1U8QB

Crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 in complex with gp41 peptide elekwas
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
235
structure length
227
Chain Sequence
b'RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPGAAAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLQTYTCNVNHKPSNTKVDKRVEPKSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY 2F5 (LIGHT CHAIN)
publication title Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine design implications
pubmed doi rcsb
molecule tags Immune system
total genus 38
structure length 227
sequence length 235
ec nomenclature
pdb deposition date 2004-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u8qB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u8qB01
1F4HA 1EBPA 4OIAA 2F74B 3L3HA 3MBEA 4O2CA 1OWRM 6FABL 2BVQB 3PWLB 4X83A 5E4EB 3GMQB 5D70L 4XNQA 5KVDL 1G1CA 1CN4A 2PCPB 4C83B 4C56E 5KOVC 4S0SD 4XMLL 3ZTNH 3MZGB 4I18A 3ZDXE 1AD9A 2HKFH 4HWNA 1U8JA 1T04A 4HIJB 5EZIL 3T0XA 3GFUA 4M3JA 5GPRA 2ICES 5BS0A 3U4EA 4LLDB 1J1OH 3WFBH 4G43A 5E9DE 3WV0A 5SX4I 1D9KB 4M7JH 3TYGL 3EYUH 4LLWB 3KPSB 4MDIB 1QA9A 2ESVD 3ME0A 5HHMD 1SY6L 1VFMA 5GXBB 4XVTL 3VXOB 2BC4A 3GMOA 2RR3A 5ILTL 3RUGB 1T22B 1MCRA 4A2MA 4WUUA 1JFQL 5DJZA 3BP6A 1HZHL 3BGMA 4PG2C 3O9WB 1MRCH 3CX2A 2XXCB 2VUYA 1G7MA 1HHGB 1U8KB 5E2WH 1CF8H 2NTFA 3D18B 1DEEA 2N1KA 3P0YL 1N6UA 1W2KT 3QQ3A 1KB9J 2OL3B 3TBVA 3E8UL 5IW1B 1N0XH 5F21B 3DBXB 4G80B 4OLUL 4F2MB 3F7YB 5F8QC 5I0DA 4JJHA 5D7LB 3O2VH 1D7FA 2X1WL 5DMGD 3AS3A 4TUJB 4JKWA 3SDDB 5CSZA 3GIZL 2VERN 1AXIB 1I3RB 3GMPB 1T1ZB 1A6ZB 2R4RL 4F9PA 4XP6H 1P4IL 2BVOB 2CGRH 3NCCB 1J8HE 1HKFA 2A9ML 4WY7H 1INQA 3VD5A 3MJ7A 3WUZA 5HHXH 3N50A 4PUBH 1F02I 3K8KA 2FZ3B 3STBA 3NIDE 4JRYD 2NQCA 5E00B 4BKLA 2YUWA 4K2UL 3ZHDA 5FDYA 3V0VB 1NC4B 3TNMB 3U82B 1FNGA 2KQNA 4ZD3L 2FL5A 2R8SL 3C5ZC 1UKQA 4Z5RB 3LN4A 1NGQH 4Z7UB 4JFOB 4OZGA 3ZE2E 3HAEH 5KN5A 2CSPA 4P57B 3ULUD 2ADGB 2AJZA 3A6OA 1AE6L 1FIGL 3QQ9D 4XXCC 5HYQA 1HQ4A 2IANA 3OJMB 2HN7B 2OJZL 1PZUB 4KAQH 2FB4H 3H9SB 2CR3A 3GHBL 2MPAL 2W91A 2AS5M 5CJ8A 5EU7C 2GAZB 2UYLA 4HV8B 4KKLD 4MJ6B 1RIVH 1TFHA 3F7QA 4BZ1L 5TQ0H 4K8RC 1KN4H 2APBA 2UUDH 3ARDB 4G8EA 1AD0A 5CEZE 1UH4A 3X3GL 4APQB 4A2LA 4NKQB 1K9TA 2Q76A 1QBAA 3WXVH 1XR8B 4Y0GA 5JA8B 4PV9A 5E08L 2B4CL 4NUGH 4DKFH 1VESA 4FFYL 1RHHB 2WUBL 3GBML 3O8XB 4BM7A 4G9FA 3E0GA 5SV4A 4JN2A 3OWEA 4GW5A 5FYLE 1X5FA 3O6LL 1YNLH 5C0AB 1NAKL 2AV7A 3GI8H 1T1XA 1OAXL 1KLGA 5E24E 2R69L 2NXYB 2QR0A 5EO9B 4PRIB 3QRGH 1CQYA 2WIIA 1NANH 1ZA6A 1IRAY 3CCHB 5I76A 2KZ1B 4YGVB 4WHDA 2EXYD 5HTSA 4J7RA 1F58L 1BZQK 3IS0X 3EJYC 4M6NL 5DJ2A 4POUB 1NGPH 2VLKB 4BH7A 2VXTH 3HN3A 1KPUA 5HBBA 5GRJH 3P9MA 4HMDA 1NGWA 2OP4H 4QEGA 2YPLB 4JKMA 2BNQB 3N1QC 2X7LA 4MA3B 4YHLL 4MS8C 3ESUF 3C60D 1R24A 3E6HA 4J1UB 4ZXBA 4MA7L 3IDJA 3DO7A 4ZQKB 2YUVA 4YQXL 1BOGA 1Z9SA 1FZKB 4EI5C 1U9KA 3GMNB 3RZCA 1RZJL 3OAZH 3WS6A 1DVFD 3D3VD 3WNOA 3RWIA 1MCHA 1ZAGA 3ARRA 4YHKL 2FH8A 3BN9D 4DVRL 1J10A 1IQWH 3WHE1 5EA0H 1ZLVH 1OTUC 5EWIL 3TT1L 4KC3B 5DEGA 3LD8C 5TDOB 4TRPL 2KDGA 12E8H 3OGCA 3FZUC 2GUOB 5D1XA 5DLML 3QDME 5C07A 2A9NH 4I0PD 1EEZB 1DR9A 4HK3J 1FG2B 5F6HJ 5F88A 3VGAB 3O3DB 4TOYH 2EICA 1GOFA 3JV4B 3QUYB 1BZ9B 4OB5H 1KJVB 1NCWL 1YQVH 2BJML 3ZE1E 1AI1H 5J56B 3QIBA 1NMAH 1PJ9A 3BP4A 4KKNA 4M6OL 1A7OL 3VXUE 4JZJB 4ZAKA 4JPKL 3JWDC 3MCG1 4KQ4H 5D1ZD 5L0QB 2I24N 3T1WA 2R1XB 1DBML 1LE5A 4OF5A 4K94H 3QFJB 1DBBL 3W82A 5DEZA 4MSWB 1C5DB 3QIWC 5ELIA 2O26U 35C8H 2P46B 2LE9A 3HZMA 4CN1A 3HZKB 1S7UB 1NC2A 3DMMC 2BVPB 2OQJB 4XBGA 5HHVL 1DANU 4IS6A 3LKNB 2Y06H 5CJOH 2BRRH 4XPTL 3FN0H 5ITBH 1PDKA 3I6GB 4Z95H 4JFFD 3TBTB 3MNVA 2K7QA 1IC7L 3BEVB 3FOLB 3VFSB 3T65A 2BDNH 1M71A 3WNNA 2VLRD 3M07A 4PRHE 4QNPF 5GRYA 5ETUB 4P59H 2AXFA 2YC1A 4V1DB 2YN5A 1S7TA 3P77A 5DZOA 3I2CH 3WEXA 3IDNB 2C4FU 1UVQB 5T3XE 1AY1H 4QF1B 3BISA 2J5LC 3C5JB 1UCBH 5FYLL 1A7QL 4QTIH 3L9RB 5CMAA 1CGXA 3GJEB 3MREB 1YYLL 4U6HB 4GXUM 5F9WC 4U0QB 4P4KD 4LCWE 3OJDB 3DYMA 2Y25A 3ROLB 2QSCH 4L3EA 1GHFH 3RA7L 3QCUH 5GISL 3MLTB 1CGVA 1FVDA 1NKRA 2H26B 4NJ9L 1A3LH 1UQSB 5EUKA 1Y6MR 3NCEB 4LLUB 1N64H 4MB3A 3VFVA 1MHCB 5L2KA 2FR4A 3U0TA 3GMLB 1OL0A 3ZLQC 5EO0B 4EVNA 2W65A 1UT9A 2J8UB 4XWOD 1MHHA 2H3NB 3F8UB 5IB4A 5I1EH 3G6JB 3MRGB 1S9YB 3SDXF 3CFDA 4RZCB 1IGJB 4ZFGH 4DUXA 1ZSDA 5KSAB 4GBXD 1X5IA 2FLBT 1ZVHA 4PJXF 2EEBA 1BF8A 4KKCD 1MQKH 1EUTA 4QT5A 4Z8FH 2CJUL 2D9CA 5F7HA 2KZWA 4ODVH 3PV6A 4PJCB 1RD6A 3DSFH 4WFGD 3V52H 1AR1D 4JFYB 2WQRA 4EBQL 4LVHB 2PO6B 1TPXB 1J1XH 3HNSH 4KY1L 1PFCA 1AQDA 5IB3B 3T0VA 5BZDA 1MF2L 3CH1A 4NC1C 4X7TB 4TSCH 5ICXB 4B5EA 3HC0B 2AJYL 2EE3A 1AH1A 4G8IA 3FHQA 3UZQA 1UCTA 4CW1A 4YK4B 2V2TB 1G84A 4ZNEE 5EBMA 3SGKA 1Z2KA 4DK6A 3BIKA 1ZLWK 4X4ME 3U7YL 4GKSA 2ESVA 3SGJA 3PQYD 2VXVH 3W9DB 1HI6A 1MJ7H 3RPIB 3VFPA 4OZHE 4S1SL 1I3GL 1MCPL 4OZIB 1QP1A 3MLZH 2EXWD 2Q6WA 5GS0C 3IDMB 2ICCA 3O45A 3VDAA 3OMZA 3FQRA 1A6VL 4IOIB 3MOQA 2R2BA 3OKLB 3PHOA 1GAFH 3RVVD 2BHYA 3CFEB 1ROWA 1OAZL 2VDQH 3ARBD 3SKOB 1MPAH 5IMLA 4NQVA 5F9OH 4P5TD 1G9MH 3TCLB 1QSZA 7FABL 2R29L 2XRAL 3VGGA 1NAMH 3QISA 4D9QE 