1U8OB

Crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 in complex with gp41 peptide eldkhas
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
235
structure length
227
Chain Sequence
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPGAAAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLQTYTCNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine design implications
pubmed doi rcsb
molecule tags Immune system
molecule keywords ANTIBODY 2F5 (LIGHT CHAIN)
total genus 38
structure length 227
sequence length 235
ec nomenclature
pdb deposition date 2004-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u8oB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u8oB01
2BK8A 4XBGB 4LSRL 3TIDA 2OP4H 4NJ9H 4MXWL 1VPOL 2P5EB 5JW4M 2IANA 2DWDB 1B4JH 5MEPB 1A7OH 4HMDA 1NDMB 3B8SA 4WU7B 3VGAC 2V2WA 3EUUA 3PL6D 3FKUS 3IXTA 3H42L 3EO1A 4QYOA 4J3SA 3ZKMD 1LP9E 1WZMA 2CR6A 3DMMD 5DHVA 2IH1B 2FSEA 3U1SL 1U8PA 1LO3L 1RZFL 1FFPB 4AEHL 3ILPB 3ULVF 4NWTL 4PJGA 5DC0A 3QIBB 2UWEB 4HPYH 3LKQB 3HZKA 3QT2A 1EEUA 1J05B 1GH7A 3GSNH 1RZ7L 5E8EB 4ZDHB 1IBGH 3PWPB 4O00A 4MHHI 1XIWA 4QHUB 3O6KH 5ISZB 3C09B 1R3LB 5GIRB 5L0QC 4HS3A 3T2NH 1H5BB 2CIIB 1B0RA 4PPTA 5FGBC 3QUZA 3QG6B 4IMLA 1UVQB 1EERB 4OD3H 4HJ0C 1SBBA 4M9PA 1TTGA 1JUFB 1UM4H 1G0YR 4E9LA 3VXME 2CKBH 3HPJA 4MNQD 4RRPA 5BZDB 1XGQB 4OLZL 1I8KA 1CICD 1EFQA 4HT1L 5MENE 1CE6A 2F54A 5J13C 3RAJH 4KJWC 4BH7A 4ELME 5J89A 1L4IA 5ESVB 1HEZB 4KUCD 2ERJC 3BP6B 3FFCA 1UWEL 1IT9H 4U6YB 2DIBA 5C2UB 2DDQL 4DZ8B 2BNRB 4FTVB 4WHDA 4KDVA 3C60A 2AJ3B 3DMMA 1A1NA 1RHHA 1AJ7L 3ARBC 3FZUC 2J12B 1RPQA 3EJYC 3RUGB 2R2EA 4JZJB 3TVMC 4LCIH 1CCZA 1UWXH 3VG0L 2RCSL 4I0PB 1C16B 4XVJL 1BJ8A 4KKLC 2JB6A 2H26A 5ITFB 5DHYB 1F3RB 2A6JB 5DQJB 3WKNA 5JTWA 3CFIC 1BF2A 3MRGB 3RUGE 1X7QA 3P9MB 2FYYB 5T5NG 4DUWA 3S5LG 2R2HB 5CEXB 1SHMA 2IALA 3D25A 3H0TB 4RGOL 1TENA 4OCWL 3RL1A 1W72B 4P9HL 5IFJA 3B6SB 1KEML 5K9KB 2L7UA 4JZOA 1GPOL 2YZ1A 5JPMA 5CEYA 2O61A 5I74B 4XC1L 5TPWL 4XRCA 4M9OA 1BHGA 1CG9A 1QPXA 4M1DH 3K1DA 5HY9A 3RHWF 4LAJH 4NBXB 1F6FB 5CJQH 4NZTH 1FRGL 1U9KA 4QCIB 1VACA 4GMSL 4AH2A 3OG6B 4UILH 4JPVH 1J10A 4MJ5B 2EH8H 4GKZA 1BD2E 1JE6A 4KVCH 2OZ4H 4P23D 4Y4FD 3GMQB 1XGQA 4PB0H 5E7BA 3QIWD 4OCXL 4XPHL 5E2TL 1CLYL 3HMWH 4G6FB 3QQ3A 1YJDL 4W6XB 4HT1H 1YEDA 3BEVB 4NQXA 3HA0A 5AD0B 4PJ9C 1UA6H 3HZYB 1CGUA 3ZTJG 1KIPB 4OIAA 5D5MA 1G7IA 4XX1E 1A8JH 4LSSH 3ULVC 2AAVA 1NMAL 2CO7B 3VDAA 1S7WB 3QUYC 5F8RC 3P11H 1H8NA 2X4TA 1FBIL 2AJXH 4M48L 1CDGA 5D2LE 1K8DA 5GISH 1EZVY 2CLVB 2AJZB 5FYKL 4TUJB 5EO0A 4YHYB 2A6JA 5DQJA 3SKMB 2XN9D 2HWZH 3NZ8A 4P3WA 3FQWB 2VXVH 4Z77B 1ADQA 2R9HC 1T66C 4M02A 2AXFA 1IFHH 4I5BB 1N3NB 1NAMH 4ISVB 5HYSB 2J8OA 3DGCR 3KPQA 5EU4A 2J8HA 2R0KL 3EYUL 3H9SE 3AU1A 3LRHA 3O2DL 3T4AA 4Z78B 4L1DA 3CX5J 1NAMB 2KZ1B 4L4TD 3MRDB 4LF3B 4EJ1C 4WI6A 4C57C 3HNSH 1GIGH 2C5DC 4HGKC 2AQ3A 3QUXD 1EGJL 3S96B 1I7UA 5F7UA 2DLGA 1S3KH 2DI7A 2OJZH 2WLZA 3GJEA 3DSNA 3QIBC 1IM9B 4KGLA 2OL3L 4KRNA 3AM8A 1T1WA 4PJ8D 4E41A 3IAQA 2H1PL 2KKQA 1TETH 3OPZL 4WFHD 1S8DA 4FQXA 4NNXB 5CGYC 2UWEF 1BZQK 3T77B 5LGHL 3RWDA 3HR5A 2BXYA 1SYVB 2OI9B 3O6KL 4LLUB 2W9DH 3MLUH 4DKDC 1TITA 5DVMA 2JJSC 1MCKA 3GJFA 4AEFA 4KQ3L 5DT1H 1V3LA 2ZNXA 1R3HA 1HH6A 1QBBA 4X6DB 4XNYL 3LN4B 1XGTA 4XCYB 2IADA 4F8TA 5H37G 4XCCL 1QQDB 1FQ9C 3IDIA 1U95B 4R7DA 4UIMB 3KPSA 4HZLA 5AWNL 3BRFA 2ZSVA 2A6KA 3CFEA 5IROA 3PHOA 1ZT7B 5DRXA 3QUMB 1EHLH 1NCNA 4NUGH 4JM4H 3D3VA 3C6SA 4P2RB 5B21A 4JFED 2AJUL 2OCFD 3VWJD 1ROWA 4NWUH 4M7KL 1UFUA 4P46D 3GRWA 4Q9RL 3JWOC 3GI8L 1I85A 5HYSA 4NFCA 2J8UA 4PJ7E 2C1OB 2FX7H 2EEBA 1GGCL 4F7CB 1UM6H 1XGPA 2VIRA 1IQWH 4WIQA 5JOPE 1NCWH 2A6DB 4LPUA 1OSZA 2J8UE 4PJ7A 3CFJB 1ACYL 3I9GL 2ZG1A 3R8QA 1MIMH 3TT3H 1QSEE 3RNQB 3VI4F 4OB5H 5DEZA 5CUSH 5SV4A 4PS4L 1MAML 1AY1H 4OGAC 4UT7L 4F58H 2Y5TA 2KH2B 5B38G 4NHCH 4DUXA 4P48A 3MRHB 2IPKB 2GTWA 5D1XA 1C12A 4LU5H 3GUTB 1T3FB 1UB5A 1JN6A 1IAIH 3DOSA 3MRRA 2DYPA 4Z7NE 5DJ0A 2FHCA 1YN7A 3P4MA 4JB9L 2UZIH 5DURD 1YEKL 3ZL4L 3FB6B 3DUUA 3NOIA 4JY6B 5DRWB 4YIQA 3MREB 1A64A 2QQNH 3P0YL 3V0WH 2XYCA 3OB0K 2G9HB 1T22B 4LAQH 4ONOA 2YRLA 4NZTL 3BN9D 1HZHH 1IL1A 1NGYB 4L9LA 2UY6A 4HKJA 1JNLL 3UJIL 5JXAH 4P4KA 5I18H 1CR9H 2V5RA 1BFOA 3RVTC 2F15A 1F3JB 3PP4L 2ID5A 3BN3B 2AXHA 1CD8A 3WXWH 2YD6A 2I9LB 1E4WH 1IAII 2FD6H 3VXPA 5I0DA 3D39B 4YJZL 8CGTA 4X4MA 3BHBA 3OKMA 2FNBA 3G6JF 2DMKA 3LRSB 1AD0B 5BMFH 4JFFB 4AG4H 4L8CB 1PD6A 5HHOE 3SDXE 5L2KA 3DRQB 1YYML 5HHOD 4OQTH 2A77H 5DJ6B 2BY3A 4PJHF 4N8CH 1S7UA 3MGOB 1IEAA 4PGZA 4B5EA 1G9ML 5DEGB 1CFTA 4TSCL 3VD7A 4U6VH 1IC7H 4JQVA 3VH8B 3U9UA 3TWCL 3BP4B 2GJ6E 5IW3A 1JZ2A 3KPRD 1SEBA 5TGBB 5TQ2H 1IC1A 5FYKH 4NCC2 3GSXA 3HG1A 3PL6B 3H9SD 4LVNC 1FO0H 3JWNC 4BH7B 3Q5TA 1H0DB 4ZO8A 2HKFL 3KPTA 1E6OH 1KPRB 3MC0A 4F2MA 2OTUB 3ARED 5FYJU 4PRBA 3UTZB 1CFSA 4LQFH 3V6BR 2I9TB 3K7UA 1RVFH 4DZ8A 1AXSB 1G9NL 1JVKA 3QUMH 3QWRA 3LS4H 5DEFA 5E94B 1ACYH 4HIHB 1AE6H 4JFPA 4GSDL 3T0BA 3QNYA 5IBLC 3UTTE 4FXKA 3EHBD 5SWZD 4KPHL 2XWTA 1JPGA 1B2WL 1X44A 4X5XA 4YE4L 5I75C 4MA3B 4PJXE 1I1YA 5DHYA 3RDTB 3VXSE 4G9DA 3AREC 1L0XA 