0L 5DEGA 4LAJH 3DHJA 3GRWL 1VFUA 3VFPA 3SY0A 1I1AA 1M71A 3GIZH 4I13B 3WIIH 5CILH 4U1KB 4Z7OF 5B3JE 3LRSA 3ZHDA 1JGLL 3O3AB 3ARFC 4Z8FH 1I4FB 2FX7H 1QQDB 3CLEH 4LBEB 5C09A 1KCVH 2DQTL 3VGAB 1H3VA 1T0NA 4ZTOH 4OZ4B 5CKGA 3IU3A 3T0AA 5J1AB 1ED3B 1J18A 3WD5L 5MENE 2Y7QB 1BREA 1JZ7A 2ZCKH 5EO1A 1MFCL 1T0MB 3AU1A 1NAKH 5C3LD 3QIUD 4HKZB 2EH7H 1CLZH 2M2DA 2XOTA 4FXGB 4XPAL 4CU7A 1GIGL 4L8DA 1HDMA 4LLMA 4M6OL 2PW1A 3H9SA 4GRWE 4G8FA 2IMMA 4D9LL 5EBWA 2FL5A 3LIZH 1HXMB 1JHKL 4PGJA 5ITFB 1NAMB 2VL5B 5IQ7L 2QADB 2XTJE 1FIEA 4NP4L 4WI3A 3C6LA 5SX5K 4C59B 3HI6H 3KPOB 1CN4A 4GMTL 1JWUA 1YEIL 4PJCE 2CXGA 3QHZL 4XAWL 1YPZA 1N4XH 2FIKA 4GQ9L 3QT2A 2NY5H 2ZUXA 4HWUA 4XRCB 1BBDH 4EN3A 3MV8E 3NOIA 1J9CT 5EZJB 4K9EH 3RVXC 5D71L 1MRFH 1WWBX 1SJVA 3CMOL 4PJCB 3L95B 2ICWB 4M62H 5KTEH 4KMTH 4JHWH 3U9PH 2ITDA 3WFBH 1RZIA 3N85H 1OAYH 3OGCA 1JZ3A 3QDJB 4UV7L 4XCNA 5FO9B 4FG6D 3E2HC 4S11A 1AQKH 3HZMB 5EUOB 3SQOL 1I8LA 2XNAB 3C5JA 2R69L 1C1EH 4NUJB 4D0DB 4PGEA 5HBBA 1JZ5A 3PDDA 4KROC 3QISA 5IJVA 5TE4H 1NFDB 2J8UE 4NYLA 5JR1L 1AC6A 3ARFD 4NN5C 1CFTB 1YN7A 5D6CB 4X8XA 1RSFA 4YXLH 3BJ91 5C0CE 5IEKB 2GTWA 5IBLC 3RZCA 1JRHH 3O2DA 2EKSA 3L3DB 2YPVH 2XN9A 3H6JA 2R0ZL 1DANT 1GHFH 5DVNA 3WS3A 4Y2DB 4JFEE 3DVGB 2KUTA 2GTWB 2NTFB 4HF5H 1AR1C 3WN5B 4UZGA 2O5ZL 1S7UB 5IIEA 1UB6A 1F5WA 3IAQA 3MBEC 4JANA 1MJ8H 2BVYA 3CDFA 4R2GC 2WV3A 1CT8B 4MA3A 3VFNA 4GXUN 5CZXD 1LO4H 4Z7WE 4TUKL 3TZVA 1A1NA 3V95A 3RIAK 2OR9H 2BERA 2ZWLT 2YBRB 5FCUH 2C1OB 3V4PL 5HYEA 4HWEH 3MR9B 1G7JB 4X9FA 4G42B 1U8HB 4DKEL 5BMFH 4YBLC 5IFJB 3S34H 4M9OA 3TN0C 5I18L 3VFOB 5HHVH 4J23A 2XRAH 3CLFH 3GFUA 3RDTD 4OCXH 1FSKC 1OAXH 1QSEA 3FQTA 2LU4A 3GMLA 4QOKD 1U8LA 4IIQA 3TEUA 1IAKB 1WZ1H 3LAFA 2DYPA 3KLDA 4RA0C 3NCJL 1MHCB 5D1XC 3UMTA 2X4RB 2NW2A 4RDQG 3QDHA 4PP2B 5FFLA 3EJZD 5F9DC 2XWTB 4EXPX 4Z7UF 4R6UA 1P7QB 3FAWA 2MOVA 2HKHL 3QCVH 4EEEA 3KNBB 4CNIB 4OAWB 4I18A 1Z9LA 4Y5XA 4HJGB 5DEFA 3UZVB 1S7TA 4XPFL 1QLRB 3T0DA 1UEYA 5L6YH 4ODTH 3IDXH 4QRRB 4GW5B 4MNHB 2XV6B 4JFDB 3ZL4H 3ARDB 1BAFH 3D5OF 1T5XA 1KB5L 3PWPD 2CGRH 1QHOA 2K7PA 2R29L 1T89A 4GOSA 3BPOB 1JNHB 5I1EH 1BECA 4WI4A 3WXVH 4C83B 2Q3AA 2E7HA 4Z7QE 4HLZG 1V5JA 2HJLB 5FOJA 2F19L 1NCDH 4LAQH 4MJIE 4GLRH 5HVWA 3L1OH 4PY7B 5T3ZE 4IMKA 5IB4B 3FFCA 5ESQB 4B50A 4UNUA 3OV6A 4WUKL 5EIVA 1F8TL 3VD5A 1RPQA 2HA1A 4HS6B 2NW2B 1XZ0B 1R5VA 1F3DJ 5GGVH 3ZE0F 1NLDH 3CX5K 1UWGL 2FJFB 5BS0B 1G7MB 2XQBL 4EZMA 3SQBA 2F53E 4F9PC 3PQYE 4KRPD 1F11A 5L9DH 4LLYA 1MPAH 3W0WA 5DD6B 3HPLA 5JW4Q 5F8QC 1ZHLA 2V17H 3GMMB 2H26B 2D03H 1ZSDB 2VLLB 5F9OL 3QUKB 5F96L 1E4KC 4AT6B 1PKQA 1UB5B 2F53D 5CFHA 3P0YL 3ARBA 3HI1B 1J1PL 4ODBD 3BKJH 3S3JA 1FGNL 1OPGL 3LN5A 3QH3A 1NFDE 3OKNA 3QRFM 1BOGB 1VGEH 1KJ2A 2E7CA 2X4QA 1LE9A 2AXHA 2MPAL 1TZHA 2ADFH 1TLKA 4JO1H 5MP6L 3GMQB 2VZ3A 2X4NB 3ZDZF 3U7AA 5GISH 1DBMH 1ZLWH 2IPTH 3X11A 1ZAGA 3B3IB 5GGVL 4U31A 1U58B 4KKBD 3SKNA 3QQ4B 5KG9B 1U0QA 5DRNB 5BZWA 3L5JA 1RZJL 3BPCB 3GMRB 3RGHA 3QUYA 2D4FA 2ADIB 5D5MB 2WBJA 2PKDA 1EV2E 1JF6A 2Q7YB 1AO7A 5FKAA 4FP8H 5D2LB 3SDDB 2ZPKH 1HNGA 1J1PH 3L5HA 4L4TD 3DGGA 3BJLA 5LQBL 1EX0A 3BH9A 4ETQB 2E7BA 3WUZA 1Q94B 3FO2B 5F88A 3H3PL 2B39A 5CAYB 1OP3K 1AHWB 1XF5A 3CH1A 3MCKB 2Z8SA 4LSSL 1UACL 4M6NH 1F6AA 1MFAH 3DMMA 3K80A 2GSIB 4P59H 2FJGA 4NNPL 3ULUH 5IM7A 1KCSH 2ZP0T 3HTLX 4XCEA 3OKMB 1CBVH 4KMTL 4NDMA 2BRQA 2M26A 3FJTA 1GSMA 4QHUA 5B39G 3TFKD 1Y6KR 2VQ1B 4NQVA 3VWKC 4HJ0C 4X4XA 4NGHL 5DD1H 1WBZA 4D0CB 4OI7A 4AEIH 3RZCD 3QQNA 4JM2B 1QLFA 4YHPA 2V6HA 1GGIH 1J1XL 3K81A 2DQCH 4Z78A 5JW3L 3B2VL 3HZVA 5F7FA 1N2RA 2YXFA 1R5VB 1PX4A 1XGUA 3MV9B 3MV8B 4X6CF 2VXSH 4X83A 2XKSA 4XMKH 3E1F1 4F33A 4LPVA 3I75A 4DK6A 4U1JB 3UTQA 2ENSA 1H5BA 4ISVB 5GIRA 4ZPVB 1F3JA 4UB0L 3F12B 3H42L 3MREB 3W5NA 2VZSA 1X5YA 2EH8H 5C2BL 1A21A 2BNQE 3P2TA 1N6VA 4Y5XB 1YEEH 4APQD 3OKMA 4HUWA 4ODSH 3VFSB 1MRCH 1P9MC 5E2UH 5E95B 1FO0A 3MFGB 3BZDA 4QOKA 5E6ID 3BP4B 1CE1H 1YNKL 5SWQB 5TQ0L 3C08H 2DIBA 2NY2B 1IARB 2VDPH 4HBCL 4L9LB 5DUMH 1QD0A 1YEFL 2AEPL 1BBDL 1IAKA 2YC1B 2C7UA 4HUNB 3U7YL 5EIIB 4LRIC 3GRWH 3HE7B 4NRZB 1YYLH 2EC9U 4F57H 2Q8AH 1PW3A 3HNSL 3QDAA 4L29A 4CNIA 1MRDL 1INQA 1FL6A 3RU8L 4YBQD 1C5DA 1FIGL 5F6IC 2WP3T 5GSRA 5IB1B 5I2IA 2G75A 1QVOB 3B8YA 5IB4A 2F74B 4LOUC 4LKCB 4U6VL 2R4RH 4P5MB 3BQUB 2PYED 4L8SC 3S4SG 2FDBP 3CC5B 5FOBA 3DSFH 1WEJH 4OZ4A 5T1DH 3EOAB 1FVCB 2APVA 1YEDB 4XVTH 1X5ZA 1WIUA 5KVEH 2QQLL 2YPVL 3ZYOA 4F7TB 3UPRB 3B6SA 2D31B 4AT6A 2P44B 2HH0L 4QT5B 35C8L 5KSBF 4Y2DD 3QH3B 1QACA 4OBRA 4CVUA 2P5EB 4ODVL 5C0FB 3EYUH 4JFZH 4PG9B 1B9ZA 1KIUA 5GSVB 5IB2A 5IHZA 5TDNB 4KHXL 5A1AA 4WWKD 5IBTL 1JPSH 3WLBB 4UIMB 4LLYB 3W0WB 4PP2A 3QDJE 2OLDA 2ED8A 4J8RB 1EFXD 