1U8PB

Crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 in complex with gp41 peptide ecdkwcs
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
235
structure length
227
Chain Sequence
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPGAAAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLQTYTCNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine design implications
pubmed doi rcsb
molecule tags Immune system
molecule keywords ANTIBODY 2F5 (LIGHT CHAIN)
total genus 38
structure length 227
sequence length 235
ec nomenclature
pdb deposition date 2004-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u8pB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u8pB01
4JDZA 4PJ7F 5DQJB 5JIIA 4OLZL 4NC1E 1PJ9A 5M95B 3I75B 4LHUA 1LDSA 1FC1A 4M6NH 3MRMB 3IB4A 3SE3C 2NW3B 4YXKH 4N5EC 1ODAA 3ZSSA 3T4AA 4HWNA 4M1CC 1I1FA 1KCRH 1ZA6B 1FO0L 5F1OB 4MB4A 3RVWC 3ULVD 1EERB 3HI1A 3IDMB 1U42A 5FYLL 2RQ8A 3X3FH 1R5IA 1S78C 3OF6D 1F2XK 4PJ7A 4Y5XB 4DTGH 4UT6L 1T7WA 3JTTB 3G6JE 2PR4L 1GCFA 1FIGL 4DGVH 5HHMD 2B5IC 5J6GB 1GGTA 1CCZA 3L5XL 1F3DJ 1PG7L 5IESH 3PWJB 4I3RL 2EDTA 1TJGL 1YEFL 4LGSB 4XP9H 3PL6B 4MNGE 5KTEH 3PP4H 4Y5VC 3FFDB 3RDTB 1MF2H 5E2TL 2J8OA 4OFYA 1MFDH 5TDPA 3ZKMD 1A9EA 1OP3H 4PLNC 1VCAA 1WWBX 3VI3E 2Y6SC 1SYSB 2M2DA 3QG6A 3QUYB 2QEJA 1TQCB 5JW3L 4DGIL 2ADIB 5C0DB 2UY6A 2V7NA 5IMMB 1G0DA 1I3UA 2OXGA 2BCKB 3PDOA 5F9OH 3HC4H 1IGIH 4HK0A 4RAHA 2H1PH 2C3WA 1XR9A 4X80L 1QQDA 4KDTC 2QSCL 4WUKH 4BQBA 2IF7A 4BH8B 1LEGA 3OXRB 5F7YC 1WTLA 2JJWA 3VWKC 5DC9B 4HH9B 5T1LD 4PJXA 3ZE0E 3VWJB 5BQ7B 4XRCA 3GI8H 1T0NA 3KHOA 2ZOKA 2Y72A 4GBXD 3H9HB 1JGDB 3QDHA 3PWPA 3PQYA 1BFVH 1GVIA 3PHOA 1ZA3A 4G6FD 5J12C 1JHLH 3MRIB 5C07B 5SWQB 4R90H 5CLTA 1NUDA 1T66D 2OL3H 4WU7A 5FGBC 5MI0B 4XBPA 5D5MF 1L7IH 1DVFB 3WLBB 1IT9H 1L6ZA 1LK3H 4EUPH 2DB8A 1ZTXL 1FYTB 1QLRA 2WIMA 1UA6H 5F9JA 3NIDE 5JQHC 4Y16D 5C07A 3N9GL 4I0CC 4NGHL 1IC1A 5GRVL 4PBWD 5F7FA 4K3HA 4XWOC 3WLBA 2XZAL 2ARJA 5DHVB 3QQ3A 5CJ5A 4MJIB 2YD6A 4JQVA 4XCYA 3DI3B 1ERNA 4Z7OF 5DEZA 3G5ZA 3S35X 3ARBC 4C54A 4HJ0D 8FABA 1CDCA 3O3BB 4G7YH 2NR6C 5C0CE 1IEHA 1VKXA 2Z93B 1MRDL 4HF5L 3AGVA 4P5MA 5HI3C 4JQIH 1JF1A 4G6JL 4U1GC 3JVGC 3LCYA 1CD8A 5CUSH 5FYLE 1K85A 1L7IL 4MA1C 4PJ5D 2VTFA 4BYHA 1IT9L 3MV8D 4KQ3H 2BNUB 2WBJD 5DQJA 5HVHB 4P9MH 3ARVA 3WNKA 2QHRH 2B0SH 5B3NA 4HWEH 1A7OL 4WIQA 5F9DC 3WV0A 1JZ5A 2PN5A 4DWHA 2X42A 3GSRB 1YEIH 3F7YA 1Q72H 4LCWA 3RWDB 5ITBL 3O0RL 3HB3D 4P2QE 4TPRL 4XH2B 1FPTH 4L5FH 4XCNA 1SQ2N 4APQC 2G2RB 4GAFB 2AEIT 1AXSB 4RFOL 4U1HA 1VEPA 1H15A 1R5IB 2X4OA 3B8YA 1CGTA 5DD3L 1CL7I 4G43B 2VLKD 5BJTB 3LRSA 2XKNB 4JFQA 4KKCD 2P8LB 4Z5RA 3W2DL 2HT3D 5BV7L 7FABL 1T7VA 3EO9H 1GL4B 1A9BB 4GAGL 2EYSA 5IV2B 4X99B 3NMEA 3ORJA 3L9RB 1IL1A 2NW2B 4UU9A 5CZVL 2I5YH 3ETBF 4OLVH 3FFCB 1MJJB 5INDB 4HKZB 1HXYA 1I4FA 4WI6A 1QQDB 3VFNB 5CSGA 2P5WB 5BS0E 4WHCA 2OK0H 4LOUC 5T1MA 3TNMA 4F58H 1A0QL 3H8NA 5I1IH 3ZE2F 3PIQB 2PTUA 4M4RA 1KYOK 2VDOH 3KPOA 4ZFFA 3O3EA 1CXFA 3E0GA 2W9DL 4CVXA 5HYJE 3LIZH 3MA9H 3QQ4B 3CSGA 4A6YA 5ELIA 2OSLA 3ULVE 2X10A 2WUBL 5GS0H 4YE4L 3L3HA 4LVOB 1GXEA 3SO3B 3EZJB 3RIAF 1MLCA 3KNBA 5BS0D 4D0BA 3M17B 3QEHB 1WEJH 3O6KL 4E41D 1T5XA 3WS6C 5IF0A 5GS1A 1CD0A 1VGKA 1TCMA 1NGQL 5IT2H 2YD8A 4HS3A 3ZMRA 4JFFE 3FQUA 3CFKA 3ZDZF 43C9A 1MFEL 2NNAB 4PJ5A 3HE7C 4MZ3A 4JN2A 1A7PL 3D6GA 3TV3H 1FL5B 1IGCL 1BM3H 4YDLC 1KN2L 1RUAL 3MO1B 5EO9A 1WISA 2JB5H 2NZ9C 3OGOE 1G7PA 2M26A 4GBXB 3VD5A 3GKWH 1SY6H 2GAZB 1SEQH 1U8IB 4P2QD 3QWOB 4GG6A 1GYAA 5DZLA 4ODSH 3FT3B 3CZJA 3IDYB 2EDLA 1QEWB 5J89A 3K1DA 3BKCL 4L4VE 4GG6F 2XNAA 1MCLA 3QCTH 4LLMA 5K9QI 5DJZB 3DGCR 2R1WB 4JO2L 1DQQA 3BQUD 5C0RL 1QR1B 2ATKA 1IGFL 3F62A 2X1WL 4LKCA 3RL2A 4Z95H 4GKSA 3DUUB 3PP3K 4UI2A 4IM8A 4QRRA 3CCHB 2BP3A 5E9DD 1FZMA 3U0TA 2WUCL 2YZ8A 3P4NB 3WIIL 4F7MA 5BZWB 1WBZA 1BM3L 5C09A 5ISZB 5IP4A 1KEGH 4YDIH 3W0WD 1CDJA 4F7EA 3NIDF 1N7MH 4K8RD 3MRQA 3HUJA 1NANH 5JHDA 3IAQA 1XGRB 4HPOL 1CL7H 3IDGA 3KLSA 1U93A 1X44A 2Y06H 3TA3B 5HHXL 1W8NA 1QHPA 3TESA 4I1NB 5J8OA 1S7SA 3B9KC 5GISL 4FMKA 5F7DB 5C0AE 3PNWB 4X0KA 1BLNB 1KJMA 1PKQA 1YEHL 3RTQC 1FN4A 2R29H 5SX5H 4QF1B 4KK8D 5K9JL 4H8WC 3HI5H 5AZ2H 2F58H 5FF6B 1YECH 3GSUA 4ZNEA 1JYWA 4QHKJ 1WBYA 2CDGB 2EDNA 4QHLA 3CFEB 5ADOL 3V4UL 3GIVB 1DBAH 4MGXA 1KJ2B 4H8WL 5BJTA 4AEHL 1O5DT 3SBWC 4NN6B 1RVFL 3WIIH 2CLVB 4UT9H 4JM2C 1KJ2A 3K2UH 4BA8A 2VXVH 1YQ2A 1RJLA 2R2EB 2R0WL 1EEUA 2FECI 5D2LF 5CD5D 2K7QA 2D9QB 1QKZL 2HTLC 4M6AA 4KFZC 1KJ2H 4JRYA 1RZIA 1WT5C 4UAOB 4UDUB 3LSOB 1J1XH 4HWBL 2W0LA 5EUOF 3NACH 1IM9B 3QHZH 2BFVH 3FQRB 2FJFA 4HBCL 3RWIB 1ZGLA 15C8H 3W11C 3BFOA 1AJ7L 3B43A 4ODUA 1VB9A 1JUFB 3TA3A 4S1SH 4S1QL 2XQBH 4OQ1A 5CMAB 3WUWA 2C3GA 5J1TC 4O2CB 3QHFL 4Y1AE 3U9UB 1DBBH 4XNUH 5FYKH 1X4XA 1Q0YH 1CN4A 3QJHB 5DS8B 3AM8A 3SE4A 2JJSA 1HHJB 5JXEC 1HQRB 2LABA 2Y5TB 4N0UA 2NXYC 3PWLB 4J7RA 4MNQB 3O3UN 4LLMB 2DQTH 3RWEA 3NFPB 3CU1A 3DI2B 4X6BB 1F3DH 32C2B 3FRPA 3QWQB 5DZNA 1CLYL 3DETC 4XPGH 4M43H 2YD4A 3PABA 1RAMA 1BD2B 2IH1B 3VXNA 2P4AB 1JZ7A 3TCXA 2JE8A 2Y25A 4APQB 3VE0A 2X70A 5KVDH 2ED8A 3P0VL 4G8FA 1BBJB 