5BV7H 5IESL 4XHQA 1JZ5A 3TV3H 5DHVB 3B9KD 2E9IA 1MFEH 4O02L 1AQKL 2F19L 5CINL 3WJLC 4E41E 3G6AB 5EIQA 3QEUA 4U4BA 3TO4A 3T0AA 4Q6IA 3GMMB 4OCSH 1UXSA 4HS8L 4QHLA 3W9EB 4EDXA 1GPOH 2NY7H 5KG9A 1BM3H 3FFDA 2ICWI 2DWDB 3MRJA 4K8RL 1L6XA 4NWTL 3FN3A 1RV6X 3QQ4B 43CAA 4YFLF 1HINL 4MCZA 3G5VB 1N6QH 3BYTA 3U4BH 1HKLH 5C71A 3HUJA 1C1EH 3GSUA 1X6NA 1JGEB 1EEYB 1TJHL 5FYKD 5JORB 1VACA 4NRYA 4I3RL 3OPZH 1U8PA 3ZSTA 2NCMA 1ZLSL 2W60B 1RURH 3IDXL 3PWJA 1OQOA 3MLSL 3KPOA 4NO2B 3GRWL 4TNVF 4DZBA 5FK9B 3MPCA 4XHJD 5EZOL 3NCFB 1D5XA 3GJFB 1XEDA 4X5WB 1KFAH 5DJAB 5HVHC 3U9UB 1XCTB 3FMGH 4H1LH 5EU4B 5JW4N 2XWBB 3DSNA 5HHQB 5JPNA 4L8BB 1C08A 2FWOA 4TVSa 2WW8A 2EH7H 4JQIH 2EDEA 2NY3B 2ZNWA 1WICA 5E8EA 2IAMC 2VE6B 1E27A 2NW2A 4OLYL 5F7NC 4BFEA 3LQAL 4JRXB 4UINL 4PJ7B 1YEKL 4L4JA 2YD6A 3V6OE 5C2BH 1RFDH 6CGTA 2V2XB 5JO5A 2BY3A 5TQ2L 3CVIL 2BXZA 2DI8A 4LKXA 3LS5H 2DI7A 5D2LA 2GCYB 4IRJB 3PDOA 4XAWL 2IGFL 2CKNA 3MACH 5E94A 5F7MC 4P4RA 3ULSA 5CD5C 3SE3A 5A1AA 3P0VL 4KVNL 2EE2A 1A6UH 5CSGA 3OXRB 2X41A 5DK2A 1JK8B 2VXUL 3NPZB 2IH3A 3MLYL 4O2EA 5BVJB 1LP9E 3UTTD 3K4AA 2AV1A 4Q74A 5EU3B 3O4OB 3OKNA 1WBXB 3EYQD 5CJQL 1U8IA 1I8KB 4I9WE 1NFDA 1PSKH 4DW2L 4HW6A 5DURD 3B5GA 3TJEH 1MRDH 5CSBA 1CE1L 3VXNA 1FC1A 4K23L 3GSRB 3SKMB 2QHRH 1E0OB 4FQXA 2H9GA 4DKDC 2VB5A 1IGMH 3OKMB 5JOFB 1SBSL 4Y5XB 5IJKA 3C60A 1UEYA 2CLVA 2EYSA 5LG1A 3JV0A 5KAQF 1IGFL 4RGOL 1LO2H 5D2NC 2I26N 4NBYB 1UM6L 3MRMA 1K3IA 3TA3B 1K2DA 5GHWH 1AFVL 1S7SA 2DYPB 1WWCA 1MELA 5IB1A 3ZHLA 1WC7A 2X09A 4HCRA 3ET9F 1NCAH 1GC1C 4D8PA 1DVFA 1JPTL 4JDVA 1A7NL 3OBAA 4TSAL 1BBJA 1LO4H 1CIUA 4YX2L 1LGVA 1O5DT 2HVKA 4HIIA 2XOTA 5EIIB 4N8PA 3IGAB 4XP4H 2HT4D 1QFOA 5BO1H 3VWJB 1ETZA 3BW9A 4WI3A 2G2RB 1YEEH 3MR9B 3U46A 1MJJB 1YEHH 4NZDA 5I1LA 3KXFD 4WEMB 3WD5L 1X6LA 1F8TH 4OIBA 1MFNA 4GAGL 4YXKH 4LSQL 1UXWA 4I0PA 4NZRL 5ICZA 4ZUUB 2CDFA 2ORBH 3PGFL 1A47A 3GUTB 4GRLA 5L8KB 4HS3B 1OCWL 5FFLA 4FRWA 4BFIA 4NUJA 4P5KA 1S9VA 1WBYB 1Z0NA 1MLCA 1HILB 3NH7H 3G08A 3P2TA 5D1ZA 3ZKXC 3CH8A 5JUEL 4X8XA 4WI9A 3MCKA 1SBBA 4RNRA 1QYGH 2LVEA 5JPMB 5IF0A 4KUCF 3S3JA 4KV5F 5IV2A 3RVWD 1ZHBB 1JGUL 4GKOA 5BRZE 4NQXB 3QIWD 2AJVL 3DRTB 3RWHA 3WUWB 4DTGH 4NQCB 5FECA 4PY8J 1QEWA 4JY5L 1KN2L 3VXRE 3DMMD 3KPNA 5EUOB 1CICC 3OKDB 3MV7B 5D6DC 1LK2B 4PS4L 2UZXB 4GKNA 4MLSA 4HUXB 1EVTC 2VLRA 2QQQA 1QVOB 1FGNL 2M8XA 4RGNE 1UYWL 1BD2D 2D0HA 1WIOA 1XF5A 2FHCA 4N5ED 4ZUWA 4RAUA 3SOBH 5C0IA 4NOBA 3UTPE 1MY5A 1JWUA 4LLYA 4M7LL 4R4BA 4J23A 2OTUB 5FEBA 1IM9B 1BGXL 3A67L 1FPTL 4GG6E 3ZYOA 4MNHB 4P4KA 4M6AA 5CZVL 1RPQA 3P4OB 5HY9A 1G7PA 4PLJD 4R96B 1Z3GL 2VLJB 1E28A 1B0GA 1UENA 3BPCA 5DRXA 3JUZA 3CLFH 2AW2A 4TYUA 2XTJE 5GJSL 4ZOCA 3ZKQD 4XAKE 3G6DL 5DTFB 1RU9L 1UJ3B 2EDXA 4NQDE 9CGTA 1OY3B 4EXPX 5FO9A 5IW6B 4KKBC 1D6VH 4MHHI 2HWZH 2VSDA 2HTLD 5D6CA 1ORSB 3O3AA 4J3UA 2PYED 4DOHE 2ZNXA 4IRZL 4GBXA 4HCRH 1Q0XL 1IC5L 32C2B 3LQZA 5ID1B 4QXUH 5INDB 3BPNB 3VGDA 2Q3ZA 1R5IA 2Q8BH 4BK4A 4PJ9B 2A83B 1OGAD 2F5BH 4LMQE 3E2HC 2KPNA 3CZJA 1MI5D 1WZ1H 5BCAA 3V7AG 3EOAA 1ZS8A 3UZVB 3HS0A 3NZ8B 4P3CL 4QWWC 2Q7YB 4DFIA 2P5EB 5IMKB 3HZYA 4IDLA 3SQOL 4ONFL 4OUUA 3VFRB 5C8JA 3V5KB 4X6BB 3KGRA 1FGVH 1FLTX 3EDFA 2KL6A 1N7MH 1GGIL 2FJFA 2XG5A 4PRNA 2JCCF 4KJQD 1QFWH 3DUSB 4XPAL 4AENA 3W0WD 2F15A 3WFCH 4OM0L 3PQYA 2OCFD 3I6KA 3RTQA 1ONQB 2YK1H 4PJGF 1MJ8H 1KIRA 3MFFA 4N0UE 1BQHG 2XZCL 4OF6A 2OXHA 4YHPB 1BZ7B 4L29A 4F58L 2BCKB 3C6LC 4UDUA 2J4WH 3LPFA 1SEBB 2HFEA 3DYPA 1E4XH 4PJDF 4OV5B 4P23D 4Y1AD 5D93B 5AEAA 4Z7WF 1T5XA 4WENB 1XGRA 2MHAA 5IQ7H 3ARBA 4R4FL 1K4CB 2KH2B 4E9LA 4P5TA 1T2QH 3GHEL 2P8LB 2R1WB 4EUPB 1LEGB 2OMNA 3BJ91 5IW3A 4QTHA 3B9KA 2NZIA 1T0NB 2WLYA 4X99A 4K7FA 4XPHH 5D7JA 4URTB 1NKOA 5GIRA 3BKJL 3BWUC 4LVNC 4KMLB 4I5BA 1S9WB 1NBVL 5F3HA 1HWHB 1D5MA 1YA5A 5EULV 1Y18A 2H32B 4XNUL 4GSDH 5EOCH 3UJIH 4PIRF 2GJ6D 5I1DA 1CFTB 4JE4B 3DO3A 1U3HA 3FRUA 4K9EL 3EKCA 1A0QH 5SWQB 2PW2B 4NQSA 3VFNA 2DQJH 3EYFA 4OZFA 5DI8A 1L6ZA 3PIQA 3TPUA 8FABB 2JB5H 4FNLH 1OTSD 1TJIL 4YZFE 4LMQI 4PJIB 1G7JB 1R3JB 3MLUL 2OSLA 3MLXH 3MQIA 3PWPD 1X4ZA 1RZKH 3X14A 4LKCB 3LDBB 5A16B 3CFKA 4XI5C 1O7SA 4GAYA 4D0DA 1AP2B 5C0JA 3HG1E 4KMTL 5FDWB 3BX7C 4A6YB 4PJAA 3NIFF 5H35A 1CBVL 2CDEB 3KPMB 4K3DL 3C5SA 4YE4L 5D7KD 4JR9L 1S5IL 2F53E 2VLME 4OD3H 1CXEA 4OLEA 3TEUA 4TSBH 4MNQB 1XAUA 1HIMH 3QH3A 3KPRB 5T1KD 2NY5C 4XVJL 3DJ9A 4M7ZC 4E5XA 1TITA 4R97C 3QUZC 1A3RL 1E4KC 1UACL 1CZ8L 1F4YL 2WAHA 5HI3D 4B50A 4GRWE 5C9JB 1NSNL 4IMKC 4IOFC 2BMKA 4TUOB 3L3HB 4OCMC 4N5UA 5HHPB 4Y5VA 4ODSH 1CR9L 2B1HL 1CGUA 4LPVA 3GM0A 3CFBB 3H7BA 5K59F 1L0YA 3I50L 3H9HB 4F57L 2WWMC 5JHDE 2WP3O 5FYJU 1BBDH 3MRFB 1JBJA 3G04B 1W72L 2XACC 3KYOB 3RVXC 1KNOA 4G43B 2B1AH 4JQXC 4EOWL 3UTTA 3JSSA 1PEWA 3M45A 3OF6D 4N8VB 5CD5D 3RWCA 4D94A 5D1QC 3BVNA 4FTVB 4MWFA 1GGBH 2BC4B 4FFZL 3GKWH 1OAUH 3GMRA 4H25A 3ARTA 5DUPH 3WHXB 4L8SC 3BQUD 3GNMH 2BOCB 1CGSL 5DDHB 3PGDB 2AK4E 1VB9A 2QQLH 2XICA 1CFVL 5FA3B 1CDGA 3EHBC 3OTTA 3VMOA 2J12B 1EHAA 4WTZA 5FHAL 4UILL 1F11B 3ZT5A 3NPSC 5FCUL 3ZKMC 4CU6A 2VZTA 2ZUSA 4ZFOB 3VW3H 5GRVL 3C8KA 5TE6L 2EZ0D 1FN4A 2AGJH 3QPXH 3OKEA 4XXDB 3TBVB 