1ZS8B 1DQTA 5I15H 4PY7A 4WTZG 2AERT 3JZ7A 3PABA 4OZGF 4I3RH 4MA7L 5DJZA 3ROLB 4XMKL 2YKLL 3FT2B 4LAQL 2FO1A 4PRIB 1A7OL 3V0WL 4YIQB 4RX4D 5AAWA 1CICB 4L8CB 1Q9OA 1FZMA 1VFBA 4UB0H 4XH2B 5LCVL 5KJRH 3MCG1 1U6AH 4JPVH 4ZTOL 1KIQA 2YUWA 5F9JA 5FYLL 2NMSA 1KTKE 2Q86A 4APQA 1HYSC 5FA4B 4KV5E 3I6KB 4QYOB 5L2JB 3VXRE 1F90H 1NC2A 3IT8D 1GOFA 2ZJSH 3S37H 1A9EB 4ZOCA 3E0GA 1HSBA 5C71A 1NGWB 1Q72L 3HAEB 4D9LH 4FQLH 4E0RA 5C0IB 1EPFA 5FCSH 4W4OA 1MJJB 3VXRD 4BSVB 4UQ3A 1G9MC 4K2UH 4NO5A 2PYFB 4QF1A 3GJEB 1TJIL 4XCEB 4HIHB 2EEAA 2N4IA 4U6HA 2QSCL 3MV9E 5ITFA 3PDOB 1A6UL 4LCCB 3V6FB 5DRWB 4JZJB 3C8HA 2A6IA 4YGVA 4O4YL 3VGFA 1CDGA 3EYVA 3MLYL 4MAUH 1CFSB 2XICA 2IPTL 1A7OH 2GQHA 4X4XB 4ZFFA 2OR8A 2AQ3A 3PQYB 3GO1H 3LKQA 5D71H 4OSUL 1TQBB 4XMLH 3TVMA 5D6CA 4Y8AA 1DN2A 2XXCB 3OGOE 3M1BA 1T04B 1VSCA 1RU9L 3HS0B 5E7BA 3ZKSD 4MXVF 1MI5A 2AV7A 1J1OL 4GBXB 1BQLH 4H8WH 4U1GC 2B5IB 4HUKB 4WHYG 1I1FB 2GAZA 4F3FB 2R1WA 4RGNE 3LZFL 5D8JH 3D18A 5DRZB 1CXKA 3LEVH 2HT2C 3KPMA 2ZSVB 2C4XA 3HAEA 1QA9B 3UJJL 4PD4J 5IB3A 1MSPA 3BRFA 4AMKH 2HT4D 3O6ML 1A4KA 1FV1B 1CG9A 1XGPA 1YYMH 3D1MC 3JV4A 4M6OH 3NA9H 4PREA 2MKLC 3BAEL 2AGJL 2Y6SC 1FG2A 3BO8A 3HR5B 4JFDE 1CD8A 1OGAE 2XXMB 4JGUA 5DHYA 5IUSA 1O5DT 2VQ1A 2RGSA 2IALA 3BD4A 2GJ6D 5JO5A 3BIBX 5D2LE 4BA8A 1VKXB 2BSTA 3O6LH 1YPZB 3O2VL 4OD3L 3O3EB 3BH8B 3BYYA 3BP5A 3DXAD 2V2WA 2VZUA 5EOCJ 1CDJA 1FVEB 2FCBA 3BMVA 5F1NB 4LVHC 1KEML 3LCYA 4MJ5B 2JTDA 3NCMA 1GZPB 4GT7A 5DVMA 2XTJB 1F6AB 1H5BC 3LQZA 4U3CA 2VDRL 5BCAA 4MZ2A 3DSFL 4Y19A 4G6KH 4LVEA 1RFDH 5B39A 2OK0L 5EC1B 3C60C 4BSWA 4BK5A 5EBGA 4DJMA 1RUPH 4OM1H 5GGTH 4KJYB 5IP4A 3SE9H 2XN9E 4JRWA 1GC1H 1IEAA 3DETC 2VAAA 4FNLH 4K3DH 5F3BA 2W92A 3BDBA 3SDDD 1ZLVK 4XP6H 1FFOA 3RVWC 2AKRB 1WZ1L 5L7XH 3KPRE 4JFPB 5IF0B 2VSDA 5FA3B 3GMOB 1JNHA 3LKSB 4J4PC 3S9DB 4WU7B 1ZWIB 4GRLC 4P2OB 2P47B 4GRWH 4XZUA 5AZEH 1HHIB 1X6NA 1W72B 1FNEB 3UTTA 4Q9QH 4TUOB 5MI0B 3PWLA 2X89D 3TN0D 5JZ7D 3RGVA 1OGTA 5DUML 4H0HB 1AGDA 3WNLA 4O2CA 5KOMC 4AEHL 5JLZB 2R0LH 3GSVA 2ITCA 2CRZA 1BAFL 2YSSA 3PUCA 4JFHD 1QEWA 2R23B 2XI9A 3BXNA 4G9FD 1F4HA 3KWWA 1GXEA 2VXVL 1W2KT 1YECL 1IM3B 4I2XA 1MFCH 4DZBB 1BVKB 4P23C 4CL7A 1OGAA 4HZLB 2DD8L 2FIRT 4EKXA 3DNKA 2W9LA 1Q9LB 5FIEA 4N9GA 4R2GD 4NOFA 1I8IB 4QXTA 4ZNEE 3DYMA 4L4VA 1FO0B 2YOCA 4NNXA 4LHUB 4ODWA 4K3EL 4QEGA 4BKLA 5I1JL 1C7TA 2MQCA 2VDKL 3ZDXF 5CCKL 1T20A 1QQDA 4RWYH 1MLBA 5A2JH 3QNZA 2NTSP 3O4OB 4ZD3H 3AS2A 1X44A 5BS0D 5D1ZD 4IRSB 1JWMA 1H3WM 5IR1B 3JV6B 4LHJB 5EPMA 1K3IA 3B5GA 3C5SB 3MRCB 4WO4B 2GITA 2VITA 3G04A 3R0NA 3N1PC 4MDJA 4OZFG 2KQNA 3DOSA 5IVXB 4ZFOB 5I2IB 5E8OB 3NGBB 2DQFA 5DK2A 5E4EB 4WW1A 3QI9A 3S37X 3LEYH 3O2WL 4EI5D 5TDNA 1QYGL 2HKHH 3FO9A 4RWHA 1FFPB 3GMNA 5IMKB 4UUJB 3P11H 1G6RA 1JGDB 3V5DA 2A77H 3U83A 1F4WH 1FSKB 1Z5LA 5E5UB 3CVIH 1ADQL 5LWYL 1HKFA 2MQ0A 4PJ7F 4YHLL 4JFDA 4GKNA 3LMJH 1D5IL 4MD4A 5D1XB 3ZDYF 1F42A 4U33A 5I18H 3BN3B 3MA7B 1RFDL 5E2TH 5CZVH 1T03H 4GKSB 3TA3C 3BT2H 5JDSA 3QQ3A 1A0QL 4LFHG 5I30L 3ME0A 4N1EA 3LZFH 2Q6WB 3TF7C 3H3BC 4R4FH 5J6GB 3SDAA 3JV0A 3ES6A 4WFED 5ESVA 4LPCA 5I8EA 4LRNH 4JY4B 4LRIA 3G6AB 3MROA 2JJUA 2GUOA 4MSWB 2RR3A 4LF3A 4E9LA 3KYKH 5FO9A 1NJ9B 1EFXA 3EHBD 3HLAB 4XGZA 1QBBA 1DVFA 1P7KA 3ALWA 1F3DH 4OFPA 1JFQH 4PJCF 3TIDA 1I3UA 5ICYA 4KFZC 4YO0A 3QJFB 3MV11 2LVCA 2WBWB 3CPLA 2IANE 5JW5B 3JWNC 1FBIH 1TVDA 3P4MA 3QFJD 5AWNL 3I6LD 2VLJA 2LV4A 1DVFB 1P7KB 1U91B 2W65A 3ZTNH 4LFHD 4OLEA 4YFLF 2UVFA 1U3HA 3QIBA 3RVTD 3ULVF 1D9KC 4O00A 4IEFB 3WS6C 4DOHB 4JRYE 1I3GH 1CGYA 1S8DA 2ILLA 4JFYB 4YXLL 1DEDA 1I1CA 2DWDB 2OJZH 2B1AL 3VWKB 4ZFGH 2CKBL 2RFXB 1S9KC 4R97B 3S6CA 4E42A 1N6QH 5INDB 2D9QB 5E6IA 2N1KA 1PQZB 4PJ9A 4YHZH 2G2RB 2RIKA 1V05A 3IFPA 5D7JA 5DJYB 1FAIL 2VKWA 3QO1B 4QRQB 5K9KA 2WBKA 4BQBA 1BQLL 4H8WL 3N9GH 1R3LA 3EYQD 4N90E 2P8MA 5LBSH 2F53A 1PQZA 4PJ9B 4JFXA 5I0ZA 2VMFA 1T7YA 4GRLA 1ZHBA 3ARXA 4N0FA 4PJ8D 1A1OB 3GM8A 1V7ML 1FORL 1PSKH 5LAXA 2MKWA 5JW4R 1YN7B 3Q6FA 5AWNH 3VGDA 3ULSB 2W60A 1CI5A 5DD0H 1CFSA 1CDYA 4BH7B 4HUUA 3NCFB 4Z7VA 3VD7A 3RA7H 4JKPH 5JHLH 1NBQA 3C5ZD 1G7QB 5KSAD 4Y5XC 1MWAH 2V5YA 5IW3A 4MQSB 1IRAY 1KCKA 1T2JA 4NUJA 4D0DA 3FFCD 3IDMA 4PTTB 1TNNA 4X7TA 2VB5A 1Z9MA 3CFCL 1UGNA 3VWJB 4Q0XH 3IAGC 1PX3A 4Y4FB 4CADA 3HPJB 1DBKH 3IDYC 3TBYA 3UBXB 3QXUA 5D96C 5EU4B 5ACZB 1I9IH 5DEZA 4PRPE 1ACZA 3HE7C 1X6LA 2GW5A 3PWJB 5IK3A 3BGAA 4ZDHA 4RFEB 4RBPH 4XNUH 5HGGS 4NZDA 3RKPA 1MLCA 5FGCE 4LQ1A 1YQ2A 5L2KD 1RUAL 4MQTB 4CN6A 1K3ZA 3MRGA 3DX6B 4GRLB 4P2OC 2JIXA 4ONGH 5J57B 3TIEA 4G8GE 1JI1A 2XT1B 3D25B 2QR0B 3H0TB 4DWHA 3MUZ1 1NCCH 3AREC 5KAQF 1QRKA 1I1FA 2GAZB 2R56L 3RWIA 1KENH 4X7SH 1B0WA 4GRWF 4HDIA 2Z92B 5J3HD 4JY6B 3KPLA 