4LLVB 5ICXB 1QD0A 3TLRA 5C0GB 5C0FB 4LCIL 1S9WB 4ZFZA 3MV7B 1OCWH 3O3EB 4BM7A 1MUJA 4GAJL 3MLUH 2VITB 1HHKB 3NZ8A 3CX5J 3CZFA 5E08L 2P24A 3D3VD 1YN7A 4XNXH 2AW2A 4LGPB 4EDWH 4LPXA 4GFTB 2J12B 3QDGE 4RAUB 4P0DA 1MLCB 1UM6L 5DJ6A 1U3HC 4GG8A 1P7HL 2IPTH 3C08L 3IVKA 4NKOA 4NO0D 4UQ2A 5C07D 1OAYH 1AGEA 2FB4L 2DIAA 5C7XL 2EDFA 1NBZA 2W07A 4XAWL 1MVUB 1AD0A 2PW2A 1WAAF 4ZFFB 4PJAA 4HS6B 3DSFH 5FYKU 1HOCB 3GI9H 4YDVB 1IC5L 4Q2ZB 4ZFOL 5D70H 1TVBB 3IJHB 2OBGA 3RGVC 5CKGA 3RVUD 2DQJH 2O93L 4M3KB 4K7PH 3FT2B 4F15B 4DFHA 3ZZ1A 1U8LB 3VXUE 1KFAH 2IGFL 3T1WA 3K4AA 4M5YH 1HHGA 1NMAH 4XBEH 4I5BA 5I8EA 4HDIA 1CE1H 4BUHA 2ICCA 2ZUYA 4Z5RB 1WICA 3TN0D 4AQOA 5C09E 1FZKB 2ILLA 4KK5C 4X99A 3VXOA 5J12B 2VN4A 4JRXB 4LASL 4N0CC 2QR0A 1FCCA 3HLAB 5GGVY 4FFWD 4Y4HD 1LDPL 5MP6L 1TQBC 2X89A 4YXLH 3VFVA 3PWNB 2Z92B 5I1AB 1S7VB 3RKDD 1EO5A 3BEWA 4EI6B 2YD1A 4ZYKA 1JNLL 5DD0H 3NFNA 2WBJC 2NY5H 4OCSL 4MJ4A 1QA9A 1HSAB 4NRYB 3MLUL 1A3QA 3WKML 2FR4B 1JK8A 1ZHLB 3BP7A 1UB6B 2MNUA 4M7ZB 5KOMC 3QDJA 3CFDA 1F4AA 2WK2A 4MJ5A 1WCBB 3MLXL 2X2YA 3VXTA 1HSAA 2BNQE 4BQ6A 4F3FB 3D85A 4LP4A 1AGDA 4NQCA 1LD9A 4ZSOB 3SHSA 2XG5A 2VB5A 2FECL 1UB6A 2YKLH 4AENB 5SV4A 3T1FA 3MRIA 5SWQA 1WBXB 2AK4A 4HAFA 5EOQH 1J0YA 1XCQB 1NBVL 1OCWL 4TTDC 1FNGB 5DMYA 1YPZA 4JRYE 2XZCL 3DV4B 3QUKB 4XXDA 5E4EC 2JCCA 3MFGB 2EYSB 2W91A 1KELL 5B38G 3KPTA 4LRNL 4U1NA 4NQTA 4PUBL 3WDJA 1T89A 4FQQB 1DN0B 1BBDL 3JTSB 4MDIA 4ELME 5KVGH 1N3NB 4MB3A 4DVRH 5B39B 5HVWA 1ROWA 2ARJB 3MXWH 1A6AA 4QRPD 1A22B 3L7FA 3QDAA 3VXUD 4HLZG 1DN2A 2WWKO 1F4WL 2FL5B 2HP4A 1P7QD 3BAEH 1A5FL 2KBGA 2QADD 3VXSD 4PTTB 2DQCH 3MRGB 1CXLA 3BKJL 5EIQA 5JDJA 2UWEE 1F11A 4ODTL 2J6EA 5JZ7C 1YA5A 4K3DH 1TJGH 4YFDB 3U7WL 4I77L 1UM4H 2OZ4H 4ZPVB 3NCYP 4LLYB 2BXZA 3LQZA 5L7XH 4Y4KC 4CVUA 1UACL 5EU5B 2VC2H 4DAGH 1EMTL 5FHBL 2YUXA 5IMOA 5DRWB 5T3ZE 2EIBA 4C4KO 4RAVA 4YBQD 3QH3A 3IVKB 4R4ND 5JW4Q 1RK0A 5TE6L 3DARA 4F80A 5IW1B 3P4LA 1LVEA 4P2OA 1YMHB 4MHHI 1CVSC 4O58H 4GRWF 1FO0H 2NCMA 5B3JF 3B5HA 1Z5LB 1QACA 4JFDE 5EU7C 3DTXA 3O9WA 2APWA 2Q86A 4G6KL 2E9WA 1S9XA 5F7HA 3A67H 1BVKB 1ZE3C 3BQUC 1OTSD 3UTOA 1HINL 3LS4L 3X3GH 3BSZH 4DTGL 4O2FA 4PIRF 5DRZA 1NGWB 4Z7WA 3VFMB 3NN8B 1A4KB 4LLWA 4I9WD 4G3YH 2B2XH 1GGCL 2DWDB 1FO0B 2VLRD 5SX4I 3WE6A 5D1ZC 2QV2A 4ZQKB 4JR9L 3SQOH 2DQUL 4K07A 4X6FB 1HKLH 1HH9A 4P2OC 2DQDH 1R6VA 1A2YB 4UDTA 3NTCL 3K8KA 2EO9A 1MHPH 4HXBH 1OLZA 2C1OA 4KJYA 3TFKC 5F1IB 4P2RA 4P3DA 1Q8MA 3AS0A 4GKNB 3ROOA 4G8EB 2FNBA 4N0FB 1RQ5A 3SE8L 2FJGA 3N1QC 2C5DC 4L29A 4RQQA 1IKNC 4HXBL 4QGTA 3MOAL 4LOUD 2XICA 4K7FA 3DV6B 4MS8D 3ZL4H 1RJZA 2AABL 3DURA 4LAJH 5GGUA 2VXUL 1TXKA 4OM0H 1NDMA 5JOEA 4JJHA 2CPCA 2R29L 5A16B 1KCSL 1EAPB 1VFUA 3T4YB 1JFQH 3FO2B 4HV8B 2WMPA 1BPVA 1TITA 2OP4L 1J1OH 4MDIB 4OJFH 4WI5A 5B8CC 1CR9H 3OAZK 4LIQE 1YY8B 2OTUA 3CK0H 9CGTA 5ENWA 4CU8A 2HT4D 3E3QE 3BP4A 5E8EB 3PGFL 4LEOA 2I60L 2FZ3A 4TNWK 4P57B 4JM2D 3QUKA 1GHFH 4NN6C 3DROA 4PJIA 4FMFA 1TETH 2HVJB 4OKVA 4XVJH 4W81A 5D71H 5DC4B 2JB6A 3MRRA 4NKMB 5KAQF 3MOAH 4JKMA 4O5LL 1SY6L 1BIIB 5EIVA 5I6XC 2ITDA 3RVTC 4JPWH 4OZHB 4CGTA 1PZ5A 3UYRH 4KK8C 2F19L 4G8FB 4R2GC 4PY8I 1I8KA 2OTWB 3EO1A 1UWXK 5D71L 1EBPA 2D2OA 1IM9A 3MLVH 4JVWA 3WSQL 3IFPA 2W0FB 4JFHD 2VNCA 5EZLA 5IHZA 2FR4A 5EZIL 2YBRA 2NY0C 3MV9B 5JA8B 4OCXL 5C0BA 4HQQL 1B2WH 3LKOB 1S3KL 3FN0H 5F88A 1SBSH 3BIAX 5HGBB 4P99A 1KPRA 1QLEH 3PXHA 5L9DL 2F15A 2HLFD 3CLEH 4R96A 3TH3T 1UCBH 4YEFA 1QTYT 1C1EH 1C5BH 1R3HB 3WEXA 2IQ9L 4KTEL 4Q97A 5DVMA 4AEHH 3GBNL 3T08A 3OKLA 2YRPA 4RISL 1S7WB 3RWHB 5FUOH 3E6FB 4M4PA 2J8UF 3EOYG 1R3HA 4HZLB 4G6AD 4LP5A 2K7PA 4X6DA 5J11C 2XWTA 3GB7B 5F96L 3MLSH 1BHGA 1UWEH 4JHWL 3X14B 1DEEA 3EOTL 1X6NA 3MV8E 4M62H 3WFDL 3DX7B 2BOBB 3CU7A 4U7MA 3OX8A 1QRNA 1FPTL 4NCDA 2A6DA 1J5OL 2MKWA 1XR8B 4LF3B 1DUZA 5FECB 2AJZA 2XWTB 3GB7A 3LV3A 4PTUA 2YPKA 2VLMD 3T09A 1B6UA 3GSOB 3MLWH 4AEIL 4JO3H 4XVSL 1ZKAA 3DX7A 1NUNB 1WTGT 3IAPA 4YHIA 4OIAA 4PPTA 5ERWB 4N90E 3Q6FB 5BVPH 2DBLL 5C9KA 1R0AH 1AXTH 4HC1L 4KZEL 2BOCB 1VENA 3VJ6B 3SCMD 4WFHE 3DETD 2YPVH 2FX8H 3VGFA 2EZ0C 3H42H 5DJ6B 1IGTA 3DRTB 5ESQB 4RWYH 5DFWH 4H25B 2F8VA 3Q6FA 1KIQA 3L3HB 1TZIB 3P0GB 3C8KA 5CD5C 2DWEA 1A6TA 3JV5A 5D70L 5E8NA 1DLHA 5BRZB 2FSEB 2AJUH 1JUFA 2MSPA 2JLLA 4JY6A 3U7YL 3V5KA 5IW1A 2UV3A 2F5BL 3QEGH 4EIGB 2Q3ZA 3QFJB 4YPGB 1O7VA 3KJ4B 1MEXL 2X1XR 4V1DE 4X6DB 2JB6B 3MRRB 4NKMA 3TN0A 5I18L 4FQJL 4AZ8A 1U8OA 1FVCB 3EFFB 3OKNB 4H5SB 5C0EB 5SWSE 3EDDA 4MNQA 5TJWK 1KLUA 5I9QB 4CMMA 3RWCB 1I8LC 2VIRB 4ZOBA 3BZEB 5I8OH 2P8MB 3WO3B 2A6KB 5C2BL 5AYQA 1JI2A 4J4PC 4X5XB 4GW5B 1L0XA 3D18A 3DROB 2X4OB 4PLJC 2XRAL 4WCYL 5C08E 3O4LE 5EBWB 4KROD 5TPWL 2WUBH 2DLFL 3AS1A 1ULVA 3MJ7A 3O9WB 4NJ9L 1BECA 5A2JH 1KEML 2CUHA 5A3IC 5HGBA 4L4TA 3THML 1FH5H 3SKMB 4UILH 2GYSA 5EU3B 2Q7NA 5L2KD 3OWEA 1FIGH 1V7NH 3TN0C 2V9TA 5I8KL 4X8JA 3LD8C 4NIKB 1NCWH 2GY7B 1J5OH 1A7RL 2R69L 1IBGH 2A6IA 1I85A 1UEYA 4QXTB 4Q74A 2AK1H 5ETUB 4Z8FH 3BGFC 3MLPA 4G7YL 4Z7UB 5FYKD 4KJQD 2CK0L 2GIYA 3J7HA 3FO0L 4BQ8A 2FIRT 1RU9L 4KKLD 4O00A 3QRGH 1N0XL 1QBLH 1IEAA 3WNPA 3GNML 1HIML 5MENE 5GSRA 3D87B 