1U8UA

E. coli thioesterase i/protease i/lysophospholiase l1 in complexed with octanoic acid
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
178
structure length
178
Chain Sequence
ADTLLILGDSLSAGYRMSASAAWPALLNDKWQSKTSVVNASISGDTSQQGLARLPALLKQHQPRWVLVELGGNDGLRGFQPQQTEQTLRQILQDVKAANAEPLLMQIRLPANYGRRYNEAFSAIYPKLAKEFDVPLLPFFMEEVYLKPQWMQDDGIHPNRDAQPFIADWMAKQLQPLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate specificities of Escherichia coli thioesterase I/protease I/lysophospholipase L1 are governed by its switch loop movement
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Acyl-CoA thioesterase I
total genus 63
structure length 178
sequence length 178
ec nomenclature ec 3.1.1.2: Arylesterase.
pdb deposition date 2004-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 1u8uA00
1K7CA 1YZFA 2WAAA 1J00A 1DEXA 4JGGA 1BWPA 2W9XA 5HOEA 3BZWA 2Q0QA 4S1PA 3DT9A 4XVHA 1V2GA 4DEVA 3DT8A 3P94A 1ESEA 1WABA 4K40A 4H08A 4HF7A 1ESCA 5B5SA 1JRLA 2Q0SA 3SKVA 4OAPA 5A4AA 4JJ6A 4OAOA 2WABA 1VYHA 4NRDA 4TX1A 1ZMBA 2O14A 1VJGA 4HYQA 3U37A 2APJA 4IYJA 1PP4A 3MILA 4I8IA 4RW0A 3W7VA 3RJTA 5JD3A 4K7JA 5BN1A 1DEOA 3C1UA 1FXWF 2HSJA 3PT5A 1Z8HA 1ES9A 4JKOA 5CD9A 4Q9AA 4PPYA 3KVNA 4M8KA 4Q7QA 2WAOA 4RSHA 1IVNA 4JHLA 3HP4A 1BWRA 3DT6A 1FXWA 3DCIA 3SLRA 4JJ4A 1ESDA 1U8UA 4K3UA 2VPTA 3DC7A 4LHSA 4K9SA 1BWQA
chains in the Genus database with same CATH superfamily
4RK7A 5K51A 5GV8A 2KWIA 4C5CA 4EEZA 3EAGA 3FTDA 1Y9ZA 1RXVA 5A4DA 3CLRD 3ISVA 2R5FA 5LDGA 3RRFA 5ILQA 5IKXA 4RK1A 4II3A 2OBYA 5JTTA 4WT7A 4TYNA 5G0SA 3ADPA 3IB3A 1EHIA 1CUJA 4CGZA 3TDNA 3JR3A 1Y5MA 1XZCA 4MVWA 1XDDA 3Q2IA 4KZKA 2AUMA 2OUKA 2CXUA 2YYSA 3LQ1A 5JC8A 4WKCA 1M1XB 2WF6A 2YX1A 2ZU0C 4MLDA 4R1TA 4EAQA 1RJ9A 3FZYA 1RAHA 4LYGA 2PMKA 3C48A 2P90A 4F5EA 5F77A 3TEMA 3JRWA 1CNMA 1U28A 3OHSX 4GX2A 