3V0WH 4OF8A 4U7SA 3BKMH 2NLJB 4NSKB 4NCC2 1H15A 5INCB 1RSFA 1UH3A 3TIEA 4FQ2H 2NNAB 1IGIL 2H2SC 4P48A 4LLVB 3QI9D 2ADIB 3RU8L 2FX9H 4S1DC 1DANT 3FAXA 4OZFH 3UP1A 2EDBA 4WGVB 3GSQA 4Y5YA 1AO7E 2A6KB 1OVZA 4JZNB 1XCQB 3GK8H 5D7IA 3VXSD 1AGBA 5DS8A 3T0ED 4XRCA 4JKPH 1PLGL 5EORH 5JW3H 5I1HL 3BZFB 1A1MA 2G75A 5FYKH 3KXFA 5DRNA 1J9CT 5GGUB 3DHJA 3LEYH 2X4PA 3EDJA 4FN0A 3UPRB 2R0ZH 3K0WA 3RI5F 3QO0A 4U1IA 3QBTB 4JFEB 2C4FT 1FNEA 2WINA 5EN2A 2DLEA 2JJUA 1F90H 3MXWL 4RQQA 2H2PC 3LN9A 4UU9B 4G6MH 4Z7VB 3VWKB 5K9QI 1RZIA 3RUGF 4PR5A 4G7YL 3ABZA 4MD5A 4WWKC 2YD9A 2DTSA 4L5FL 3N85H 1EFXA 4DJMA 3ZE0E 4PGCB 3TWCL 4WO4B 3MC0A 5F96L 3T2OA 2ITCB 4U1NB 5JNYA 1HH9A 2W07A 2IANB 2IBZX 2WBJD 2ZOLB 3MBXH 2RJMA 1JI2A 3TT3L 1FAIH 3IXAB 1LVEA 1CFQA 1L0XA 3MOBH 1FNSH 5J0BA 1U3YA 3PE9A 3MRPA 5JW4Q 4N8CL 4XP1L 4ZNCD 4PGDB 5E99H 2YSSA 2DBLH 1KELH 4B41A 4KZDL 2D7MA 2EC9U 2NXZD 1DJSA 4Q9BA 2VL5B 1QQDB 3G5YA 1AGDA 5CGTA 1T89C 1HHJB 1X5YA 4H8WC 4M7LT 1MFCL 4AEEA 1BD2A 4HDIA 5ESVB 2A38A 4HJJH 4RISL 4TQEH 3QDGB 5FGBC 1T7VA 4BELD 3VD3A 3L7EA 4L9LA 1YJDH 3FT2B 4ELME 2AV7B 5HDOA 5J13B 4OKVA 5CLTA 4KH2A 5FYJE 2GFBB 2W0FA 3UTQA 4QHUB 2D4FA 4WUUE 3VXME 3MRLA 5CGYC 2DL2A 5DUBA 1B0RA 3DIFA 5AG9A 1UB5B 1KXVC 1I8MB 4OV6F 1MEXL 1MREL 1NPUA 5MEND 2FHFA 1A7PL 4PJBF 2BY2A 4M5ZH 5JHLL 4UOW1 3ZE1F 3S5LB 4FMFA 4LPYA 3HFMH 2OTWB 3QNZA 4RMSA 4LP5A 4OLVH 1M05B 3BP7A 1XGPA 5EBLA 5FM8A 1MAKA 4GXVH 2ZKHH 3C6SA 4YWGL 2N7AA 4EZMA 1KC5H 3L3JA 5AWNH 4BSVA 3SQBA 2PYEA 2VTFA 2X4SA 1WFUA 4Y4FB 5HGBB 4TUKH 4NNPH 4HFUL 1I8IA 5BMFH 5LXGL 3R4DA 1IQDB 1OGAA 3UYPA 5D7SH 5J11B 1B4JL 1X7QA 4L4TB 4FMKA 3BUYA 3QEQE 2JLLA 3B5HA 3FB6B 1WBZB 4MJID 4KK5D 3PGCB 1YY8B 3SE4C 5FO7B 3VA6A 4JPIA 4KGLA 5B8CC 4GLRI 5TDNB 5DJYB 2CRZA 4XNXH 3O6FB 5B4MC 4F80A 1EX0A 3EO0B 2RGSA 4WU5B 3TBSA 2V7NB 4AEHL 2CLRA 1NBQA 4J4PD 1IT9L 3V8CA 1MCKA 5LVEA 5E8NA 1FIEA 4NJAL 4K3JL 4PGEA 5DD1L 2BSRB 4OCWH 1RJLA 4QRTA 3MJ9A 3L3KA 5DHYB 3BRFA 3ZKND 1KXTB 1YN6B 4R0LC 4NZUH 4Y4KD 5C0GA 5DD3H 4P23A 4Y1AA 3RGVD 1BEYL 3RL1A 3QUKB 2DQGL 5CEXA 2HJLB 3LOWA 4M3KB 3V4VH 3AXLA 2VWEE 3WBDA 4OQ1A 5FB8A 3O4LB 1J86A 4U6YA 5BJTA 5I18L 5L7XL 5HDQL 2YWZA 5IHZA 3CXHJ 2DS4A 3ZMRA 5C92A 2VO5A 4IRSD 3S96A 1UKTA 3OAUH 3MUGB 4LSDA 5C0CE 3FT3B 5DFVD 4BQBA 1NC2B 4FQLL 3NACH 2COQA 4XBGB 5A40E 2A6DB 3D39E 4K71C 1NAMB 4AQ1B 5BV7B 1EO8L 4MQTB 3S34H 1F5WA 1NMCB 1OQXA 3QWOB 2C3XA 4Y4HA 2GJ6A 2W9DH 3NABH 1RZ8A 3DECA 1A7BA 3X12A 2VN7A 4NDMB 2XYCA 4XCNA 3PHQA 3WDHA 1JHTA 2NY5L 1A3QA 5HVFB 5IGXL 3LKSB 2A77H 3ZL4H 4XCCL 1NCBH 1S7TB 5I8KL 5IHUH 1R3LA 3DI3B 4LVOB 4WFED 2ICEA 4ACPA 4GFTB 3KPSE 1GCFA 1IAOB 3LB6C 5ENWB 5JLZB 3IFOB 4JCMA 3FONA 4M1GH 3RHWF 4G6JL 2ED8A 4YHYB 4LRIA 3K1DA 1ACZA 5FYJL 1T83C 1JHKH 5HDBE 1EMTL 1EJOH 2LU3A 1A1OA 3HR5B 4MQ7A 1CLYH 3W39B 1RUPH 5FGCB 5EUKB 5SWSD 5IOPA 3QWQB 2FGWL 3VFVB 3KYAA 5IB2A 5ISZB 4FQ1L 5AYUH 2W65B 5JXEC 3UO1L 3MRRA 5T1KA 4M6ML 1ZGLA 1CT8A 3UYOD 1NMBL 2BK8A 1RI8A 2XWJB 5IB4B 1RUQL 5BVPL 1AC0A 4LCCA 4HUVA 5K33A 2NY0B 3DX8B 5EFIA 3BH8B 4ONGL 4H1LB 3SCMC 5KSBF 1YEIL 4MMXC 1KEGL 4GQPH 5T1DL 3PV6B 3B4NA 2Z93B 3VGAC 4JHWL 3B2UD 1V7ML 5C07E 4IOFD 3VMPA 3VG9B 1OM3H 3EGSA 1S8DA 3P4NB 2AQ2A 3FO0L 3CH1B 4N90E 1LO0H 1MRFL 3MJ9H 3IFPA 4OT1H 3KLSA 2XA3A 4AQOA 4C56D 5IG7A 4G8IB 4KJWC 3VGFA 4LF3A 2R15A 4I48A 3LIZL 3CU7A 3T09A 3OF6A 5E6IC 2WWMD 1B3JA 3TH4T 3QO1A 5E9DD 4G7VL 1AR2A 1G6RH 2Z8WC 5KW9L 4PP1D 1BVKB 5HHMB 4QRPE 4JEGB 4X9BA 3TGXA 3RVXD 1PBYA 4CN4A 4N9OB 4UDTB 5F71A 4ORGA 4YFDB 1FHGA 3BQUA 3QNXB 4PYHA 5J89A 4ZUVB 2NR6C 4HWBH 1HH6B 3GSNH 3GB7B 3GIVA 3ARUA 1VSCA 3IETA 4JFQB 4WW1A 2CK0H 4NKIH 4G6AD 4F15B 1RIUL 2MTPA 2R0KL 2QSVA 2NY6C 2DD8H 2P5WA 4QY8B 3QP3A 4HKBA 4MXQD 5J12C 1X5XA 1LWRA 3NA9L 3BN3B 3QI9A 2QQKH 2R2CA 1U58B 4RSVA 3U0WH 5DJDB 1NDGA 3LHPH 1T21B 4PP2B 5K9JH 2VR9A 4JY6A 1KJ2B 4CVUA 3F6LA 1NDMA 1UKSA 1ZVSB 3FB5B 5ALCH 5JW5B 4OD2B 4NQEB 3VXSA 1U8NB 5CP3A 5C0AE 2ARJA 2EDQA 3QCTL 5FKAA 3T0EA 5I1IH 1ZK9A 3MSPA 4JG1H 4S1DD 3KHOA 1SVZA 1J8HD 4LCUA 3ARGC 5KG9B 2PR4H 3VE0B 2AJ3A 1K6QH 2XQYK 1IFHH 2IBGA 4NM4H 4LHUA 5IFAL 4JRYB 3VMNA 1I9JH 1FZOA 1WEJH 4MCZB 4H5SA 2NMSA 4L1DA 4RAVA 5GRVK 4ALAL 2IMNA 3W11D 5CBAB 2DKMA 5FUOL 1DBKH 1CDCA 2VSCA 4Q7DA 1CE6A 3PP4H 5A2JH 3RVUD 3MA7B 3GSXB 4H0HB 5DSCA 2AERT 3OKYA 1DQLH 4R90H 3ZT6A 1VACB 4NRYB 1V5JA 1DLFL 4NQTA 4OZIF 1J5OL 3H3PL 5ITFA 1IM3B 1YC7A 4DZBB 5IBUG 5JW4M 2BNQE 4FFVC 1XF4B 4XMKL 2DWEA 5TFSL 2JJWA 3LH2H 2WBJA 3UDWA 1SYSB 4PJEB 2AJUH 4MD4A 1DUYA 3KYKL 4PJFB 3TO2A 1BFOA 1TPXC 4OGYL 2BX5A 1ZWIA 3WS3A 5JQ6H 1CI5A 1C08B 3FCTB 1CLOH 2OL3L 4NQUA 2IQAA 2R2EA 4UUJA 2O61B 1Q9LA 5CEZD 3QUML 4FQCL 2NW2B 2YUZA 5CWSB 1WLHA 3V6OC 2XNAB 1IEBA 2QEJA 4P9MH 4JZOB 5IJVB 4OCLC 4KK9D 3MOAL 5ALBL 2GYSA 4Y8AA 1FNHA 2DQUL 5D2LB 1KEML 4G9DA 5FYLD 1QNZH 3VH8B 3MRBA 1R3KB 3O6KH 1RK0A 3T77A 5JMRA 4P4RB 5L88H 1NUFA 2DQIH 1YZZA 1P7KB 1CFBA 1D5IH 4WJ5A 5TF0A 4Z7QF 1A6AB 4U6VL 1DDHB 3WNLA 2X4QB 2CIIB 2FO4B 1MQ8A 1P7QA 1OAQL 1BQHA 2C1OA 4YDJB 4ZFFB 1KENH 5CGYD 3SO3B 5MENA 1ZT4B 2VZOA 3GBLA 1FDLH 4OFYA 2Y1VA 5HVGB 3RWDB 3S36L 1MCOL 4YAQA 1IBGH 2L7UA 1JPST 