1YEKH 2CK0H 3EYSH 4QWWD 5EPMA 1JWMB 4JVUA 3U36B 4NZTH 4YBHA 3SGJA 4G6ML 4P57A 2J6EH 3H9SB 2DKUA 3IRZA 5FHAH 3OKKB 1JHKH 4L3EE 3VRLF 1JV5B 1UJ3A 4NUGH 5F89B 1I1YA 4GT7A 4JCMA 3FONB 4X9GA 3OAUL 2VXSL 1EO8H 4DZBA 3WCYA 4WO4A 2IPTL 5FYLH 1U95A 5T3ZL 4MXWH 1HXMB 1JNHA 2YUWA 4HUUB 4XAKD 4UINL 3EO1B 3ULVL 1TCRB 2B4CH 4BFGA 1II4E 2PXYA 1BOYA 2IH3A 5IB1B 1PBYA 1N3NA 1ZT4A 1PQZB 3RVWD 3ULVC 3QEUA 3VG9C 1HH9B 1D6EB 3AREA 5F6HI 5KSBB 3SDAA 3BZFB 4HKXA 1T0PB 4ODWA 1E0OB 1WFOA 4EQ2A 3EHBD 3UC0L 3OPZH 3HZKB 1F4HA 4QRRB 1U8JA 2R4SH 2X4TA 5CS7A 1BOGB 5KG9A 4HG4K 4Y4HC 1T22A 3QEUB 3BT2L 3UTSE 2X4SA 3L5WB 4JFOA 2QQKL 3CFDB 2XZAH 2JCCE 2EE2A 4HIHA 5KANG 5GS2D 3O2DA 1NH6A 4UAOC 4ZSOA 1WIOA 2N4IA 3TCLB 1YYLL 3QB7C 2YSSA 4IDJH 4HCRA 5E2UH 1Z5LA 3BESR 4CNIA 4U1MA 4OD1H 4P2RE 4IEFB 2H1PL 5E8OB 3QUYC 1JPTH 5CEYB 3KYNB 2H8PB 4LSDA 4KU1A 4QRPE 4QHUA 3O41A 5IIEA 1GGIH 5KJRL 3HZMB 5KS9F 4MX7B 1CS6A 1P7KB 1KT2B 4ZAKC 3I6LD 4LQ1A 1ACYH 2WP3T 5F8QC 5JMOC 4J12A 5EC1B 4JJ5A 1NBQA 3CLFH 4PJCB 3ARFD 4Q9BA 3S4SB 3P9LB 3ZE2E 5JDSB 5E6IC 1TZHB 5DA0B 4NOFA 4GBXC 1M05B 2XQYK 1J05B 4ORGB 5FO9A 4MCYB 2DYPD 5D1XC 2W65B 3N1FC 2YWYA 3L7EA 3VDCA 4A2MA 4NQXB 3ROLB 3O8XB 2EC8A 3HB3C 4OFVA 3WHXB 5IFJA 2UUDH 1D5BB 4QHNA 1MFAL 1AGFB 3O6FC 1YMMB 2ESVB 3F5WA 1I7UB 1ED3A 1OSPH 4WI3A 5ILTH 1F45A 3ARZA 4JN1H 2Q8BL 1NLBH 5HGAA 3KLHC 1A1MB 2FJHA 3AUVA 2Q6WA 4JDZB 3O3AB 3UP1A 2ZSWB 5IB5A 1INDH 4GS7C 4MNGB 2N7BA 4PGBA 3QNZA 5I1CL 3C60B 5DTFA 5ALCL 4HBQA 1OGAD 4TOYL 5CEZL 4FFWC 3QDGA 5DJ8B 4OUUB 1XZ0A 2GT9A 4JM4H 4GSDL 1OP9A 2Y36L 2NTSP 3IDMA 4NO3B 3LKNA 2HKHL 5C09D 3SKUD 3MRNB 1KXTB 3P11H 3W39A 1JZ2A 4YIQA 1OSPL 4L4TD 4Q9QL 3PWUB 4OTXH 1GOGA 2ICES 3EIFA 1X5FA 2FGWH 1KLFA 3L5IA 4NO3A 3D39B 3VGGA 2X41A 3BZ4B 3NCFB 4K7PY 4PJHA 3KPQB 1FV1A 3SKOA 1YPZE 2ZG1A 3FB6A 2I25N 4NNYA 1FSKC 2CR6A 1X3DA 4J8RB 4JQXC 3TCLA 2EIDA 4WW1A 4B53A 2AP2A 4JG0L 4XPHL 5I1EH 1ZHBB 4OQTL 2DJ4A 4PRBB 4WI9A 2X44D 3PGCB 3CZFB 2AV1B 4JFYA 3HC0A 4CL7A 1A4JA 4TOYH 2VUYA 2WM0A 3ARFB 1HN1A 4YBLB 5E6ZA 2EXYC 4HK0B 1F6LL 5DVNA 4JPWL 3B6SA 4P46D 3RL1B 5E70A 5KSAC 4WWKA 1P69B 3WIHA 3IS1X 4LNRB 1WIPA 4DKFH 3C2SA 5DFVC 5T1LA 2Q8AH 1JV5A 4FNLH 4NWTH 3IYLW 2WWKT 5D1XB 1G7LB 5JHLH 4AIOA 2AJXH 4JREB 5J06A 1XGQA 4X83A 1HOCA 1EIBA 4UQ3B 1U95B 2EH8H 1M7DA 4LQFH 3EW3B 3WJLC 3P4OA 3M8OL 5HDBE 3UYPA 3MUJA 4XP4H 1LK2B 3LQAC 1WEJL 3G5YA 3O6KH 5IQ9A 3ZKXC 4DUXA 3RWCA 3HCVB 4UTAH 1JNLH 5DD0L 3IETA 1JP5A 3S9DB 3GSXA 2DQGH 3GK8L 3QUMH 1H3XA 4RFEA 4DW2H 2AK4E 5DUML 1ZT4B 2QHRL 3L3DA 5A2IH 3LIZL 4UOW0 2YXMA 3ZE1F 2EYRB 2D7OA 1EGJH 2ZUSA 4PREB 5FOBB 5LQBL 1CLOL 1J7VR 4PJGB 2Z4QB 4L1HA 3DVNA 3TYFB 3G6DL 5CCKL 3RUGB 2XRAH 4WCYH 4OGZA 1F58L 4HK3J 4JG1L 3HG1E 4X5WB 1PSKH 1T2JA 3CPLA 1OP3K 3RTQD 4XWGL 3DHMA 3W9DA 4YGAB 3MUGA 3SGDI 5F93C 1P5UA 5C0IB 3BUYB 2PNDA 1JTOA 5LCVH 1MPAL 5T3ZD 3ECBB 2FJFB 3MA9L 4Z7NE 3GBML 3D25A 4FQHB 3QFDB 1C12B 1XIWC 2CRZA 2XPGA 3EO0A 3AROA 4EUPG 4KI5E 5C9JB 4LCWD 3I75A 3I50L 1OD9A 3BEVA 5A43C 3U30B 4QEGA 3BW9A 1LE5A 3ARWA 4ZTOH 3S4SG 1JGUL 3U46A 1EHNA 1HHJA 4KC3B 4FQIL 3REVA 2P8PB 2RBLA 3PV6B 5HVGB 1UM5L 2RIKA 3ARTA 3W81A 2JJUA 4Z77B 1OGTB 3CFIC 5EOTB 5ISZD 3U1SL 2G60L 4UB0L 3UJIL 3VXRD 1A7PH 5AYUL 4XC1H 1BVLA 5I19H 1ZLSL 1JPSL 2PETA 4WGVB 1LMKA 2BC4A 1VPOL 2DQJL 4YDLB 5L8JB 4L3AA 1A7BA 2DI8A 3HR5B 4P5TA 4QRSB 4PJBA 4Z7VB 1I8MA 5B38A 1DBMH 3CDGA 3SKMA 3WXVH 3GMPB 4HT1L 1T1YA 5CAYB 1JGLH 4PV9A 4DKAA 2UVFA 3VXRE 2FLRT 3BN9D 2WZPD 2VAJA 2CKBL 5B38B 4LU5H 1DBJH 2PYED 4M7KH 3U0PA 4Z76A 5GJSL 1MCNA 2R9HC 1JRHH 2VLLA 5IB4B 2DI7A 4UTAL 3KLAA 1ZLUH 2ZP0T 4MAYC 1EGJA 1FVEB 3WMSA 4TUJA 4YO0B 5F7EH 4M93C 4LDOB 2X4PB 4PJ8D 4HULB 1I1RA 4TULH 4NZRH 3I02A 1KXVC 4HC1H 2O5YL 5IHLB 4O4YL 2E27L 1ZVSA 2HG5B 1VPOH 4HZAA 2OTUB 2F54A 4P3CH 1D5IL 2DKSA 5LAXA 1NFDF 4L4VB 4M6NL 3CVHH 3UZEA 1KIPB 1IAIM 2CXGA 5BO1H 4CVZB 1N6UA 3MREA 1YEJH 3QCVL 4BKLA 2VAAB 4KAQH 5FV2A 1ZAGA 4DN3H 2GUOB 3Q2CA 4LSSH 4MJ2A 4GMTL 4YDJB 1ZEAH 2XG4A 5E2JA 1K8IB 5C7XH 4HHAA 3RUGA 6CGTA 1ORQB 4LRIA 4Y89A 1IM3A 2VO5A 5IM7B 4RIRA 4K71B 1AQKH 3D0VA 2VH5H 2V2TA 5F3BB 3RFZC 4HLZH 3EHBC 3EUUA 4TULL 5C92A 4OF7A 1AXSA 4Y8AA 1KB5B 4CUCA 4KTDH 3IDUA 4G9FD 3L3DB 3GRWL 1OD7A 3A0OA 1FNHA 4FQIH 4JFEA 12E8H 15C8L 3U0PB 2K9UA 3QFDA 2HTKD 1FE8H 3WJLA 1QR1A 4NRZB 4OLWH 5CZXD 1G7QB 1AE6H 5B4MD 1DQQB 1XFPA 1BZ9A 3HE6B 2C1PA 1EFQA 3AVEA 3P0VH 2UZYB 1MH5B 1FNAA 4MCZB 4D8PA 5HYQA 5HHOB 3SY0B 3DRQA 3UTTB 3OHXA 5F9OL 1CBVH 3MRLB 5C08A 1QVOA 1S7UB 4OQTA 3ESVF 4HBCH 4L29B 4RQQB 3SDYL 4P23C 3DXAA 4GAJH 5IVXF 3OAZH 4JO4L 2J1KA 3EYFB 1XGRA 2EDBA 3VFRA 5GGVH 3O41B 4JN2B 5FKAA 4M5YL 3T3ME 5HTSA 2OI9C 5C2BH 3LEXB 4TSBL 1NUGA 1ORSB 3QO1A 5D7IB 5KSVA 3SCMC 2VLKA 3OKOA 3MROB 4YUEL 1QBML 2BVPA 3S88H 4B7IA 1FNSL 1NANI 1KJVB 4WFGE 4JKKA 3M17A 2V5SA 3QEHA 5D1QA 3BP4B 1TFHA 3UJTH 1Y0LB 4OF5A 2E7CA 4X4ZA 1AJ7H 3BGMA 3OZ9L 2GI7A 3MC0A 4MWFA 2CLRB 2CR3A 3OG4B 1G6RL 4U05A 5ECJE 3LH2L 3ZYJA 4LEXL 3LKPA 5KTEL 1BQHB 2RB8A 1FYTA 5IK3B 1YMMD 3S3SA 3O45B 2QSCH 2AEPL 3C08H 1PZ5B 4HKBB 4G9FA 4HS8L 1RUPH 3V0VB 1FFOA 4HGKC 4ODWB 1GOFA 3MMEA 5KSAA 1KC5L 