1VG0B 4XCQA 2ZBFA 5MDHA 4P9NA 1U0GA 2ZSUA 3AG6A 4DR6B 3I1YA 1IXKA 2G9VA 5IVKA 1L4FA 1X2EA 3O3MB 1EEHA 2KE5A 2YFYA 5FLXA 1J24A 1L5WA 5B3AA 1TVKA 1H5UA 4YWHA 3K8OE 1J70A 3K1TA 3CLSC 3GLIA 3N8GA 3SQMA 3KZCA 4HYQA 4K6OA 3UHAA 5TIIA 3H1PA 4FU0A 8MHTA 1M83A 3EA5A 4G5XA 4YV1A 4U39A 5AOBA 2IUYA 1KJNA 2XKBA 2R1TA 4GE3A 4KUHA 1XTBA 1GV0A 1W85B 5C51B 1J2UA 4NBNA 3WMGA 1L7PA 3PWTA 1R0BA 3JXEA 3T4UA 3VC1A 5ILGA 5AK3A 3DC2A 2F2TA 3KJGA 1ULTA 3M4JA 2R00A 1P33A 4HLDA 4IRUB 3P7MA 4RKFA 2M6KA 2K87A 4BZWA 4IDDA 2WTUA 4JXJA 3M70A 1PFYA 4RZIA 4Q34A 3GLTA 3RAGA 3T7RA 4BCDA 4O4LB 2QV7A 2NN3C 2YIMA 4MZXA 2IH4A 4BNYA 2XI4A 3GUYA 4P1ZA 3BF7A 4ARUA 1GKIA 1J0CA 3W1EA 4KWTA 2IYUA 4J0IA 1XA3A 1CTQA 4XYLA 2A5JA 4R6WA 1YKSA 2WIBA 4PZEA 4ZODA 3M3PA 4O4JB 1NBEA 4ITUA 4P3PA 3R0IA 5AVRA 4KGVA 5J5VA 4M8KA 2HWWA 4NBTA 5ALTA 5I9BA 5JC1A 2C7QA 1VI6A 3EC7A 5KOJB 1TL7C 2KB0A 3BD9A 1PVOA 3PHHA 1G18A 1KRHA 1BDJA 1EQUA 4ALNA 3BWMA 2FPPA 3C85A 3E7DA 3I9V6 4EPYA 4D92A 2UAGA 4ZV9A 4DBLE 1L0BA 1TFRA 4JUDX 2ZYDA 2AWOA 4CLOB 4M1OA 1DRVA 1WXGA 1ZNYA 2E5FA 3AFIA 1A04A 3HI6A 4MWBA 4TLCA 3RVPA 5GM2A 1N9KA 1U04A 4AYTA 4R98A 4E5SA 2WYHA 1I01A 1SIOA 4G1EB 4JJ4A 5LOVB 5BV7A 1SOUA 4WOKA 2B4TO 3PC8C 3W8NA 3D5QA 4OEHA 3FRIA 4XWGA 3GFRA 4JOCA 3A32A 4UEOA 2V7TA 1ZM9A 3HWSA 2QX9A 4NECA 4RE6A 1IAQA 1L5HA 1JBQA 3GP8A 4ZHQA 4YS6A 5K3AA 4NH0A 5B6IA 3VZDA 3OAAA 2ZJ2A 2GEDA 4J1SA 5GIPE 3UCFA 3AFOA 2XDWA 1CUZA 2NTNA 4A5SA 3V46A 2QAIA 4AJ9A 3ZDQA 1P81A 3WQQA 3IEKA 1Q74A 2P6UA 2ZFUA 3EIQA 4P83A 4BNWA 4S0ZA 4MPJA 4DVGA 4ZJZA 2G76A 1Q17A 4N0MA 5B1IA 1IIRA 4DJAA 121PA 3PHGA 1CRQA 1TADA 1I7NA 1TLFA 1S2MA 1Y33E 1RTTA 1U80A 3OA2A 4QU9A 1IQ0A 4DB2A 4KLCA 2INGX 3IHLA 1TLTA 1NVKA 2ORWA 4M0LA 5AHXA 4R51A 2WWFA 1NX6A 5AD1A 3AVVA 1KXZA 1JAZA 3H2IA 1HG0A 4JQZA 4BOYA 1EGAA 2OCGA 3QKTA 1XKQA 2O7VA 1RJFA 2P4EA 3WVNA 3CLHA 2WQ6A 