2QADC 5IFHL 4Y2DB 1VADA 5HGDA 1JPFB 5C3LD 1T20A 4S2SA 3B8SA 1FL3A 4JFZL 4WW2F 3IJSA 3WN5B 1BAFH 3HPJB 4Y88A 1XGYL 4S1RL 3OKOB 1J1PH 3RJDA 3I75A 5CP3H 2BERA 5JIKA 3JTSB 2DQDL 5E03A 4MJIA 3MGTB 3MRCA 3D3VB 1H3VA 4Q9QL 3HUJE 3BE1H 5TPWL 3FTGB 4XX1E 1KB5B 2E7LA 4NNXA 1EPFA 3TZVC 1H3GA 2Y07H 5HPMA 4KTDL 4J4PA 4ETQB 4BZYA 2VQUA 2HRPL 4R26L 1SY6A 5SV3A 1YPZF 1QO3B 5EC2B 5I1GL 4PLKD 4PV8B 3HI5H 1ULVA 1LDPH 2DM3A 5KSUA 1V8HA 3QDMD 5JA9A 1AGEB 3EYSL 4J6RH 1TENA 2D31B 5E1HB 1C16A 1DQML 1DSFL 4Y4KA 1PKOA 1R5VA 2Y5EA 3RGVA 4WW2C 4ZTOL 1VGKA 5FAAA 3VXUD 4WIQA 2V5YA 4KDWA 5B38G 2WM0A 5IVXB 2J8UE 2XI9A 4P2OB 3QAZC 2X4OB 4G8GB 3KNBB 5IROA 2CH8A 2NZ9D 3WIFB 3KPPA 2OK0L 3G6JE 1L9NA 1P53A 4M43H 3E6FB 1WIPA 3VFGL 3STZA 1DBJH 2CRIA 3H8NA 4JAMA 4IRSA 4LSTH 1FC2D 5JIPA 1KTLA 3PUCA 3C08L 1NEZA 5DD6B 3SJVB 3QIUB 5DJ6B 2E27L 2EDDA 3FQUB 4PJCE 1J88A 4X6DF 4QRUA 4CBPA 3L7FA 3NTCL 4P5MA 3GBNL 4NFDA 1FL6A 1N59A 4JFFB 2YKLH 3MRQB 2Z8RA 3PXHA 5KTEH 5IMOA 1ZHLB 4Y19A 4G3YH 4MNGB 4XP9L 1BFVH 3K2UL 3DUUA 2VLRB 3JTTA 4W4OC 4HKJB 4PJ5E 3OSKA 3MRDA 1AIFB 3JWOL 4TNWF 4PRHD 4DEPB 1XF5B 4P49A 4JO4L 2EKSB 3MJGX 4RAUB 4ZUWB 1JWSB 2R0LL 1RY7B 4LIQL 2QTEA 1OAYH 5DT1H 5ESQA 5T3XD 2R39A 1L7TH 3QT2A 3VFMB 3BKCH 4P4KB 1HQRB 4PRAA 3VI3F 5GS1A 4P46A 3NBNA 4XPFL 4Y16A 4U6XA 1G7PB 4RWYL 4LCWD 4OFPA 3AS1A 3SDCC 1B0GB 5DRXB 3KS0H 5IEHB 1NFIB 5K93A 1ZLWH 5MP6L 3GEWB 5SWSA 1ND0A 2F8VA 3UBXG 1HXYB 1U6AH 1HN1A 4NO3A 3L1OH 4KUZL 1DE4B 2ZCLH 1HHHA 3OZ9H 2APXA 5D70H 3PDDA 4M62L 4RIRB 4KGJA 1GRWA 5C0ND 5CFHA 1P9MC 5JXED 1M6OB 4XMLH 1BIIA 3HRZB 2VDOL 5EZIH 4DGVL 1LMKA 3NA4A 3HKFA 2VQ1A 3H0TA 5GRXG 1FV1A 3HS0B 4HPYL 5T1MA 2W59A 5C1MB 3GSVA 4RGMC 1PAMA 1UWEH 3HE6D 1ZLUH 4C55A 1VFUA 4X4YB 3DGCR 4FP8H 5ILTH 1F00I 4C56A 1MIML 2JJSA 4F7TA 4NRZB 3LEXA 4TTGA 3H3BC 5E9DA 1YMHA 4U1GC 2YRLA 4LQFH 1WTLA 4X9IA 1NEUA 1S9KC 3P0YH 3MGOB 4F8TA 1CS6A 1T1YA 3E8UH 3EUUA 4FXGB 4TTDC 3ES6A 1GXEA 1QOKA 3CX5J 5D96C 5CP7B 4YDVB 3DVIA 4NHUA 3KPTA 1MHPH 3CK0L 2IPUK 2EYTA 4FFWC 3BRDA 3ARBB 2NR6D 4J8RA 3EOYG 3P9LB 1SVCP 3OG4B 4AY0A 1LO5B 3G5ZA 1A22B 5I66A 4DAGL 4EQ2A 4PJ7E 5FA4A 2FNBA 3B9KB 5FKPB 4D9QD 4K7FB 3DRQB 5D8JL 1ADQL 5JDSB 2J88L 4ZTPL 1DUZB 5SX4H 5K9OA 5CJXC 5DEFB 3LN5B 2FYYA 4XCYB 4MAUL 4E41D 3MODL 4CVXB 1LEKA 1D5MB 1Y18B 4PLNC 1GOGA 2R8SH 3N9GH 1J8HA 2I07B 5HI4D 3W2DH 4L8DA 3VCLA 1T2XA 3EYFB 2RCSH 3CFIC 1Q0YH 1E6JL 3TPUB 4CU8A 3AU1B 4AMKH 5GSRA 1VPOL 1FIGH 5F1SA 5I16B 1KTDA 1IE5A 2OJZH 2VDKL 1JGLL 2EH8L 3GHBH 3GGWB 2MPAH 2IC2A 3Q5OA 3QB7C 4PTUB 4BZ1H 4LLQB 2XQYG 5DMKA 5KS9A 5CLWA 1QLFA 4GAYB 4KRPD 4HQQH 2JJTA 3EO1A 1ZT7A 3C5ZB 4WEBH 1R3HB 1QSEA 1T66D 5DWUL 3F12A 2NY2C 4Z18A 4HH9B 1X5AA 3JBG7 3LS4L 3V6ZB 5E08H 2P4AB 5HYIA 3GBMH 4FFVD 1I7ZB 3CC5B 1ZE3C 3QH3B 4Z7NF 2A0LC 1JNHB 2PN5A 4JO1L 4U1KA 3W81A 4E5XB 3L3IB 1Q9WB 1Q1JL 1WSST 3UC0L 1VA9A 3RI5K 2XV6B 3QULB 4QHKJ 2B0SH 3KJ6L 4LSUL 1KCLA 5C0RL 1CGTA 3DX7B 2NW3A 3K7UA 3FHAA 2BSSA 4AH2B 1U8LB 3HE7C 3I6LE 4I4WB 3IJHA 1F58H 4JANA 2F54E 5C7XL 3CXHK 4M6NH 2XZQL 1P6FA 3VXTB 3RNQA 2XXMB 5D93C 4X5LA 1I7RB 2ILLA 5C0BB 3D85A 3UZEA 5CGMA 4P2RB 4ODXB 5HYSG 2F58L 2P43B 1R5WA 4N1CA 5F9AC 2HA1A 2YXFA 4JY4A 3QA3A 1NLBL 2EYRB 5HHNB 1N2RA 2BSTB 4XVSL 2C3HA 1P7HL 2CXKA 1A6WL 1FAKT 4MA7H 4U1LA 5DURB 1X5GA 2IADB 1LEIA 2P42B 4MVBD 4I9WD 4YQXH 4P9HH 1W0VB 3FN9A 1CD0A 1IC1A 4MA8L 1EHNA 5FV1L 4HT1H 2J3SA 2YPVL 4JFDB 4LRNH 4R8WL 3ZYIA 1I9IH 4CN6A 4NQCE 4HXBL 1JNLL 4YHKH 5TE4L 1IL1B 4NFCA 4JQVC 3ARSA 1G9NH 3C8KB 1YNTB 4DVRH 3OKEB 2YBRA 5ESAA 5EUOE 5EZJA 3VG0H 3STLA 5HGAB 5EWIH 2LABA 2VDML 4TN9A 4ZDHA 1XGQA 3M1BA 4CVZB 1OPGL 3J8F7 3SE8L 2WUCH 5LKNA 1K5NA 1MVUB 4EI5B 2Q8AL 4Y5YB 3EZ8A 1FNFA 4MJ5B 5T5NF 4IMLB 4QOKA 1U92A 4JPKH 3RNKB 1EEQA 3KXFB 5ECJE 2IH1B 2VZ1A 5J6HB 4YIQA 1DFBL 1AHWA 4M7KL 1U8MB 1J05B 3QDMA 1DBBH 2VLJE 2WINB 3LD8B 4HZLA 3P4LA 5HD8C 3H42H 4BUHA 1WT5A 2NY4C 3LKOB 4KHXL 5LAXA 3VXUA 4OCRL 5F6IC 3A6CL 1A7RH 1EGJH 3O3BB 1OSZA 4OQTL 1BF2A 3AREC 5C09A 4OSUL 1INDL 2YD7A 5FO8B 2NYYC 3LMJH 1KJMA 2X4UA 3PWVA 3BZ4A 3S3PA 4ISVB 3MBEC 4U3HA 4FABL 5CEZH 5JZ7C 1TVHA 4MB4A 1T2JA 5DC0A 1IC7H 1BFTA 5L9DH 5EU5A 2V7HB 1OGTB 1WTGT 4C59B 3QIWB 5E5MB 3Q48A 5BRZD 1QSFB 1F3JA 4UAOB 2Z8SA 4BK5A 1I1AA 4I18C 3DMMB 2AXGB 5F7EL 1W0WB 5LBSL 5FYLH 3VXRD 4DGIH 3MNWB 4XVUD 1IC4L 3EDKA 1KPRA 2VITB 2FBJH 5E4IA 4I8DA 5E6ZA 3HLAA 3IDYC 5E0QA 1MCEA 4HXAL 4X5XB 3ZTJH 5ERWA 4RGND 1YEFL 3D2UB 1FO0B 3HMWL 4HWZA 5IT2H 4U1MB 3RIAK 3UTPD 1BHGA 3BZDA 4XBEH 5H37H 2HFFA 3DETC 4XZUA 3DXAB 5I1JL 2DQHL 3GRWA 4HUWA 2C1PB 4LCWA 5K9KA 3HAEG 3Q6FA 1KCUL 3DX9A 4OZGF 5F9WB 4YBQD 4LOUC 2H6PA 5DA4A 1B2WL 3S9DB 3B9EA 1XT5A 2VZVA 1JL8A 5D9SB 1MOEA 3OAYH 3IKCB 3KLHC 2W0PA 2XTJD 3BH9B 4XAKD 3KJ4C 2LU4A 2V9QA 4NQDD 3F7RA 4F9PC 4U1HB 4EBQH 5TJWK 2H8PB 4XCEB 5CKGA 2EE9A 4Q2ZA 4ZS6D 2PYEB 4KY1H 5DA0B 3ZDYE 5BQ7B 5B3JE 3SY0A 4YPJA 5KVFH 3EOBA 3BWAB 2ICWA 3O11B 1AGCA 5D7IE 3RVTC 3U0PB 4BQ6A 4D2NA 3NIGF 5T5NG 2AJYH 3ALXA 3UTSB 1XGUA 4LPUA 1N0LA 2CMRL 5KSVA 5I2IB 3VRIA 1MNUL 5H94B 2FBOJ 4WDIB 2FJGA 1PYWA 2FLRT 1IKNA 3RHWK 1S78D 1MI5B 5IVZA 3DPBA 3U7YH 4GKZB 3T4YB 5DVKA 4HMCA 