1MOEA 4OGAC 3RZCB 1N0LA 4TTDD 2FO4A 2GY5A 3CX5K 1OT2A 1FYTE 1BQUA 4HPYL 2ICWB 2AEWA 4MXVF 1WK0A 3MLSL 5IB5B 4GUPB 4MNQE 3PWNA 3VH8A 2BK8A 4JZJB 3ULUD 4OCMC 3C60A 2A6JA 1MI5A 4DKDC 4OI8A 4I0PA 1NMBH 3STLB 3SN6N 4O58L 4JG0H 3QIBA 2YC1A 2H6PA 3RDTC 3WHE1 1OSZB 5GS2H 2ERJC 5DMIL 5F7MC 3O6FA 2ZG3A 3KXFD 3MOBL 1BJ8A 3P77B 1JWUB 1T1ZA 2W9EH 3TH4T 2CSPA 4WU5A 3V8OA 2BHYA 4NQCB 1VFBA 1J1OL 4BFIB 4I2XA 3NCBB 4G42B 2VQTA 2HN7B 4J23A 1J8HA 3L3OB 3F7YB 2ITCA 4F7TA 4WHTB 3MCLL 1NJ9A 2F5AH 4O2FB 5EULV 1N5YH 1PFCA 1GHFL 1IJ9A 1FORL 3MLRL 1KT2A 4K23H 5I1GH 4OV6F 1E4XI 4I48B 3UMTA 3V0AC 2VZVA 2ARJQ 3RZCD 1IGJA 4BZ1H 4P46A 4IRJC 2EE6A 1FFRA 4LCCB 5I30L 4X8JB 5IUSA 2IFGA 3TBTB 4PJGA 1G9MC 1SMOA 4LCYA 1GSMA 1XAUA 5AEAA 2OL3B 2HFFA 5DJ0B 3V4PH 2PF6A 1IKFL 5B8CB 1FVDB 4HS8H 1IGJB 3ELAT 2VITA 5JXAH 5EUOA 4TVSa 1D5BA 4X6EA 2YD7A 2BVEA 1OM3H 1K2DA 1YEDB 5GS1C 3BKJH 1OTTC 4G3YL 4FXKA 5GGUB 4RX4D 1ACYL 2X1OA 1RJZB 4YGVB 3MRHA 1U8PA 4F2MB 1MJ7H 4N5UA 4GQPH 2ZOLB 4DEPC 4JZNB 5KVFL 3QIWA 5E0QA 1F3JA 1MCKA 2HWZL 3BP5B 1JN6B 1SMAA 3DUSA 4EUPA 1DANT 1EZVY 1U8MB 1RFDL 3GO1H 1ND0B 4NRXB 4Y4HA 1AGEB 1RK1B 5C1MB 1RUPL 4HFUH 3LKQA 5L0QB 3MRDB 4YGVA 2A9NH 1NSNH 1INEH 5I2IA 3GMQA 3KPSE 4PJAB 3PWPB 1K8DA 3GSQA 2B2XL 3DLQR 4AT6A 5HYJB 3V0WH 3K80A 4MXQD 3MRDA 3V6FA 4TUOB 4NZUL 4HXAH 3V52H 3GHBH 4Z7QF 1KELH 1INQA 3GZKA 5E95B 3C5ZC 2G9HB 4YR6B 1HI6A 1IM3B 4D9LH 3LZFL 4Y4KD 1ZLVH 1CXIA 1U8HB 3HI1B 3TVMD 5GZNC 1ADQH 3MMEB 2NLJB 2ZCLL 3HA0A 1CZ8L 2W9DH 1OGAA 2P5WD 3FB7B 1OWWA 3MQIA 2FIKA 4HIXH 2OZ4L 3V7AE 4F9PC 5J9PB 1E4JA 2GUOA 2A1WL 5DUBA 3SKJL 1FL3B 1NPUA 2ADIA 1W0WB 5I8CA 1VHPA 2VYRE 2YUVA 4L8SB 3I9GL 3V5DB 3QQNA 1GGUA 2XTJC 1I8IB 1HEZB 5IFAH 1XIWD 2HFFB 5D2NC 3C5SB 4NQDD 5EDXA 4NC0B 1I3GH 1CICB 3NIFE 1QO3A 1F4YL 1L7TL 4IDLA 1RZIB 3RVXC 2R15A 5J7CC 1MHPL 2AXFB 2ZCHL 2NY3B 4CKVX 3EDKA 1P7QB 3RI5K 4LSPH 1JJUA 4HCRL 4DUWA 4AMKH 4BZ2H 3BD3A 4G8IA 1Z0NA 2DOCA 1OAUL 5CP3A 4HUVB 4POZD 2D0HA 5M94B 1BGXL 3IFLH 3STLA 1Q72L 4U33A 3WFBL 2R23B 4YH6A 3ISWA 2YK1H 1I85C 4XX1E 2NY2C 4X4MA 2FX9H 3TT1L 3MJ8A 2FD6L 4WTXA 4WEBL 4ETQB 4UOJA 3FOMA 3Q3GB 1YC8A 1DZBA 4H88H 4R6UA 5BV7B 4Y16B 3LQAL 3TBWA 5I15H 1PYWA 4WY7H 1RZFH 3I3EA 4OCWH 3T65A 3BKML 3QWRD 4I2XB 1I1YB 2VE6A 3LKPB 4D3CH 5H37G 2DM2A 4G9DB 5E1AA 4FZ8L 1A6VH 1MFBH 4WO4C 3HAEG 1DQTA 2OL3A 4OBSA 4FQQA 5TE6H 2Z31A 1A6WH 1ETZA 1CTNA 1ORQA 2FX8L 4TPRH 1C5DA 4MJID 1UJ3C 4IIQC 1MFDL 1JGEB 2Z8VC 2GCYB 2BY3A 3QBTB 4UV4H 1S7VA 1BGXH 4QRPA 1RPQA 5E9DB 2Y07H 3DGGB 3DRTA 3BGMB 3L5JA 1N4XL 2R2BA 3OGCB 1PQZA 3OV6A 4G8GA 1NEZG 4KI5D 1FH5L 3VGDA 2GK0B 4PGZA 5HJ3A 4EBQL 5C6PB 3RNKB 4S0SD 1RIHH 4Y4FD 4JFDA 2IWGA 4Z76B 5EBGA 1BD2E 5IHUL 3P40A 4M9OA 4ODXA 3KPLB 5IHBA 2KZ1B 1AC6A 1DLHB 5F96H 1FNEA 3QO0B 4CVZA 4ELMA 3MRLA 5L2JB 3NZHH 1S7XA 5JIPA 2O5ZH 3QFJA 5IROC 4G6FB 4TUJB 4YO0A 3L5HA 3BKMH 4HIEB 3K81A 2D31B 5LGJB 3AS3A 5GS0D 2X4QA 4PG2A 4XWGH 1GZQA 3ZT6A 4Z77A 1F4YH 1XEDA 2YK1L 3GMOB 1UM5H 3BH9B 1BMGA 2F54B 4L4JA 1N59A 3WFEL 1B4JL 3C6LA 5FYJD 5LWYL 4NFCA 1CIDA 3KAAA 1P5VA 4OCXH 1A47A 5GRJL 4RCAA 4KK6C 3V6OC 4YHZH 4PRHE 4R2GB 4WFHD 3GMPA 1T5WB 4KH2A 4X0KB 2DYPA 1BF8A 2CRMA 5TE4L 4ZS7H 1DUZB 3Q48A 2O5ZL 4QF1A 4PS4H 4F15C 3LKRA 2YPKB 2FD6H 4M1GL 3D3VB 4ZXBB 4PRHD 4QRTB 1AXTL 4LLVA 5ICXA 5DUPL 1G7IB 1JRHL 2PW2B 2ZUTA 3JWOL 4K7PX 3U0TB 1EGJL 1OPGL 4IOFD 3PHSA 5SWSA 5ESVA 5I71B 1RJLB 1C1EL 3QO1B 1KN4L 2HG5A 1A1OB 1OVZA 3HPLB 4NKDA 3C2AL 3PV7A 5CGTA 1GZPB 3EKCA 5DI8A 4PJCF 1X7QB 5D6DC 2HJLB 3L3GB 4HUNB 3W5MA 1GZQB 1P1ZB 3OKDA 2R4RL 2XYCA 1NMBL 2YD9A 3HCVA 2HJFA 4NBXB 3UZQA 4OF8A 3KNBB 4L4TE 3CIQA 3OQ3B 1NCBH 1SY6A 2H41A 4L8DB 1UC6A 5HPMA 4JFZH 5CD3A 3C5JA 1DP0A 5D2LE 2GFBB 2D4FA 4PD4K 1MEXH 4PJ5B 2FLBT 3CXHJ 4ZTOL 5MEQB 4OGAD 4DVBA 2DQHL 2FWOB 3GSWB 5FUZH 1ZT7B 4OKVB 3ZKSD 2BSED 1AH1A 3CMGA 3KJ4C 1E4WL 1U2CA 3H7LA 1QNZL 2KZWA 2F5AL 2ITDB 3QDME 3TVMB 3KJ6H 2YD2A 1KB5H 1IAII 3PWVA 4NQDA 4JB9H 4PGEB 4QNPE 5MERA 1A14L 5JXED 4FQ2H 1FV1B 3SKOB 4Y19D 1KTLB 5JPNA 2R1WA 3WE6B 3RVUC 4HIEA 3MRQB 2VDQL 2VDPL 1QLEL 3TO2A 5L9DH 2UVEA 3BISA 2VOTA 4XMPH 5F1NA 3RL2B 1UENA 5A16A 2BVYA 2UYLA 1BWWA 5HYIA 3AU1A 4GRWH 4OZIF 3HN3A 3VDBA 2DBLH 1I8IA 3BW9B 4NZJA 5JW4N 1S7SB 2Z8RA 5ADOH 3ARFA 1NLBL 5I0ZA 3HRZB 1D3CA 4R4FL 3ULUF 1N2RB 3CH8A 2ZSVB 5F7UA 3NGBB 4JFEE 5IBLC 1MCOH 3B6SB 3L5XH 1QFWI 1S78D 4KK5D 1E4WH 1I9EA 1TVDA 3VRLE 3FOMB 3Q3GA 1BVLB 3DV6A 3SDXB 4L8CB 2A2QT 2DQHH 3CFKB 1YDPA 4K55A 4UIKL 5KS9E 4FQXC 1DCLA 4Y2DA 3GMNB 2HVJA 5T5FH 2JB5L 4KJPD 3I6GA 4OKDA 2VLRE 4EJ1C 2HJKA 4IRJD 2OJZH 4TUOA 1N59B 2R56L 2CXKA 1G7PB 3RY5A 4NN5B 1SJEB 1DUYB 2VZ3A 3QIUA 1WSST 5DLMH 4XGZA 5DJXB 1AKJB 3HI5L 5AZ2L 3CMOH 3WIHH 1H15B 5MENA 4FTVA 4PJFE 5EORH 1FAKT 3OKYA 1MREH 3ARYA 3ZDYE 3VGEA 1G6RB 2ENSA 1RY7B 1DQLH 4OD2A 4RGOH 4RMTA 2AEQL 3BH8A 3P2TA 3O6LL 4ODVL 2OR9L 3MRHB 2NY6D 4XNQA 5E7BA 1EEZA 1DFBH 2A0LC 2Z93A 3WHXA 4JFDB 4HKJA 1FGNL 4N9OB 1AQDA 4JPKL 4CU7A 1TNMA 5JNYB 4BJLA 1G6RH 4ODVH 4ELMB 5HHVL 4KXZI 4PRIE 1JZ4A 1I7RB 1R5WB 5E8DH 4U6HB 1BFTA 4G5ZH 1EMTH 4FFZH 2MWCA 4NM4H 2B0SL 1L4IA 2Y9RT 3NA9H 1PVHA 3QZWA 2R4SL 