2C7GA 3GJSA 3GUHA 2WUWE 3W2HA 1K7SN 3GEEA 1LI5A 3IAFA 1L5HB 1XU4A 4UUAA 3FDFA 2C07A 4OHRA 3W2EA 4F8JA 1N6OA 3VYWA 1RWMA 4A15A 3LX5A 3DZFA 3FB4A 4E30A 3S1SA 1QQ6A 1MOPA 1ST2A 3OKPA 4IILA 5B58C 2XIJA 1D5CA 1ZONA 3K9CA 5BW5A 1AHIA 3OFJA 1WV1A 1RYHA 2OD7A 2R7LA 1OVMA 2X4IA 1R27A 2HN9A 2YUIA 3QX9A 4N9QA 3RS8A 4CR7A 4DL9A 4WASA 2YWCA 3GA0A 4QFDA 1O6CA 1C14A 2ICAA 4ZO4A 5GONF 5LUBA 1TYBE 3BH0A 5FLYA 1XKLA 3GUVA 4RM2A 4Y6LA 4DSZA 3SMVA 4TSFA 4Y7DA 1EKXA 3CT4A 3UGJA 2RI6A 2CBXA 2YCLA 2C88A 2YV3A 1NJ2A 1UC9A 4LXIA 5LQSA 5CAEA 2XMQA 1OH5A 3GRRA 2AMFA 3GZNB 4TYMA 2DWPA 3W6ZA 4ZFNA 4DR2B 4EG8A 4FW9A 1Y6RA 2H48A 3G1UA 5L40A 4YK7A 3FX2A 1N36B 3WICA 2GTHA 1U3TA 5BNTA 3HEAA 2P6MA 2B35A 2GRJA 1ZH0A 2BMDA 3ITNA 1SC3A 4G6ZA 4UNSA 2PGAA 5F4BA 4P5PA 3SC3A 3E4CA 3IDAA 5A9TA 3RRMA 5KVVA 1L5VA 1VPLA 3GV0A 5JRJA 1UC5B 4DR3B 4C4RA 2P0AA 4JBWA 4UBNA 1O95C 1P44A 2XIQA 4YCNA 1CP3A 2PE5A 1KH2A 2Q5JA 2QVLA 5KWIA 5CMLA 2ZJZA 4G37A 3HKCA 2ZUEA 1DQSA 3ESDA 1PZXA 2AVNA 3UV3A 1II8A 4LDNA 5F33A 3HTXA 2FX5A 3RVQA 4WSOA 2ZTHA 1C7JA 1VCIA 3BA1A 4RABA 5A1TA 1YOVB 4BN0A 3NYQA 3HY3A 1FXWA 5NLLA 2F1JA 4G0ZA 4CFZA 4RTLA 1UC4B 1MO6A 1QDUA 3ZH2A 2GM5A 1XROA 3RJ9A 1XTQA 3U49A 4EI7A 4KFSA 3JAKB 5ERGB 2ODAA 2Q9UA 1M8GA 3VH3A 2BRUA 5CLQA 2O8CA 2JGMA 3QM1A 4FFSA 1UBTS 1IY2A 2FMUA 3COVA 1V4NA 1MC8A 1JPJA 2JI6A 4QUKA 2G1KA 1C3JA 3TLMA 3ESQA 5BN4A 5J4LA 2GERA 1L8AA 2OB1A 3P0RA 1XD9A 4KFTA 4L15A 5E38A 3Q9NA 5TQVA 3W6PA 4CMCA 4GP7A 2NNLD 3AI3A 4D4LA 3JYPA 2P2NA 5DRTA 1MJFA 5IM5A 1OYYA 1P7CA 2LDXA 1FRQA 3JVVA 2PN1A 2EP7A 4FOOA 4IPTA 2JDIA 4J1TA 1NAIA 2IOHA 3CWZA 4N03A 1T1EA 3X44A 1ESEA 5LA6A 3SBXA 2AJCA 1ZWKA 4PC2A 1SKUA 3U48A 1UMBB 2VAWA 3GFTA 3DFUA 1N8KA 2OG2A 2QTWB 3BD6A 3OE5A 5I9MA 2QSUA 1KVQA 4RA6A 1KYZA 2FR8C 4LK3A 5I7RA 4LGMA 3DBRA 3FXAA 2GRUA 2DSTA 2JVIA 1V9SA 4BNIA 1DUVG 4C29A 3NT2A 2Z58A 3RAPR 