1P2CA 2AXHA 3HE6A 4D0CA 3KHQA 2EDWA 3MYJA 3FQNB 4S1SH 4PJIE 3IFLL 5E2VL 1QR1A 1MCPH 1YEDB 1LDSA 4PREB 1CTOA 1YUHA 3TBSB 1NCCL 4GW4B 1TCRA 5HYEA 3LRSA 3W0WB 1JWMB 3LKPB 3WKNA 1N8ZB 1H3XA 2O5ZL 2OBGA 4L4VA 4ZNEA 1TTUA 3MMEB 1A9EB 4NO0D 1OAZH 3VGHA 4X4MA 1I7TA 3L3KB 4RFNC 4NN7C 2UWEA 4M4RA 4OZHA 2X4RA 1QLRB 1BJMA 5IESH 5C0DA 4HHAA 4K94C 4KRLB 2R2HB 3CXDL 4KI5E 1G6RB 1WZKA 4O02H 3RWGB 3EIFA 2EDRA 2F19H 4MNQE 4U1JB 1S5HB 4NT6B 4P3DB 1UM4L 1U95B 3SDXB 3BD5A 1T80A 4PD4K 4NKDA 2EEAA 4NRXB 5SWZA 5HDBF 2R1YB 4HS8H 4PJXB 5IM7B 43C9B 3DI2B 5IHZB 3FOMA 1DQJA 1ACYL 3S96B 1OWWA 4FFWD 3GSNB 4NWTH 3U36A 1MWAB 4CMMA 5IEKB 1JV5A 2J8OA 5E6YA 3TNNB 3IFNL 5DJ8B 2IPUG 4E41A 5F44A 5C6PB 1X5HA 1UZ8A 3ILPA 1I3VA 1M7XA 1UG9A 1X3DA 4I13B 5FM5M 1MFAL 2DLFL 4BQCA 3BGFC 2H1PH 4QRQB 2PUQT 5T3XH 4ZUTA 4OFDA 4JVWA 1BFSA 3FB8B 3IDXH 3MLSH 1MH5B 1U93A 3GRWH 2AAVA 4GRMA 1V7NL 3GSWB 2YEZA 2GTWB 2EO9A 3PWPB 1E4WH 2IFFL 3RZWA 4FTVE 3BFOA 2QKIA 1P4BL 3LEVH 3SO5A 3QEHA 4X6FA 4D3CL 1UWGL 2HKFL 1CTNA 1T7YA 1FE8H 1RJCA 3TBYA 3VXQB 1ZHKA 4ZXBC 3MZTA 1UB6A 3MJ8B 1QHOA 4ENEC 5I1AA 3HG1D 2Q7NA 4OLYH 1FZMB 3MLRH 4R3SB 3LQAH 3EYUL 5TE7H 4UINH 4WHCA 1S7WB 2FIRT 2I9TB 5IB2B 1LO3L 1WAAE 3RFZC 3TLRA 3MGAA 3RZCC 2F53D 3SBWA 3ORJA 2VLMD 3WS6C 1MAMH 2GT9A 5T1KB 5KVMC 3CVIH 2CDGB 5HVHB 3CPLB 4I2XB 1I7UA 5C6WH 4G6KL 4XAWH 1G7IA 1MRCL 2B2XH 1TIUA 5GZNC 5I1KL 3MRNA 3F7PC 5C86A 5E2WL 4K7PX 4ELKB 4JPWH 5E2TH 5B39A 3ARFD 2IAMB 1AXSA 3C09C 5D1XC 2VXUH 4MAYA 1JTPA 1N0XL 4OM1L 3FL7A 1Z9OA 3V5DA 2AVGA 1AKJD 4HF5L 3O2VL 4BA8A 1B0WA 5CJQH 5DD0H 3ARZA 3PP3H 1MHEA 4ZO6A 3QIBC 3THMH 1MLBA 3D69B 2HP4A 3HB3C 4ZAKC 5IHLB 1F45A 2CGRL 3FB7B 5JHDD 3D0VB 4Z7VE 5JTWA 2VDNH 4KDVA 4WY7L 4PYGA 1F2XK 5CBEA 3QG6B 5BZWA 1LP9A 1VEOA 1SBSH 4PUBL 1CXIA 1N5AB 1IGFH 4C58B 1UM6H 1LD9A 4XBPA 3BQUB 5E2JA 2ZSVA 1RZGB 1S9XB 3IU3A 4A6YL 1G9MC 4S11A 3X13B 3RJQB 4FG6C 3TCXA 1VFAA 4TPRH 1NCDL 5BV7C 3CLEL 2AK4D 1JPTH 4TSAH 1A7NH 3VFWA 5MEPA 2ITDA 4TVPE 2HVJB 4OZ4A 2ZUQC 3L5JA 1Z9LA 3DVFA 3WO3B 4F7MB 1G9EA 2OJEB 4EI6A 1FFPA 3ZYZA 5EC1B 2YN3A 2FX8L 5D2NB 2DQTH 2R23B 3DURA 1NDGB 3QZWA 2UVFA 4GAGH 4LSQH 4NZRH 4P2YA 4HKZA 2A6JA 3QXDB 5TQ0L 3QDGE 3NCJH 3PGFH 4ORZC 4HGWA 1SYVB 2DJUA 4HC1A 1GZPA 1OCWH 3VXSB 2P8PB 2ARJB 1AO7D 4D9RE 4YHYC 4NHCL 5CIPA 4NCC1 4JFPB 4ODHL 2AJ3B 3QJFA 3RBSA 3ARYA 3WXVL 2P8MB 3SGEH 1IAKA 1QKZL 4NUGL 2C9AA 5F3BA 4RAVB 1TXKA 1FYHB 5JUEH 4PG9A 4UQ2A 1HXMA 3LRHA 4KWUA 1YNLL 1HNFA 3OXSB 3GI8L 4J3OC 2G9HA 4BH8A 5DQJA 3WCYA 3FQXA 2BXYA 4JM4H 3VI4E 3D25B 2VDLH 2EDOA 2W92A 2NY0C 3QXTA 1KN2H 1H3WM 5AD0A 1XF2A 5IB5A 2H41A 5I19H 5DK0B 4QXGL 3VXPB 4JO3H 4WHYH 2V17L 5E8DL 2NY1D 1FGNH 1UYWH 4S0TD 1OW0A 3EYVA 2VXTL 4ZFOL 4PTTA 2IFGA 4L4TE 2IQAB 4KPHL 2ATPB 2Z8VC 3ULVE 1N6VA 2LVCA 4UTAH 3CX5K 5IMMA 3VXRA 1IEBB 2AEQL 1FPTH 3A67H 2HYMA 4F33B 5T1LB 4WU7A 4RFEB 3SGKC 2C3VA 2P24B 1KCVH 1INEL 5CZVH 4PRDA 1HEZB 4OCXL 2VKWA 4RMVA 1P69B 1CICB 4X8JA 3SGJC 4LAQL 1UGNA 3RKDD 1Z3GH 1FLRH 4WNQA 5ACZA 1FZJB 4CADA 3MRBB 3L3OA 2VIRA 4WHTB 3VJ6B 3N1MC 5I17B 1BJ8A 4GG6A 5FYJD 4XT1C 2V9TA 2ZOKB 1S7QB 1RU9H 4DGYH 3O41B 2CQVA 3RWFA 2Z91B 5CD3B 4WUUD 4B0MM 4DN3H 1Z5LA 2JELL 3VXMD 4FQJL 3HHRB 1S7RB 3I3DA 5EA0L 3TVMD 3NN8A 2P49B 3SHSA 1BQHB 3H9YA 1ZANH 4IRZH 1EAPA 1U2CA 12E8L 3RDTD 1Q0XH 1P4LB 1ORQB 3O4LE 5DMGC 2YA2A 2P5WE 3L3GB 5C08B 4PJEF 3K3QA 3O0RL 3TO4C 1AI1L 1A2YB 4NQDA 4Q6IC 2ZP0T 1NMAL 5C0EA 1XIWD 2YPKB 4P3CH 2X44D 1WCBA 3SQOH 2O5XH 4KQ4L 4ONFH 2ZUXA 3AVEA 3IJSB 5JIIA 3I9GH 4OF3A 3BP5A 4Y7MA 4X4XA 4HC1H 1GGIH 4TVPL 2E9JA 1CLZH 5MEOB 35C8L 1PQZB 5CIPH 4OM0H 4CRPA 1GZQB 1NGXB 3MRCB 3QEQD 1KLUA 2DM2A 3E2HB 2DIBA 4MCYB 1BQUA 1W72A 4FZEL 1HCVA 1J0ZA 5D2LF 4F58H 4O51B 3MNZB 2VABA 2X2YA 4G42A 4F37K 4IIQA 2BRRL 5ITBL 5MI0C 3SGDI 1BLNA 3PL6D 4LBEA 2Y23A 4BFBD 1BREA 3QQ9C 5IKCA 2HT3D 3CNKA 5AYQA 2VAAA 4G8FB 1ZHNB 3ZT7A 5GZOC 4NO0A 3T3MF 5KSUB 5JXAH 2YR3A 4R4FH 4P59L 3GHEH 4KKLC 1FJ1A 3IXTA 2X70A 2HFTA 4HPOL 2IQ9L 2HLAB 1C16B 1EBAA 2G60L 4X7CC 1R5VB 3QDAA 1NFDF 1AY1L 1UCBL 1B88A 5ISZE 3HC3L 3CMOH 3BKJH 1JYVA 3U2SA 3C6LB 3ZDZF 3C8DA 1U0QA 4YDKH 4UIKL 3BXNB 1AXTH 5L2JB 1NBVH 3HC4L 1KTKE 3SKJH 4KXZH 4LSRL 4Z77B 4XNUH 1GHFL 4M5YH 4N68A 3WNPA 5BOZG 3OX8A 1KTLB 4K9EH 4XH2B 4JM2D 5C0CD 4PJHE 2W0LA 1MCCA 2LFGA 4KVCL 2D4DA 1FYTE 1YN7B 1KV3A 2ZWLT 2GSGA 2IF7A 3D39D 3SE3C 3MLUH 4M8QA 4CU7A 3AMLA 5I1EL 4QXTA 4LVNB 1KJ3H 2AKRA 3EDDA 3I3BA 2EXYC 3JVGA 1MQKL 3MRDB 4RRPG 4Z8FL 2BY1A 4KMTH 3KDMA 1UC6A 1P84J 4PJGB 3V52L 1G7QB 1CGYA 4JPVL 3HZVB 3U83A 3IU4H 1J1XL 4YE4H 5AUMB 3KPSD 4MX7B 4JR9H 2N7BA 4FQXC 3R06B 4NWUH 3VFTA 2PTTB 3DGGA 4TSCL 4ZO9A 4U6XB 5IJKC 5F1IB 3C60C 4Z7WB 1YECL 4XVJH 3MRHA 5DYOB 4F7CB 4C57C 3AFLA 4WTWA 5F9JA 1ES0A 3CU1A 5IVXF 1UACH 2GJZA 1CZ8H 3REVA 4KJYB 4O2FA 4X0KA 4LVEA 1F4WH 5A2KH 1MJ7L 3FT4A 4YXHL 1DL7L 4ZFZA 3HMXA 3U4AA 1DVFC 2XKNA 5FGRA 2B1HH 3RBGA 3BO8A 3BN9C 3MLZL 3TJHD 1K8DA 3CIQA 3HI1A 1H0DB 4PGBA 3RZCD 2ENSA 2HJKB 1CU4H 2LV4A 2ZUVA 1MFDH 1GAFL 4M7ZB 4NQEE 3RWJA 2VDQL 3ARFA 3B6SA 4R97B 1MPAL 1W72H 1NCNA 3QUZB 4QRRB 1G9ML 4OD1H 5ADPH 2Z35A 4I0PC 5GZND 3U1SH 1NAML 4EOWH 