3IU4L 2W1NA 4BUGA 1VFMA 5TGBB 4FRWA 4U6HA 4MVBC 2PCPA 2UWEB 1A1NB 4UT7L 5CJOH 1VGKB 5FDWB 1EHAA 1FFQA 3DMMA 3NVQA 1ND0A 1JRHI 4NBYB 2QADC 1NJ9B 3QXVA 2XNAB 3BWAA 4FQLH 1R5VB 4XWOD 5IVXE 3TBWB 5ACZA 2PKDA 2P8LA 5DWUL 5EBLB 5EU4B 1Q9WB 4XXCC 5DJDA 5B39A 3M1BB 4V1DD 5DJYB 5EZOL 2DDQH 5JW5B 5D1QC 4GKOA 1A9EB 4C57C 3ULVH 1AGBB 1K3ZA 4GW4B 3S3PA 3ZHLA 5L7XL 2Y7QA 1LDPH 5K9KA 1HI6B 4P23D 5FGRA 1U91B 3UYOD 4LCCA 2AV7B 1RJCA 4C4KT 5MHSD 5HD8D 2P7TB 1S9VA 1U92A 5DQ9B 5E99L 4S1RH 4JN1L 2KKQA 5DJ0A 4PJEF 4LCYB 1AD9B 4J8RA 4Y2DC 12E8L 1OW0C 4NHCH 5D7KE 2VR4A 1FE8L 2YS4A 3LKSB 1GIGL 4J6RL 2YRZA 4EDXB 1AP2A 4HUMB 2EYTB 2YKLL 3D48R 4M7JH 4RFNB 2BNQD 4OIBA 1SJHB 5IJVB 2IANA 4ALAL 4CW1B 2RCSL 4JZNA 1YDPB 1T3FB 4H26B 2V5RA 5EC2B 3Q1SH 1C16B 1JPFB 5DQDH 4NNXB 4LRNH 4IOSD 5C0ND 4Z0XB 1A1MA 2J6EL 1C16A 1JPFA 2FB4H 2COQA 4MQ7B 3REWB 1JWMA 4EI5D 1ZTXH 3BWAB 3FQTB 5FYJU 4LRIC 3DMMD 3GJFK 4X9IA 1GC1H 2P5ED 4UIMB 4F58L 5HYEA 4M7JL 3EJJX 4X98B 2FHCA 1OAXH 2NLJA 4N90D 1RHHA 5I16B 5IGXH 4IRSA 4KI5C 4JQIL 3QAZC 3V0VA 5HDQL 4X7SH 2CDFB 4UIMA 5E2VH 2XXCB 3G5ZB 4R7NA 3CD4A 2APTA 4IRZL 2VLKE 4Z78A 2A1WH 3W2DH 4ZFGH 1B0GA 5DR5L 4P9ML 4IHOA 2VRAA 3T0XA 5IESL 3QG6B 3QUYA 3O2DL 1CU4H 4LASH 2AXGB 3SE3A 2AXFA 5F8RC 5LG1A 2PO6B 5FYJL 3N1GC 4NDMB 4KQ4L 3MJ7B 4Z7WF 1WCBA 4N1CA 1KPVA 2E7BA 3MR9A 4LLDA 5I1AA 2IADB 25C8H 3VFVB 4LIQH 3BD4A 1H5BC 3T0AA 1T21B 5MERB 3DIFB 3NFNB 3RA7L 4JANB 2F8OA 3O11B 5BQ7A 1MVUA 2EXWD 2DTMH 1E6OL 3FOLA 3S3JA 1CFQB 3NIGF 5FUOL 1JPSH 3PHOB 3PHQB 1P6FA 1BREA 4NYLA 3RWJA 1GIGH 4J6RH 3KR3H 3V6OE 4XB8A 3ILQC 1MQKH 4K9EC 5GGRB 4CMMB 4EN3A 1IEAB 5BRZD 3V6ZB 3VRIB 5CEXA 1UZ6E 4UNTA 2PXYC 3HNTH 1CE1L 2SEBB 5FOJA 4M7LT 3STZB 5HGDB 2H26B 1CGYA 4I8DA 4D3CL 4PJ8A 1SM3L 3WFZA 5BS0A 1OAKH 4PG9B 3BDXA 2CLRA 3K2MC 3V6OA 1ZWIB 2AKRB 1QRNB 3K1KC 5DK2B 3O8XD 1ZLWH 2DQGL 3GK8H 3BWUC 1BQHA 2BSTA 3MLYH 4LSRL 5IFHL 1EEZB 4GO6B 2X70B 5SWSD 5IEKB 2R0LL 3N9GH 2DYPB 5AAMA 25C8L 4Y16C 2BRQA 3QUZB 1S9YA 3CUPB 4X7CC 3ULUL 5HYFA 1CQYA 4OCSH 2WQ8A 4TNWF 1VGEL 2P47B 1CGSL 3AM8C 1MCWM 1A6AB 3SE4C 4F37F 1UADC 3NCYS 4MXQC 2QKIA 2E6JA 3H3PH 5CFHA 2IQAA 4P9HH 4KTEH 4NHUA 5C6TL 3W5NA 1EBAA 4C56D 5CMAA 5E2VL 3T4AB 3CSPA 4WTZA 3FO1A 1AGCA 4DQOH 3IAGC 4C55A 3WIFA 2P42B 3UBXA 5ID0A 4FNLL 4XPHH 5HHPA 2VAAA 4O5LH 3G5VA 3FQRA 5F7DA 2UZXB 3KGRA 2V5TA 4MLSA 4KMQA 4YPGA 3HS0A 1UVQA 4NC2B 3BKYH 5CILH 5EBMA 5IVOA 4DZBB 2Z35B 3WNLA 4YDKH 2BVUA 1CFVL 4LARH 3C6LB 1XF5A 1WGOA 4JG1H 3RIAK 4RISH 1UCTA 2HJFB 4NSKB 3D0LA 4HZLA 2PYEE 4PGEA 3QJHA 5DS8A 2FATL 3CH1A 5FO8B 1RUQH 3GGWB 1T7ZA 3MNVA 5DO2C 3ZDYF 1B2WL 4HIXL 1I1AC 3ZKXB 1E4XL 3CCHA 1MLBA 2YRLA 4OF0A 1Q9OA 4JZOA 3CXDH 2IFFL 1NUFA 3GO1L 2UZIL 1LQSR 2VDMH 3TNMB 3UTTD 1R3JB 3B2UC 1QFWH 5BOZG 4CDGC 4XCEA 5EU7E 3K2UL 3CVIL 1NGPH 4U1IA 1T1XB 5C08B 4O2EA 3ULVF 3O4LB 2CO7B 2D3VA 3P0YH 3JV6A 5FO7A 4R96B 4JQXA 3QHTC 3BVNB 3QCTL 3IFNH 4MD4A 5IB2B 3HG1A 1HH6B 1TVBA 4LKXA 4HLJA 4FG6D 1FLRH 4YHNA 3ILPB 1I3VA 5ANMA 2ZPKH 3CFEA 3RVVD 3MLZL 5D1ZB 5D1QB 3O9WD 4NN7C 2VLME 3X3GL 3BZEA 1DR9A 4HV8A 3HG1B 2GFBA 4QY8B 3WUZA 4N9GA 2Y23A 5EZIH 4Z7UE 1X5GA 3K4DA 1MWAH 3D2UA 4BK5A 2O61A 1YY8A 1M7IA 5EO1B 2M1KA 2NY7H 4PJ8C 5I73B 1AHWA 4DVBB 4FS0A 2AERT 2A0LD 4KJQC 4MZ2A 1AY1L 4LSVL 3TYGL 1CF8H 3ZO0A 3CVIH 2EH7H 5CIPB 3RTQA 4KDVA 3R0MA 3S37L 4CN1A 4DKEH 1P2CA 5DMKB 1W72B 2NZ9D 5DJCB 1QOKA 3MJ9H 1IE5A 3W0WE 1OARL 3TYFA 1XGUA 4RA3A 1ES0A 3TWCL 1BX2B 3HC0B 4OCRL 5KSBF 5BZWA 2ED9A 2R2CA 1FZMB 4JY4A 3RX8A 3OKLB 4C59B 4D0DB 3H6JA 1F90L 1QYGH 3GHEH 4MD5A 5F1SA 1LHZA 2KQNA 1DVFD 1W72H 2OYPA 2PTTA 4OLWL 4Z7VE 2GTZB 2ORBL 1F4WH 4PJCE 5D1XA 3JZ7A 4MD4B 1HQRA 3S35L 1AY1H 4LSVH 3SDCC 3TYGH 2EIZA 1KC5H 5K93A 3QWRA 4HWZB 1BD2D 1AR1C 4HIJB 4PGCA 4M93B 3LDBC 4NT6A 4JDVB 1RJYB 4OT1H 3PNWA 5E6IA 5FECA 5I1KH 5EO0B 5JA9A 1V5JA 1XR8A 3EFDL 2E8YA 1PX4A 2OMNA 3TPUA 1JGDA 4PUBH 4XNZB 3NH7L 2EEAA 3LKNB 4ZAKA 1YMME 1I9RL 4YWGH 3SDDC 1FG9C 3U6RA 3MRPA 2C4FU 3I2CH 4MAUL 1R3KA 1EDQA 1AHWB 1K6QL 4ONFH 1KB5L 1NCCL 5CJXA 1MELA 5DMIH 5FKPB 3FFCA 1QSZA 1RHHB 5F9WC 5JLZA 3D0LB 5C71A 4WFEE 4JPIA 4GQ9H 4OZHA 4XCCL 4P2RB 3IDXH 4M6OH 5GGRA 5IW6B 3G5YB 1O7SA 1JMZA 2CLZB 5D93B 4WFFD 5HGGS 4C83B 4WI8A 2ERJB 1EO8L 3D85D 3RGHA 3VD7A 4I18A 4LSSL 3MYJA 2DN7A 3DGGA 4L8BB 4QRPB 3GEWB 3QQ4A 1R3LA 5D2LA 3IFOA 1K2DB 1YEDA 2B4CL 3EYSL 1YZZA 4P5KA 1OB1A 4N8VB 4POYA 1QZ1A 3QH3B 4F2MA 2X7LB 5BXFA 3P9WB 2QJDA 4NO5B 1CU4L 5C8JA 2F74B 3G6AB 5TF1L 5AZEL 2CGRH 2GJ6D 1BJMA 1SYVA 3SEPA 3VFGH 4NQEE 4A6YL 3RWGB 3E6FA 3IFLL 4I0PB 4LCUA 1SBBA 1T03L 1K8DB 1MNUH 5HY9B 2EDKA 2NXZC 3IGAA 4ODBD 3LQZB 1ZOXA 2GJZA 5IKCB 3VG9B 4MNGA 1MCDA 4ZTPL 3HZMA 1LK2A 2UY7A 4K3JL 4XH2A 3TO4B 2Z9TA 5HHOE 5I75B 1MRDH 1AGBA 4GW4A 4IOIB 4JFXA 3TC9A 3UTTE 3VD4A 2WBWB 4KPHL 1MCFA 3JTSA 1JTTA 5I1HL 3KYMA 3QNYA 1P84K 4NNPH 3ZSTA 1W0WA 5I8CB 4NO2A 1J18A 4QRUB 3C09C 3DMMC 5IW3A 3PDDA 4XP6H 4MCYA 4HWEL 1DL7H 4KJYB 2DBJA 4U2YA 4L8BA 5KZCB 4LNVA 1I4FB 2YD5A 1S7RA 5GRWA 3H7BA 3TZVC 3MRFB 4X9BA 4EOWH 3RA7H 4B7LA 4KJPC 4JJ5B 1KV3A 4YBQC 2OJEB 4H26A 1AGDB 4XBEL 4PRPA 2FJHB 1WBXA 1A7RH 2AK4B 1S5IH 