4PRHB 1UENA 4K7PH 5C08D 3RNQA 1EJOL 4G8GB 4HAGA 1RD6A 3RWIB 2KQMA 3KPQB 4FQQA 1N0LA 2A1WH 1D5ZA 2MHAB 1RVFL 3QFDA 3QI9D 5C8JB 4DFHA 4WUUE 4XZUB 1FVEA 2CIKA 1OPGH 3GDBA 4HIJB 5ESQA 3T0EA 2VITB 3IAPA 2ARJA 2YPLB 1BQSA 3U7YH 1AXTL 2EXYD 4S2SB 1JWSB 3V5HB 2DBLH 5C0CD 5LVEA 2FEDD 5K9QG 1IC5H 5DWUH 2NY7L 2HTKC 4M1GH 3EAKA 5HHOA 3MOAL 3BVNA 1R3HB 4KTDL 4X4MA 1HE7A 5IESL 4Q7DA 5DJ8B 5BJTA 4WU5B 3OMZA 3O4OC 1MCSA 4RAUA 5I71C 5D1XA 4K8RL 4LKCA 3AS1A 1ZLUH 2B20A 1I3RA 3KGRA 5ENWA 5IBTH 1U92B 4ELMA 2AVGA 2YZ8A 1L6XA 1RZGA 1UQSB 4OZGB 4LGPB 4LCWD 2W38A 1MY5A 4NSKB 1ZHKA 4EUPA 3NZ8B 3GBLA 2KBGA 1YNLL 4ZFZA 4ONOA 3ECBA 4HJJH 4JRYB 1A2YB 5HY9A 5CJOL 1MIEH 1HHHB 2G9HA 4V2BA 5T1KB 1WC7A 3MRRB 3SGJA 1AGCB 4R96B 1RUMH 1D5MB 1F45A 3RY6A 3KPSA 4R0LB 4QLRA 3KYOA 5AUMB 5IKCA 3IJYA 3EJYD 2A6IB 3W39A 4ORGA 4L3AA 1NPUA 1EMTL 3QQ9C 3ULVH 1JYNA 1GGTA 5CIPH 3EIFA 2QQQA 8CGTA 5HVGB 3EGSA 3Q5TA 3RL2B 4JQVC 2APFA 3HMXH 2ZOKA 3NTCL 4P9MH 3PXHA 1IEHA 3BDYL 1CG9B 1XGPB 5DLMH 3CX5J 4UDUA 3RWJB 3PG2A 5EU6B 3SDCA 1P2CB 3DVIA 3P0VH 2VIRA 4QTIL 1QSFA 3JSSA 4KKAC 1I9JL 2AEIT 4EUPH 1CS6A 1S9WB 3MC0A 4MYWB 1JBJA 4R4BB 2HTKD 1IGFH 4I0KA 3C08L 3QDGD 3V6OE 4Z8FL 2JF1A 2F5AH 3QNXA 2DLFL 4DQOL 1LK3H 2FWOA 4UOW0 1NCAH 5M95B 2XQYG 4GBXC 4AL8L 4K7FB 2YEZB 2X6MA 5T1DL 1M7IB 2AJVL 5F7MC 1PZ5A 1S7WA 4MSWA 3ARRA 2C3WA 3KPSB 4R0LA 3SGDH 3SQOH 5DFWH 1M05B 4G6JL 3QIWA 3KPSD 4UUJA 2FR4A 5GSRB 5IB1A 5JIKA 1S7SA 4XHJC 1CK0H 4Z7UE 4NWTL 3QA3A 1LO2L 3SE9L 2IAMA 2WUCL 3MXVL 1QR1A 1BJ1H 4HK0A 2QSVA 3ET9F 5CKAA 3S88L 1YEHH 4LVOC 2VQTA 5HDBE 4Q6IC 4K7PX 2ICCA 4MJ2A 1J1XH 4QNPF 1NC2B 4P2YA 4OLWH 5CEZH 4Y1AB 1WT5A 3LPFA 2PXYA 4LPUA 1MCWW 4ZG1A 2QADD 3IYLW 1JGDA 1FL3A 1CICC 1KLUB 3UTSA 1HH9B 3P30H 4NPYA 5F97E 1LEKA 3QCUL 4GRWB 1ACYH 1NMCC 3QUML 1MHHB 3GSXA 1MHEB 4AZ8A 2HAZA 1OT1A 1U8OA 1U8IA 4D0CA 4Z7VE 5CEYB 4UT7L 4U0RC 3EJYC 5IWLC 5MEOB 3QWOB 1U58A 1UA6L 5T33L 3LSOB 4DVRL 3HN3A 3O6MH 3WJJA 3ARQA 2A6JB 4NQTA 5L88L 2XKNA 3C5ZB 4GUPB 1GGUA 3DROB 3MYJB 3DXAB 3TNNB 1CBVL 2BY0A 2ESVA 2BY1A 3MRFB 4CMHB 3O6FD 5JPMA 1B2WH 4GSDH 4OZFH 2NCMA 4TYUA 3VMPA 2J6EL 1IAII 2BNRB 1JYVA 4UDTB 1QPXA 1EGJL 4Z0XB 5F70A 1JK8A 3EYFA 5IW6B 5D7LE 3RJQB 4ONFH 2NY6B 3HC4H 3IFLL 2OTPA 4Y4KD 4HJ0D 4HWZA 4KK6D 1AD9B 3FCTA 1K2DA 1ZSDA 3OXSA 3AREB 1D5BA 3RPIB 3SN6N 1DQDL 4I77H 2EO9A 4PPTA 1JUFA 4TUJA 4HXAL 1AD0A 4G9FA 5GRVK 3LPWA 3QZWB 1NCUA 4LLWA 4PJXB 4ZPVA 2V7NB 2I25N 3B9AA 5GRXG 1MCNA 5MHSE 3EYSL 3CVHL 4MVBC 1AJ7H 4FABH 4RA3A 1TVHB 4P23B 4EOWL 3SBWA 4J4PA 4BQCA 5GGSB 3RL1B 4ODXA 1FZKB 4N0UA 1R24A 5FO7B 3DX8A 4FZEH 1WSST 3TO4D 4J7RA 3ULUD 4JY6A 2NY3D 5EG6C 4NNYA 3MRKA 2HJLA 4HAFA 1P84K 1P84J 4NQCB 3D85A 1T2XA 1E0OB 2EXWC 3ZKQD 3WJLC 5BRZA 1S7SB 5AZEL 4DKEH 2AJZB 1BD2A 1NKRA 5E1HB 2NY1B 4QRSA 5T1LA 2EIZB 3VXUB 1QFHA 4PJ7E 4OZFB 4X6BA 5I6XB 1IQDB 3NZHL 1EK3A 4V1DD 4M93C 4X6EB 1U3HC 2H3NA 3QIBC 5JOEA 4GRLD 1T83C 3DV6B 3O4LE 5HYSB 1AIFB 1A1NB 3FQUB 5ADOH 4TUJB 3V0WH 4G9DB 3QULA 3HZKA 4LSVL 4PJBF 3UJJH 2Z31D 1NDMA 5F1IA 4E5XA 1TETH 5FOBB 1UB6B 2BOCB 1MNUL 2ID5A 1KJMA 5SWZE 4QCIA 4OD2A 1PG7H 4M5YH 4JDTL 1BFSA 1HHKA 4R0LC 5I9QB 5I0DA 3RY4A 2GKIA 4NQDB 5DUPL 1INQB 3RQ3A 2A74A 1WBZB 1KXVC 1TQCC 5CEXB 2NYYC 3TIDB 5ICYB 1G9NH 5C9KA 3DARA 3D3VE 4JM2A 3MBXH 1U8NA 2BNQD 2CMRL 4XCYA 2OCFD 2IWGA 4K7PY 3FFCB 2H2SC 1A7BA 3KPRA 4YNYB 1KPVA 2GITB 2IH1B 3U48A 4JDVB 3W11D 3WEXB 3SDCB 3MJ9L 2H2PC 5KG9A 3KYMA 5C09D 3J7HA 5DVKA 1KTRL 2VLRA 5DJ6A 5FYKH 2NW3A 3FQRA 5F9WC 1NLDL 1JF5A 2WSKA 4QHKI 5EZOL 4LCIL 3OKOA 3GJFA 3WFDH 1FP5A 3HZKB 3S8WA 4LSTH 4FMKA 2KL6A 2YD7A 2QV2A 4PJDA 1P6FA 2JB5L 1PKQB 1UB5A 4NHCH 3TH3T 3IJSA 4MJIB 4WV1B 1XR9B 4FQIH 1N3NB 1FRGL 4Z76B 4PP1D 3I6KA 1WZMA 1RZKC 4QYOA 4CW1B 2R1XA 1HHHA 2G9HB 4Y16A 3R8BB 5IEKA 2BSRB 1YEFH 2K9UA 2HVKA 4B5EA 3TO2A 3LRGA 2BNRE 2NXZC 4IDJL 3AFLA 1NAMA 5E08H 3SDXB 1E4XH 4JE4B 2R1XB 1JHLL 3NFPA 1FZJA 2I9LA 5E94A 2VLME 4FFWC 1NFIA 5D1ZA 5J89A 1G9NC 4X6CB 5TQ2L 4L5FH 3SDXF 5GGUB 5IMOB 5DO2D 1DUYA 2Y25A 1GZQA 5SWZA 3BIKA 5E4EC 4ZUUB 1RIUH 4LSRL 1U93B 3FN3A 4PJFB 1OAUH 3G6JA 5HYJE 4N9OB 4ZUTB 4DN4L 2XZAL 2ICWA 1B3JA 1KEGL 4NM4H 2FX7L 1XGRB 3BUYA 4XP4H 5KS9E 4FQIL 4IMKC 2H2SD 2WBJC 1ONQA 5K9JL 1JP5A 3MZGB 2NZIA 4U1JA 2Z8WC 3BZEB 3HNSH 1ZHLB 2D7TL 3TA3B 4Y7MA 4OLXL 3BGFC 4QTHA 3RHWF 1C08A 5D1QA 1IAOB 4JJHA 1MVFA 2V7HB 1G6VK 3T09A 4P9ML 4UT6H 4OJFL 5HI4D 2E27L 1Z2KA 3WNNA 3ZDZE 1NGXB 3ZKXB 4P4RB 2YMXL 1IFHL 3FQWB 4HHAA 3RI5K 4UNTA 4U1LB 5INCB 3AY4C 3IXTA 4ZQKB 4ZO6A 1J8KA 3FB5A 4OZGE 4X6DF 2X1PA 4ZAKA 1SYSA 5DMGC 3S7GA 3FT3B 4S1SL 5F7UA 3NN8A 4P2QD 3O8XA 2DTMH 4GQ9H 5DFVC 1KCUH 5F7YC 3EYQC 4CN4A 1V3KA 4AG4L 1J8HA 1WK0A 2R0LL 4NYLB 