3T8XA 3IB4A 2XZAL 4ORZC 5M7QA 3Q48A 5ID1B 1KIQA 1X5AA 2XIDA 3SBWC 1UZ8B 3O8XA 1BM3H 2X9XA 5JO5B 4NUGL 3SDDC 1YECH 1JCKA 4LSVL 5GHWH 1FG2B 1MFEH 1T80A 3DHMA 4XPFL 1JNNH 1U8OB 1FV1B 1INQB 5GGUA 1VFOA 8FABA 1X4ZA 4S11A 4Y4HC 4HPOL 1NCUA 1LK3H 1BEYL 1JZ6A 4XVUD 1NCAH 3T0WA 5DMIH 5KSVA 4M1CD 1G9MC 3RX7A 4LLQA 4UDUB 2ZJSL 2UVFA 2F9BT 5D1ZD 4R96A 5IJVB 4LIQE 1A6TB 3ZHLA 3KR3H 3ARXA 1T7YA 5K59F 2AV7B 2HH0H 4NDMB 3BO8B 1I8IB 4YBLC 1A6AB 5ERWB 1X5ZA 4XXCC 3F58L 4MD0B 5JW4R 3C2SA 4NNYB 1E6JL 3GIVA 2BRQA 1Y0LB 25C8L 4NYLA 1KPUA 2VR5A 4U6XA 1V7MH 3WE6A 1ED3A 3EFDH 3OAYK 1N64H 1ZTXL 3WXVL 4LASL 4AENB 2GI7A 4JFDB 4RDQG 3CU7A 4J3WA 5DFVC 1OTUD 3QFJB 4CGTA 4Z7UF 2BNRE 4FTVE 1CTNA 4WGVB 1H3UA 5DGQA 1M7DA 3SJVE 4UAOB 4UQ3A 4JFPB 2BNRD 4FTVD 5EU5A 1A3RH 4PJ9B 3EYSL 3ZKND 3P9LB 1EHXA 3UYPA 1D6EA 3OV6A 1XCQB 2PTVA 4QY8B 1F4WH 4D3CL 4I0PD 3KPLB 3EGSB 4KZDH 1RULH 4JDTH 2NXYD 1S9KC 3LN5A 4IOIA 1AE6L 5DJCA 3KYNB 3L3GA 3AS0A 3U4EB 3WUWA 1NC4B 2QSCL 1KB5A 4E5XA 2A9NH 4DGVH 1CGSH 1MFAH 2COQA 2A83B 5E08L 3UTPD 3BPLC 4KY1L 4NWTH 2YPLE 2UUDH 3MRIA 3NIDE 1INEH 4WFED 1HXMB 1A1OB 3IKKA 2AVGA 3HE7D 4OZ4B 2KQMA 1IE5A 5JA8B 5D2NB 2OI9C 5D2LA 1HXYA 3ZHKA 4MJIB 4QNPE 1CGXA 3WIFB 1LO3H 4OZFH 4EI5D 2GFBB 5F7DA 3MV11 1U8IA 4WY7H 3VXOB 4ZUWB 1RUKH 4I3SH 3AY4C 2H26B 4LHQB 1AKJB 1KB9K 4K3HA 2FGWH 4U0RC 4F37K 2WZPD 1GPOH 5T3XH 2Z31B 1QSEB 3MFGB 1ORQA 4XNZB 1DN2A 2X41A 5C0AB 3U4AA 2YD4A 3L3JA 4K3JH 4UAOC 4CDHA 1FYTE 3W5NA 4NZRH 5IV2B 4XNXH 4UQ2A 2VR9A 4OI9A 4PJBE 2QTEA 1JTTA 3QH3A 4UQ3B 1R3IL 2Y07H 3D39E 3SDDA 2HTLD 3F65A 4HWZB 4X98A 3SKOA 1JV5B 5HYQA 1ACZA 2A74B 2NQCA 5IVOA 5I1KH 1FNGA 4BSVA 3MRQB 3EOBA 5A2KH 1XCTA 1J8HB 4XWGL 2B0SH 3REVA 3UJTL 3TYFB 3RA7H 3LZFH 3EAKA 1RK1B 3I6LD 5F97E 4QCIA 4ONFH 4O58H 2P5WB 1KENH 2HLFC 2XZZA 3TNNA 3VRJA 1BIIA 3QG7L 1CD9B 4TUKH 3IDNA 3NMEA 3C2AL 1AHWC 2X4QA 4UTBH 5HHVH 5HVFB 1IRAY 1UZ6F 4WW1A 1WEJH 2YMXL 3AAZA 4WEUD 4C4KT 1EJOH 1CGWA 2FECL 5IW1A 3HE7A 5FYLE 3BPOB 1D7FA 3O4LA 4APQD 2A6IB 3PDGA 3R06B 2CKNA 5DRNA 5BV7B 5B39G 4OLWH 3RTQC 4GRWE 2X40A 3MR9A 3UAJC 5C1MB 4XPAL 2AXGB 1A7QL 1FP5A 5HDBF 4K94H 3QHTC 1WTGT 3L6FB 5I1AB 1G1CA 4MCYB 3HAEA 3KJ4C 3N9GH 1KN2H 1CT8A 3PGCB 1NGYA 3TA3C 3QRFM 5I1EH 1J0YA 3QWQB 5SWQB 3D3VE 4CADB 1KJVA 2GITB 3BP7A 3FQUA 1L6XA 4K2UL 4OZ4A 5DJZA 4G7YH 3SDDD 2XTJD 1QG3A 3QDGB 5HGHA 4HS8L 3W0WE 3RWDB 1KJMB 2BVQB 4ODVL 3V5KA 1HIML 4N90E 1ZLVH 3DURB 1R3KA 4NO0B 4XMKL 4XWOD 5C7XL 3QUXB 1UEYA 1X3DA 3L1OH 3BSZH 4J6RH 1S3KL 4EDXA 3O41B 3IT8D 9CGTA 1JGDA 3L5XH 5INCB 2BSED 2VDML 3FCTA 2CDEA 4G5ZL 5E9DA 5C0AA 4X8JA 1BPVA 3EW3B 5D1QB 5C08E 5J11C 3IDJB 2VUYA 3DHJA 5HGDB 2HYMA 5D1QC 1K4CA 1U8MA 2VLJA 5E6IA 3BIKB 3RNKB 3B3IB 2FECI 3Q3GB 1H5BA 4X7TA 1CXEA 2IF7A 1KF9B 1ZLWK 2HVJB 1GC1C 3KYAA 5HGBA 5A16A 3SGDI 3MRKA 3OWEA 4KPHH 4PRHA 4Z7UB 1B90A 3SE3A 1UH3A 3KYKH 4D2NA 5KVFL 3D3VD 1KCSL 5LCVH 3QBTB 2ZUXA 1HINH 3ULUF 1S9YA 4ESKA 4PJGE 1HI6B 4KVNL 2A6DA 4KV5F 5L2JB 4EXPX 2EYTB 3AAZB 3LPWA 5DS8B 3PWLB 5ITBL 1NAKH 1J1PL 4TVPH 2WUBL 4P57A 3ISWA 1M71A 1NLDH 4N8VB 3BEWA 2NY0D 1BVZA 5C9JB 3QIWB 3BE1L 4NO3B 5ACZA 1IKNC 1OAZH 3UTSE 1JHKH 4RIRA 1A9BB 3QDGA 2YOCA 2OL3A 5JQ6L 1W0WB 4KAQH 1F2XK 5EZIH 5GRJH 1JRHL 1QRND 2Q86A 4ZPVA 5I9QB 1MPAH 3QEHB 4JPWH 4WCYH 2UY7A 2VUOA 4J3UA 4F7MA 2CRYA 2FJHB 3V6OC 4GMSH 3O41A 4OD1L 3C09C 3EDKA 1R3JB 1PZ5B 2DRUA 3H8NA 4RDQF 2QHRH 4MAYB 4NKIH 2VDRH 5EZOL 3FOLA 5I8OL 1E6JH 4FFVC 4PGCB 2VXVL 3QNXB 3B6SA 1ONQB 2A73A 2HFFB 2ZOLA 3MYJB 3QUYB 2R4SH 5ACLA 3TYGH 2VLJE 2E8YA 2YWYA 2QR0A 4M3JA 5T1DH 5IVXB 2EE2A 2B0SL 4PYGA 4MMXC 5IB3B 4K23L 1I9JL 4LSQL 5HYJB 3IYLW 4ONHB 5TF0A 1IAKB 2G5BB 1Q8MA 1WFTA 1TCRA 3IJHA 2X42A 2DJSA 3VW3L 3DX8B 1MJ7H 3VE0B 2PKDA 1VCAA 1FIGH 4PJFF 3ORJA 3QQNA 4PB0L 2JJTA 5CIPH 2OJZL 3P4OA 1J18A 1KXVC 4GQPH 2VWEC 3IKCA 3WHXB 1F6AA 4QT5B 3WDHA 5F6IC 5INDB 2ICCA 4L8SB 3FQRA 2Y4SA 2GK0A 2F19L 1Z9LA 1X4YA 4BKLA 4LLDB 1NGWB 5L9DL 3BDYH 2FO1A 3QEUA 1HOCB 1MHHA 1T20A 5DHVH 5KTEL 1FLRL 1A0QL 2P47B 3FONB 1T1ZB 4K55A 5IF0B 3IETB 4WWKB 4WU7A 5L8JB 4ZFOL 4L4VE 1MLBB 3BYTA 4TTDC 2VE6B 2P5EA 2AABL 1AXIB 1D5IH 2OX5A 3IU4H 3OKLA 4M7JH 4P2QB 3MLTB 4Y19A 4JQXA 3VFNA 4EDWH 3GFUA 5KJRH 1MREH 4G7YL 5IM7A 4R0LB 2C1PA 2XA8H 4NOFA 1KELL 2XXCB 4JKPL 4U1LA 4GG6B 2X89D 2XI9A 4NQED 4KKCC 2IAMA 5DJXB 3VFRA 1WSST 1YMMB 4NQDA 3E2HB 4JFEB 1PY4A 4OLXH 4P5TC 4X83A 1F11B 3VXSB 4AEIH 3KPLA 1B6DA 1S7XA 1ZS8A 3I02A 4YC2C 2ESVA 1EBPA 1EO8H 3N1QC 4MS8D 2LAGB 3SQOL 3GHBL 4ODTL 1CK0H 1J05A 1MCPH 2FGWL 4Y19D 4DN3L 1KEGL 4UNTA 1KB5B 4RNRB 1UCTA 3LKQA 2MQ0A 4G9FB 1HKLH 4PREB 1I7ZB 1KNOB 4MX7A 4OFDA 4HKXA 2BMKA 2G5BA 3U82B 5F9JA 3RKDD 3V8OA 4BQ8A 3MOAL 3RWJA 4HJJL 4I9WD 1FG2A 2EIDA 3QG6A 4IMLB 5D5MF 2XA3A 5ISZA 1FL6B 2JCCE 4HS3B 3O6ML 4QF1B 4RZCB 3SGKC 3F7RA 3SPVA 4LVOC 5F7LB 1S7RA 2P8LA 4MXWH 2PO6C 3LCYA 1JPFB 2IBZX 5T5FL 1BD2A 5KOMC 3K2UL 3TLRA 5IG7B 4GRWH 3ETBF 4F57H 3LDBB 4OFIA 4XGZB 2BVYA 3LHPH 2IBZY 5DURB 4OGZA 4JKKA 4PJGB 3FHAA 3ILQC 1P7QB 4R7DB 4OLVH 4OZIB 1DQTA 5KSAD 3ARPA 3KLHD 1NCBL 1T66D 3K8KA 4XP6L 5E5UB 1CVRA 5DRXB 1EAPA 5GRVK 4BZ1L 2HA1A 4JN2B 