2R69H 4JHAL 3ARBA 4YQXH 5C6WH 4MA7L 1DQDL 3TM6A 3IU3B 2VR5A 4PJHE 3RKDC 3HNSL 5AWNL 4HH9A 4S1RL 2VUOA 2QTEA 3RWGA 4OIIH 5DRWA 4YHLH 4Y19B 4MAYB 3WNOA 5E8PA 5MP6H 3IJHA 5CEZE 4LK4A 4XP6L 1WLHA 1E28B 3ABZA 1ONQB 2HFTA 2QHLA 3FQXA 4GRMA 1YEEL 1LD9B 1HXMA 4XMLH 4YHPA 5E8DL 5GS3A 3T3MF 1OWRM 4NO0B 2QQQA 4KQ4H 3TO4A 4I18C 4EOWL 2VKWA 1HILB 1HZHH 2D0GA 3HPJA 4QOKA 3VXMA 2EKJA 5D1ZD 1CFBA 1FC2D 1QPPA 3OMZA 4MQTB 1J9CT 3T0WA 2A9ML 1YNKH 3QEQB 3IXTA 2XI9A 2BHUA 4YR6A 5E08H 2QR0B 4YXKL 4G80A 2I07A 1DQDH 2GT9B 5DVOA 1U58A 3RI5F 4RBPH 1FO0A 4GRLC 3SDAB 4FQXA 2ZNXA 4RGNC 8CGTA 1ES0B 2NY2D 1C5CL 1BJ1H 5D7LB 4LVNC 3LN5B 1BFOB 1WZLA 4MVBD 2VSCA 1CVRA 5DHXB 1ZHBA 2IH3B 3OHXB 4Q6IA 1LEKA 1WCQA 1UWGH 3DXAB 1RD6A 3R1GH 4PJ9C 1UKSA 3SOBH 3R4DA 4JHZA 3SDCA 3BDBA 1MIEH 1XIWB 1T20B 4HIJA 1D5MB 2AI0L 5T3XE 5I30H 1G7JB 1L7TH 4U0RC 5I1DB 5K9OA 4XPBL 4MAYA 4D2NA 3HHRB 2FEDD 2I26N 3DMMB 4Z0BL 5CBEA 4RSVA 5JHLL 2X4SB 3GDBA 3L5WA 3U4EA 4JGJA 1RHFA 2P5EB 4RMVA 5HHME 4FTVD 4X6BA 2FH6A 2ZJSL 4PRNA 3CFJA 5GSVB 5DJ2B 3P11L 1K4DB 3B2VH 1WFNA 4GXVH 3QR2A 1UKTA 1KOAA 4CMHB 3IDNA 1RZJL 4XX1G 4R4NC 4WJ5B 5K9KB 4OFIA 3PE9A 4N8PA 3CK0L 3MLZH 4HUUA 2PYFB 1WBYB 2F53D 1EFXB 2PXYD 2EH8L 3RZWA 3NCMA 3C9NA 4X4ME 4ZAKB 5CIPA 3RTQB 1MSPA 3ARGD 5E00B 2QL1A 3L6FB 4R8WH 3RGVA 5GGQH 4H0HB 2VZUA 4NP4H 1YMMA 5HGHB 4CADB 1UEMA 4AK1A 2VQ1A 3PWPE 3K4ZA 2BHZA 5HSFA 1NAMA 1MLBB 5D9SB 3SE8H 1UB5A 4D9QE 4OF3A 4QYOB 1HHHA 4UMGA 5HI5D 1CGXA 4JY4B 1HH6A 1PD6A 5FUCE 4WDIA 3ZDXF 1RZKL 4QNPF 3QUZD 5I74B 4I0KA 3SKJH 1MCHA 3S96A 1S9KC 1I7RA 3PWPD 2R4RH 2HFGH 3EGSB 4AYFA 1TJHH 4U3XA 1AC0A 4RZCB 2Q20A 4D94A 4JR9H 3VFRB 3WJJA 4Q6IC 1WZMA 5LXGH 5GRZA 3IGAB 1DJSA 1L6XA 1ORSA 3IDJA 2APXA 3UBXI 3K7UA 3U9UA 3WNNA 4NO5A 4NWUH 4MS8C 5A40E 5FCUH 5FGCE 2GITB 4JRXD 4MJIE 3VXQA 2Y06L 3L95A 3CFCH 5MEOA 4NZDA 5EA0L 3UPAA 4JY6B 3U0WL 1ITBB 2MFNA 4LPUA 5F89A 5MEQA 1ZGLM 2FO1A 1XGYH 1P4BH 2DM7A 2BX5A 4NWTL 1I1AA 1CL7L 3CLFL 3BE1H 2WWMC 5I1IL 2R56H 1YPZF 3BMWA 4OB5L 5CP7A 4FQCH 3ZKND 5D72H 3ARDD 5EN2B 3WD5H 3TIDA 4D8PB 1IQDB 1NDGA 5DURD 1K9TA 1ZSDA 2EYRA 4H1LB 1KLUB 1EXUA 2WUCH 1BAFH 1V7ML 2OP4H 4XTRC 4PRAA 4LSQH 3S36L 1K4CB 3EYQD 4LKCB 4CVWA 3FFDA 3VJ6A 2E6QA 4OAWB 2AJVH 3T3PE 1EXUB 5AAWA 4NP4L 5I76A 4HPOH 1ZSDB 5EIIA 1XGTA 2FRGP 1T1XA 3VFWA 5BOPA 3EYFA 3SQOL 2KQMA 3O2WL 3NZ8B 1HHKA 1X9QA 3FKUS 4L3CB 3MUGB 2VDOL 1Z3GH 3OF6A 4DQOL 1AI1H 3HMXL 4P2OD 5IOPA 4H1LH 4MCZA 5A1AA 1MHCB 2XKSA 1RZ7H 2ZUWA 3D25B 2A77H 3DVIA 4PJ9B 4R97B 1AO7D 1D9KC 3X12B 4A2LA 1A7NH 1QFWM 3UTTA 4NQVB 3ULUH 1T83C 3QCUL 4OLYH 2EH7L 2B1AH 1FFNB 3AC0A 4XVTH 4L3CA 4OUOA 5HDBF 2HFEA 5JOFB 3W9EA 3FN9A 4LLUA 4BKLB 3TO4D 3ZL4L 4LLQA 3HPLA 5CINL 1RI8A 2DICA 3FB5B 3OXSA 4L9LC 5E2WH 3FFCE 4GRLB 4X9FA 1UXWB 2C4XA 4MDJA 5J13B 5IQ7L 1EJ6A 1B4JH 3I6KA 5FCUL 5LGHH 1YYLH 2HMID 5B21A 1AR1D 5IM7A 3UAJD 4XP5L 2BOCA 4UBDC 5CP7B 1G9NC 3RY6C 5IQ9B 3VW3L 3KPRD 5DD6B 4LU5L 1NDGB 5DJCA 1LNUA 3JUYA 5D5ME 1KPUB 1UFUA 3MV7D 4EZMA 1CFSB 4PV9B 1I8KB 2OTWA 1QR4A 4PTUB 3SDDD 4LDEB 3E6HB 4ISVB 1U8IA 3QRGL 1X5IA 1G9EA 4N0RA 3F8UB 4M8VA 2ZUQB 3V4VL 4KPHH 4HT1H 4IHOB 2YA2A 3ECBA 1EFXD 2O5XL 1LO4L 2IMNA 3RVTD 1KN2H 5F7EL 2BSRB 4NZTL 4Q9RL 4TTGA 2VH5L 2FX7L 4FQ2L 5CJQL 3KPPB 1QP1A 2GK0A 5HJ3B 1UYWL 5ESQA 4OFPA 1I9JL 1BEYH 3WEXB 4R3SA 1IEBA 1U8QA 5GJSH 2LVCA 4KVCH 2EICA 3C6SA 2P8PA 5GRUH 4GMTH 3IDIB 1IC5H 4AY0A 1KCUL 3GMLB 3TT3H 4O2CA 2YEZA 4JANA 4LHUG 3P30H 4F57L 2C3HA 3MGOB 4ZDHA 5FM8A 2H2PC 4XAKE 2DF3A 1XGQB 1JE6A 3PWUA 1RZ8A 1PY9A 1DSFH 1Q94A 2DQIL 1J0HA 4OIIL 4M7KL 2E27H 1UM6H 3P4OB 2D7NA 2H32B 2BOBA 4AG4H 1I1CA 4UUJA 1ETZB 2ADFH 1CGSH 4N5ED 4WWKD 3VXQB 4YHZL 2FX7H 5CJQH 5EB9A 5CEXB 1PKQB 1AE6L 4KGJA 2AJZB 3WBDA 5JW3H 2R1XB 4HH8A 5ISZE 1M7XA 4NHCL 5D7JD 1KPUA 3BJLA 3DX9B 4Y1AA 5F9WB 2FDBP 4PRPD 1PY4A 4ZOCA 5E56A 2CJUH 3TJEH 1UB5B 4FG6C 3DVNB 1YEKL 2DS4A 4WW2C 1HSBB 4MX7A 4HKZA 1CE6A 2H9GA 3KPRA 2GJ6E 4F7CA 4P59H 5DGQA 4ZUVB 3B83A 5H37H 3SQBA 1ED3B 1YUHB 4NRXA 1MCJA 4Y4HB 1LEIA 3HMWL 1YNLL 4DN4L 5BZDB 2HKFH 3UXFA 4R7DB 4U49A 2OCFD 2R0ZH 3F7VA 1OP5H 5BW7C 1H5BB 1ONQA 3QUYD 5DD5L 1CGWA 1F97A 2MTPA 2VXQL 4Z0XA 4NO0A 4NQXA 1R3IH 1U3ZA 4NKIL 4OGXL 1XZ0B 5FM5O 5GJTH 1NEZB 5AYUH 2AJSL 4QT5B 1EUTA 1ZHKA 1ZT1A 3IU3A 1ZA3B 5J6HA 2CO6B 3V5HB 4J1UB 5C3LD 2OQJA 3U2SB 1VACA 3FT4A 1FL5A 2Y1VA 1KCVH 3Q1SL 4X6CE 1A9BA 5EOQL 3CAFA 3V5HA 5I16A 1AHWC 4KRPD 1OY3B 1CICA 1HKFA 4K7PL 4JLRA 5CJOL 5DRZB 1ZHNB 3RY6A 4XNXL 1N0XH 1QBLL 2H2SD 3G04B 5EU4A 5C0AA 3X11A 3B3IA 5DD5H 2D03H 3KPSB 3BIKA 1D5XB 3QYCA 5J9PA 1HE7A 3S37X 2XKNA 1F6AB 3BOVA 5J56B 4JPVH 5JOPD 4FFVD 3B9DA 2AXGA 4GW1B 5INCB 5E5RB 2J2ZA 1TTUA 4XI5C 1J05A 4JFOB 5GHWL 1FORH 4WENB 4JGMA 4E41B 1F2QA 3RDTA 1PLGL 5T1KA 4WUKL 1NAMB 4KROB 4GOSA 2V9RA 4UILL 4YBLC 1IGIL 3AFLA 4GSDH 4I13B 4HCRH 3BZFA 2WINB 3ZDXE 4ZNCD 1T03H 3TBTA 5KVFH 2PYEA 4BH7A 1X5ZA 4G5ZL 1U8JB 2X4TB 3O6LH 3WFCH 1CDGA 2GEEA 4HJ0C 4Z7QE 3RWFA 5DQDL 3O3AA 3SGDH 4NYLB 3RWJB 4EQ3A 1NAMH 1WZKA 3QPXL 2VZOA 4KK9C 5H94A 4QKXB 1T0MB 1FNGA 4LQFL 2R1XA 4LCWB 4GRMB 4XRCB 2XTJD 5D2NB 3SPVB 4EDWL 3X13B 1HILA 1AO7E 1I9IL 