3MUY1 1AP2B 3T4YA 4FQXA 3CMOH 4NKMB 2QHRH 4PYHA 3NIFF 1G6RL 4AEIL 1MREL 3QG7H 1IZJA 1HSAB 1D9KB 1U3ZA 1A6WL 4OD3H 1P1ZB 5H35A 4AIZA 5C0AB 1XF2B 2UZXB 2EZ0C 3SCMD 3UJIH 4ZO8A 4J3UA 4PV8B 3MLWH 4ACPA 2IQAA 2MSPA 1KIPA 3GMPA 4MNHA 4X99A 4JANB 4N0CD 4M4PA 1MNUH 5KVDH 3VA6A 3NVQA 1G7QA 4PJBA 4OKVA 1HEZB 3D85D 3D2UA 3VXSA 4LPYA 1BWMA 1MCHA 3IVKA 2FBJH 3HFMH 3PJSA 4FQ1L 1DQLL 3UEZA 1PYWA 3DXAE 4YHIB 1T1ZA 2VXUH 2AAVA 3RJDA 2IALB 1PD6A 2EIZA 3MFFB 2OM5A 4P0DA 1MHCA 4BELD 3MNZB 1P9MA 2WUBH 4OCNC 2BC4B 4PJ8A 2EO1A 1DBKL 1II4E 3BFOA 1U3HB 3L3HB 3QIBB 4OZHF 1U8HA 2A6DB 5ID0A 5L2KB 3JBG7 3RNQB 1YZZA 3ILPB 1ES0A 3TN0B 4TULL 3LN9A 4LKXB 3WIFA 3C6SB 4NIKB 3LKRA 4OCLC 4F7EB 5A2LH 4RGNB 4WVRA 3FB7A 3TZVB 4P2RB 5C07E 1KJMB 2OTUA 1GPOH 5DEGB 4ODUA 3CFEA 2FLRT 1QSFE 12E8L 5F93C 3PL6A 4JFFE 1OQXA 4D3CL 1EHLL 5EOCH 2R56H 3SJVD 3HZYA 1HHJA 4X5WB 1X7QA 2NX5D 3U4AA 3IDIB 5K59E 3FCTB 1LP9A 2DJUA 3SJVB 1A4JA 3Q48A 3L5IA 1HKLH 1ROWA 2Q76B 1J0KA 5E1AB 1MEXH 1RZKL 1TIUA 1FQ9C 1EFXB 5JHDA 1YQVH 5IKCB 3QJHB 4P46B 1JZ4A 4OM0L 1UXSB 3FQWA 2D0GA 6FABH 3D3VA 1O7VA 3ZDXE 3EYOA 3MMEB 3PDOA 4LCCA 1VEPA 1LEGB 4PUBH 3WMSA 4WHTA 3BD5A 2P5ED 4GG8B 5E2WH 2VL5A 5E99L 2B7DT 3HNVL 4LLVB 3TV3H 4U1MB 3ARSA 2APBA 1AGEB 4ODTL 3MODL 1J0ZA 1IAIL 1KN4H 1FGVL 2UZIL 4NO0D 2DL2A 2VIRB 3P77B 3V2AR 4QGTA 4YAQB 1I3RB 1KT2A 1UA6H 5T33H 4QRPB 5E2JA 3T0EE 2HRPL 5TGBA 3V79C 5BV7C 2Z4QB 1OCWH 1N59B 5DJYA 5C0CA 3MPCA 4R90L 1NMBH 3DV4A 2AJVH 2IBZY 1N5YH 1FYTA 4N1HB 1CD0A 4NO2A 5D7LB 2FYYB 2AJSL 3CC5A 3DLQR 2VABB 4KKCC 1FHGA 1HILB 3ZKMC 3GUTA 1EUTA 2FB4L 1DDHA 4YEEA 5GZOD 3VI3E 4PJ5D 4OZIE 3P4LA 3C5SA 4WO4A 1J0IA 4X6CA 4YHML 5I30H 4GBXD 4AIOA 3KPRD 4RMUA 2CJUH 2FX9H 1MI5E 1F4YH 1HIML 1KTLB 4YX2H 2DWEB 4Q9RL 5KSVA 2QQKL 2YD5A 5T3XD 2DQIH 1B6UA 3S35L 3MUJA 3G5XA 5F7DB 1CFTA 2DN7A 3ABZA 3O8XC 2AXGB 3P11L 5L0QB 5FYJL 1AGDB 1G1YA 2DTML 1NCBL 2FL5B 1Y18B 2VWEE 4GG6A 5BOPA 3BSZH 1MAML 1H15B 3RWJA 4KK8C 4FXKA 3G08A 5D2NA 1NQBA 1RZ7H 3QB7C 4MWFA 3L5WB 1R3LB 1Z0NA 1OWRM 3LRSB 4MMXC 5FUZL 2WWMC 4MD5A 5EZLB 4S0TD 2ZUQC 3D39D 3DBXB 5DC9B 1F4XL 4NJAL 1YMMD 4E42B 5E8NA 2F5AL 1IGJB 3T2OA 3U0WH 2EYTB 5EUOF 4JO4L 2P7TA 1VFMA 5JXEC 2HYMA 3ZKXC 3FOLA 4JM2D 5JUEH 3ULUE 2WZPD 4AH2A 3IXTB 5FM5M 2BXZA 5EC1A 4BSWB 4JO2H 1MH5B 5M94B 3BWUC 3JWDH 3TPUA 4H8WC 2QBWA 2E9BA 4V2CB 1RJLA 5MEPA 3HB3D 2AJ3B 3DXAA 2VO5A 2Q8BL 2I5YL 1S5IL 5SWZD 4NQEA 3BPLB 5TFSL 4JQIH 5F7WC 1K85A 1YN6A 4MAYB 4GW1A 1EERB 4BUHA 5EIQA 3MSPA 3SGEI 1A22B 3I84A 4AL8H 1L7TL 4OT1L 2YUZA 4XPBL 1CVRA 5JIHA 3FZUD 3SPVB 4IDJH 3HMWL 3X3FH 5CSZB 2G2RA 4Y16D 2QSTA 3KNBA 4GAJH 4HC1L 4HWEL 2KDGA 3BIKB 4ZUUA 2MCG1 1LGVA 3C9NB 3BKCH 3O6KH 2YD1A 5HYSA 4H1LG 1BX2A 2VOTA 2XZCL 3VXQA 2SEBA 3OAYH 1QSVA 3ARGD 3OL2A 3UTTB 4U1HB 4KK8D 4UOJA 2DDQH 1RAMA 4RZCA 1AXSB 2A83A 3MRIB 4M93B 2FYYA 43CAB 2XPGA 1UM4L 4HUUB 3EUUA 2IANA 2ZCKL 5EBMA 4ZXBD 4HS3B 2N7AA 4XPAH 4LMQE 3KAAA 3TWCH 2UVEA 3WSQH 2VLJE 4XGZB 4YDLB 3UYPA 4L9LC 4AJ0A 2N7BA 2AK4A 5EPMB 2XZQL 3V52L 5C9JB 4Z18A 1FNEA 1EEZB 1VACA 4JREC 4P23A 3DUHA 4I8DA 2VN4A 2GYSA 4P5KA 1HHGA 1I9RL 4NC2B 1FNGB 4WFFE 3V7AE 3VG0H 2P45B 2DQUH 1WBXB 2GCYA 1D6EA 1KBGL 2VZVA 3OAUH 1TZGH 4NRXA 4UIKH 4OZIA 3WYRA 5T3ZH 3GSRB 4KKLD 3ZTJG 2B2XL 1E28B 2HTLD 4TULH 3Q5OA 2QKIA 4MWFB 4MJ6A 3RGVC 1S7XB 3BP5B 1GIGH 1TQCB 4OZIB 1ZV5A 4XP1H 4XMPL 3DURA 3NPSC 1RMFL 4GXVL 5CHNB 3DX6A 3I2CH 1OP5K 2LU7A 4XI5D 3AGVA 1EEYA 4JGMA 5CP3A 1NBYB 4X7SL 3MZTA 1JPGB 2YRPA 4RX4A 1GGYA 5C7XH 1BWWA 1RJZA 4QRTA 1S5IH 3C5JB 2R9HD 3X13A 3EO0A 4Z5RB 3C5ZA 4UQ3B 2C1PB 2BVEA 5I19H 1YMHA 2BDNH 2F54A 1E4KA 3ARBC 3G04B 1XFPA 2B4CC 2CUMA 3OAZH 2NY1D 3G9AB 4TVPH 4IRJB 1DANU 1MEXL 3VD4A 3LIZL 3QQ3B 3OPZL 4LEOB 1FVDB 2X7LB 1MCJA 1H9VA 5JA8B 3HC3L 5L7XL 2OXGA 2DLHA 5J6GA 1N64L 4O2EB 5F1SA 1QRNE 2JB6B 2FX8L 1CXLA 4PLKC 4PYGA 1AD9A 1FORH 4TRPH 1JPFA 4FTVB 4LSUH 4JCMA 4NNXB 4KQ4H 1AHWA 1XF5B 4HFUL 1S8DB 4K23L 4J2XA 3I9GL 2FZ3A 3L3JB 4X7DC 5IGXH 5DT1L 5GS0L 5JXEA 4G43B 1RK1B 2YK1L 4OLYH 1MJ7L 1U8JB 1IGYA 1BBJB 3WNKA 3QO1A 4B7LA 3B9KB 1OAZL 3K74B 2E9WA 3LHPL 2W9EH 4NN7B 3EHBC 5GGSA 3RL1A 1QKZL 3T1FB 2ZG3A 4PRPD 1MIEL 3MJ8A 5K33A 4LRNL 4IMLB 4PY8J 3GUTB 1NGWA 3FO0H 4X80L 3TYFB 1OT2A 3DRQA 1Z3GL 5HGBA 4NRYA 2ATPB 4MJ4A 4P4RA 5L9DL 1OF2B 1QVOA 4C56D 4ZUVA 5D7SH 4JKPL 4LCCC 3LKOA 4M3KB 4JN2B 5HDOA 1S9YB 3RX8A 3BIAX 5DDHA 5EZLA 1XCQB 2AABL 2Y4SA 3ZTNL 4HK3N 3WO3B 1AJ7L 4PGDA 2BNUB 1RHHB 3Q2CA 3QCVL 3EFDH 3R8QA 1FBIL 4P3WA 4S1DD 5CBAB 4LL9A 4K94C 1JK8B 3G5YB 1X4ZA 4MA8L 3V8OA 4PGBA 4WTWA 2YN3A 3MOAH 2PYEA 5FYKD 4HS8L 3NABL 2W0FB 4MJIA 4WV1A 1NGQL 3UBXG 4LASL 1WGOA 2ZUWA 4TNVK 3UAJC 3ES6B 1QLRA 2VXTH 4DUWA 4DTGL 3T0VA 5E99H 