5J1TC 5EC2B 4KDWA 3RGVB 1XIWD 5HHOB 3CC5B 4U1GC 1OAYL 1FNSL 1G7PB 1DJSA 2X4OB 4XC3H 4IRSB 5T1LB 5T3XD 1A1NB 4S1DC 2H3NA 1H3VA 5D70L 1A7PH 4HUWA 5DJXA 1PX3A 4J8RA 3QA3B 3BPOC 4FQLH 2QADC 1DVFA 5GS0D 5C0CE 5CP3H 2PCPB 2WUCL 1FJ1B 4RFOL 4GRMA 4BFGA 2JELL 2R1XA 3DX6A 1N8ZB 4M6AA 4OZFA 1UWEH 4OLYH 3X14A 1NJ9A 2NY7L 3QPXL 4NM4H 3U36B 2DQUL 3W11C 4XTRD 4HX1B 3MLVL 3IDMA 4U3XA 4NFBA 4L4TE 1U6AL 2ADGB 3IGAB 2FATH 3C8KA 5F1IA 1OB1B 1O7VA 2ZG2A 4OD2B 4Y4FC 5IQ7L 4LCYA 5GSRB 4MD0A 1DBJL 1JRHI 4U3CA 3MR9B 3OKKB 5CLWA 1ZVHA 5JA9A 4YDVB 3EYQC 4UOW1 1DQLH 3CFCL 3TYGL 2ADFL 2P8LB 5BVJA 5D71L 2XZCH 1WCBA 3Q5OA 4G6JH 4M1GH 4WEBH 4X6CE 1MCNA 5EU3B 5IBTL 1JFQH 3DROB 1SEQL 3HNTH 5A43C 2VAAA 4PRIA 3RHWK 5EN2B 1TVHB 2ZCKH 3K74B 5I75B 4OCRH 1P7QA 1JJUA 3L3KA 5C0CD 3STLB 4OF3A 2VDLL 3BH9B 2JIXB 3O2VH 1QBML 7FABH 1JRHH 1GGTA 1IGCL 3QXVA 3C08H 4XPFH 4CBPA 4PGEA 4HKZA 2L7JA 4Z76A 4TSCH 2LVCA 5IG7A 3JV6B 1P4LB 1KCVH 4YEEA 1CVSC 3TBWB 3S4SG 2Y36L 1RZJC 3DBXA 4M93B 4MJID 4EDXB 3Q6FB 4KKLD 4Q58C 1CXHA 3RVXC 2P46B 4PR5A 1AQDB 2LVEA 1M05A 3LRGA 4W6WB 1UB6A 3VW3H 1KBGL 2AJZA 2DLHA 1WFOA 3DV6A 3TVMD 3BRGC 2V5YA 4UIKH 3HCVB 2ARWA 5C07E 3QIBA 4H88H 1WT5C 5FUCC 3GHBH 4ODTH 2XZAH 2OXGA 3C60D 3X3FL 3DRQA 1G7PA 3PWPD 1VPOH 4TUJA 1RJZA 2VSDA 5JR1H 1KACB 4WV1C 4XH2B 4DZBB 5EO9B 3RY5A 4XVJH 5IFHL 5T1DL 1WUNT 5C09A 3QISA 4IDJL 3TVMA 4IIQB 5BQ7B 5GZOD 4MNHB 4X6DE 2H32H 4IOFD 1U8JA 3C5ZA 1KIPA 4FXGB 5A3ID 5JXED 4PY8J 3MTRA 3QSKB 2VTFA 4L5FL 1IGFL 5E70A 1EEZA 4NT6B 2CDGB 4AT6A 4U2ZA 4X9IA 4JGUA 4L9LC 4KMLB 1YEIL 4I4WB 4Z0BL 2NY2B 3VGFA 4MWFB 1RZ8B 3ZE0E 3WNKA 3IFOB 1MFCL 2D2OA 4GBXC 4FHBD 1J1OL 1I1FB 2W59A 2VMFA 1RZGB 3RAJL 4XPGL 5CJ8A 1LEIA 2PW1A 1T2JA 3L3JB 5CD5D 3LQAC 1JZ5A 1YEHL 4WUUE 1T1XA 3HC3L 3WFEL 2ZOKA 4PRDB 3WNLA 5E8DL 3L9RB 4X80L 3BUYA 4W68A 2BOCA 3LD8B 4OLEA 4OZFG 1Q0YL 4DN4L 5J12C 2XWTB 3CFBB 5TE6H 1I9IH 1HH6B 1HCFX 2AK1H 5CGMA 3IDYC 4PR5B 2FBJL 4FQIL 3D0VA 5C6PB 4D9QD 4GAGH 5E2VH 2D0HA 5BS0D 5EUKA 5DJDB 4JQVC 4OI8A 4ERSL 2CQVA 3CSYA 3SE3C 3NAAL 2ZKHL 1DTUA 4HFUH 2CIKA 2X4QB 1DANU 3PE9A 2X4UA 2VQ1B 1YN6B 1A14H 4JQIL 3CVIL 4HHAB 4WJ5A 3FOMA 5GS3A 1AP2A 4Z9KB 5KTEH 3HRZB 3M17B 1M7XA 5KSBA 5FKPB 2ITCB 1RU9H 2PXYC 1RK0A 1BAFL 1BQSA 2IH3B 2EXWC 4ZAKA 4KDTC 5E6ZA 2DQJH 1VADA 5I1HL 4YHMH 5TH2B 4TRPH 1YQ2A 4LEOB 4JHWL 4KUZL 1OY3B 4YDJB 1MJ8L 1EA9C 1MIEL 2EDFA 4XPBL 3TO2A 4PJCA 1F4AA 3RZCD 3UBXG 3TJHC 3EIFA 3Q3GA 3HUJA 2EDHA 1EHNA 5FA3B 2VDMH 5F8QC 2ZUSA 1MCQA 3GMLB 1S78D 4OSUL 3RU8H 5DXWA 4PG2C 3EOAA 3NCEB 4MVBD 4YHOH 4Z6AT 5F7KC 3FRPA 4QRRB 4K7PX 3VI3E 1Q0XH 4JZNA 3FT3B 3GSRA 4ZUSB 2X05A 2R1YB 3O45B 1FVCB 2IQ9H 2NXYC 4H5SB 1HSBA 4R3SA 1MIML 4HWEH 5F6IB 5BV7L 5I73C 1MWAA 1Q1JH 1FZKA 2EE6A 3TGXA 4EIGB 3FN0H 3AM8C 1ZV5A 3ZT5A 3MLVH 3ALPA 1GIGL 2D7PA 2BXZA 4JLRA 3BUTA 3BKYL 3UTSB 4ZFGL 3CDFA 3NZHL 4PJ9A 4HKJB 1CXLA 1BQHA 5D7IE 2VQTA 3SE4A 4JY5H 3S97C 4DEPB 4I3GA 3G5ZA 2NNAA 3AB0B 3UC0H 1QSFE 2WANA 3BN9C 3OG4B 1KIRB 3G6JB 5ESQB 3BZFA 1RJLB 4XPGH 2YD7A 4X6BA 3OMZA 3VD4A 2QADB 1O7SA 1Q94B 3GEWB 4WJ5B 3D0VB 1GC1H 2PW2A 5DJCB 5KSBB 3U0WH 3HNTL 3LPGA 4JO2L 4BJLA 4N5EC 3BE1H 4H26B 1OAXL 4LCUA 4ZTPH 2C3WA 1DUYB 1RUQH 4Y16A 1IGTB 2Y5EA 2I5YH 5D93B 3EYOA 5IHLB 4P4RA 3MODH 4JM2F 3VWKA 3HZVA 2V9TA 4UT6H 3O2WH 1ES0A 5C0EB 4O2FB 3AU1B 5DHXB 2BNQB 3A67H 1I8LA 4K2UH 4KVNH 5D8JL 1A6VL 4H20L 4FQCH 4Z7WA 4PV8B 5FCSH 1JWSB 2P24B 1R24B 2W38A 2LU3A 4HH9B 4HLZH 1YEEH 3ULVH 4UB0H 4X4YA 3GSOA 2X4PA 1FG9C 3BQUB 5AG9A 4E0RB 3W9EB 1A7QH 1Q72H 4XMLH 1DLHA 1Q9LA 4QWWC 1MFDL 2CUMA 1R5WB 3VXUD 4YHKL 2D0FA 5FA3A 4LVHB 1C5BL 4RMWA 1T5XA 3QDMA 3V6OE 3MJ9L 1OGAA 5DEFB 4JO3L 4ODWB 3QDJD 5DZNA 4G6MH 3HUJF 4FP8L 4UQ2B 2FLBT 1KGCD 1YEIH 3EO1B 3ZO0A 4JZNB 1HWGB 3G04A 4JPKL 1MFCH 3JV4A 5BCAA 2EDJA 4MA8H 3SDDB 5D6DA 1JPGB 4HAFA 4Q6IA 4FS0A 4XCYA 3OKNA 5L7XH 3LEYH 2WWMD 5LAXB 3BI9X 3LQZA 3STZB 1J8HA 3HAEG 1I3UA 3W2DH 5E6YA 2CKBL 1BOGA 2XKUA 2Y7QA 2ADIB 3SKNB 4GAJL 4LLYA 1Y6NR 5D7LA 2MCPL 2NXZB 2XPGB 4WV1A 3WJLC 3DX9A 3MBED 5IROC 3MBEC 5EB9A 5F9AC 5IMKB 5EO1B 4JAMA 4XXCA 4YK4B 1ZHKA 3LS5H 1AO7B 4EVNA 1U91B 3OAUH 4LRNL 3OX8A 3WHXA 5C92A 4G8GA 3WFBH 4EKXA 2H2PD 2BVPA 4OCYL 4P59L 1Z9OA 3AY4A 1T0NB 3L3DA 4L8SA 1RUAL 2AJSL 4BKLB 4MNGB 5IVZA 2HMID 1FL5A 3OKEA 4NQEA 1DVFD 4WO4B 4JREB 1QRNB 2P24A 4OF5A 2FIKB 1CL7I 1Q38A 2PR4H 1KTDB 4M6OL 4WO4D 1BM3L 4Z18A 2ITDA 4RX4D 4P2RE 3NACL 5HTSA 1DEEB 3WFHB 1ZA3B 4ORGB 3VRIB 4X7SL 3BDBA 1ZHBB 2VXUH 3L5IA 1Q72L 4XMLL 4PV8A 2PYFB 4NNPH 4UTAH 3PDDA 3L3HB 1CDIA 3WS6A 2VKXA 3BIAX 3K4DA 2P44B 1NMBL 4RAHA 3JV6A 3W9EA 5JHDA 2BSTA 2GJ6D 1UM5H 2FJGA 5GXBB 4OLUL 2HRLA 4XCEA 3NFPB 3DTXB 1WICA 4HK3J 4H8WH 4M03A 2I9LA 2E9WA 5F88B 1A9EB 3QNZB 2CLRB 3PJSB 3DI3B 4GXUN 4XNUH 5EU7C 2J6EL 4XMPH 1O5DT 1KB5H 1NEZB 4HIIB 4IMKC 5IK3A 4UINL 2EO1A 4RMQA 5HYJE 3W0WD 3UTTA 1U3HA 4HPOH 2J2ZA 4HXAH 1I1CA 4ZXBD 1FLRH 2A2QT 3MRMB 5IMKA 3WD5L 1EO7A 1PKQA 3LY6A 4P0DA 2YHGA 2EIZA 2BC4A 1HKLL 3ES6A 2V9RA 4G8FB 5F6HI 5FUOL 2MFNA 1WITA 2WBJC 2CLZB 1MQKL 3VWKC 3AVEA 4LBEA 1U41A 4L4JA 3VJ6B 4LOUD 3X14B 2ZUYA 5C0CB 5A40E 2VDQL 1MJ7L 4HCRA 3PWPA 