4GQ9L 3BPOC 5BV7L 4GRLC 3K8LA 2VLLB 1JGDB 3D0LA 4Z7OF 5T1MB 5HHOA 5BW7A 3PABA 5D1XD 4HJGB 1CD1B 5C07D 4FFZH 4YLQT 4C56B 1A21A 4LGSB 1NC4D 4OCSL 2GJJA 4HBCH 4P2QA 5JHDA 3S36X 5KBNC 1CGSH 3MFGB 4N90D 5D1ZC 4O00A 1OOAA 2UZIL 4CJ1A 2A73B 4YHOL 3WLBB 2NY7L 1BM3L 4LLMA 5E9DB 4ZAKD 5FHAH 4LEXL 5FCUH 3S4SG 1LE9A 4E0RB 1N6QL 1HKLL 5TE6H 2H45A 4QRPD 5FUCC 3LSOB 5DQDL 3ES6B 1C1EL 4F7EA 5DR5H 1OB1A 2Y4SA 2VYRE 1MAJA 4X6CA 1IAMA 3KPLA 5CZXD 1H5BA 2CIKB 3AM8A 3RU8H 1HDMA 4JN1H 1J8KA 2AK4A 4L8SB 5EZLA 5J9PB 4KZEL 3MYZA 3GSOB 4OGXH 2A74A 3ARDD 3U6RA 4YHIB 3SKNA 5J1TC 1NGYA 4FG6D 2XWTA 4JGUA 4H0IA 2Y5TB 4Y19E 5I66B 1PLGH 3QXUA 3QXVA 3NPSB 5DJXA 4QHNA 3DYOA 4R2GC 1FCGA 4BQ8A 1TETL 1JRHI 3IJYA 5K9OB 4WUKL 4Z76A 1PD6A 5GGQH 2XIDA 1TZHA 3DV6B 1EZVY 3RIFF 1KULA 1GJIA 2EH7L 2VKXA 1F3RB 5C0AD 1J8HB 4UQ3A 8CGTA 2L7JA 4L8DB 3V5HB 1FL5A 3BDBA 4L5FH 4BSWA 3TWCH 4DQOH 2CO7B 1CFNB 1B6DA 2ADJB 4UTBL 4AT6A 5F96H 5C2BL 1RFDL 4D0BB 2EIZB 2IPKA 2DQFB 1KTDB 2JB6A 1ZEAH 2P47B 4L3CA 4LDEB 1OP3K 1CD8A 4XWOC 4CNIA 3MACL 2R4SH 4ZUSA 3QJHA 1WCQA 3Q3GB 2D9QB 1ZT7B 3HMXH 3N06B 4NPYB 4GBXC 1A6UL 4XMPL 2WMPA 3KLDA 4KKCC 5FM5O 3RGHA 4WWKB 1N26A 2BNQD 4HKXB 4ZPVA 3FJTA 1QFUL 1AR1C 3T0WA 1PSKL 3SDYL 2YHGA 4F9LA 5HYJB 1MFCH 3TJEL 1LNUA 1MRDL 4RISH 3L95B 4GRWH 1PKQA 1JRHL 4E42B 2QHRL 2ZG3A 1RJYA 1RK1B 1Z0MA 1IGML 2BNRA 4K7PH 4CKVX 3G5XB 4ONHB 1YEGL 1ZA3A 1K4DA 4NO5A 1LO2L 3IS1X 4P3WA 4HIXH 2HH0L 2BSED 3OHXB 4YR6A 1KJ2L 3RTQC 5GHWL 2I9LB 5DUMH 3BD4A 2BOBB 4NKMA 3PJSB 4QXWA 1L7IL 1MEXH 3MXVH 4LGRB 4ELMA 2EXWC 3AAZA 5BXFA 1NCAL 2O93L 2ZCHL 3WJJA 4NYLB 5JHLH 3RWEA 3CDYA 1PX4A 1QZ1A 4MQXD 3QUYD 3QHTC 4R7NA 3RVVC 4XP4L 3VFUA 3QNYB 3VXMA 1U8OA 5BO1L 1OSPH 5C0FA 3ARBC 3TVMA 4HIEA 3NAAH 4YWGH 4P5TC 3EO9H 3TIDA 1YEHL 2HFGH 3CFJA 4UT9L 3RDTA 4G8GE 3S6CA 1F8TL 4KDTA 3CDGA 3ETBF 4PJAF 1ZTXL 3ILQD 3B9KC 4NOFA 5LXGH 1MUJA 5D7JC 4XGZB 1WZLA 3ECBB 3ULUL 3HNTH 1T3FA 1B4JH 5C9KA 5EG6C 2GTZB 3QUMB 2WANA 4AL8L 4YEEA 3IDGA 5DRWA 1HSAA 1I1FA 2Z92A 3SJVE 1XIWA 3MUJA 3PWUA 4JDZA 4LEOA 4AK1A 2EDJA 3FAWA 3LKQA 1IKFL 1U3HC 2Z4QB 3TO4D 4DZ8A 4GUPA 4M1CD 5GSVB 2AI0L 1ZLVK 2ZUWA 1U8QA 2I27N 3M1BB 4AEHH 4R7DA 1IT9H 1BQLH 1SM3H 2JK5A 3GM8A 5DD1H 4YHNB 1OF2A 3QEQA 1T0PB 5F9DC 4DTGL 3NFPB 4DCQB 4UNVA 2AEPL 5A3ID 1CFSA 4HLJA 3VGBA 3WIHA 4O58H 3PL6A 1C7TA 5FYKU 4WV1A 1PZ5B 1T7ZA 5B8CB 1KYOJ 4XHJC 1B6UA 5KS9E 2X4NA 5LCVL 4YPGA 1FSKC 4AIZB 1JTTA 1QSEE 5LGHL 1J12A 5I18H 5L7XH 1D5BB 5HDQH 3SOBL 4ZPTB 1NBYA 4PJBB 4B7IA 4GT7A 4U2YA 3KWWA 3WFHB 5GZOD 4MB5A 4FQLH 5FOBB 3IKKA 4R0LB 1MCJA 3CFCH 5DVLA 1OSZB 1QFWI 3FQTB 2HJFA 3DVNB 3S3SA 3LY6A 1S7VB 4NBXB 2X10A 4M1DL 5JOPE 3PWVB 4JJ5A 1NUGA 4IEFB 1T6WA 4Y5VC 5EU6B 5DJCB 3CLFL 3NFNA 2V2WA 5KSAD 2XKSA 4JM2A 5C0CA 5D5ME 5E8OA 3T4AA 4EEEA 4XCCH 1E4XI 5I8KH 2F74A 2KQMA 3IF1B 4XB7A 1F3JB 2Y7QB 2BVQA 3PWLA 4OZFG 3VFOB 3GMQA 5HPOA 3BESR 3D39A 4UIMB 2HWZL 2PO6D 5EBWB 1IGYB 5B3JF 4C83A 1X9QA 1YJDC 1VFOA 4K71B 3QWRA 3BSZL 4RA0C 3EFFB 4G6JH 4QXUL 3EYQC 2Q8BL 3ARQA 4HIJA 4PRHB 5FYJH 4PJ5D 1PG7L 4Z0XB 3CUPB 3FFCB 2P45B 2CO6B 5ANMB 1U3ZA 1CL7H 1KB5L 1ZT1A 4L8CB 5I8EB 1WFOA 5JIHA 4FXLA 4LLWA 3KPSA 4MDIA 2FGWH 2FEDC 3VXOA 5DZNA 1XZ0B 1IEAA 1T22A 3WIIL 4M6MH 2P48B 4YHML 1KPVB 1NMBH 1YEJH 2W9EH 1RUQH 1H3PH 1QFWL 3O9WA 4FQXD 5BVPH 4YO0B 3WFCL 4OIIH 1HHGA 1U8KA 4ONGH 5CHNB 3D18A 2YK1L 1MJ8L 1KEGH 5T1DH 3IB4A 1DN0A 4GMSH 2OL3A 5IW1A 3DBXA 4G80A 4UZGA 4F2MA 2AJSL 2J4WL 5D7LA 4Y5YC 1V7MH 4M93C 1E4XL 1S7XB 4TUJA 3SDDA 2HT4C 1I85A 1CXHA 1I3RA 1T1ZA 1QLEL 1G7LB 1A6ZA 4UT6H 5IQ7L 1CDBA 4U7KA 5KSVB 4QOKE 1QFWM 2AEIT 2FJGB 1RUML 1V3MA 3SCMB 4I77H 4XTRC 3QUXC 3WIHH 1P6AB 1NGZA 2FZ3A 3WL9A 5E00A 2E6QA 1CQKA 4N0FB 3V0VA 1A5FL 3MROB 2OR8A 1NC4A 3TNMA 4GRLD 3KVQA 5EOCL 4GSDL 2GIYA 3HI6H 3WE6B 1OP5H 3UJIL 3HNVL 4Z5RA 4N1HB 4Z7UA 4JFOA 2EIDA 4EJ1C 2DQJL 3KR3H 5C09E 1BX2B 2W38A 4P57A 2ADGA 4QRPA 2JB5L 3RVWC 5E6IB 3SE9H 3VDBA 4WTZG 3V7MA 5E5UB 3P11L 3L6FB 2HN7A 3NA9H 3H9SA 5GRUL 1RZKL 4UAOC 5IBUB 4GS7C 4QHMB 2GAZA 2UVEA 1DEDA 2Q20A 4MXVF 1M4KA 3ARDA 5TGBB 4APQA 5AZEL 2OMBA 3QCTH 1A4JB 5KSBB 2MCPL 2LU7A 3FOMB 3RRQA 2G5RA 1XR8A 1XR9B 4N5EC 5I75B 1X5JA 4PB9L 3DROB 3NZHL 4L9LC 2ICWJ 4XNZC 5ADOL 4IHOB 1RHHA 2NY6B 4LCIH 3O8XA 2PYFA 1JMZA 1IAIH 5FUOH 5J12B 4E41B 3K80A 1HIML 4PJ8D 2SEBB 4R2GD 2XA8H 3L3DB 3MRKA 4WI7A 5C0AA 4F7PB 4BQ9A 1A1NB 5KVEL 4PLJC 1UZ6F 1ED3B 1J5OH 1G6VK 5C0BE 1KIQA 2Z31D 1JVKA 1Y0LB 4P2RE 4K7PY 1U93B 3CCHA 2VR4A 3ARGB 2WZPD 3EOTH 4U3XA 4XMKH 4ODSL 5TFSH 4YGVA 3OV6A 4J3VA 5DQ9B 2E3VA 5EPMB 2RBLA 1DQQA 1M1SA 3IDIB 4LCYB 3RAJL 1Z6JT 3KYKH 2HTLC 3PWNB 4OGYH 1BBDL 2DLGA 3CZFB 3CMGA 4JFDE 5FCSH 3RY6A 2YPLA 2B1AL 1SHMA 4DVBB 2BNQA 4MA3A 3L5WB 1KG0B 4NNYA 5GGSB 1Z9MA 4C4KT 4OFVA 4EN3D 4J1UA 1JGVH 5GGRB 1IEHA 2ZPKH 3MOAH 3MV8E 4ZQKA 3TA3D 2GT9B 2A1WL 5DUPL 1Q9OB 5DRZB 3OGOE 5M94B 4Z0BH 4H88L 2DYPD 1FZKA 5EOTB 1U91B 4Q9CA 1A64A 1Q9KA 1LQSR 3O2DL 2YS4A 4KJQC 3UJJH 3C9NB 3VW3L 2D03L 2YUXA 3QPXL 2HTKC 4JKKA 3VWJD 4L4VE 4B53A 1RUKH 5E95B 3I6LD 3K81A 2GUOA 2FSEB 5E5RB 3RTQD 1EEZA 2UWEE 2F54D 1FG2A 5I73C 1YMME 4P23C 3O3DA 3JV4A 3QUYA 4U1SB 