2B5IC 2AV1B 5J9PA 1AR1D 2B0SH 1R3KA 3PWLB 1I7TA 3QUMA 2PW2B 1FC1A 1PY9A 3LSOA 5D1QC 4I1NB 1KJ3L 1JGVL 2DYPD 1F2QA 4DKAA 4H1LB 1T6WA 3TO4A 1WCBB 4FABL 4N1CA 1JGEA 2DI7A 4KDTA 1FYTB 1PAMA 2DIJA 5ERWB 3O0RH 3QEQB 4KU1A 5HDLA 4YUEL 4U2ZA 3CGTA 1OP9A 3T3ME 3WO4B 1RZFH 5IFJA 1QSZA 3S36H 3BO8B 4NKDA 4KC3B 2QL1A 2VZ1A 4MQXC 1I8IA 3MREA 1BZ7A 1AQDB 4S1DC 2ATKB 2NY5C 1SJEB 3CCHA 1ZGLP 1A6ZB 2JJSC 2PYEB 5FUCC 1Z0MA 3QDGA 1IGJA 5MEQB 3KWWB 1RZIB 2V2WB 1S7VB 5ESAA 4RSVA 4XC3L 1TTUA 4OF3A 4I18B 1D6VL 4UOW1 5HYJB 4OCSH 4OF8A 1I9JH 1QFWM 5KVEL 2XA8H 4PS4H 5K59F 3BGMA 2Y06L 2WMPA 2P42B 4FFVD 3MLRH 4U1NB 4MD0B 4U6YB 4AEEA 1D3CA 2IFFL 4UBDC 2YA2A 3T0EB 3GGWA 2OL3L 3O81A 5DSCB 4IDLA 5HHNB 1EO5A 1HI6A 1JHLH 3DRTB 5KTEL 4EI6A 1S9VB 5DD3H 3VXRA 4G6JH 5TDOA 2NYYD 2CDFA 2VDOH 3P9LB 5EH1A 3U30C 4HX1B 4PJFF 1T1XB 4L3EE 3SCMC 4G5ZH 1HSAA 5MI0C 1U36A 4G6AD 1P6AB 3WEXA 4EIZC 5DI8B 5HYSG 1OARL 4XBEL 2BRRH 4GBXA 1CF8H 4YPGA 2CDFB 1UVQB 3FRUB 1AFVL 4WDIA 4E5XB 2R1WB 3OKLB 1FNSH 1WBXA 2GCYB 2CJUL 4NT6B 4WTZA 2CRMA 3TESA 5I17A 4LLUA 4DTGH 4FNLL 3I6GA 3OQ3B 5DTFA 4KWUA 4IOIA 1C5BL 4JPWH 2IGFL 1WVZA 5EFIA 1U95A 4MZ3A 3BDYH 3CZFA 1NMAH 4DN3H 3QRGL 1D5MA 3RUGF 5JIIA 3GIVA 3MFFA 4Y4HB 4F7MB 2AXGA 4FQQB 4UT9H 5DRXA 1A9BA 4P99A 4EUPB 2UYLB 4RCAA 4G6FB 1EO7A 2HT4C 5LGHH 1FGVH 2UZIH 1P5UA 3KS0J 4HKXB 2XZCH 1SHMA 2Y07L 1CD1B 3KLAB 5JW3H 2PW1B 1OARH 3C8DA 5IHZB 3ULUC 3UX9B 3JV6A 2PTUA 4DK3A 3TLRA 4EDXA 4OZFA 4X6BB 1FZOB 2OTUB 2NY4C 2VC2L 3Q6GH 3T4AB 1HYRC 4FQXB 4NKMA 3LEXB 3LS5L 2FSEB 4K3JL 3VXPA 5C0DA 1EFQA 1EGJH 1DTUA 2AP2A 1AGBB 2O5YL 3O3AA 2X70B 5D9SA 5DTFB 1F11B 5D2NB 4FS0A 1MQ8A 4UAOB 5I73C 1IC7L 4Y1AD 4DZ8B 4P2RD 5D7IA 1PJ9A 3CVHA 3ILQD 1U3HD 3QIBD 5IBUB 2QQKH 1HNFA 5CINL 4PLJC 5GJSL 2ATPA 2D7OA 4P59L 3ULUL 3WLWC 1IAOA 3F6IA 1C12B 5KSVB 1W0WB 3ALXA 3VRIA 4TQEL 1MCIA 1WJ3A 5IFHL 1EZVY 3GEWB 1NC4A 4V1DB 4ZFGL 1CXEA 4M8QA 2BSRA 1EGJA 3BKYL 5EOQH 4L4VE 2NXYB 4LIQH 2AEQL 1QRNB 1IBGH 2JIXD 4OZHE 4KHTL 3R0MA 2VDNH 3GBNH 3CVHH 2CRYA 1XF4A 4G6FD 3EOBB 3U6RB 3BPLC 4CVZB 5F6HI 4NN5B 4FQ1H 4F15B 2ORBL 4BFIA 1OD7A 4U6TA 2H2PD 3MR9A 1ZLWK 2OP4H 1EHLH 4PUBL 2P5WA 4KK6C 2AABH 3I50L 3MLZL 5E2WL 4ISVA 5GIRB 4Y0GA 3RBGA 5KZCB 3RWFA 4X6DE 1IGML 5D72L 4MX7B 1EUUA 2YWYA 3TT3L 4NKOB 5GRWA 2AW2A 5A3IC 3ZLQC 2VN7A 4P3DB 2YWZA 1OM3L 2IMNA 1IEBB 2YPKB 3QIWD 4RGMB 4IRZH 3REWB 4X6FA 3FHQA 4NFDA 5DK2B 5C0BB 1PEZA 3AS3A 1YJDL 3D3VB 1KPUB 1C7SA 1T1ZB 3KJ4C 3WFEL 5I15L 2D7NA 1JNLL 2VLJD 2QLVB 5E56A 4OBSA 5CD3A 5DJXB 1UYWH 5T3XL 4J8RA 3JTTA 4XNZC 3VI4E 2LU3A 1TETL 5KBNC 2I5YH 5BW7C 3MGOB 3DURB 4UILH 1DVFD 4I18C 5IOPB 4DGYH 3IJHB 1FFNB 2FATH 4UBDD 5H2BA 5JDSB 4QNPE 4TTDC 5HGHA 3RHWK 4FFVC 3WFCL 3FB7B 4PR5B 3TJEH 4KY1L 3SDYH 3H7BA 3IS1X 5BO1H 4OCRH 3IFLH 5A16A 3CFEB 2VLKD 2LVEA 3CJJA 5FA4A 3RTQD 1A7PH 3UTZB 3U46A 5BJTB 3FO2A 4YEFA 4EN3D 4JKWA 3P40A 3EOAA 1FYTE 2ADJB 1XGQA 1YUHA 4M7ZB 1G84A 3U46B 5F71A 1KTLA 2H8PB 3RGVB 3OZ9L 3EO1A 3LRHA 5KW9L 2PXYC 5A2FA 3V8CA 1I8LC 4LSUL 4KKCD 2GHWB 1KB5A 1AXSA 4PRNA 2P5WE 4XVSL 4JQXA 1I7ZB 4H1LH 1A2YA 3UDWA 3MRMA 3ELAT 3OJDA 4W81A 3AAZB 1HWHB 1VPOH 4JHAH 3CFDA 4NQSA 1Q72H 5CMAB 4TSBH 1EAJA 4K07A 3W39B 3F12A 4P2QE 3RBSA 5A3ID 1D5BB 3RPIA 5C9JA 3MJ7B 4KKAD 3O11B 1JCKA 1ZANH 1EEUA 4KAQL 2G5BA 1GJIA 5F8RC 5ICZA 3BUYB 4NJAH 5C2UB 5E5MB 4JG1L 5IB5A 3OAUL 1JPFB 4F37K 2X4UA 4CMMA 2OR9L 1A9BB 4HWBL 4GSDL 4POZD 3GHEH 2HFFB 4XPBH 5JPNA 4BYHA 1JL8A 5IV2B 1FL5A 5FYKE 4LSTL 3GSQB 4RFOH 4RMQA 2LAGB 5EB9A 1J88A 4MDJB 3FO1B 3NFNA 5KANI 5D7IF 5FO7A 3DX8B 1HQRB 1IGCL 1CL7I 4O9HH 2CDEB 5EZIH 3BPNC 4QHLA 1MFNA 4XCYB 2NR6D 4CJ1A 3BP7A 5J6HB 2FWOB 5C2BH 4E41E 3BEVB 4K94H 1EXUB 2CDEA 1SMOA 3MLVL 3BEWB 4NQDD 3GSNL 5IB2B 2QQNL 25C8H 5E8EA 3QI9C 1MFAL 1KBGH 3FOMA 2BY2A 4RMTA 4IS6A 1QBML 4M1GL 1UVQA 4O58L 3EOYG 3ARFA 1E4WL 4RAVA 4YQXL 1JNNL 1VGKB 2B0SL 3ROOA 3AC0A 3CUPA 5JORA 1BVLA 2EDWA 2VLLA 5AYUH 5T1KD 4NPYB 4BZ1L 3N1QC 4KI5F 5JXAH 2CKNA 4OGAD 3P4OB 3PL6D 1KC5H 3N50A 3OR7B 1ULVA 3PP4L 2VDKH 2AJXH 3ISWA 2FJFA 3LB6C 4JQIL 1OLLA 4B7IA 3DUSA 2MCPL 3GIVB 1RUPL 2Y23A 3IF1A 5H37H 2GFBB 1HXYB 4E41D 3WFHA 1K9TA 3WIHA 3DMMB 1GC1L 5E6IC 1OSPL 5LKNA 1HQRA 2DI8A 2FHCA 2XKNB 2NLJB 3BZFB 3CFJB 3DIFA 4HQQH 1AGCA 5D7SL 4D2NA 4DFIA 3KR3H 2VDQL 4APQC 3WS6A 3GM0A 3H8NA 1BJ8A 4QHMA 4RGOH 1INEL 2PO6B 1N2RB 1V3LA 5ADPL 1IGTB 1U8IB 4FTVD 1DBAH 3EO1B 2P8LB 1NFDA 3MRJA 4PG2A 5KS9A 2APTA 2D7QA 3D6GA 4JR9H 5TPWH 3VRJA 4OIBA 4ZTPL 2C26A 3T8XA 2IBZX 5C0DB 1PG7L 3DWTA 4F15C 1S7VA 3ETBF 2EE9A 2VXTL 1BJMA 2EC9T 3QUXB 3HI1A 1NUGA 3ARBB 4QHNA 4TVPD 4NKDB 3MV7B 1QSFB 3BVNB 1KT2B 1WV7T 3I9GH 4HT1H 4HMDA 4LSRH 5IIEB 1CTNA 1E4JA 1YMMA 2D3VA 1QSFD 2J8UF 