3N0PB 3V7AG 4I48A 3O6LH 4NN6B 4P57B 2D7TL 2Y1VA 1PEWA 3HMXA 2RB8A 4CW1B 3RKPA 3A67L 3PP3K 1AFVH 4IM8A 4Y2DB 4Z7NF 4GKNB 2NMSA 3WS3B 4HWBA 4S1RH 2ED7A 3BMVA 1BBJA 1UVQA 4PBWD 2AABH 3JV0A 1T7ZA 1T6VN 1MCWM 1CTOA 4I0CC 5K9QG 3ARDC 3D0LA 5ESAB 1WTLA 5SWZB 2YRZA 5E6IC 3AS2A 3DSFH 4FFYH 4FXKB 3W11D 4Y5VC 2WIIA 4WHYG 4M5ZL 3HZKB 3MUJA 1QLRB 1FDLH 4ODSL 3WUWB 1I3RB 1NFDF 5EUOB 4D0BA 3FFCB 2DLTA 4FZEH 1A1MA 1T04B 4C59B 4M6OH 2E5EA 4CN6A 2HRPH 5EC1A 3OQ3B 1VFMA 1OW0A 4NN5B 3MMEA 4WU5B 3UBXI 1DL7L 1I1YB 3MNWB 5CD3B 5JHLH 2V2XB 4YXLL 1Q9OA 3FQTA 3QJHA 4HWEL 4ZUTB 5CHNA 2J6EA 5CKAA 1I9JH 4LSQH 3NTCL 4H25A 4HIIA 4BFIB 5FDYA 4ONGH 4LVNB 2V7HA 2B1AL 3EDFA 1MCIA 4LLVA 1N26A 4A6YA 4UDTB 1I7RB 5KVDL 4MJ6B 1B4RA 2V5MA 2EE3A 4H8WL 2QSTA 5ENWB 3IF1B 4IRJD 2RR3A 4R96B 5IJVA 1F2QA 1ZLSL 3KPPA 1GOGA 4ZSOE 3T1FA 3GJFH 2QQKL 2B2XH 3FB8A 4WW1B 2DQIH 2FLRT 3CMGA 3RVVD 3SY0A 2A38A 4GW1A 3OZ9L 3TVMB 3KXFA 4Q9RH 3MV9A 2VWEE 4QHMB 5HY9B 4LFHG 3W0WB 4U1HA 1AGBA 1D6VL 3QB7C 1H3WM 4IRSD 5T1LD 2ADJB 1HOCA 1T2XA 1S5IL 5CD5C 4ZUVB 4YBHA 3V4UH 2VLKE 3CCHA 2CGRL 4LCCA 1G7JA 3LIZL 2V2TB 3QXTA 1FZMB 4MWFA 3B9AA 4DWHA 1U92A 3GM0A 1QFPA 5F7WC 1XH3A 2IMMA 5LXGL 1UENA 5JW4N 1H8SA 3HMXH 2XICA 5F3HB 5C6TL 1G7QB 3G6AA 4MS8C 3WFBL 1WISA 4P23A 1HHIB 1IC4H 3KLAB 2BVEA 1YMMA 4NQDB 3QUZD 5FA4A 3CLFH 4NKMA 4HUUB 2LE9A 3C8DA 3FO1B 2ESVB 4J1UB 1QYGH 1DQJB 3MMEB 5CBAA 1MWAL 2RBLA 1D9KA 2APWA 3CVHB 4HUXA 2JJSA 3ZTJH 3MLZH 1LO5A 2VQUA 12E8H 4S2SB 3QJHB 2HJLB 3RZCB 3WIIH 1LP9F 2CPCA 1MCJA 3I9GH 3OJMB 3SGJC 3A6BL 4AY0A 5F3BA 2EDBA 4PJ9D 3PV7A 1J5OH 3DRTA 3PQYB 5I18L 5C07D 2V2XA 2XV6B 2GKIA 3TZVA 3N1MC 2PW1B 3N1GC 5BS0A 1D9KD 2H9GA 3GSNB 4G80A 4D8PA 3L3OB 3UBXB 4UTBL 4ZD3H 2DYPB 1SMOA 1EJOL 4W4OC 3ARVA 4X7EC 4E41E 4U33A 1WWCA 1J0JA 3B9KB 5D2LB 4UI2A 5FIEA 3DPBA 5AWNH 1UXWB 1QUNA 2FZ3B 4JZJC 1P2CA 5C86A 1U8IB 3VXOA 1X5KA 2Z91A 1WZ1H 3QIWA 4JVPA 1G0DA 4MJIE 1JWMA 5IKCB 5D72H 2Z93A 1QP1A 1NANI 1N5YL 3HPLA 5KG9B 1U2HA 5C07B 2VLJD 1RFDH 3DXAD 3CUPB 4O2EA 1MRCL 4PLJD 4XNXL 2NTFB 3O6FB 3VXPB 5ALCL 3C5JA 4V1DA 4C56A 1PAMA 1YC7A 1OQXA 4KRMB 1DL7H 5I66B 4U1IA 4PUBL 3CVHL 5BW7C 4NKIL 2FJHA 4WDIA 4L8CA 2D7MA 3SO3C 2AEWA 4Y5YC 4QXUH 1E4XI 3U36A 3MRPB 4Z5RA 5F7YC 2IC2A 3PHOB 2NY6B 4FZEL 4MD4B 3UXFA 4PRAB 4PJ7F 4GKSB 4WTZA 5LGJB 5JORB 4YXHL 1BZ7A 3C9NA 2X4SB 4PGCA 1ND0B 3O6FD 4JDVB 1UXSB 2HFEA 3P0VL 3GJEB 4OZGF 3BEWB 3L5JA 4ETQA 1P1ZB 5EPMB 1WEJL 1GZPB 2YMXH 5FGBA 4OGXL 1NEUA 3VU2A 3K46A 2B2XL 4FQXB 5IB4B 2WLYA 2XKNA 4QEGA 4OCLC 3RJDA 2DQTH 4Y7MA 1XIWC 4HUVB 1HH9A 4KK6D 4NM8H 4Q0XH 1TTFA 3GSRB 1WC7A 3LN4A 4HWNA 3BSZL 4YQXH 4J4PA 1MAKA 4PRIB 2R0ZH 2I07B 1NFDB 3PQYE 3T2PA 3RVWD 2C3VB 4PJ8A 4E41D 3DO7A 4HC1H 5C0GA 3VGGA 3X3FH 1ZLSH 2JB5H 3MLZL 4JGJA 4XB7A 5DUMH 5I1EL 5C09E 3SDAC 3C87A 4HIXH 4Y5VB 3SGEH 5IKCA 1ZWIA 3AMLA 4NKOB 4EBQH 4HV8B 3HPLB 1UT9A 2PYEA 4OIIL 1KPVB 3RWIB 3NCYP 5DJYA 1F90L 4MSWB 1UXWA 1BVLA 3B9VA 2BDNH 1RIHH 1TQBB 3GGWA 3P77B 1SJXA 4K71B 2PTTA 3TA3A 4LP5A 4RX4A 1KC5H 3LIZH 2HLAB 3DMMC 3IFLL 3FCTB 4FA8A 3WEXA 3V4UL 1JNJA 3MBEA 3O8XB 3JWDL 4FQHA 1W72L 3NABL 1Z0NA 4MA7H 4GG6A 5JIHA 1DZBA 5EBGA 5KSUB 1I75A 3UX9B 3IDJA 3MJ8A 4JFEA 3CSPA 4HMEA 2HT3D 5F96L 2EIZB 3QIUA 2VXTH 1T5WB 2HFGL 1CD1B 3BXNB 1HYSD 3BAEH 4YHZL 3JWOL 3SDXF 4QT5A 5ETUB 4WWID 1CXIA 4YHIA 3GI9H 4CMHB 1CF8L 4DKEL 4IHOA 4UT9H 5HXMA 1OD9A 5T33H 5KJRL 2SEBA 2BFVH 2VLKD 1XGYL 5ICYB 2F53A 1A6ZB 1HYSC 2AJVH 3UPRA 2DD8H 3AREA 5GRVL 2A0LC 2FIRT 1YPZB 3MO1A 5F7EL 1IEAB 3OKOA 2YS4A 5GS0H 6FABH 4PP2A 3UAJD 3WLWD 1BEYH 2UVEA 5FDWA 2ZOKB 3EZ8A 2VRAA 4N1HB 4PRDA 2M2DA 2MQ3A 4NN7C 1GGUA 2ICWA 2CUIA 5FXCH 3FQNA 3UCRA 3MJ9H 3ZE2F 5D7KE 4HH8A 1NEZG 4BQ9A 4PJEE 4K7FB 4CVXB 1CDJA 4TVPE 1FAKT 3HN3A 5DSCA 4BSJA 2XNAB 2XPGA 4HWUA 4G8IB 1NC2D 1FZJB 4N0UB 3LEXB 2C3HA 3HFMH 4K7PH 3BPCB 3U7WH 4JFFA 3CXHJ 1NQBA 4ZTOL 1A4JB 5IHUH 2ZCHL 1VKXB 5L2KB 4UB0L 4PJDF 2IGFL 4HC1A 2PYFA 1QFUH 3KPRA 1AD0A 1OARL 2AK4D 2GSIB 4HS6B 4GG6E 3T0EB 1F4YL 5KSUA 1D5XA 4PG9B 3VXQA 5HHNB 2AV1A 1NBZA 3L3IB 3QDGE 4X6EA 2NY4B 3BJLA 4I77H 5DEGA 1SYSA 2XQYK 2HTLC 2ERJB 3ZHDA 3L3DB 1QZ1A 4UT6L 2X70B 5BXFB 2VXUL 3AXLA 5J13B 2KL6A 1OTTC 1C08A 3VFGL 3FB7B 5DD1L 5GGRY 1SMAA 5L9DH 2YBRA 5IJKC 4JO2H 1K3IA 2HAZA 3TBSA 5L2KD 2UYLB 3P3YA 3G5YB 4H0IA 1N0XH 1SJEB 4YXHH 1Z0MA 4LCYB 5GQBA 4Q97A 3RBGA 5IB3A 4A2LA 4YHNA 3E0GA 1ERNA 4P3DB 3U6RB 1HWHB 4IHOB 1FRGH 2OK0H 1B0GB 3DUHA 3TH3T 1AGBB 4CNIB 3BWUC 4L29B 1F6AB 1A5FH 2XG4A 2C4FU 3GMNA 4N8VG 4HIXL 2OTWB 2X4OA 3CVHH 1ZANH 4HXAL 2O5YL 3U9PH 5EN2A 1MHCB 5MI0B 1ZK9A 1CGSL 1HSAA 5CWSB 4NP4L 5TQ0L 4K7FA 4RBPH 4CVXA 2R56H 4RMTA 4FQ1H 5HYIA 1YEFL 1A6WL 1AO7E 4PJCF 4YQXL 1F8TL 3V5HA 3EJZD 1MH5A 5ADPL 1F5WA 2R0ZL 2W1NA 4GKNA 4X9BA 3WS3A 4MXQD 5CEZD 2Q6WA 4P2RA 5DHVB 4HSQA 3LSOA 3KXFD 1O0VA 4QHUA 3F7VA 5JHDD 1A4KB 4PLKD 3MNVB 4OM1H 5DI8B 2ADGA 2VDOL 4NQCE 1G7LA 3FAXA 3QIUC 1NUDA 1AC6A 3O6MH 4OM0L 5BOZG 1U8OA 5AZ2L 5HHXH 1GC1L 5T1MB 3ARDB 2P42B 5IFAH 2W9EH 4IS6A 5D7JB 1ZAGA 5L8LB 3T0XA 4GUPB 2PR4L 2YPVH 1RSFA 3JWDH 2KZWA 4JPIA 4MB4A 2VISB 1KJ3H 3U7YL 5I16B 5IMMB 2AV1B 4MNQE 5FCUH 