3JV4B 1A21A 2PW1B 5ENWB 2YPLA 3O45A 4WTWA 4AL8H 4HPYH 4NM4L 2VN7A 1JNHB 3PGDB 4N68A 5IJKA 2Q7YB 5DMJB 5DRXA 2QQNL 1QLRB 5EH1A 4AEEA 3L7FB 5C0NC 5IEHB 4TUKH 4OZFG 4JO1L 4GJTB 3T0EC 4ZS6D 1CK0L 3L7EB 1Y0LA 1G6RA 3SGEH 5BMFH 2JELH 1P4BL 3V4PL 2OTPA 4JKLA 4WI2A 1KTLA 1DEDA 1SYSA 2XY2A 4X80H 1DFBL 3LZFH 1VFAB 3HAEB 2F54E 4R7NB 5JDSA 3HZKA 3WXWH 1AXIB 3QIBB 4PJFA 1V7MH 4KGLA 1A64A 1CFTB 5B3JE 2HVKB 3HAEA 4RFNC 4MA8L 1H3WM 2LU4A 2NZIA 1F13A 1N64H 4PRHB 1U8PB 5GZOD 3NCJH 5FEBA 3VXUB 4ELKB 4U1JA 4Q0XH 2DQUH 3HAEH 4OFKA 5E9DE 4OLZH 1JN6A 4G42A 4C58B 2V7NB 3QI9A 2EIZB 3DBXA 3IRPX 1Q94B 2W0PA 2A77L 4TYUA 4D0CA 3D69A 1A3LL 2BRRL 3OL2A 4M8QA 3G6JF 1MI5E 2J4WH 5EUKB 2P46B 4KMLB 4OZGA 1Z9MA 3HKFA 3H3BC 3QJFA 4L4VD 3SOBL 4Y5VA 4Q9CA 4OFDA 4HUWA 3LOWA 1J1PL 4PYHA 4X7DC 4X7EC 2AJXL 3PWLA 4JDTH 5JORA 3UTQB 4MWFB 1YEGH 3BHBA 4XNZC 1DQJB 3GRWA 1KF9B 2QADB 3CFBB 1U8HA 3MBXH 1MWAL 3GMMB 5F6IC 2FWOA 4P4KB 5TQ0L 4CMHC 1G7MB 43CAB 3KWWB 3PWJA 3VWKD 1IC4L 4JPIB 3T2PA 4EN3C 1HHIB 4LSTL 2BNQA 2KUTA 4R4BA 4WW2F 1S7UA 5D96C 4GXVL 5E6YA 1U92B 5DQ9A 5C0FA 4F8QA 4LMQE 4OQTH 4QXTA 3O4LD 4FQ1L 4PRDA 1IGFH 1HKLL 1HNFA 5CHNA 4OD3L 3D2UD 5ITFA 3N1PC 5D2LB 1CLZL 4I3SL 1H5BA 3FB8A 5DEGB 2CUIA 3S34L 4DGYL 1WFTA 2OXHA 2NY0B 3KPSD 2NW3A 4GG8B 4YE4H 3WNMA 4KHTL 3TBYA 4LARL 5EUOB 2H6PB 5D7SL 1MCPH 1OQXA 2HAZA 3D3VE 4OLEA 5FDWA 1UZ8A 5KJRH 2YEZB 4OI7A 1LWRA 2QBWA 4PJ7B 1IGCH 4N0UB 4YHLL 4B0MM 5ANMB 3BH9A 3QUZC 1OL0A 4U6VL 5K33A 4YPJA 4KRLB 2CD0A 2C3VB 2R1YB 4YNYB 5GGRY 5T3XD 1L9NA 2AK4D 3ARBD 2ZUUA 3BDYH 5C0EA 3HTLX 2W9LA 2A83B 1V3LA 4GRLA 3MZTA 4TSAH 3NBNA 3TJHC 1XF3A 3GSNL 1FRGH 1OPGH 4Z7VA 3ZYZA 1RMFL 3C5JB 3PQYE 5CGYC 2FBOJ 4JFEB 2DMBA 1YYML 3HNSH 4IMKC 4ZUWB 5AWNH 2FEDC 2D4DA 2R2HB 4ERSL 2IH1A 3VXNB 2HMIC 3GUTB 2Y5EA 4F7EB 4K94L 2V2XB 3ALWA 1RUAH 2XN9D 1S8DA 1CFSA 5A2FA 3CSBA 2IG2L 5IHUH 4KKBD 2VLRB 5HHNB 2YC1B 4PJXF 5I1JL 3G9VA 4PJ5E 3H2WA 5I8OL 2I5YL 3JXAA 5KW9H 4HX1B 5F3HB 3BZDA 5F7NC 5I15L 1PAMA 3NOIA 2V2XA 3FQNA 1I7ZA 1EHXA 4JAMB 2O26U 4EVNA 1FNEB 3C8DA 2L7UA 5GGVL 3IXAB 4TRPL 1NGYA 5HYSB 4LLUB 5B39G 4ZOAA 1JGUH 1MHHA 5E24E 2HFEB 3HFML 2JIXD 1ZVSB 3JV6B 4IS6A 2R8SL 1U3HB 4FFYH 1NGYB 2DM3A 2PUQT 3IDGB 1TNNA 3SJVB 2BJMH 4C56B 4HJGA 4XNMA 3U4AA 3ARSA 4LFHG 3OX8B 4Z18A 2OR8A 1QUNA 1NCTA 3L3KB 3ULSB 4PJXE 1Z2KA 5JOPE 1JGEA 1MAML 4KXZH 5J1AA 5IMKB 5I75C 5DFTA 2V2WA 4FQJH 1DE4A 4K71C 4XXCA 3VH8G 2A38A 2J3SA 2W0KA 3QXAB 5E9DA 5FA4A 4MJ6A 2CDGA 1GAFL 2VDKH 1EPFA 5E1AB 1MFBL 3S97C 1KFAL 2VE6B 2YR3A 1P4LB 3EDJA 2BSTB 1P84J 1NKOA 4UNVA 1F42A 5I8KH 3TBSB 1FZOA 1DE4B 3FHQA 2D7QA 1KGCD 3NAAH 4L3EA 4UV4L 4X7TB 4NKQB 2VL4A 4R0LC 3BUYA 5TPWH 2VXSH 4M61B 1CLYH 2H45A 5IR1B 3LPWA 4Q9RH 3G08B 1T80A 2W0FA 1C8PA 4MA1B 4QXWA 4DZ8B 2W60A 4PGDB 4JHWH 1NLDL 4FTVE 3CVHA 4Y4KA 1TVHB 1D5IH 3TZVA 3VFUA 3I3BA 3N06B 5L8LB 4ZTPH 1FYTD 3DO7A 1DBJL 3T0BA 1BD2A 2YXFA 3PV6A 1ADQA 1RZGA 4UZGA 2IG2H 4JFQB 3U4EB 1S5HB 5HPOA 3GSUB 3FOLB 3ZE0F 1W0VB 1YEEH 2Z35A 3T65B 5DJ2A 1VEMA 2Q86B 3MV9E 3JSSA 1M1SA 2IBBA 5KVEL 2FBJH 3S5LG 1OAYL 3GSRA 1DDHB 2BDNL 4F9PA 3D69B 3SDDB 1XF3B 1NSNL 3HG1D 1TPXB 1SJVA 4R4BB 5DDHA 1NCCH 2VXQH 4I4WA 4PY7B 2F9BT 1Z9OA 1IAKB 1T1WA 2AEQH 1RIVL 1N8ZA 1I9RH 4YWGL 5HBBA 3MNVB 1F00I 5DK0B 5BV7C 3L3IB 4NN5C 3FRPG 3VFPB 5IV2A 1T5WA 5GGTA 4KZEH 1MAJA 1MRFH 1Z0MA 3GMMA 1QPXA 1Q9OB 5IVXA 2F5BH 3QEGL 1T7YA 1VFAA 2ADFL 4A6YH 3TF7C 5KAQG 1TZGL 1FFPA 3FB8B 4N0CD 3CC5B 5DEGA 8FABB 2C7UB 3VXMD 3QHFH 4KRMB 5ACLA 3BP5A 5SWZA 3PL6D 1T21A 5T5FL 4FFVC 4RGNE 4WDIB 2V6HA 3QIWC 1HWHB 2BY0A 4P2CG 3TPKA 1U8KB 4CVXB 3FQTA 2HLAB 4DGIH 4M5ZL 4XPTH 1EH9A 1T2QH 2EO1A 1NBYA 1KLGB 1UA6L 4OT1L 3FQXB 4IIQB 1UYWH 4GBXA 4LSPL 3W0WB 3QQ9D 4XVUD 1LO5B 3MJ8B 1G7HA 3S7GA 3O6MH 1UXSA 3ZTNH 4FFZL 1BZ7A 2F58L 1MFAH 3DVFA 3VDAA 2FZ3B 4I0PD 1A02N 4LCIH 5FDYA 1WWAX 1YY9D 3GJFA 3GI8L 4ODHL 2J4WL 4JEGB 1FL3A 3CFBA 1U3HD 4PJIB 3V6BR 4X98A 4KMTL 5IEKA 1SHMA 3C5ZB 3V6FB 5EWIH 2V17H 1RUKL 5BRZE 5TF1H 1FZKA 3D39A 4IRSB 4WNQA 3LN5A 3WO4B 3LS5L 5CBAA 3QFJE 4E41A 4PR5B 1RFDH 1JWSB 1KTDB 5ILTL 4HEPG 1BVZA 2NXYD 1A8JH 1IC4H 2X09A 3D85B 4EI5C 1QSFD 1FBIL 2WQRA 5I1LA 1U8NB 2IMMA 2DM4A 2XN9B 1MJ8L 1TTGA 4ZYKB 4EI6A 1G84A 1U0QA 1T20A 4YHYB 1KTDA 2APBA 1N5YL 4KKCC 1KIRB 3MLRH 3LEYH 1A4JB 1QA9B 4MYWB 1AGCB 4GKNA 1RK0B 1CYGA 2EYTA 4KMTH 2VERN 2DDQL 4M5ZH 3DIFA 2XZQH 5D7IA 4M03A 2ICEA 1MFCL 1HWGB 1JFQL 3IKCA 3T1FB 1JNNL 2P45B 2J5LB 1QRND 3L9RA 5IIEB 3HUJF 4HUVA 2DKMA 1G7MA 1U41A 5HYJA 1U3JA 5KVMC 3OAYH 2ADJA 2HRPH 3OB0K 4JE4B 3MRBA 4OZGB 2WANA 4BFIA 3RU8L 1QBMH 1Y18B 2Q7YA 3EYOA 3INUH 3NCJL 5DHVA 3QNXB 2D9CA 3VXMB 4ODHH 3QPXH 3MNWA 3QPQC 1ZS8A 4OLUH 1B9ZA 3MLYL 5SX4H 5IFHH 3QNXA 3INUL 2OSLB 3EYOB 3S34H 2JJSC 4NN7B 4OZHF 5MENB 2IALA 1YNKL 4I18B 1FZJB 2HKHH 1KCSH 3O3BA 3MTRA 4MXWL 5CZKA 1VA9A 4XZUB 1H0DA 1YN7B 3TA3C 4PLOB 4Y1AD 3KXFE 1F11B 1A6PA 3UDWC 1LO0H 4MA8H 3FMGL 1MY5A 1EJOH 4ZO6A 3SDAD 5T1DL 5I2IB 1XR9B 1WITA 4ZPVA 3RUGF 2X4UB 1ZLUK 4XZUA 1FNFA 2X5PA 3OXRA 4GRLD 4OM0L 5IR1A 1SYVB 3BRDA 1OHQA 3RWIA 1ZGLB 4ZXBC 1OTTD 2R0KL 1YNTA 5CUSL 5DJDB 35C8L 3MRPB 1OT1A 1OF2A 