5T5NF 1EO8H 4HKBA 4MQ7A 2YZ1A 4NZUL 3QEHA 3SJVE 4CVXA 4OGYL 2YEZA 4MNQA 4KUCD 3IKKA 3MRBA 4IBLT 3RNKB 1DN0A 4XWOC 1M4KA 3VCLA 5I76B 4HKJB 3RGVD 3LV3B 3FB5B 3MCLH 1EA9C 4ODHH 5CP7A 3SE3C 1G7HB 3L3KB 1I7RA 4XXDB 1OWWA 3U0TA 1OW0C 1NMCB 4KJQD 4L3ED 1ITBB 2Q76A 4PREB 2IG2L 1PGRB 3P4MB 1LD9A 1N3NA 1I7TB 3QUMB 4NCC1 2XNAA 5GRZA 4YBLB 1DQMH 2F54D 5E8DH 4H25A 4WFHD 3S36X 2X4PA 2UUDH 4YDVA 5D7KD 2VXUL 4BJLA 1H0DB 1JZ6A 1LO0H 1JVKA 3EGSB 3RL2A 3GKZA 4M5ZH 1GVIA 1D5IH 2W0PA 4GG8A 4XHQA 5IG7A 4HXAH 2DRUA 3OR6B 3P9LA 1A6UH 3X12A 1DQDH 2BOCA 1CL7H 4PLJD 3RWCA 3GSRA 3L3GB 4YBHA 4P5TB 1ZA6A 4U7SA 1BGXH 5DZNA 3OKNB 1LE5A 2XWBA 5FXCH 3ARGC 5F3HB 1I7UB 3P0YH 2NY6C 4MNQB 5AD0A 2X4TB 4U6YA 4OD1H 5C0BD 2UZYB 1DLFH 3KXFB 4U05A 5L6YL 3QWRA 1O0VA 3MNZA 3OKEB 4KROB 1KG0A 4IMLA 1G7PA 2ARJQ 3QFDB 1RIHH 1ADQH 1GOHA 4NFBA 5CBEB 1LO4L 1U6AL 4JPVL 3MRIA 3DVNB 1T5WB 5B21A 4MX7A 3P4NB 4HDIB 3BT2L 1ADQA 3VE0A 3O2DH 4BH8A 4JKLA 1JHTA 3K4ZA 4YDIH 1KNOB 2OL3H 1P4IL 4YXKL 1FNLA 4F7PA 4BFBD 4DAGH 3WN5C 5C0AE 1M7XA 5I8OH 2CH8A 2ZUYA 3QNYB 3SGJC 3EKCA 5DJ8A 2YRZA 4LHUD 4EVNB 4TPRH 2XRAL 2HN7A 3NIFE 2GJJA 3PWUB 5E9DB 4RFEA 3QUZA 4Y4KA 3NN8B 1H3TA 4YIQA 1ZVYA 1V3JA 3UROR 5EU6D 3M8OH 4IOSD 2FD6L 3QUKA 2V5SA 4L1DA 2MTPA 4OF6A 4Z0BH 5CUSL 1X5XA 3VXSB 1S7TB 4TNWF 2NY4B 5E2UL 5IBUG 4GS7C 3SDXA 4JRYA 4FXLA 4P9HL 2Y07H 5B38G 1QO3A 3I3BA 4XVTL 1C5CL 2ERJC 4OB5H 1LEGA 1BHGA 1HXYA 3VXSE 4LPTA 3TPUB 2DQEL 5D2NC 1LHZA 1TTFA 3IFNL 3IU3B 3UXFA 2V5TA 1RURH 1TCMA 3C09C 1S7WB 4QT5A 4F2MA 5TE6H 3F7PC 3VD9A 2O5YH 3IDJB 3I3EA 1NBZB 1OTSD 5HY9B 4DVBA 4QGYA 1Z6JT 3N06B 1NFDF 3SKMB 2C3GA 1CFNB 3GHBL 2EDNA 1UKSA 1E6JH 3ARZA 4LNRA 4BK4A 1B0GB 3F7RA 1YEIH 5ALBL 1GZQB 2VRAA 3SDDC 3B9KD 2B1HH 4N5EC 4N8VB 4ZSOE 3RDTC 1ZA3B 3ARDC 4PJAB 4I3RL 2EDKA 1E4WH 1KPVB 2IH1A 2X41A 4HZAA 1T7XA 4QHNB 1CU4L 1FH5L 1XMWA 3LEXA 4L4TA 3RVTC 1RZ7L 3MLXH 3GSQA 2DMBA 2AK1L 3QDMB 1JMZA 5CWSA 3WNPA 2WQRA 3REWA 3DO3A 4G7YH 5B4MC 4AENA 3FMGL 2IH3A 2BFVH 3W9EA 2HVKB 3MNVB 2VXVH 1WIOA 1HXMA 4JPIB 5ICZB 3BE1L 3GGWB 2VLJB 3TA3A 2UWEA 4XPTH 3EYUL 4JFZL 5F1OB 5TF1L 5EIIA 2RHEA 1UM4H 1GL4B 3ZMRA 3C87A 4KAQH 1T83A 4CDGC 3N0PB 1B0RB 5I76A 1DJSA 4ZOBA 1AY1H 5JZ7C 1XIWD 2HVJB 3CFKA 4Y4HC 5DJCA 4WFEE 3Q3GB 3GI8H 4ALAH 4OI9A 3VU2A 3S4SA 1ZLSH 4Z7NE 1G9EA 4PR5A 1X5GA 4JLRB 1IJ9A 2DIAA 3V6FA 5E6ZA 2HJFA 1UG9A 5CD3B 3RWGB 3OKLA 3CMGA 4XPFH 3G6JE 3I6LE 3OGCB 3BSZL 5ICXA 5ALCH 1MWAB 1YYML 2LQRA 1FYTD 4KTDH 5AZ2H 2DQGH 1R3HA 5HD8D 4ETQA 1P4LA 4NQEE 3OB0K 1WTLA 3IS0X 1L4IA 5MENB 1MI5B 1ERNA 4OZHA 4JQVA 2BCKA 4XNUL 3OTTA 1CGXA 3ESVF 2OYPA 5I73B 2LTQB 3ARPA 4M1CD 2BC4A 2JCCE 2A6JA 3QJFA 1A6PA 2X4TA 4OCYL 4OV6F 4LSSH 5CJOH 3THMH 1YNLH 4NQDA 3MO1B 2ZSVA 5EC2A 3VGGA 4I4WB 4X0KA 5I1CL 2JJVA 1FNHA 3EDFA 3ECBB 3JWOC 1FFQA 2AKRA 2PNDA 4O5LH 4DGYL 4WWKB 4A6YB 5JOFB 4HGWA 4M00A 5DJ0A 4GRMA 1KGCE 3U9UA 4PJDE 1Q0XL 5FO8A 2X1XR 3U2SB 2EDRA 3UTPE 1TNMA 3KYMB 4MLIA 1HDMB 4LLMB 1IC1A 1P4IH 4YXKH 4CVZA 3VXPB 4HWZB 5F6IB 5I8OL 3EFDL 3V6BR 4I2XE 1MWAL 3L6FB 2PXYB 3EZ8A 1BLNB 4XB7A 4AYFA 2WINA 2D2OA 2BNRA 5L2JA 4FQJL 2ED9A 1Z3GH 1QTYT 3V5KA 2PF6A 5D8JL 1X5FA 1X5LA 2YUXA 1UADC 2MMXA 4GAFB 3MRCA 1IEBA 4KJWC 1VCAA 1PFCA 4RMWA 1JGVH 4XAKD 5IQ9A 1RVFH 4KY1H 3SDYL 1FO0L 5DHYB 1BFOA 5IFHH 2R0KH 5T5NG 5DURB 1XGYH 2DYPB 3KXFA 5DC4B 4YHZL 4U49A 2HH0H 3FO1A 3WUWB 4PBXA 4OV5A 4LCIH 2G75B 3VH8B 4ZMAT 3IDNB 4PRBA 4BM7A 4XP6L 1A7QL 2C5DC 3MRNA 4RGMC 4ZSOB 3V0VA 4OFVA 1UC6A 3P77A 3RUGB 1F8TH 4CGTA 2Q1EA 1TJGL 5TDPB 2J7LA 1U8PA 5IESH 5KW9H 4H0GA 1J0YA 3D87B 5DT1H 2BMKB 5LJYH 3W11C 1SQ2N 4O02H 3FB8A 3ARDA 1JHTB 4BSJA 5DDHB 1LWRA 3KPNA 5GXBB 4G6KL 3RUGE 4PTUB 4WEBL 3UJIL 4HX1A 4K3JH 4DGVL 2MQ3A 3UTTE 4NQUA 4DQOH 3GK8H 1IQWL 2DL9A 3OPZH 1K6QL 4Q9BA 4PRAB 5JXED 3H7LA 3P30L 1CXFA 4BQ8A 1HYSD 1DBAL 2P24B 4YHNB 3PWVA 3E3QE 4FFZH 4RGNC 4F7MA 1A6VL 3VXNA 1KG0B 3S98A 3MV01 1A4JB 2WBJD 4XBGA 4QO1A 1KJVB 3LQAL 4YWGH 1F58H 3PWPB 3VFRB 5I1AA 1ZA6B 5LGJA 1OL0A 4TUOA 2FHBA 3MGAA 1M1SA 4NO0A 2W65B 4JFDD 2R4SH 1MCWM 5MP6H 4QXGH 1BQHB 3G6DL 1U8JA 1DQLH 3EJJX 1ND0B 2EKJA 4Z7UB 2QQLH 8FABB 2FECI 4P48A 4L29B 4PV9B 3HCVB 4OIIL 4PJHE 1N0XL 4OTXL 5DO2C 1WZLA 2LFGA 3QEQD 4YHLH 2GJ6A 3T2NL 4OKDA 5DUBA 3QRGH 4WO4D 4U1MA 3MNWB 1Y0LB 4FTVA 1DR9A 2NX5E 4KI1A 5GGSY 3MJ7A 3JUZA 5LBSL 4MXQC 4L5FL 5HPOA 4NO3B 1L0XA 2J6EH 4APQB 4TVSa 5LGHL 5I19L 1JRHI 2Q6WA 2X4SA 3KYNB 4G9DA 4O58H 4JRXD 1N7MH 3EW3B 4DEPC 1HHGB 2E7LC 4HH9A 1R5WA 1DVFC 1I3VA 4WRLA 1I7RB 4XXDA 3CDGB 3SJVA 3U0TB 2J88H 4NUGL 2OMBA 5EZIL 3F5WA 5KVFH 5DJCB 1A02N 3MUGA 2EDEA 1YN6B 4LSQL 3QEHB 4R97C 5KANG 1CK0L 4B41A 3TCLA 5J9PB 5KOVC 2BCKB 4J3TA 5C0IA 4BZ2L 4RQQB 1QLEH 1Y6NR 