5FM5O 3C6LB 5DFWH 3PNWB 1HEZA 3P0GB 5I8EA 4AZ8A 3IVKA 2E7HA 1ZGLP 5DRNB 4JRXE 4P59H 3MV9D 2BNRA 4FTVA 5LQBH 4X6CF 3F62A 1RZIB 5HI5D 1AI1L 4UMGA 4F7EA 1JF1B 4HKXB 2NTSP 5SWZA 2DAVA 3T65B 4HFWB 3HAEB 4NRZA 5B4MC 3ARYA 3RWJB 1BREA 2NY4D 4O4YH 2Y6SD 1BQLL 1XGRA 2XWJA 5BS0E 1RURL 3BISA 3KPMB 4DKEH 1MHCA 4WHYH 3QFJA 5DJ8A 1RMFL 4I4WA 1KJVB 1JWMB 4JO1L 2BNQE 5DF0A 4JRYA 2R29H 5EDXA 2D3VA 2P43B 3WFEH 1MCWW 1RZGA 5H94A 5SX5K 1A3LH 3HR6A 1JPFA 3ULUL 5MHSE 1ZOXA 3O3EA 3TCLB 3HNSL 3U0TA 3HE6A 2X1PA 4NWUL 1BIHA 1VGKB 3HNVL 5JUEH 3HI6H 4C54A 4ELKA 2VDNL 3TV3H 4YWGL 5B4MD 4Z7WE 5ANMB 3O3BA 1D5ZA 4Z0BH 1MUJA 5E9DB 2XACC 5CINH 3IU3B 1JIBA 1HN1A 1U8PB 1FAIH 1G6RH 2E7LC 2VZUA 4G3YL 4FQJL 1IGYB 1XR9B 4DOHE 1SY6H 5AZ2H 4F9PA 1A14L 4NRYA 3MCLL 1BGXL 1T89C 1N5AA 4AYFA 4EVNB 5MEQB 3DXAA 3G5VA 3MRJA 4WFGD 2X4UB 3CDGB 4IRJC 2AJXL 4RISH 1PJ9A 1MAMH 4UT7H 4PGDA 3FO1A 2CR3A 3ULSA 1H15B 3UDWA 1T03L 1DANT 3MRIB 2FD6L 5D2NA 4BA8A 1GGCH 4ZFOA 3FN3A 3PGFH 2XN9E 4XPBH 2UZYB 3MSPA 1ZHNB 5LBSH 2ZZUT 3MV9E 1ULVA 3QQ3B 1AIFB 3ZKXC 2JCCF 3BEVA 4ORGA 2XRAH 1INDL 3WFCL 1OCWL 4Z7VA 2ARJA 5GGTL 1DQMH 4ZUWA 4OZHA 3HE7B 3QFJE 1NBQA 3QXWA 1R0AL 1U8HB 2PYEB 2BERA 1HHIA 3HE7C 4ODSH 5EZLB 5IVXE 4URTB 4O02L 2Q86B 3S3SA 5EU6A 2H6PB 5TDOB 3GRWH 1OPGL 4DCQA 2J7LA 1BJ1J 1S7TA 4M6NL 3G6JE 4JB9H 5FO8B 3MUY1 3FN0L 2VXSL 3BW9A 3VFOB 4LSPH 1NUGA 3IDXH 4XXDA 4PS4H 3MRQA 1AGEA 1MY5A 4EN3C 4MAYA 2YC1B 2ZNWA 2NY2D 1FZOB 4XWGH 2E6QA 4OFKA 5C0IB 5IGXL 5CZXC 2YXMA 1UWGH 4RMVA 1RK1A 5CJXA 4KQ3H 4X9FA 2DIAA 1I9RL 2R56L 1F6LL 1K8IB 4PFEA 2YEZA 3GKWL 2ZOLB 3UZEA 1U3YA 2OJEA 5I1IL 1EGJA 2J4WL 3BKMH 5ID0B 2IQAA 4KK5D 4RA3A 5EBLA 2H45A 3MUGB 4BYHA 4DGIL 3RVTD 2LABA 1UKSA 4X4XB 1J9CT 1KCVL 2J8UB 4ODHH 4Y16B 1CFQA 5EFIB 3HFML 4M7ZC 2FYYA 3BZ4A 3NIGF 5CIPA 2WBJD 3DX8A 1H15A 5IT2L 4EI5A 1TQCC 3E6FA 3BGFC 4QRPB 4RFNC 4M00A 4P2OD 4YGVA 5D2NE 4P2OC 4WI3A 1HHKB 4MXVE 5EO9A 4MCZA 3CDGA 2E3VA 2W9EL 5EBWB 1QD0A 4YHML 4NDMA 4DOHB 2QV2A 2ZSWA 4G6KL 5HPOA 1UH2A 1YNTB 3T0AA 4RQQA 3VFPA 2D7NA 3DYOA 4XP5L 4OGYL 1K2DA 3H9YA 3PIQA 3CUPA 4O2EB 4NYLB 5IW6B 1KYOJ 4EOWL 4JDZA 5ANME 4Z7WB 4HBQA 3QUXA 1NGQL 5ESAA 5DFTA 1C12B 3MXWH 3C5JB 4V1DB 3MFFB 3FT4B 1IZJA 2WINA 3FB6A 4LPCA 2EYTA 2OR7A 3D9AH 4HJGB 4QRPD 3MACL 3C6SB 1MEXH 4KJPC 3VFVB 3DWTA 3ULUD 4LCUB 3IJYA 3EFFB 1LO2L 2APBA 5ILTH 1K4CB 5E6IB 5C6TH 1FSKC 2KUTA 3U2SB 1C7TA 3C5SB 3TBTB 1OAKH 3ULVE 3PP3H 1FFQA 4QXTB 2BOBB 2K1MA 1J1XL 4RCAA 5A16B 5HVWA 3RNKA 4U1KA 5F7NC 1GYAA 5EH1A 4Q7DA 2WBJA 2VKWA 3RY6C 4RWHA 1ZSDA 3HC0B 4O2CB 2DYPD 5GS1C 3GMRB 4Z78A 1N64L 2F53E 2MHAA 4I2XE 4UDTA 1RU9L 2P49B 3NZ8B 2PYED 3UDWC 4WUUB 3S34L 1XAUA 2YA2A 4JHAH 3T4YA 1TJGH 2UYLA 3B2UD 5FYJE 4MQSB 4EI5B 4OLZH 5DMJB 3K81A 3RI5K 1NCBH 3PGFL 2FO4B 3SDCD 5KS9B 3F7PC 2F8VA 1N59A 4X6DF 5DS8A 4QF1A 4RZCA 3SPVB 3LKPA 5CJOL 2AEIT 2PXYA 1S8DB 3IDYB 4O5LL 3QUKB 2D03L 3MLSL 3T77A 5H35B 5JW3H 1X9QA 5D6CA 1WBXA 5B3JE 4KWUA 5IW6A 3ROLA 2VLRD 1IM9A 1RUPL 2VLKB 4FZ8H 2ICES 2VLRB 1XF3A 5MEPA 1OW0C 5FM4A 1U3HC 2K9UA 3B9KD 5IMOB 1KTLB 1NBYA 3HE6C 4HJJH 3T0ED 2V2WB 3EKCA 3FHQA 3LRSA 2DDQH 1F58L 5T3XL 4KQ4L 4C83A 4JM2B 3WFDL 2EC9T 1EVTC 2EEDA 4S1QH 4M62H 3MA7A 4H1LH 3QH3B 1FO0A 1HILA 4U3HA 3IJYB 2EH7H 4GLRH 1WBZA 4Z0XB 1KGCE 1MLCB 2B1HL 3VFSB 5DYOA 4MNQB 5HHPA 4YHKH 3DIFB 3H2WA 1RZKC 3DX7B 1CFTB 3BP5A 5EOTB 3Q6GH 3I50L 3RDTD 1ONQA 2FEEL 2OQJB 1U93A 4XC1H 5TPWH 3AS3A 2BJMH 4J2XA 3MA9H 4PJBB 4ALAL 2NX5A 4KK9C 1T0MB 1YEEL 5GZOC 3BPCA 1A22B 1MQ8A 3PHSA 2XKSA 3VGHA 5ICYA 2Y6SC 1W2KT 3BJ91 3BD4A 3O6FC 1D5MA 3WKMH 4HC1L 5AUMB 1UACL 4B50A 5F1NA 3BOVA 5DD6B 1RFDL 4OJFH 1S7XB 1ZS8B 3IAGC 4HBCH 1UA6L 2VITB 2X4RB 4F3FA 2NXYB 3M1BB 2FEDC 1T83C 3VI4E 1YMHA 4N68A 4X4YB 2V5TA 3QPXH 2IPUK 2XNAA 5E00B 4JN1H 2BDNL 3TPUA 2WMPA 3QPQD 4JFZL 1BBJB 1VKXA 4JR9H 1IL1B 4FQLL 1T5XB 2C4FT 3EOTL 5FF6B 3KPRB 1FVDA 1OGAB 1INEL 3DYMA 4JM2A 3HE6B 5DD1H 4HD9A 4Z7OF 1BBDL 1GJIA 1LVEA 3LS5L 3QRGL 4L3EE 2AEQH 4GXVL 4G42B 4NJAL 1A6VH 1Y0LA 4NSKA 4P4KC 2D4DA 1DFBL 1JGLH 1S9WB 4NN5C 5SV3A 4WHTB 3GB7B 1KB5L 1UB6B 2JK5A 4PGBB 3V0VB 3IJSB 2H2SD 3CK0L 3DX7A 1WLHA 5MENB 5DVLA 1LO0L 4UBDC 2P8MA 1R5VA 5IGXH 4F15B 5T33L 1SM3H 1DBJH 1CS6A 4ZMAT 1FO0B 5ICXA 1YPZE 5EBMA 4LCWE 1N5AB 2DTMH 3RZWA 3VFWA 3NH7H 5BZWA 3TZVC 4BZYA 1W72A 4XP5H 2IAMD 5D9SB 3TO4B 3P9LA 5HPMA 3DI2B 2FX8L 1FNFA 1OT1A 4K7PL 1S5HB 3LMJH 3UJIH 1XCQA 4J8RB 2F5AH 4PRPE 5C2BL 4WFFD 2DQDH 2CJUL 2MQCA 1YEJH 1PKOA 5IB1B 5C0BB 1BD2B 4MD5B 5BJTA 4UU9A 1PDKA 4BFIA 4JEGB 1M7IB 4LU5L 3U4EA 2BRRL 3O3AB 4JPIB 5JZ7C 4G5ZH 3CFKB 2Z4QB 2I07A 1CDYA 1JK8B 3UTQB 4WRLA 2EXYC 2QSVA 4E42A 4FQXC 3HUJE 3GKWH 1NGZA 2AJVL 1NAKL 4TVPL 3QQ4B 4DKFL 4PJFB 4ZUUB 3PWUB 3UMTA 5CCKL 2ZG3A 3MXWL 1EAPB 2IEPA 3DYPA 4MAUL 2H3NB 3CCHB 3U48A 3LKRB 4KTEH 4MDJA 4Z7VE 3CLEH 5BVJB 1MVUB 4HUNB 5HVGB 3X11A 4O5LH 4ETYA 1NCWL 2WBWB 4YHPB 4JANA 4MYWB 1NFDE 4ZOBA 3T0EC 3VGEA 1K6QH 3FN9A 1OP9A 1UM6L 1MJUL 3V0VA 1U8NB 3KPOB 4FFWC 1I1RA 1NKOA 4FFWD 3MRBB 3KWWB 4JY4A 35C8L 3BD5A 1YEHH 5IUSA 1FJ1A 4FXLA 4HX1A 5FO7A 3VRLF 1FO0L 5D96B 2HP4A 3ZE1E 3KPQB 4WTWA 4IRJA 3JZ7A 1EK3A 