1BZ9A 3GK8L 2GSIB 4JKPL 2CK2A 5BZWB 5EORL 5JW3L 3S7GA 4JZJA 2YA1A 4OAWB 1A6TB 5SWZE 4JRWA 4X7FC 1XGYH 4UV4L 2R1XA 2R0ZL 5KVGL 1HNGA 1SJEB 3L5HA 2ZSVB 2AABH 4PY7A 1QD0A 1VFBB 4MSWA 1C5DA 4XPGL 5B38B 3CSBA 3WYRA 1P84K 2MSPA 3HZKA 3GKZA 5D7JD 1S7UA 4Q9QH 2BVPA 4Y4HC 4F3FB 2OQJA 3EAKA 1QSFE 1NJ9A 3WFEL 2QADB 4NQCD 3LKNA 1JIBA 2V9RA 4KTEH 4M48L 2WK2A 3OJVC 1X4XA 3KPQB 3P4MB 1FFPB 4KTDH 3QHZH 3TBTA 1OTSC 2CR6A 2DM7A 5E2UH 1T0MB 2HRPH 3BDXA 1U3HD 3CVHB 3FO1B 3BEVA 3FOLA 3VFSA 1EDQA 5I6XC 3QDJB 1FAIL 1A4KA 5ETUA 4HGWB 1JNNL 3I02B 1T7WA 2LQRA 4LU5L 2R9HD 1FNSL 4V1DA 3EJJX 1DSFH 1DQMH 1KCRL 2ZJSL 1F13A 1MCWW 2FX7H 4LRIC 4QF1A 3C5JA 3QJFB 4Q97A 3S88L 4U7MA 4RRPA 3DXAE 1IM9D 4FQHB 3L9RA 3O6ML 3U30C 5F1NA 3GJEA 3MREA 1N3NB 4U6HA 5GJTL 3TZVB 3OJDA 5KANG 3ROLA 2DKSA 1GGCH 3RPKA 3VFGH 2VLJD 1OLZA 3QG7L 5ICYB 3LV3A 4QCIB 3DNKA 3KYMB 2G9HB 1TZGL 4POZD 3MLTA 4BH8B 4GW1B 1UQSA 3WXWH 3WO4C 2E27H 4HAFA 4GAFB 4LLUA 4HWEH 1YY9C 4LCCC 1MHCA 2X89D 3T3PF 1UA6L 5D72H 5EO0A 5HI3C 4MXWL 2J8UA 4WW2B 5AD0B 2APTA 1XF2B 2H3NA 2DQEL 3UBXB 3QEGL 3G6JA 3MRGA 1S9YA 3AY4A 1ADQA 3QAZB 4RZCA 1VKXB 1IGJA 4XP9H 3K2UH 5KSAA 1QRNE 1UWXK 3UTSE 3V6FA 4QNPE 3JWOH 3ULVC 4M5ZL 5BRZB 2CPCA 4PJCA 5A43C 3AS0A 3HFML 2R0LH 2E9WA 4JFYA 4OLVL 2VH5L 2XQBL 5AZ2H 3D48R 4LSSH 2PO6A 4YHZL 3OL2A 4N9GB 2XPGA 5IB3A 4TUKL 2IALB 4X7TA 2FIKB 1MIEH 1YPZB 3HC0A 4PBVC 4PJ5A 4RWYH 2I60L 5BMFL 4RBPH 5D7SL 2V2TA 3CDFA 5DC4B 3BQUC 1TQBC 5MP6H 3QPQC 3W9DA 1D6EA 3ROOA 4YNYB 4XNYL 3RPIA 1RZ7H 1QPPA 3QFDB 2A6IB 4RA3A 2F5AL 2BVUA 1E6OL 2A2QT 4M62H 1JUFB 2FEDD 3S4SA 3IDMA 1F4XL 4GMTH 4PRPE 2EZ0C 1WUNT 5HGHB 1MCIA 1EAPB 3SDXE 4I0KA 2HT2C 2FATL 3CFEA 3SDCB 4NN5C 4PJXE 2VDOH 3QI9C 3SKOA 3TCLA 3OR6A 1ZV5A 1TJGL 1DLHA 2RFXB 4NZUL 2R0WL 4X6DB 4KK6C 5C0EB 3JWDL 3BEWB 5DD3L 2JKXA 5DHVA 3T8XB 4HPYH 4XWGH 2GI7A 4C4KO 5MEQB 5F7KC 3T0EC 3G6AA 3V4VL 1FBIH 4U3CA 1KCKA 3FQWB 2X05A 1KBGH 3GMMA 2D0FA 2FJHA 4OJFL 3U9PH 2ZUTA 2ARJQ 3BT2H 4EQ3A 1HYSD 5IIEB 4HEME 2OZ4L 5TDPB 3TP4A 3AS2A 3OAUL 4OTXH 2DWDA 5I0ZA 2MCG1 3QQ4A 4ZOBA 1KLUB 3G5VA 1KUMA 1HK6A 4XTRD 3QUXD 2VABB 2YXMA 5D71H 3O3EA 1JGEA 2BNUB 2KKQA 4JFXB 1EEYA 3DV4B 4RGMB 3S34L 3V95A 3F7VB 1FO0L 3SDAD 4RCAA 1A14L 4I3GA 4NO0B 3C2SA 2WBJC 3UDWC 1EFXD 1GGTA 2W60A 2WBWB 3ZL4L 2A77L 3IXTB 4N0UB 2X70B 1NCBL 4FQIH 4NO2A 5FK9A 5IHUL 3EYOB 4U1GB 4NGHL 1JN6B 4X5WA 5DJAA 1PY9A 1GOHA 3U9UA 5EO1A 2J88H 4ZTPH 4KI5D 4POYA 5D96B 2NXZC 2XWBA 4MNQD 4MAUH 5HHQA 4I2XE 4HGKC 4L8BA 4JB9L 5FXCH 3MRIB 1CLCA 1EJOL 2VISB 4BYHA 2VE6A 4BZ2L 3OX8B 3LCYA 3VD9A 5GRWA 1CLYL 2EDFA 4UT7L 2Q86B 4JRXA 4PJ7A 4HK3N 1YNKL 1KT2B 1T4KB 1EXUB 3WMSA 5T5FL 5AYUL 4PJ8A 2CUMA 4LHUG 2X1PA 2VDKH 5LJYH 2X9XA 1JGLH 4MDJB 2XN9B 2GCYA 4IRJA 4QXTB 3TN0C 4CGTA 4S1QL 1HHIB 3AMKA 2ENYA 2Z31A 5I1CH 1CD9B 3OXRA 3B3IB 1JK8A 5BVJA 2ZSWB 5CEYB 4LNRA 2E6PA 1UFUA 1JF6A 1KIPB 5EU3A 3LS4H 1VGEH 4KU1A 2V5TA 4JLRB 1V05A 1OM3L 4K3EL 1I8KA 2CKBB 5HYSB 3K4ZA 4FTVD 4LQ1A 2BVYA 4OQTA 4HFWB 1CG9A 4ZSOE 1TNMA 3SKMA 4RFOL 3HG1B 1ES0B 1F6AB 3UC0H 5AAWA 2VOTA 3OKMA 5JOFA 2DLTA 4Y5XA 5DHVH 1G6RL 4O2FB 4EN3A 5E1AB 2UV3A 5C0RH 5LGKA 1KYOK 4AIOA 2NY2B 2F53B 3TA3A 1HOCB 4KK5C 5GS0L 2DYPA 5D2NE 4HWBL 3DWTA 2E7LC 4QYOA 5C7XH 4F8QA 3GSNL 1JTOA 4J4PC 3T1FB 2CK0L 1MWAL 1BJ1H 3IVKB 2IG2L 3A6BH 5IWLC 4GAJH 1XGTB 5EIIA 4ODUB 3IGAA 4OLZL 2DD8L 5C6TH 3VWJA 2IPTH 2HKHH 1I9RH 3Q1SH 1AKJB 1DZBA 3MR9A 3ZKNC 1MJJA 4NKOB 3C8HA 4XVSH 3U0WL 3DHMA 4BSJA 4J3TA 3HPLA 4Y4KC 3LHPL 4K07A 1SJHB 3HE7B 5MERA 4YFLI 2HTKD 2F54A 4ZUUA 3QXAB 3RGVC 5K9JL 2VXQL 2Z0BA 3E1F1 3PNWB 5JHDB 4HS3A 3F5WB 4UV7H 5EH1A 4KRMB 2YPVH 5IROC 2PR4L 1WBYA 1K6QL 1IFHL 3GI9H 4PRBB 1NBZB 1HILA 1JNLH 1WEJL 1F42A 1XH3A 3IAQA 4IRSC 5IFJB 5DXWA 3IYLW 5DFVC 4HUUB 4MD0B 1OB1B 3NFSL 5H2BB 2VDMH 4J3WA 4NM8H 4JFHE 5JPMA 2C4XA 3SE8H 3BHBB 1P1ZB 1DQLL 4R90L 3VRJB 1X4YA 5EZLB 1ZHBA 5DGRA 2A74B 3DRTA 3WUWA 3U6RB 4NQCA 1NGYB 4TVPD 1XF1A 1JHLH 1CCZA 3V2AR 4Y4HD 5EUOA 3OKDA 3MV7A 1RJZB 1LK2A 3LRGA 5I15H 1I1YB 2AJUL 2C7UB 4DKAA 4HUXA 2C26A 3V7AE 1QVOA 2QBWA 3OKKB 2D3VA 3TYFB 1TZHB 3UAJD 5JQ6L 3QDGD 2OR9H 1CLOL 3WLWC 5GS1C 1AO7B 1OTTC 4P46C 2FDBP 5CILL 4Y16C 2OTUA 4M61B 4CMHC 4JCLA 4HIHB 4D9RD 2J8HA 2VR5A 1IM9A 4P9ML 2DDQH 5LQBH 3A6CH 3ZDXF 4ZO8A 1XF3B 3FO9B 3JXAA 4MNHA 4UMGA 1K8IB 4OQTH 3DVGA 4OSUH 1ZGLM 4R96A 2VLJA 4QRSB 1GIGL 5E7FA 4KV5E 1D5ZB 3MV9B 3HAEB 3UYRH 5L88L 2X89A 2B4CC 5C08E 2DQIL 3AUVA 5DTFA 1UJ3A 3NGBC 1NEZG 1D5IL 2NY4B 2EC8A 2AP2A 5H8DA 4N0CC 3WFDH 5F7EH 5IW6A 5F6IB 1YY9D 3F58H 5LBSH 1ORSA 1IC4H 5FF6B 1KENL 3AREB 32C2A 5INDA 3B2UC 4YBLC 4HG4K 2E7BA 4HXAH 4QLRA 4PJ9A 2M1KA 2A83A 3MBEB 4O2CB 1YEFH 1IBGL 2E6JA 4XNQB 5HHOE 4L4TD 5T3ZE 5J57B 3BAEH 1TNNA 2MFNA 3IRPX 3ULVD 3C2AL 3NZ8A 1P5VA 2Q7YA 2JJSC 5IMKA 4I18B 1AD9B 4P2QE 3VFRA 3V5KA 3KLAA 1BAFL 1U8JB 1T04B 3NOIA 1SEQL 4PP1C 3O6FD 4RAHA 4XCFH 1QBMH 5BS0B 3U4EB 4ZOEA 3CSGA 4LARL 4H0GA 3DUSA 1B2WH 4KTYA 1GC1L 3IDYB 3NIDF 1JZ8A 1EERB 1QA9B 3IAPA 3T2PA 1ONQA 3BE1L 3H6JA 5I9QB 3GMOB 3RWEB 2ZCKL 4YHPA 3UJTH 1QHPA 4X6CE 1BZ7A 2BVTA 4D9LL 2BCKA 4WUUB 4HJ0D 3QPQD 2M26A 4OUOA 3BP6B 4X80L 5DJZB 3BGMB 