4JFOA 2J6EA 1TCRB 4GMSH 4PGEB 1R24B 1S78C 3LEYL 3GJEA 1L7IL 1OTUC 1A5FL 4PJ9C 3CZJA 3S3SA 1W8OA 5AYUL 3S35X 3RZCC 3G5YA 4HKZA 4LQFL 3TN0A 4NQSB 4OCSL 2BNQB 2ICWI 2NY0B 4AEHH 3CSYB 1KYOJ 2A73A 4N0RA 2W07A 2M8XA 4F3FA 3LDBB 4JO4H 3LMJL 1KN2H 3U2SA 2BRRL 4DW2H 5D9SB 4A6YH 1F4XH 3VXME 5C0RH 3UBXI 2NY0D 1EEQA 2YA0A 4JCLA 3DVGA 4JVPA 1EDQA 1MI5D 4XCFH 4D94A 5CSZA 3Q0HA 3IETA 4LLDA 1RUQL 4IM8A 3VXMB 5I1HH 3D39E 2G60H 4Z9KB 3O9WD 4K3HA 3DSNA 5BOZG 1IKFL 3CNKA 4YXHH 1Z9SA 4MXVE 4NO5B 5F7EH 4QXGL 3STLA 4WWKC 1YMMB 1MAJA 2WIIB 1T89C 2ESVB 1QFOA 5KVGH 3RWFB 1GHFL 1BZ9A 4WI5A 1CF8L 3HRZB 5HYQA 3ARGB 4XCNB 3O8XD 4NP4H 3WLWD 3B43A 2EYRA 5DYOB 3HE6A 3TBSA 3QWOA 3BD3A 4GAJL 1KFAH 1MFEH 4ZAKD 3QWRD 4POUB 5IOPA 1CIDA 3ULVD 1KELL 4BQ6A 1NGYB 5HGAB 2XFXA 3RAJL 3PGFL 5JHLL 4GG6E 5HYFA 4YHYC 3ILPA 1DBML 3NCCB 4KUZL 4MB5A 4TSCH 1S7RB 4YUEH 5D2NE 4S2SA 3VRLF 5C0AD 4YHOL 3BPCA 5HGAA 3Q3GA 4NCC2 5BZDB 4YE4H 2UUDK 2F74A 4DZBA 3N85L 1B6DA 3QUXC 2RBLA 5DRZA 3VFMB 3MRBB 2VLKA 1PVHA 4WY7H 3JWDC 5DJDA 5E00A 4BZYA 4PJ5B 1D5XA 1AGFB 12E8H 3CLEL 4J6RH 1SBBA 1P4BH 1KEMH 4MGXA 3VG9C 4G8EB 3BYTA 2X4UB 4KZDL 1G7PB 5JUEL 1I8KA 3KPLB 1K8DA 2DJ4A 2H1PL 4JN1L 4OF7A 2WIIA 5ID1A 3TM6A 3OXRB 5DHXB 5JPNB 4YWGL 4YHNA 1FG9C 4K71B 5H8DA 1FL6B 2ZCHL 4L8DB 3PL6C 1E6JL 3GMPB 1MPAL 1T80A 4P9HC 4FQ2H 4JG0H 3MRGB 2APXA 3CFCH 2OP4L 1VEMA 2PR4H 3IDUA 4KTEH 3KPNB 1UWXK 3MLZH 2X10A 4S1RH 2JB6A 3GO1L 5K93A 1FLRH 4EI5A 4XNQB 1KULA 4ZXBB 4MNGB 4O2FB 4GS7B 3VH8A 3X12B 3QAZC 1AP2A 2DQJH 2OZ4H 4LLUB 3O9WC 4LIQE 3IGAA 1FVCA 2XTJC 3FQNA 1H5BB 1F97A 3H9HB 1OTTD 3CSYA 3MRMB 4N0YH 1MY7A 1FYHB 1ZK9A 5AG8A 1AGEA 3U9UB 1LNUB 5GGRB 1VACB 2FO4B 4YDJB 3LPGA 2GI7A 4LLQA 4MD4B 3VFGL 4Q97A 3PP4H 1U42A 3RPKA 1G7LA 1T1YB 3LN4B 1DLFL 2F58H 3IKCA 3DVFA 4Q9RH 5J0BA 2ZNWA 4OQ1A 4XX1G 3NH7L 4U3HA 1TZIA 3F7VB 3RVUC 5F9JB 2VDMH 3DUSB 4ZTPH 3UC0L 4RDQF 3V6OA 2YC1A 5CS7A 1TVBA 4LMQI 3JWOH 3U4EA 5FHBH 5SV4A 4QTHB 4JQXC 4NRZA 2VR4A 1HILA 4MNQE 4YHIA 1T5XB 2P49B 4YDKH 4JKMA 1U8LB 3KYOB 4IIQB 1BM3L 1WAAF 1FG2B 2DLEA 4XNYH 3QIUA 4EQ2A 3RA7L 3L3OA 5AZ2L 5BV7H 5EU5A 2YXMA 1UXWA 4HLZH 3RY5A 1CQYA 2F5BH 2X4SB 4OAWA 1JFQL 4OUOA 5IVXF 1OVZA 1A7NL 2VKXA 3MCKA 3FRUA 4GKZA 2NXZD 2IAND 4GKSA 1RIHL 4PBWD 2Y36L 4WW2C 4JPKL 3FQUA 5C0NC 4KTYA 4TN9A 6CGTA 3F6LA 1I1AD 3OKDA 4OUUB 3SDDA 3VD3A 5A40E 4NHUB 4ONHB 2BNUA 2DQDH 4HPOL 3IU4L 4UTAH 4LDEB 4BFGA 5JNYA 1U3JA 5KJRL 1JPGA 5B38A 3JTSA 4MQXD 4UU9B 3FQXA 4AM0A 3TO2B 4EDWL 3QG6B 4JN1H 1AY1L 4QY8A 3BQUA 1UH4A 5FECB 4KK9C 4OFIA 3ZKND 4LVOB 2JCCA 4WI8A 4P4KC 1KCUL 1EO8L 3NAAH 3C2AL 1NEZB 3K8MA 2I24N 3LV3A 3ZT5A 4HF5L 1AO7D 3LKQB 5GGVY 4NKIH 3ORJA 4F8TA 4WU7A 3FMGH 4QHUB 3BZFA 3CFJA 4XB8A 3S4SB 2PYFA 2FEEI 5MEND 1OAXL 3VDAA 2NX5B 5JQ6H 5DK0B 3ZE2F 5DGQA 2VNCA 2Z8VC 4NZTL 2HJFB 1DQJB 4FHBD 4NQED 3GHEL 2IG2H 4PJGE 4XNQA 1J7VR 1E6OL 3OXSB 3MRQA 1PKOA 3Q5YA 5HYJA 4F8QA 3VWJC 2XN9B 3GKWH 5E5RB 4U0RB 4OCWL 2Q86B 5JPMB 5HPMB 1MUJA 3T3MF 3CAFA 5ISZD 1A3RH 4U3XA 4HH8A 4OQTH 4N68A 4XAKE 5DLML 1R3JB 3IDXL 4OLYL 4AENB 3JTSB 2UY7A 1UZ6F 3W9DA 1CFVH 4HUXA 4PRIA 4WJ5A 3D39A 5TE4L 3MX0A 4R9HA 5HI5D 4PJ8C 1I8MA 5INCA 1MFBL 4MCYA 2O61A 4AQ1B 4UINH 5FYKL 5DRWA 2EH7L 1T66C 4ZPTA 1KCRH 3QDME 3QEQA 2ITDB 3ZKNC 2H45A 2W1NA 3V0AC 1NEZG 2J5LC 1LEKB 1XIWC 5DFTA 4LK4A 2J2ZA 3VXTA 4HK3J 1DE4A 2HFEB 4GW4A 4G7VH 4OKVB 3H9SD 5TPWL 3X17A 4XBPB 3IDJA 4LVNC 3QDMD 1G6RH 1KB9K 4M48L 3DV6A 1ZVSA 1MF2H 4PB9H 3V4UH 5DC0A 2XY1A 1W0VA 4PRAA 4QRPE 5L8LB 1QBMH 2HMID 1D9KD 1UWEH 1ZVHA 4YFLI 1DZBA 4F7PB 3RUGA 3HG1A 1NLBH 3DROA 3MYJA 4H0IA 1BVLB 4HD9A 1NUFA 4KRMB 4HC1A 4PP1C 4QRPD 1UEMA 4JZOA 1Q0YH 3VJ6B 4DAGL 5K9KB 2DQEH 3CFDB 1Q8MA 1ZLVH 5I74B 5CJQH 3T4YB 3SDAD 4YHKH 4ZYKB 1BIIA 3MLXL 32C2A 4R3SA 3ILQC 5DRXB 3G6JB 3VFVA 1U8OB 3MLRL 1JGLH 4H1LA 1G7IB 3RVWD 5GS1B 3MO1A 2Q8AL 5MEOA 3WFZA 1KB5B 2P24A 3B2UC 4BFIB 3AROA 1T66D 1T0NB 5AEAA 1CWVA 4K3GA 1M7IA 2BHUA 1CDBA 4R8WL 1HIMH 4YX2L 2DOCA 3BKML 1FL5B 4XP4L 1GAFH 4J3XA 2PCPB 3L7FB 2DQCL 1SJHB 5MERA 2E6JA 4PGCA 1B2WL 2XPGB 3TYGH 4I48A 3WJJC 5I1DA 1RURL 1U8MA 1H0DA 4ZNEA 5I16B 3EYFB 3IRPX 2C7UB 1NMBL 3VMOA 1MELA 4CN1A 1WTGT 3MRHB 3C5ZC 3VI4F 3RWGA 1S7XA 4WFHE 3VE0B 1OAQL 4Z7NF 3BHBA 3RIAF 4LSQH 3DGCR 2VL4A 1NDGA 1RQ5A 3DX7B 4PJ5E 1D7FA 3O3EA 4B0MM 5HHMB 4U1IB 1IAIH 3ARTA 2R4SL 3BGMB 1CQKA 5F1NA 3NIDE 4XX1E 5FGRA 5GS1A 3MRLA 3L7EB 1FO0H 1U8KB 1L7IH 3QXVA 4FQPA 3ZE1E 5D1ZC 1ZT4A 4PRDB 5BZDA 4HKBB 1HCVA 5A2KH 5JNYB 3HE7A 1WWWX 4QOKE 4R90H 4K3EH 3D0LB 1TPXC 4PJGB 3WHXA 1CXIA 2OI9C 3UC0H 1AI1L 4C57C 4FQJH 3MGTB 2IQAB 2VE6A 5A43C 1XZ0A 2JCCF 3K3QA 1RJLB 2BX5A 1SEQH 5IJVB 1QLFB 2Y7QA 3QDGE 5TH2B 3PHSA 2QSQA 4LASH 5F7HA 1FJ1B 