2W0FB 5F88A 4U49A 3T4AB 1EO5A 3ILPA 3CVHA 5A1AA 4G9DB 4X4XA 3O9WA 4ELMB 2NLJA 4F9LA 2GUOB 3V4PH 4YGAB 5A3IC 3L95B 3H3BC 2FX8H 2E9JA 4UV4H 2R4RL 4TPRL 5FV2A 4LEOA 2VZVA 2IANB 3NCBB 5F9OH 3ZTNH 1UWXK 1LO2H 4G8EA 4N0RA 4RGNC 4ODVH 2DBLH 4LBEB 4N0YH 4WFGE 4QHKJ 5I1KL 4X7FC 5F9WB 2CXKA 2MSPA 4KFZC 4QRUA 3CLFL 5H8DA 5J57B 2Y9RT 1WJ3A 4HUMB 1SM3L 2H8PA 3AROA 4XCFH 3L7EA 4LKCA 5JW5B 1D3CA 3N9GL 4OF8A 5C9KA 1T7VA 1VDGA 4GMTL 3PP4H 1FGNL 1M6OB 1IILE 5L6YL 1PQZA 3GHEL 5IWLC 1FYTD 3KS0J 5FYLH 3U0WL 3UP1A 3QRGH 4F33A 5LXGH 2BHYA 3ULUC 1NGZB 3ARDD 4QLRA 3Q6FA 3F6IA 1S5IH 1CU4H 3MLTA 1CL7L 3E8UH 3T04D 2YPKB 2NCMA 4PJIA 3W9DA 5GJTL 4LHUG 1VENA 2XY1A 3FQUB 4ZD3L 2Z93B 4JN1L 4YPJA 5F7MC 1G9MH 5GS2H 1NGPH 3G5VB 4V2BA 3QEGL 4NZUL 3RUGA 3E6HA 3VA2C 1AR2A 1FPTL 1J8KA 1S9VB 4F37F 3QZWA 3U46A 2N1KA 1C16A 3ULVL 2EKJA 2DQIL 4O9HH 2Y25A 4GRWF 1DN0B 4RRPG 5C0BE 3MLRL 5CD3A 4FXGA 4PJEA 2I60L 3IFNL 5EU5B 4G9FA 3T0EE 3TT3L 5D7IA 1LO4L 4I18B 4XB8A 5K9JL 2YXFA 4PJHA 5JW4Q 1ZA6B 3S36L 1H3GA 4OFYD 2AERT 1AI1H 2AQ1A 1QEWA 1P6FA 5DK0B 3V4PL 4Z95L 2NY5L 5ACMA 5I76B 3VMOA 4JZOB 1RIUL 4M8QA 4AT6B 3UTSD 2A1WH 4DJMA 2Y5TB 1HE7A 1FAIL 4ZUTA 5GPRA 3O9WB 4ELMA 4XBEL 1HQRB 2R2CA 3LQAH 2XKNB 1B0GA 5AG8A 1OVZA 1J1OH 1A3RL 1P1ZA 5EPMA 1N7ML 2DOCA 2NY1B 5JXEA 4XHJC 4MJ6A 3ROLB 1KV3A 2IH3A 1TZHB 2QADD 2AJYL 3X3GH 1NH6A 3ULUH 4WFEE 1U8LA 4Y88A 5C2BH 4LHUD 1R0AH 1JHLL 4ZAKC 5D96C 3UPAA 1KTLA 4EN3D 3GJFK 4LLWB 4AM0B 4FFZL 3Q1SL 4GW1B 4C83B 3P9WB 1WFNA 1T1YA 2DM3A 4M7ZB 1NCDL 4U4BA 5GS2D 5BV7H 3V5DA 4R2GC 3LOWA 5DYOB 4NKOA 5F1KC 2DMBA 2Q8BH 4PJ5A 4D9QE 4PB9L 3JVGA 1LWRA 4WW2B 5D1QA 2B8OT 4ZUSA 1AGDB 5I30L 1DP0A 5I15H 5CP7A 3D85B 3I6GA 3MJ6A 3W39A 5KZCD 1QYGL 3JBG7 4BH8B 3G6AB 1C1EL 4BZ2L 4JR9L 4LCIL 4FQJH 2JELH 1MI5D 1HDMA 3GRWL 2E27H 4X6FB 1SY6L 2NY7H 1AO7A 4PJCB 4PRHB 5FUCE 5J3HC 2C3VA 2NW3B 4PJ8B 5DQ9B 3DO7B 3BX7C 1VHPA 4MQ7A 2HJKB 3ZDXF 3RKDC 1DBBL 2VLLA 5E8PB 1OL0A 1V7NL 2RFXB 1Q94A 4XC3L 1KJ2B 4YDVA 5L2JA 3BDXA 3AUVA 4OZIE 1JBJA 5K9QI 3RWIA 2NYYD 4U1SA 4ZPVB 5FK9B 5T5NF 4WUUA 3H3PH 1J88A 2P5WE 3U7AA 2XZCL 1CYGA 4XWOC 1MCOL 4HWBL 3TNMB 5I71B 4D0CB 2Z31D 1OHQA 4JO1H 5I2IB 1QLFA 3MLWH 2ATKB 2GTZA 2XTJC 2BVTA 1A7NH 1AXSA 3LH2H 2JIXA 4I5BA 4D94A 1U95A 3MBXL 1U6AH 4QOKA 5DK3A 5CEZE 2FJGB 3R0MA 3ZT7A 5EOCH 1W0VA 3GMPA 3VXNB 3VCLA 2BSRB 4GW5B 3O2WL 4OZGB 4PJXB 1UQSB 2XOTA 3ZKXB 4PGBA 3DECA 1ZHLB 3GSQA 5IJKA 3WLBA 1QFWL 2XWBA 3K80A 4S10A 3T8XB 3SBWA 1HHHB 3S96A 4U0QB 2IGFH 1KBGH 4K9EL 1QBLL 2R2BB 1YECL 1T0PB 2OZ4L 1ZMYA 2DLIA 2NY6D 4BH8A 4P2OB 1G6RB 4HK0B 2NTFA 3O6FA 3MA7B 5FYJH 2C1PB 2P5EE 2Q20A 3QXAA 2MKLC 1RY7B 4YFDB 1JGDB 5INCA 2PO6B 3B8YA 2PUQT 3VXSD 2AEPH 2Q7YB 4U1IB 1FC2D 1CG9B 2ICWJ 5T3ZH 2MTPA 3RL2B 2J1KA 3R4DA 1WFUA 3VE0A 4QXGL 4LDLB 3RGVC 4KROC 2A9MH 1KJ2A 2CMRL 1C08B 1FBIH 4M48H 4U6HA 4Y16D 1DR9A 4JRYE 3QQ9C 1SJEA 4EQ2A 3GMQA 1G1YA 3FO2A 4R4NC 4HIJA 3BAEL 2CK0H 4U1MA 1UXSA 2HFEB 5AUMA 4FMKA 3C5ZC 2PTUA 4YHZH 3WJJC 2BHUA 2WNGA 5DUBB 4BQ6A 3VD5A 3I50H 3PDOA 1RJYB 5IB4A 4PBVC 2K7QA 3GI9L 2FATL 5TDNB 4D3CH 4H1LG 1MHHB 1T20B 3SO3B 2YPLD 5FO9A 2L0DA 4MA1C 4M93C 2GJZA 1XGUA 5J6GB 2BOCB 5E5MB 3F5WA 2Y36H 2WQRA 3V6FB 3RWGA 3G04B 3CMOL 2AJYH 3BP5B 2O26U 5EOTA 3X3GL 4WI2A 3VFNB 1PYWB 2W65A 1TNNA 1NCCH 5C0FB 5GS0L 1J1XH 1AGEB 1QSFD 1WGOA 4OTXL 2AXJA 1QFHA 2DM7A 3BHBB 3MRGA 1QRNE 2ZCKL 4N0CD 3IFLH 5I1DA 5FOBA 2R2BA 1VA9A 4HZAA 5KVEH 5BRZE 2HJFB 2DQEH 1XF4A 4XP4H 1S7VB 3BH8B 2DKUA 4M1GL 3MPCA 4MJ2A 3T3PF 3TEUA 4PB9H 4W81A 4ZSOB 4K3DL 3DTXA 3EGSA 4AJ0A 2QSCH 4MNGE 1NGQH 2CKBA 3IJSA 3OXRA 2P5ED 2O5XL 4BSWB 5D7JC 4NQEB 5K9JH 4LK4A 3OGOE 4LGSB 4ODXA 5CAYB 2FL5A 2QKIA 1IQWL 1YY8A 1GGIH 3T0DA 1F97A 2PO6A 1IGML 2SEBB 3KPPB 4YDLB 4H1LA 4DUVA 4P4KB 1FGVH 3MJ9A 4XZUB 2DQCH 1A6ZA 1IKFL 1F3JA 3PXJA 4YHIB 3C6LA 2VL4A 2JJUA 5DWUL 4CUCA 3G08A 1N7MH 5FM8A 5GGRB 5J12B 3CC5A 2ADJA 4HFWA 3S35H 1A6UL 3WD5H 3HI5H 3DUSA 4DQOH 1AKJA 5ISZE 2OTUA 5DUBA 4MAYC 3DROA 5T1MA 2UWEA 4PG2A 5GGSB 4OKVA 4Z95H 1L9NA 3WYRA 3IS1X 4MHHG 2VH5L 5JNYB 4JLRB 1DUZB 1NMCB 4XBEH 4OB5L 3MXVL 4IJ3B 3U0TB 1OAQL 2VL5B 5LGHH 3TT1H 4Y8DC 2GJ6A 1I9IL 5EZOH 4LRIC 3D69B 4LSUL 4U1KB 1EEQA 3WSQH 1ZVYA 1B0RB 2IAND 2VLMD 4WI4A 4Y1AD 5DA4A 5D6DC 4N1CA 5E8EA 4KH2A 1FL3A 5GGUB 3MRDA 3THML 4I3RL 4LCWA 4NGHL 3RTQD 5EUOF 4R4BA 3OAYH 3A6CL 4YZFF 2VDPL 5HD8D 3T2OA 1REIA 5DJ2A 1A1MB 1T04A 4KKBC 3TWCH 1NL0H 3UTPE 2N56A 4WO4C 5FO7B 3I75A 1FV1A 5JUEL 3WFDH 8FABB 1HYRC 5FHBH 1AXTH 5DUPH 4P5KA 3CVIH 3H9HB 2DS4A 3C60C 5IFAL 4PJFA 4ZUUA 3L5XL 2FEEI 4PJGF 1CDHA 4LMQE 4JREC 3FQTB 1YC8A 5HVHC 5DD5L 1FGVL 4OQTL 4UZGA 2XFXB 1IAIL 2NLJB 1ZHNA 3D0LB 2HT4C 2V7HB 1MVUA 4OM1L 3H7LA 4B7LA 4L3CB 3RVXD 1EFXA 4MQTB 4AG4L 2HKHH 1FNEB 3LEVL 1TVBB 1OT2A 1BVKB 3NCJH 1GL4B 2DWEB 5IMLA 2M1KA 4TNWF 3X12A 2QL1A 5B8CC 4AMKL 3HZYA 4TNVK 2R69H 4IEFB 4U1HB 2Q6WB 4WTZG 1OLZA 5FOJA 3TIDB 5EZLA 3K2MC 2CRMA 4IOSD 4EI5C 4RBPK 4RAUB 2YC1A 3VXMD 2V2TA 3HI6L 3BW9B 3FQXB 4G9FD 3KDMB 1HZHL 4XNMA 3TF7C 1HDMB 4X6FA 4YO0B 4R2GD 5K9KA 4GUPA 4GW4B 3BKYH 1Q9WB 4ZFGH 3MNVA 5DI8A 5DQ9A 1U91A 4P3CH 3N50A 4ODBD 5FYLL 4S0TD 