5MEPA 4X6CF 4CNIB 3FAXA 4ODSL 1VADB 3ESUF 4S0TD 4JM2A 1J8HB 3L3OA 1KB9K 3DOSA 3JUZA 2ATPB 1KN4H 4WNQB 3SBWA 5DGRA 4Y88A 3N50A 1Y18A 4PR5A 2GW5A 2LU7A 3AB0C 4JFXB 1JYNA 2VLJE 2ED7A 2VDLL 3C09B 3OB0H 3QUXB 5BV7H 7FABH 4P9HL 3RWEB 3AAZA 4RX4A 3T2OA 1MFEH 1KNOA 2CDFA 2XZZA 2YA1A 5TE7L 1AP2B 2JCCB 2WBKA 2P24B 1GGYA 4E5XA 1N6QL 1NC2D 3BX7C 3QEQD 1IM9D 4ZUTB 4NCC1 4P9HC 3B9KD 3FRUA 3TVMA 1QFUH 3A67L 4ZUUB 2FH8A 2I9LB 1S9VB 5CZVH 4JVPA 2CK2A 1AQDB 1BBJA 4GMSL 1RZFL 4WY7L 3MV7A 1RIUH 1AD9A 3UO1H 3L1OH 2J7LA 3DHJA 1S9WA 4QRQA 2RJMA 5ETUA 2YHGA 5DVKA 3L3IA 2DLGA 2Z0BA 1OGAE 1NBYB 2UYLB 3VGAC 2V5YA 2XY1A 4JFHE 3LN9A 4HWZA 2KDGA 4U0QB 3VGAB 2FATH 1KYOJ 3P4MA 3I02B 5DRNA 2ESVD 3X13A 3GIZL 3HE6C 1ZANL 3LMJL 3UTPE 5HHQA 1UXWA 1B6DA 2V2WB 3MZGB 3R1GL 2WV3A 5I8EB 1CFVH 2B8OT 3FHAA 4LVNB 1HHGB 5HI5C 2GKIA 2YD3A 4U6XB 2ZUQC 2DI9A 5IT2L 1A6UH 3PXJA 4HC1A 1ZT7A 1XGUB 1J86A 4HHAB 3WFEH 1LO3H 4XB7A 2EXYD 2A73B 2Z91B 2IAMB 2MKLC 5CSZA 3U48A 2LAAA 3D0VB 2ZG2A 4RIRB 1A6UL 2CDEA 3RZCA 4Y4FC 3MGTA 1R5WA 4K94C 1NFIB 5FXCH 4ELMF 1XF4B 3UBXG 1QSEE 2OMBA 1V05A 2ZZUT 1H3PH 5HHMB 3VFOB 4NOBA 4PY8J 2NY1C 3MPCA 2RCSH 3TO2B 4N1EA 5DR5H 3HC3H 5F3HA 3F58H 1KIQB 4PJHF 2C1PB 2X4RB 4U1LB 4L9LB 3LHPL 1A6TB 4JAMA 4EVNB 1P6AB 3HMWH 5ESVB 3MUHL 4KJWD 4D0DA 4OGYL 4M02A 4XC1L 3EJYC 4NKDB 1XF1A 4XTRD 4WW2A 5T33L 1OTUD 4AG4L 3FO0H 3EYQC 2VLJA 4Y2DB 4WUUA 3TN0B 5DUMH 3GI9L 4C56A 3FZUC 3G5VB 2HTLD 3VI3F 3S8WA 4RMWA 2BJML 3W9EB 3L3KA 5FF6A 3KLDA 4PGCB 4BELD 4GAYB 1P9MA 2J88H 5GGSY 1ZLWK 5EO0A 3IT8D 4MLIA 3KWWA 3CDGB 1BP3B 2IAMC 2EIEA 1BIIA 4LCCC 5E5UB 5JHDD 1NCUA 3EOAA 5FA4B 4IRJB 3MLWL 1Q0YL 2AAVA 2HLFC 3S36X 2CLVA 2LVEA 4NQUA 5F7WC 3VU2A 1P4LA 3K8LA 1CFNA 2VDKL 2BMKA 3TO4C 4LEOB 3U9PH 1JCKA 5SWZD 3UROR 1PEZA 2H9GB 4OLYL 2QSVA 2NMSA 2DAVA 3PWVB 1NMCB 2QKIB 2ATKB 5DSCB 5CCKH 5HGHA 5H2BB 4YHOH 4IJ3C 3U79A 3ZT5A 3BE1L 3ZTJG 3DYOA 1RMFH 4WUUE 1E27A 3QUML 1N4XH 2EDDA 3UPRB 4PJDF 4OZFA 5L2JA 3I2CL 3ZT7A 4K7FB 4YHKH 1A7NL 3OKDB 2HH0H 5T5NG 3UBXB 3DX8B 2PR4H 3TEUA 1TZIA 5LAXB 4PP2A 4JY5L 3L3JB 5ID1A 3MREB 1QLFA 5E5MB 5GIRA 4R0LA 4GRWB 5D96B 1A1OA 5ICYB 1MAMH 3OG6B 4IOFC 3IDJB 3AMLA 4KKLC 4J3VA 5DTFB 1RSFA 1X5AA 4GG6E 4S1SL 3VGHA 2BSSA 4QLRA 4UB0H 3UJIH 2DQIH 2G2RA 2I60H 1IMHC 4OM1H 4WI4A 2O5XH 2VDQH 4ONFL 1XCTA 3QUXA 1DVFC 2B1AL 5EBMB 1FAIH 3EOAB 4NQEB 3QUXC 1CLZH 1G0XA 1I1AB 2VIRA 2R2HA 3PG2A 1MHEB 1T6WA 1BVKA 1XF5B 3EFDH 1F90H 1IQDA 1S9XB 3OR6A 3VWJC 1PG7W 3TWCH 1QO3B 4KVCL 4KVNH 2W65A 5CSZB 1M4KA 1CK0H 4XCEB 3SCMA 3BRGC 5HHOD 1S9YB 3CUPA 3Q5YA 2I9LA 3ARQA 3NA9L 5J11B 1UQSB 1T2XA 4WGWB 3EYVB 2FYYB 4U1SA 5IJVA 3X3FL 3IJYB 3CDFA 5LBSL 4OLUL 3MRKB 3KYOA 5EIIB 3RX7A 2LQRA 5FGSA 3N85H 3RHWK 5I1KL 1SBSL 3BP6A 2G5BB 3AMKA 2VQ1B 5C3TA 4PBVC 2OS7A 5E94A 4KWUA 2GSIB 4PLJD 2XQBL 1KTRL 1WBZB 3OB8A 1AGFA 2ESVA 1RUKH 3TBYB 1EHLL 4UIKH 3DUSB 5DMGC 5D93C 4OV5A 1J0KA 3PL6C 4QO1A 1F3RB 3VD9A 1UH3A 3O2VH 4LAQL 1FQ9C 4KHXL 4X4XB 2JJVA 4PB0L 1INDL 3WDHA 3A6CH 5F9JB 3EOTH 3T4YA 5JXAL 3T0EB 1NFDA 5EO9B 1WWWX 3MNWB 3TP4A 4OCRH 3LAFA 4K3EH 2MOVA 3G5XA 2JELL 2FHBA 1MIMH 1KG0B 5J13C 2IAND 4KKAD 4KV5F 1MRFL 3AY4A 2ADJB 3C9NB 4Z78B 3B5TA 4OD1L 2CIIB 5DT1L 1QFWL 1CXKA 1H0DB 3FCTB 2MQ3A 4KTDL 4Q9QH 3Q6GH 1V3JA 3BPNC 1MCEA 3QT2A 2P5EE 3SDYH 1A3RH 4HUKB 5JUEH 5L88L 4FQXB 4KVNL 3NTCH 4QHMB 2AV1A 4YUEH 5GQBA 3BT2H 3WJJC 1H3GA 1HEZA 3QUZA 3ARFC 4U1LA 1LO2H 2GTWB 5DYOA 1HHHB 5C70A 1X5KA 3B5GA 4FQ1H 4JFED 4UTBL 4HGWA 4F7PA 5CGMA 5I0DA 2ARWA 4Q7DA 5FV1L 5JO5B 5JUEL 5FM4A 5E2UL 4UNUA 2P5EA 3FB6B 4D9RD 1PKQE 3QA3A 3VXUA 4ELKA 2BCKA 1XF2A 3MFFA 1A1NA 2IC2A 1F4XH 2NYYD 1J10A 5C0BB 3KS0J 5E8PB 3DTXB 3VD3A 4R26H 4Q6YA 4YJZL 2BNRE 5F7LB 2NX5A 3O6FB 4JM2B 4NDMA 4IJ3B 5D7LE 3KS0H 2Y4SA 3RWDA 5C0CD 5A3ID 4RAVB 4HIHB 3V6ZA 3VRIA 1PW3A 2X4UA 1E6JL 5LVEA 1Q9WA 2J8UB 1NAML 2VDNH 1R24A 1NCDH 3SDAC 2ZOKB 3AREC 5F21B 5H94B 3LRSB 5LBSH 5D7JB 3P9LA 4RFOH 3TFKD 1RUMH 3S5LB 2VXTH 1KCVL 4PB0H 4WU7B 4B50A 1DN0A 3QDMD 4XPTL 3UTSA 4P4KA 4W4NA 3CFJB 5GSVA 5FA3A 4I48A 4WHYH 2AXHA 1A2YA 1M71B 4UDTB 3PHQA 4QCIA 1CG9B 3LS5H 4FQXD 1XCQA 4Y4FB 5KSUB 1FDLH 1Z9LA 5TFSL 4RRPA 2DQFA 3S5LA 2CIIA 3BZ4A 3TJEL 3GJEB 4K2UL 3ET9F 1C5DB 4NJ9H 4PTTA 4JFFB 4NFBA 5DRXB 5A2LH 2MPAL 1FVDA 2VSDA 2I9TA 2X7LA 1LO3L 3QQ3B 3V7MA 2H3NB 1G6VK 3L6FA 3UJTL 5GXBB 4JFFA 1EAPA 1FIEA 2HKFL 4X6EB 3B4NA 5D7IE 1WZ1L 4APQD 1YUHA 5C6TH 4ZFOA 2GSGA 1GC1L 1XIWA 1B0RB 3GMLA 3HE6D 4I77H 2DLEA 2VMFA 3QA3B 3H9ZA 1CT8B 2HT3C 4R7DA 1RU9H 2AEPH 1NFDE 2YSSB 4N0YH 4OSUL 1CFTA 1VKXB 3MXVH 1GH7A 3HRPA 1SJHA 2FBJL 3D5OF 5ICYA 1RK1A 4BSWA 2VABB 4XBGB 4F3FA 2PCPB 2UWEA 2VISB 3HFMH 4PRNB 4KKNA 1LILA 1UACH 3GSQB 3VFGL 4M00A 3B9AA 1R24B 1RIVH 3TBVA 5FHAL 5J6HB 4Z7NF 4BQCA 4H0IA 4QT5A 1A6VL 3QDJE 2IGFH 4W68A 4Y5XA 2J8HA 1I9IH 4S1DC 4O02H 5D1XD 4E41E 5EBLA 3U2SA 2ATPA 4ALAH 1D7FA 5T33H 1B88A 4J1UA 4GMSH 1KENH 1VGEH 4MQ7A 3T0EA 4M7LL 1JZ8A 4LGRB 2X4NB 4U6TA 5JW5A 1TPXC 5HDQH 4KTYA 5ACMA 3HNTL 2ICWJ 3SCMB 2NY3D 2ZKHH 4K94H 2E5EA 4X8XA 3O0RH 1G1YA 4NQDB 4UUJB 3HC3L 5DDHB 4F9LA 2NY4C 3NFSL 5C0AB 3X11B 3BEWB 2P8MA 4P48A 4F7PB 2VZTA