1OAQH 3A6BH 2CUHA 3QUXD 3RRQA 3K7UA 4O2EA 2EDOA 1YMME 4YDKL 5TH2A 1AIFA 4P2RA 4RISH 2Z35A 1T7ZA 2CDGA 4JB9L 4XTRD 3UTQB 3RTQA 3S96B 1WFTA 3QULB 4JO2L 4MJ6B 3BESR 3LN5B 4FQLL 4JJ5B 4K8RD 1SVCP 4LCUB 3SDCD 4YC2C 1ORQB 3DIFB 5EA0H 4XVJL 4FXKB 5T5FL 3PWPA 1IKNA 4CAGA 5GJSH 2UWEB 1NGXA 1IM3A 1W0YT 5I1EL 3MLPA 4K7FA 1SMAA 1C12A 3O2VH 3WJLA 2CLZA 4HFWB 4E41B 1A64A 3LDBC 4AK1A 4YR6A 4RMRA 4R4FL 4WEBH 1JN6A 5DA4A 1NC4B 4K7PL 4V1DA 5IB3B 3QDMA 5CWSB 4YGVB 4M5ZL 5E8OA 4TSCL 5D7IB 1FCGA 1X7QB 3QQ9D 3UYOD 1NCBH 2MCPH 2WK2A 1A7RL 3MNVA 4LHUG 1QFPA 2HG5A 1TXKA 4KJQC 1RJYA 1V7MH 1LDSA 3L7FA 5IMMB 2AEQH 3H2WA 3STZB 1B4JL 4PGDB 1B4RA 1T22B 2R2HB 3IFOA 3CXDH 3ZT6A 5FUOL 4PJIF 2ARJB 1NC4D 5HHOE 4PJCA 4P5KB 3VG0L 1TZGL 3JUYA 4UIKL 3ARBD 3VWJA 3BRGC 1A14H 5SX4H 3WKML 3MXWL 1JWUB 3HFML 4K94L 3IF1B 4FQCH 1HEZA 4ZPTB 1CLOL 5F9WB 5FECA 3GSOA 1R0AH 4LGSB 4WI6A 4Z7VB 3REVB 2NY3B 4Y89A 1VB9A 4DEPB 5DJDB 2AI0H 4HT1L 4ZYKA 5C7XL 4PJBE 1PLGH 2YPLD 3ZE2E 1MCKA 2P5EA 1I1YA 4MAYA 3BOVA 3S36L 4MA1C 4C54A 4P23D 5J13C 2RAMA 2DQGL 5JDJA 3TO4C 3OKKA 3T65A 1IGIH 5KVMC 2H6PA 1JPSL 1RUKL 3HE6C 1L9MA 2WM0A 5HVHB 3GMOA 3LKSA 2DM7A 4NUGH 5C0ND 3FL7A 5ACZA 1J8HB 5GRYA 4JM2F 4F57L 4MVBD 3L3GA 2PCPA 5J06A 5ELIA 3BMWA 2VDML 1ETZA 4UQ2B 3W82A 4Y16C 4PRNB 3L5WA 2VLRB 4K71C 5FAAA 4WGWB 1OW0A 5I74C 5C86A 3PL6B 4X7TB 2NY6D 1K2DB 2NX5A 5ILTL 2EICA 4DN4H 3BP6A 3M17B 3KHOA 4MXQD 4NM4L 4UT9L 2JJTA 4CADB 2AQ1A 2BNRD 5I6XC 2V2XB 4XNZB 2OQJB 2HP4A 1T4KA 3BXNB 3MV9A 15C8H 5I1HL 3U4EB 3DHMA 3K2UL 3FFCE 4P2OD 2AQ2A 1I8MB 2F15A 1K4DA 5HHMD 4ZXBC 4AEFA 4XVUC 1NDGB 4FOMA 5ID1B 1IMHC 5HPMA 3O3DB 5CJQL 3S5LB 4G80B 4PJXF 1T1YA 4P3CH 5C6TH 1G7HA 4R7NA 1PG7X 3O41B 2CPCA 3BW9A 3OZ9H 1FLRL 4OCXL 4S1RL 1QSED 2CLZB 2FH8A 2VLKB 2OK0H 4OJFH 3TJHD 3ARYA 1JE6A 3BKCL 2JELH 4U1HA 1AKJB 4K9EL 1DP0A 2ICEB 1WICA 1PKQE 3KDMB 4JHAL 4JFXB 2IF7A 1DEEB 5DD5L 5B22A 4L8BB 4EVNA 1ITCA 4RMVA 5B3NA 3WL9B 2YHGA 3PIQA 9CGTA 4F9PA 1UM5L 3WUWA 3HNTH 3EBAA 5IFAL 5EU4A 1NL0L 2A73B 4M9PA 5F7LB 3SE8L 5TQ2H 2BVTA 4R4NC 2EDTA 1T2QL 3MOQA 3ULVL 3SDXE 2R69H 5E2VL 2RCSH 4Z6AT 2R9HC 3QEGL 2CKBB 4XCCL 3GMNB 1CT8A 3TGXA 1JJUA 4H25B 3IDMB 4PTTA 2AJUL 4M7KH 1U3YA 1KLGA 4M4RA 3D0VA 5TFSH 3RU8H 3NTCH 3T1WA 4HWBH 5FUCE 5GGTA 3OKYA 4OCMC 3NCJH 3SE4C 2Y06H 3HUJF 5DQJB 4YLQT 2VLRD 1NJ9A 1UACH 4M6NL 3OKDB 3GJFK 4OUUA 4WFFD 2ADJA 3C60A 2UY6A 3S35H 5KS9F 2JKXA 43CAA 4YO0B 3BP4A 1WC7B 1KPRB 3MRRA 1J8HD 4U2YA 4CKVX 1IGFL 4HBCH 2G5RA 4NQDE 3SDAB 2JB5H 4J3SA 5F1IB 4FP8L 1U95B 4GMTH 5I1KH 4LGRB 4HHAB 5I8EB 4LHUA 3MLVH 1JTOA 4ODWB 1UXWB 4KJWD 4OD2B 4WUUB 1FVDA 2X7LA 1IC4H 3TT1L 5BV7B 5E6YA 5JOPE 4XVSH 2VISA 4M7JL 3RTQB 1LP9B 4YH6A 2X4OB 3QO0A 5GSVA 4EXKA 3P9MA 3BHBB 3P4OA 1ORSA 1L0YA 4LNVA 5DI8A 5ILTH 2A38A 2NXYD 1P2CA 3BDXA 1NCDL 1ZGLM 1QRNA 2C4FT 1YPZE 2CXKA 2XYCA 4JAMA 4EDWH 4M1DH 2VDLL 3MNWA 1WLHA 3QI9B 5JHDE 3LKOB 4KHTH 3GHBH 5J12C 4G8GD 1ZT4B 4PRDA 1S9XA 5GS3A 4D0BB 1P7QA 3T2QA 2ZUVA 4NM8L 5HYJD 2CLRA 3VRIB 4TOYH 3X11B 4QXWA 4JVUA 3WDHA 4QHLB 1FFOB 4YPJA 2V7NA 1XF1A 3QEQE 5E7FA 2WLYA 3M45A 2F9BT 5D72H 2P7TB 4UILL 5T1KA 4R7DB 4Z77B 5IQ9B 5IM7B 1IGYB 5EBWB 1RHFA 1TMCB 3ZE0E 1G9MH 5FV1L 3UZEA 4JFFA 3O6FA 3WE6A 3MLSH 5I66B 3WFHB 2F8VA 4KZEL 2BNQA 1S5HB 1BQUA 5JHDD 1RHHA 5HD8C 2PETA 1MVUA 4N8VG 1Q94A 4NFCA 4U1SB 1B0RA 4NQXA 3A6OA 4GKNB 4KXZI 2Z93A 5FHBL 3C6SA 1TCRA 1F58L 3M07A 3FONA 2DWEA 5E9DD 2P8LA 5CILL 4IRSD 2ZKHL 1RIVL 2W0KA 3CXDL 3HRPA 2IAMB 4NBYB 1IGMH 5KSAB 2IBGA 3K0WA 4PFEA 1I4FA 4WNQA 2NQCA 1ZLSL 2HKFH 2WP3O 1NC2D 3WFCH 4MXWL 3VFWA 1CFQA 1Q9KA 3NH7H 2NLJA 1RI8A 1WZKA 2V5RA 2FEDC 5IBLD 1XF3B 2R2EA 3EO9L 1AGFA 1SVZA 4M6AA 5HDQH 2P5EE 3G9VA 4RISL 3B5HA 1LP9F 5F3HA 1D5ZB 1FDLH 5ALCL 4X99B 2NXZB 2BVOA 2AV1A 2Y5TA 3CSGA 5FGBC 3TIEB 4PJXA 4PJHF 4LARL 4I9WE 2BVPA 4JFFD 3EYSH 2DM2A 4UMGA 3DO7B 3BKJL 3RWEA 3MRPA 1G9NL 3DUUA 3MRQB 5IHUL 1IKNC 2AK1H 3O4LB 3S37L 3L6FA 1DBBL 5LAXB 1OY3B 4HKXA 4RAVB 4FZ8L 1RMFH 4GXVH 3ZYIA 4PRHE 2CKBH 5DQDH 3ARGA 1A6VH 3SO3B 1PEWA 3DRTA 4J3OC 4EJ1C 3OJDB 1FNAA 2ITCB 3FT3A 3E6HB 5CMAA 1XGRA 4JHZA 2NW3B 5DJ6B 4G5ZL 3DJ9A 2GSIA 4BZ2H 4M3JA 5LCVH 2A2QT 4G8EA 4H26A 4Q74A 3VFUA 3FOLB 1CVSC 3TZVC 3U36A 1BFOB 3HPJA 4D9RD 1VADA 4X9HA 1L7TH 3VCLB 1RJZB 2ZUUA 3PF2A 4XP9H 2G60L 3GB7A 1CLYH 1IE5A 3PNWA 1KSRA 1YUHB 3VW3H 1IKFH 4JFPA 5FA3A 5IF0A 4QRRE 5DA0B 5CEYA 2V7HA 4I77L 4N8PA 5FHAL 4NNYB 3UJTL 5E4IA 1X5AA 1FL3B 4E0RB 4UNVA 4A6YL 2DMKA 2XG4A 2HT3D 3CPLB 5SX5H 3JWOL 4XXCC 4QRUA 3V4VL 4JRXE 2DQUL 5B8CB 1TVHA 1RY7B 4KZDH 2F54E 1DQJA 2Q3ZA 4YPGB 3BN9D 4PGZA 2H1PH 3S3PA 2VE6B 2CSPA 5D7KE 2LABA 2VDPL 3LKRB 4R8WH 4FZEL 3MGOA 4P2RE 1OAKL 2X40A 4Y5YC 1SBSL 3A67L 1UM6L