1K9TA 2YEZB 3N85H 5ALBH 3FOMB 1OP3H 4BZ1H 2X7LA 5JLZA 1EXUA 3BWAB 4L8SC 3OKEB 1OAQH 4JFQA 4PJDB 5FKPA 3MV7E 2DKMA 3PABA 4PJFE 3GMOA 3K8MA 4RMRA 1UWGL 2YK1H 4F7EB 1OTSC 2XN9B 4WNQA 4Y5XB 5FO8A 2VO5A 4LARL 1ZHBA 4ZO6A 3PQYA 1GAFL 1WAAE 4R90L 3PV6B 5AZEH 4JGMA 5M94B 2X5PA 4U1GB 3JTSA 1FZMA 1OPGH 3C5ZD 15C8H 3UBXA 2OL3B 1MI5E 3VG9C 4ZXBB 5CMAA 2VN4A 3LMJL 3ILQD 4YBQC 1OTUC 1P4IH 1RIVH 1B0WA 2NX5E 3VXMA 3DARA 2W0PA 3GB7A 1KULA 2ARJQ 3SDYL 2R0WH 1JZ7A 1AHWB 1ZTXH 4P2YA 1QBAA 2LU4A 1TPXC 3MZTA 3GM8A 1MRDL 2FZ3A 2VOTA 1BX2A 3P40A 3F7QA 1MCPL 1DQLL 2Z92A 3CFCH 4XMPL 1FGNH 4I3RH 1YYLL 5IOPB 3QDJB 5J6HA 4PJEF 5AAMA 4AK1A 1JGEA 5DT1L 3MYJA 3QUYA 1D5BA 4H0HB 4P5TA 4K3DH 4DW2H 3LEVH 1ZLUK 1FLTX 5BS0B 1L7TL 4G8FA 3SDAA 4OCMC 2GAZA 1T4KA 5KS9E 5T5FH 4DKAA 1T21A 3BT2L 4KJQD 4IIQA 5BQ7A 5DMGD 1XGPB 1WAAA 2IALB 5GRZA 1EPFA 1FNAA 3PQYD 3UO1H 5CINL 3VFUA 3VWJC 4UILL 3CFJA 2BNQD 1AD9A 3KYOA 5H2BA 1IKFH 2FB4L 3X13B 4LSVH 5GHWL 2PXYB 5TDPA 3A6CH 5DRZB 4BQCA 2ZCLL 3QUKA 4GO6B 5FO9B 3S98A 5DQDL 4MJ4A 3NA9H 4CADA 2AI0L 3KPNA 3QUZC 3F7YB 4U6XB 4TTDD 1ORSA 3KGRA 1V7ML 4DGYL 1ZLUH 5HDQH 2K3TA 4MB5A 3V7MA 4MCYA 3K0WA 2HT3C 1QACA 1NBVL 4PY7A 2NPLX 3SE8L 3BPLB 1TZGH 2DLEA 1T03H 3HZMA 2DTSA 5SWQA 3QUMA 5HI3C 2DIJA 1MCCA 3GK8L 1R5IB 2FH6A 4U1JB 1P53A 3QCTL 2A9NL 4DGVL 5I2IA 4OFYA 4D0BB 4NQEE 3QDMB 1JWUB 1KIRA 2VDKH 5J3HD 2X2YA 3UYRL 4JFXA 1ZWIB 5IQ7H 4GLRI 3MUZ1 4P2CG 3ZMRA 3R06A 1LE9A 4L4VD 1E4JA 1F4WL 4PJXA 1UM5L 2EDRA 2Q76A 3WNMA 2EDTA 4DQOL 1BX2B 5ABDE 3CH1A 2GIYA 1MHEA 2GCYA 4YPGB 2HVJA 4ODXB 2F5BH 1MOEA 4OLYL 1X5IA 1F58H 4GBXD 4CL7A 4IRZL 1WC7B 1ZGLA 5HDLA 2BNQA 1DQQB 1CFQB 5EFIA 1Z5LB 1JGEB 2WP3O 4OCYH 4R8WL 2DKSA 4H1LB 4H8WC 4OCRL 1T6WA 4RA0C 4UINH 4B0MM 1S9YB 5F21B 3SJVD 2IQAB 2VERN 4FFVD 3VFUB 2GTZB 1S7SB 1HHJB 3TC9A 1AGCB 2E7MA 4LF3A 1NFKA 4NQXB 4PP1D 2VDOH 2AKRB 3VMNA 5AD0A 1VADB 2KQNA 2R1WA 2W91A 4R26L 4Z8FL 2ADFH 3OJVC 2J4WH 1DBKH 1IGJA 5IBTH 2CUHA 2BHZA 3WL9B 1A7NL 3LH2L 3FB5A 4TULL 4A6YL 4P5MA 5I15L 4NP4H 5TQ0H 3ULVD 1W0WA 3WKML 4AENA 3IFNH 2B1AH 4X5WB 4FQ1L 2Q8BL 5TDPB 1QKZL 3EDEA 5D7SL 2RAMA 5JDSA 5C08D 3FRUB 4U6TA 1KIUA 1F4XH 3EO9H 4NOBA 4FFZH 4M7LH 3OKNB 2BSSB 4LVOB 5E2JA 5HI4D 2OK0L 5F72S 2BY1A 2Z8SA 2GJ6B 4OD1H 4P23C 4LLMA 3ARSA 3FQNB 2J88H 2JK5B 4FNLH 2Q3ZA 1A21A 3RWGB 5J1AA 4XVTH 4AEHH 1MWAB 1DN0A 1OAKL 3KS0H 3QNYB 4RFOH 4Y4KC 4G42A 4YLQT 3VXUA 3DETC 2EH7L 1D9KB 5KAQG 1NAMA 5FYJL 2XQBL 2EDLA 2WWKT 1LP9B 3VH8A 2X4RA 4PJIF 1OAZL 1VFAB 3ZZ1A 2YSSB 4MXVF 4CRPA 4R9HA 1PSKH 4NUJB 1F00I 3VA6A 4LOUC 1QEWB 2AQ2A 4XVSL 4PRPA 3MUHL 2ENSA 3WV0A 2E27L 1H0DA 4K23H 1SQ2N 5JDJA 5GGSY 3QPQC 2DL9A 5T3ZE 5IVXA 4HWBH 4G80B 1QRNA 5FF6A 3ARBA 1KTDA 4Y5YA 3OXRB 1QFUL 2ICWB 1XGUB 2VDRL 2YUXA 4HCRL 5CJOH 1BQUA 5I30H 3EO0A 2AK1L 2FEDD 1KPRA 1EJ6A 3OF6A 4L3CA 3B9KA 1N6VA 3MJGX 1RZ7H 2Z8VC 4L4VB 4JCMA 3BQUA 4E0RA 4X5XB 1FNEA 4P46C 3HLAA 3U30B 3PJSA 4G8GD 3P0YH 3FONA 1QSEA 2YUVA 3V0WL 4X5WA 3BDYL 1CFNB 3O8XC 4QKXB 2R1WB 3RWFA 5DO2D 1BJ1H 4XCEB 1A6AA 1OWRM 1TXKA 2AJ3A 3DMMB 3MLYH 3WL9A 5KVGL 3WDJA 1EEYB 4S1DD 1RIVL 1S7VA 5CFHA 2P7TB 4Y19E 5E8OB 4ELKB 4JZJA 4X6EB 4OKDA 3MV7B 3MREA 4NHCL 3GBML 5D1XD 2DL2A 2WWKO 3IETA 1P69B 1ED3B 3PWVA 3SCMA 5I1CH 5BXFA 4ONHA 1Y6MR 2FBOJ 2CDFA 5FECB 3QHZL 3RRQA 3TBYB 5KSVB 4XNMB 1RMFH 1IZKA 4IBLT 1H5BC 4KKAC 2ZUTA 1HILB 4OT1H 4XCNB 5CZKA 4HXBL 1P4BH 2QEJA 5HGGS 5I19H 3BYYA 1WZ1L 3IKCB 3GK8H 5CGYD 3KPSE 3BZEB 1XMWA 5IIEA 5EWIH 1QVOB 2OQJA 3OSKA 4KUCF 2LQRA 4O02H 1NPUA 4B7IA 4LLQB 4UDUA 2HLFD 1YDPB 4LFHD 1NGWA 4UV4L 2UV3A 4OSUH 1XF5A 5EOQL 1LHZA 4P9ML 5B39B 3V9FA 4PV9B 3ZE2E 3NCFB 2L4OA 5DJAA 3DUSB 1YA5A 1XF2B 3ZL4H 5DGRA 4A6YB 1MFEL 2DI9A 3WUZA 4EXKA 3ZKMC 1I7TB 3TNMA 1VFBB 4RAVA 3T2QA 5I16A 5IMMA 2VNCA 4U1NA 4DVBB 1OCWH 1P9MA 4G8EB 3I75B 3TV3L 5MERB 4WVRA 3AC0A 2FWOA 1U8NA 3JTSB 4U0RB 1KPUB 5EUOA 2WSKA 3S5LA 1YYMH 5I74C 1FH5L 1KCRH 3I2CL 1MCRA 2YWZA 4HK3N 4N8CL 5I6XC 3L9RA 1R3KB 4GXUM 2EEAA 3HC4L 4MQXC 5TF1H 5JZ7D 3IDUA 5D8JH 4OZGE 5HJ3A 2W0FA 3L7FB 4F7MB 4LSDA 4FQCL 3MXVH 4OZIA 2Z35B 1FFRA 5LQBL 3WEXB 3CK0H 4U7SA 2APXA 2P4AB 4XPTL 2J5LB 1QTYT 3ARDA 4LGRB 5DJ2B 3Q0HA 4OFVA 5JHDB 2X1WL 2AI0H 1FL6A 1PSKL 1N8ZA 2F8OA 4HHAA 4P5TB 3SKUD 1JTOA 5ID0A 1ZKAA 3HRPA 4KJPD 1PX4A 1S7RB 1WK0A 1RZJL 1V3KA 2XRAL 5JPNB 3FMGH 4UBDD 4TRPL 4BSVB 1S5HA 5ICXB 2KDGA 3V6ZB 4M3KB 2CK2A 4XGZA 5DWUH 2DQDL 4CN1A 1INDH 4HIEA 3WXVH 2DQHL 4M7LL 3MRFA 3ECBA 3SY0B 3TNNB 1QR1B 1NCTA 2Z4QA 4F2MB 3IGAA 3RTQB 4QGYA 3OR6B 3DJ9A 1Z6JT 4I48B 5L6YH 3HR5B 5CSZA 3OKKA 1SJHB 1Q0XL 5EO0B 5E94A 4CJ1A 3BD3A 1DBML 1V5JA 2GJZB 2NY1C 5K33A 2LV4A 4HUWB 4APQA 4Z77A 3T3PE 3KLAA 1A7RH 1NMCC 2VXSH 2XG5A 4HWZA 3SKOB 4B53A 1YJDH 1EGJH 2DM4A 3K2UH 3KJ4B 1GGBH 1CICA 1AXTL 5DUPL 3Q1SH 4ZFZA 1UH4A 4Y8AA 1EIBA 2I27N 4YWGH 3TFKC 1MQKH 1FNHA 3QEGH 4NZUH 1RV6X 4TNWK 5HHQA 5FOBB 5J1SC 2HTKD 5I1GH 1YQVL 4PJHB 2D7OA 4GW4A 5AAWA 2DF3A 1CLZH 4QTIL 4PJ5B 3EOBB 2OR9L 5HJ3B 5C07A 3KHOA 1NBZB 4YBLB 3W81A 4LEXH 5KSBF 4YFLI 3V5DB 2NY2C 3HS0A 5IHZA 5DMKA 4PJCE 4TVSa 2F74B 4LARH 4W70A 2JB6B 4FQQB 4GRWB 5ITFA 2ORBL 4DEPC 5CP3A 5CJBA 