4G6AC 4AJ0A 2MQCA 1Y6NR 4P9HC 4DK3A 5FV2A 4OV5A 3TIDB 1G7MB 3ZE2F 2MNUA 5CAYB 2NTFB 4PGZA 3NVQA 4MXQC 1DEEB 1RZJC 2K1MA 5J3HD 3QQ3B 1K4CA 4W6YB 3O4LD 2VC2H 2CMRH 2P8LA 1N5YH 1MNUH 1RZFL 2R1WA 4LFHD 1G9NC 2P5WD 4EUPA 1LEGA 1MCNA 4JGJA 2Z92B 2HT2D 5DZLA 4DUWA 3WDIA 2EDLA 1T0NA 5CSZB 4EIGB 5JR1H 1CDYA 4DWHA 3KJ4B 3IFLH 1O7VA 5E2VH 1RMFL 4KK6D 3DTXA 1S9WA 5EBGA 1CGWA 2QV2A 3P30H 2H32A 1INQB 1U8QB 3MJ7B 1DBJL 2JCCE 4OLWH 3W11C 1CFTA 4IOSD 2O5ZH 4ZODA 2AK1L 4LHUD 3RVUC 3B9AA 3S35L 2PW2A 2DBJA 4BKLB 4PJGE 4CAGA 3BDYH 3I3EA 1UADC 1JYNA 3K46A 3QUXA 1FNGB 1T7XA 1F6FB 4PJIA 1G7JA 2FL5B 3V4PL 5HGGS 3PL6B 1CXLA 1R3JA 2JJTC 1F3DJ 2YKLL 3TC9A 3SDAA 4Q6YA 3LN4B 4PJDE 5KTEL 4G3YL 4LKCA 1BFVL 5A16A 4OZGB 1UM4H 4NN6C 5GGTL 1DQTA 2Y6SD 2AJXH 5KN5B 2AJZB 5FDWA 4A6YA 1IJ9A 4BFGA 3NCMA 5HYQB 1HQ4B 1N4XH 4YH6A 2CDEA 3KPMA 4RFNB 4NN7B 1XMWA 5J8OA 2UYLB 3IFNH 2DJSA 5ISZD 3BKCL 4MNQA 4ZMAT 1PKQE 3QCVL 1A6PA 4G8EB 1AD0B 4GH7B 3KPRA 4C54A 1V3LA 5FM4A 3H3KA 4KK9C 5CCKH 3B5TA 2BNRE 4M8VA 2Q76B 3HR6A 1VHPA 1MFAH 2DLFH 4PV9B 4K3GA 4DN4H 1CK0H 1UM5H 5E8OB 4QRRE 5C9JA 3L1OL 4LPCA 4G9FB 4TUOA 4OCNC 4W70A 4JVPA 1TVDA 2ZCLL 4JN2B 5HHPA 1JZ4A 1V7NH 4GW5B 3OZ9L 2NX5E 3D39B 4KK8D 5CS7A 1FYTD 4JDTL 4YJZL 2IFFH 1Q72H 1T1XB 1KLGB 3CFBA 5LWYH 1FORL 1FNAA 4KRNA 2QR0B 1P4BH 3H9HA 4D3CH 5T3ZL 1UWGH 2YD8A 2WIIB 3MRFA 1LK3H 1V3KA 1ZA6B 3ARPA 3G04A 3DLQR 4W4NA 3TN0D 5I76B 4OFIA 3KYOA 3BGFB 1ZT1B 4IDJL 1P7QD 4O9HH 4ODTH 3NIFE 4N8VA 1NQBA 4Z78A 5LGJA 1J0JA 1UWEL 1LO3H 5DJ2B 4ZYKA 4FTVA 1IGCL 1M7DA 4FP8L 4BH7B 1IEAB 4YDIH 5KJRH 1KPUB 3WHXA 4OFYD 3P9MB 1RIHL 2BOCA 1NGWB 4G6KH 5DDHA 3PGDA 2Y36L 4EUPH 2WBKA 2X7LB 1DQDH 4EDWH 2EDTA 5I1KH 4KQ3L 5FA3A 1JPSL 1R24B 3E6HB 3TBWA 1F11A 1JI1A 4LQFL 4ZXBB 3IDJB 4ZFOA 5TF1H 3DO7B 1DN0B 4XXDA 2MWCA 1WAAA 1YQ2A 4OM1H 5DJ0A 1U8HA 1BOGB 2NLJA 4NSKA 5INCA 4P2CG 3WSQL 2UY6A 4HF5H 2H32H 2NNAA 4LLVA 3RZCB 1MHPL 2ADIA 2Y72A 2IWGA 3RWIB 5F1OB 5K59E 4LHQB 2VXSH 1SMOA 4AM0A 2A6KA 4JZNA 4WWID 1XCQA 4NQED 3VU2A 2GQHA 4PLKC 1AHWC 5F7UA 2AQ3A 3ZTJG 3BZFA 4DKEH 5DEGB 1NGZB 3OGCB 3C09B 5D1XB 3WL9B 5C07B 5GGUA 1WJ3A 1WT5C 5F88B 5H37G 3UPRA 5C2UB 4JFEA 3EFDH 3QHFH 4KJPD 4A6YH 1G1YA 3SEPA 3QIBB 3BP4B 2NZ9C 4UU9A 3N9GL 4Z7VA 1NCDH 4HLZH 3VWKA 3CLEH 3W2DL 4ZAKB 2ADFL 2QQNH 2QSQA 2RCSL 2UZYB 4PGCA 1Q0YL 1WV7T 4WO4A 4QRPB 4AMKL 1LE5B 3TF7C 3UPCA 1YYMH 1H3TA 3LAFA 1TTGA 2ITCA 4U1NA 5FUZH 1OP3H 2FX8H 2ZOLA 3HZMB 5J7CC 1I1AC 5HYJE 5F7DA 3IXAA 5F1KC 4LLAA 4HQQL 4K55A 4IS6B 4MJ4A 1T03L 4HH8A 4WEBL 5E8PA 4PGDA 4NHCH 1GSMA 3P73A 4ODHH 3MNVB 2DI9A 2ZUQB 4Y19D 5F7FA 2VL5A 1QQDA 3T65B 1QKZH 1M71B 5EOQL 2LAGB 1HHJA 2PYFB 2AXFB 2V5MA 1FH5L 2YC1B 5ESVA 2X4TA 3QDGA 3P77B 4O5LL 2BY0A 3WEXB 3MRKB 3FT2A 1L0QA 2B0SL 2GFBA 5CMAB 3RUGE 4WI2A 1KIQB 4QHUA 3WLWD 1OTTD 1VCAA 1EEUA 4P46D 4Y16D 4KROC 2APFA 2AXJA 3FO2A 2FRGP 4WRLA 4GG8A 4L3EB 4QXGH 4LGPB 1UB5A 1DQQB 3MO1A 2V17H 4J3XA 1FVDB 1I8MA 5E8DH 2UWEF 4OZHF 1R0AL 5L2KB 3LQAC 2FR4B 3U0TB 5C0NC 4EVNB 4U33A 4NP4L 5D7LE 3S5LA 4KPHH 2OTWA 1MHHB 2ED7A 4Y2DD 1M05A 2CRYA 3CFDB 2AEQH 4NNYB 1ZSDB 4Y4FA 4OLXH 5DK3A 5HGBA 1IKNC 2GHWB 1INEH 2EIBA 4N0CD 4OCXH 4QT5B 4LAQH 1IQDA 1FP5A 3X11A 1PG7X 3HE6C 4P9HL 3UMTA 1H9VA 4HT1L 4LRNL 4L4TA 1RULH 1Q9KB 2K3TA 1I9IL 4TNVK 3FB6A 1WBZA 1AQDB 3PGCA 1YY8A 5BZDB 5FO7A 5TDNA 1B90A 1G9NL 5DJYA 3AROA 3O3UN 3O6FA 5DO2D 3K8MA 4CW1B 2JELH 2EE6A 3EO0A 4FQJH 3VG0L 4WU5A 2V7NA 3QQNA 5EBMB 4Z7UE 4Q58C 3BIKB 2WUCL 2YMXL 2BSRA 4GKSB 2ESVB 3RY4A 1HI6B 2IEPA 3VFPB 2XZZA 5DHYA 2V5RA 4PJBE 1YN6A 3FKUS 3H9SE 3O0RH 2Q6WB 4OBSA 2OLDA 2QSTA 3O45B 4JHAL 4AG4L 3FQRB 3JV6A 2R2BB 5FHBH 3QUKA 1PX3A 2HJLA 3PHOB 4XC1H 1ERNA 1PY4A 4P2OD 2EEDA 4G8GD 3DOSA 1IVLA 1YC8A 5I75C 5IMLB 4NQVB 2R56H 3O4LA 15C8L 4TVPH 2F8XC 4PY7B 1NLDH 3LQMA 5EU6E 3D9AL 3H42L 3MUGA 1A9BA 1WISA 3FT3A 3MLPA 5IBTH 3SJVD 1OARL 3QIUD 5E7BA 5E56A 1A7RL 1NJ9B 3QEUB 4FZEH 5GGVH 5HI4C 3TO4B 1EGJL 2A6DA 4Q6IB 2DQCH 1NAMA 1UXSB 2DLHA 1QBLH 4QHLB 1CYGA 3LMJL 3QWOA 1PGRB 4EDXB 5CEZL 4PRIE 3FFDB 5F93C 25C8H 3MRJB 4NDMA 43CAB 2XT1B 5L9DL 4UBDC 2G5BA 1A4KB 3FFCE 5DMIH 4HZAA 5ANME 2FD6L 2VNCA 3HUJB 3LKSA 1HYRC 2BFVH 2M2DA 3GSUB 4HPOH 2IQ9H 5DVMA 3J7HA 2G60H 1KACB 1J18A 4KRPC 2ZUUA 4NFBA 4DGIL 1IAOA 3HC3H 4H8WL 1T66C 5ENWA 5JLZA 2VLKE 3IFOA 5F1NB 3FRPA 1U8PB 1H3UA 2E7MA 2FBJL 4UIKH 5MI0B 2J6EL 3V6BR 1YDPA 3PWJB 3HC4H 4WCYH 5HSFA 3KPOB 4LSRH 1LP9F 2YPLE 1KIUA 1QSED 5IBLD 1D5XB 3HR5A 3LV3B 5IT2L 3SBWC 3W39A 4XBEL 2DIAA 2HAZA 2X40A 2DTML 3M8OH 5D4QA 2JTDA 5ISZA 4OCYH 4FXKA 5IHBA 4KVCH 5JPNB 2FWOB 2OI9C 1I8LA 3QDHA 4RMTA 2XWJA 4IBLT 5E8EB 5JOPD 4RX4D 1E27B 3RX5A 4MAYC 5JOEA 1CXFA 3DX8A 3BH8A 3SGDH 2PXYD 4H1LA 3ULVH 1TMCB 3Q6GL 3V6FB 1AJ7L 3V9FA 4AEIH 4PJHA 4LIQE 5JO5B 4ETYA 3INUL 3OG6B 2RAMA 4LKXB 2Z93A 1FYTA 4FQQA 5L6YH 4JPVH 3PDOB 3TH3T 2DL9A 2K7PA 3BKYH 4PD4J 2XPGB 5E94B 5KVFL 1OLLA 3P4NA 1ODAA 3ULSB 3OB8A 2PW1A 4WFFE 1YECH 4PJ5B 3TN0A 3D85D 5DK2B 2IH3B 4LSPH 4O2EB 5HXMA 3V4UL 4MVBC 2AV1B 4CDGC 3N1FC 3OKNB 1U8IB 1BVKA 3R1GL 1D6EB 1M7IA 5F6HI 3ROOB 1NFDB 4YXHH 3QFJE 4ODWA 1DL7H 4UDTA 3VXNB 2JJVA 3QNXA 2EO1A 4ZUVA