2VR4A 4MDIB 3IRPX 3MRNA 5HHME 4PJ7B 4XVUC 3SKJL 1U8JB 4PIRF 4Y4HD 4EN3A 1YUHA 3GSNA 4D8PB 2EXWD 1N59B 3P11L 4NO0D 4Z7VB 3UTOA 2QSQA 3PXHA 4U6YA 3K8LA 2EE9A 5ENWA 2B5IB 4PRIE 4ENED 3OBAA 5I19L 1DE4B 4NM4L 2GUOA 3KPSB 4HZLB 4UTAL 1R24A 1ZLVK 1CLYH 3HMWL 4LKXB 3OTTA 5BO1H 4N0FA 1NGPL 3H3PL 4GAYA 3D3VB 4I0PA 5DLMH 1PG7W 3MRCB 3RY4A 2VYRE 2QQLL 3ZDZE 2DQFA 2OBGA 3O2VL 5FGSA 1M6OA 4YDKH 3MV8B 4ZUVA 3M45A 2NY3D 3ARRA 4Y4FB 1E4XH 4X9HA 1IC5L 2V7NA 3VRLE 4S1QL 3T1WA 4QHMA 1G7MB 3UJJH 5FKAB 3IXTB 5SWSD 1FDLL 5J11B 4XBPB 3SDCC 4FABH 2WWMC 5C09B 3KLSA 4I77L 1ZHLA 3GSQB 1KPVA 2FJFB 4S1RL 1C7SA 2HJKA 1CD0A 1X5GA 3RIAF 1UQSA 5TE4L 4ETQB 4L3EA 4F57L 4DFHA 2DICA 2HT2C 5E2WL 5D71H 3P2TA 3LHPL 4GRMB 2WM0A 4MJ5A 3TA3B 4HXBH 4LSSL 5I8KL 3H9ZA 3FT2B 4ZDHA 4P23B 2ZCHH 4U05A 3AMKA 2E7LA 5LG1A 1ZT1A 3RFZC 3O6LL 3V52L 2HN7A 4UIKL 4FRWA 5MP6H 4OCSL 3TJEH 3WHE0 3QHFH 4NQVB 1H3TA 4QXGH 2EIEA 1EMTH 3ARBB 4NQTA 4TSBH 4Y5XC 3PWJB 1HI6A 3VMPA 2WBJB 2XT1B 3KPNB 3G6DL 3KPRE 2QR0B 4CMMA 2N7AA 1P84K 4R7NB 3PWLA 4XAKD 1NFDA 2OMNA 5L0QB 1P4IL 1U0QA 4D0DA 5C0GB 1SYVA 2DB8A 2C7UA 4LAQL 15C8L 3WCYA 1AO7D 6FABL 1KTRL 2GY5A 5GS1A 3NFSH 4LP4A 2ED8A 1B4JL 1GSMA 1OD7A 4F7PA 4MAYD 4NIKB 2A77L 4O58L 3BT2H 1JPTL 3QXUA 1HSBB 4R3SB 5EOCL 4OV5B 1JWUA 5BRZD 5DJYB 1JPSL 4LLWA 1CF8H 2DJUA 4AM0A 2YD5A 5BRZB 5EC2A 4NO2B 1EEYA 3G9AB 3X17A 1MEXL 4JFDE 4V1DD 4HKZB 4QRRA 1LD9A 3M17A 2Y07L 5E5RB 1KCLA 3MA9L 4OIBA 2UUDK 4L8BA 2ESVE 3MBXH 1WT5A 1DCLA 1JI1A 3RDTA 1FZKB 1QR4A 3LPFA 4IMKA 4PTUA 4UIMA 5HHMD 2MNUA 2D7TH 5KVFH 4U7MA 1E6OL 1LNUB 1OGTA 5EA0L 5KVEL 2ORBH 5TFSL 5IQ9B 1ITCA 1VEOA 2NXZD 1U8KA 1UKTA 3Q6GL 1VESA 2HRPL 5T1KB 1ADQH 1KCUH 3C6LC 1CLZL 4QTIH 3GIZH 1F02I 3WDIA 4PBXA 4NQSA 4WCYL 1QBMH 1TJGL 5FUOH 3FRPG 1X6LA 4FMFA 1UJ3B 4J23A 3W39B 2I24N 4PRBB 3VXQB 2HN7B 1YDPA 3O4LB 5EIIA 2X7LB 5JLZB 1EHLL 4M6ML 4KQ4H 4JFYB 4WUUD 3V95A 5FDWB 5HYJD 3BGMA 1YY8B 2VDKL 5MP6L 5KZCB 1GGIL 1T0MA 1GVIA 4GBXA 4QHNB 2OP4L 4NJ9L 2WV3A 2YSSA 1N6UA 5ALCH 2EIBA 4HH9A 1FFOB 1A47A 2X4NB 4K8RL 2X4SA 1BQHG 5F9WC 3RWHB 3HAEH 5GRXG 3WNPA 5D7LD 5EU7E 1LEIB 5D2NC 2EZ0C 3MOBH 5F1NB 3RWCB 4U7KA 2G9HA 3DO3A 1FCCA 4XZUA 3RI5F 4DK6A 4I0PC 2PXYD 1HQ4A 2NXZC 3MLWL 1KIQB 1P7KA 4NJAH 4R0LA 4AIZA 4YAQA 4Y2DC 5IF0A 3FFDB 3P4NB 2VITA 1YN7B 4N5UA 2ED9A 3S37H 3VDCA 5DSCB 4DN4H 2QHRL 3DIFA 1CR9L 4DGYH 3GSWA 4G8GE 1SYSB 5MI0C 2X1XR 2D31A 3D39D 3FAWA 2ZUUA 5IEHB 1WWWX 5JIKA 5SX4I 4JCLA 1M7DB 1BECA 1XF1A 1JF6A 1YQVH 3QDJA 1JNNL 2M8XA 4PJBA 4LDOB 1FC1A 3HG1D 3NZHH 1JZ3A 4JJ5B 2O5ZL 4WI5A 1JNHB 1NUNB 3SQOH 4MA1B 25C8H 5D1XB 4YE4H 4CAGA 3GUTA 5SWZE 4XRCB 5J0BA 1TPXB 1U42A 3H7BA 12E8L 1VFUA 4KC3B 3V6ZA 3KYNA 3EO0B 3L3GB 4X0KA 5CILL 5CZVH 3WIIL 4KI5F 5FV1L 2FBJH 1AC0A 4J3VA 3RPIB 3K4ZA 3B83A 2DBLL 4N0YL 2HVKA 2BNUB 4KKAD 4ZTPL 4GBXB 3MRFB 4QHNA 3OR7A 1ZE3C 4R4FH 4NQDD 3IFOA 4Y2OA 4GG8B 4YNYA 1N4XL 5I1CL 5JMRA 2BZDA 3JV4B 4IOFC 5D72L 5D1XC 5JW5A 3LVEA 3W0WA 4I0KA 3ZSTA 5HSFA 2ILLA 1YNKL 1OQOA 4JO3H 1LDSA 1ZLWH 4Y1AA 5J6GA 3QCUH 1N6QH 3T65A 3VD9A 1NL0L 2Q8AL 4HKBB 3TO4C 3MO1B 1MFDH 3DLQR 1CDCA 2F8XC 4L9DA 3E8UL 1EFXB 3G5XB 2F58L 1R3JA 4LPWA 1EHAA 1MCFA 2R0LH 2FHFA 2R1XB 1TTUA 2JE8A 2LTQB 2DQGL 1ZHKB 3FFDA 3P4NA 1JGVL 1TVBA 4LSUH 3BESR 4GKOA 4XNZC 1M1SA 1CLCA 3PGDB 5C71A 4X98B 5IIEB 2C3GA 4P99A 4GMTH 2XA8L 4G6JL 4PGEB 4WEBL 4Z76B 4QGTA 2HFFA 5DVNA 3MOBL 1J0KA 2R4SL 3OHXA 1LEKB 3V2AR 4PJDE 4M6NH 2VISA 5F9OL 4O51B 5B39A 2ZUQB 1LO4H 1OAXH 1OF2A 2R15A 4LSPL 3T4YB 4GG6F 2N7BA 4YC2B 3VGAB 2B39A 3HI5L 3IXAA 2CLZA 4G7VL 4YDJA 3S34H 5BZDA 2IPUG 3IVKB 3QUZB 3CXDH 4YO0A 4UOJA 2R2HA 5DD5H 1CDUA 3NIFF 5D7JD 4BK4A 4NNXA 3EYQD 3I6KA 1EXUB 3HHRB 1L0QA 3HB3C 4NPYA 3MCKA 2B5IC 4JM2D 2E6JA 2FR4B 1KCKA 4M8VA 3K1KC 4Z7OE 1RIHL 3JXAA 3CXHK 3G08B 5ADOH 1KNOA 3GSOB 1AKJD 4MX7B 3QZWG 4OIIH 4CNIA 4Z7WF 4KK6C 3T3MF 4NNYA 5GGTH 1MCLA 3QWOB 4FQ2L 5DD3H 3ZDXE 3S37L 4N0CC 4GG8A 1YNLL 3IDIB 4AL8L 4Y4FA 5D7SH 5IK3B 3C60B 5I1IH 3V79C 2VN7A 4Y2DA 1SVZA 5GGRA 4OT1L 3GO1L 5KG9A 5D1ZB 1HKFA 1SBSH 5KANI 4OLVL 1NMAH 5JNYA 4N90D 2GY7B 3QDHA 2I60H 3MYZA 2BC4B 3KAAA 3WHE1 5D5MB 4XAWL 4C56B 43CAB 3JTTA 4LCWD 3OXSA 4PRID 5FEBA 4WFHE 3D69A 1ITBB 3KYMA 3S35L 1S7WA 4N8PA 3OHXB 3BWAA 1FH5H 3GDBA 3I2CH 1QLEH 2H32B 2Q1EA 2YN3A 2BCKA 3TPKA 1ZGLM 1PEZA 4LHUB 4JM2C 3QQ9D 1ADQL 1KCUL 4KK8D 5L88H 3UYOD 2CDGA 3CNKA 3SEPA 5JORA 4R4BB 1S7UB 3MGOA 1RZ8A 1KTKE 4FFYL 3FTGA 2VQ1A 1YN6A 4TUOA 1GGBL 1FYHB 1KB9J 1MFAL 1MHPL 4G7VH 1FL3B 5EU4B 5ICZB 4KY1H 4Y5YB 2IPKA 3TT1L 4HF5L 4OJFL 1U8HA 3BP4A 5B3JF 2YD8A 5HGHB 2H8PB 4HBCL 4D0DB 3SDXB 5GSVB 2QQKH 5GRWA 1X5FA 3VXUE 1XGYH 1SEBB 1X5JA 3RQ3A 1WZKA 4RFEB 4Y1AE 1NSNH 4OZHE 1FORH 2LAAA 1GHFL 1WQVT 1P7HL 4OZHB 3D87B 3E6FB 4WUKL 1IEBA 4JRYD 3S4SB 1HXYB 4V1DE 2X4TB 1U8QA 4OD2A 3WLWC 2YKLH 5C09D 4QTHA 3I3BA 4ZTOH 4K94L 4NNPL 5CSGA 4ONGL 4I3SL 1RUKL 2H6PA 1I1AD 4WWKC 1AFVL 3A6OA 3U0PA 1NDGA 3B4NA 5HDQL 3CSYB 1BLNA 3LB6D 5E8OA 4P5TD 2ICEB 2DWEA 4QO1A 1OLLA 1GGYA 4Q6IB 3D5OF 1BBDH 1JHTA 3GBMH 3E2HC 1RZJH 4MA3A 4BUHA 1BOGB 1HHGA 3TBYA 2FB4H 4MQXD 1NAML 4RSVA 4YXKL 3RIAK 5C0JB 4A2MA 1CE1L