3B70A 1NUAA 4X0EA 1JYEA 2UYHA 5L3RA 4MVJA 2IP2A 2MMGA 4PYQA 4RVOA 3NBXX 1ECFA 1YC5A 2P8JA 3DYIA 3FGPA 3NYRA 4XJTA 4B3GA 1NVFA 2WTXA 1ECPA 3JARB 4DC0A 3D5EA 3HU3A 1QG6A 2JFOA 4LXHA 4ZRMA 5T64A 4WY5A 3SZGA 3TSWA 4MS3A 1T1JA 3DLBA 3H04A 5TS2A 2IXTA 4ZO9A 5AM5A 5AI5A 1I2CA 1E1CA 3GQBB 3EX7C 4DGSA 2Q7OE 4KLAA 4OUDA 3VA7A 1G7CA 1I4OA 2CYBA 1ZD5A 1VXRA 3KAQA 1L7MA 3D2LA 3K94A 3GBVA 3LO8A 1G5HA 3I72A 1YIAA 1U6JA 4KE6A 1PT5A 1WXEA 2XRFA 2WTMA 3AVPA 3RU7A 2ZTVA 3DBHA 1HYQA 3E82A 3GYGA 2YJNA 4IS3A 1DINA 5IYZF 2IC5A 3FMOB 5HIJA 4N7JA 4EUHA 4GOOD 3D9QX 2HCFA 2H2AA 4M0EA 4S35A 4E5KA 2F55A 5F98A 2BUBA 2ADOA 4GWKA 3EC1A 3GIDA 2QTVA 1HDYA 2I6GA 4WDRA 2GHRA 4O2LA 3S55A 2HRRA 2PIDA 5I7OA 2Q7XA 3BRWA 3EEFA 4C7OB 3MBOA 5BR4A 4Z9YA 2HSZA 5HGXA 4WKGA 4Q18A 3DFKA 5CH3A 3FWKA 2RK6A 4GDMA 3I04M 5EMNA 2XCTB 3NHSA 5FBRB 2N1BA 5FPQA 4HNSA 4UNPA 1IC6A 3WBKA 1J21A 2WD8A 4BLUA 1QWOA 2EU8A 5BNIA 3V32A 2ZTMA 3X3HA 2I6TA 2H7CA 1WM1A 4WZAE 3EE6A 4PE5B 4MRAA 2EC5A 1NAHA 2I8AA 3QWBA 4PLTA 3IPYA 3QHQA 3E05A 5CNMA 4ZQFA 3UAWA 2HT6A 2WA2A 2Y92A 3SCZA 1DOZA 3IKVA 3GP5A 1E63A 1ZI9A 3B1ZA 1PJTA 3IP3A 4PQGA 1N3BA 4B8ZA 5JBQA 4HGPA 1SQ5A 1EP3B 1K66A 4ND1A 2Q28A 4U6QA 4BO2A 3ZU4A 4AK9A 1YQTA 2J6CA 2AKAB 1YONA 2HYIC 1E99A 5DBFA 3L0PA 2QUAA 4CHTA 1XT6A 8GPBA 2JAXA 2B92A 4OHXA 3B1FA 3OEYA 2GF2A 1WE2A 1KDTA 2FPGA 5IMBA 3NOQA 5HDQA 4B5LA 4FFPA 3IXLA 4JP5A 5HSGA 2H59A 2YIJA 3FNBA 4FGLA 1NBME 4IJ6A 3PVZA 4BLQA 4TLDA 5BV1A 1HEIA 1MV8A 4PX3A 4TSFD 3G2HA 3VPXA 3I2YX 3L1HA 1K86A 3CNHA 3EEIA 2B5WA 2I3ZA 1R6DA 1ECJA 5A7HA 2YBEA 1EI9A 3LBAA 3DB2A 3IQEA 4NFHA 4H7PA 1MHPA 1C8VB 3FTNA 3PSHA 3LYAA 2FW0A 3BTOA 5ENVA 2ZI7A 4JIMA 5ICFA 1NVVQ 4WLEA 1W19A 4BX2A 4MX8A 1PX0A 2Z08A 3WLJA 4E7OA 2QENA 1I3CA 1J2JA 4O1IA 3DZGA 5KYUA 2WZBA 2YOHA 3DMGA 3E6AA 2I87A 3NKVA 3DZJA 3UJBA 1S2IA 4QUJA 1W4BA 4WLOA 4G8BA 3CX6A 4CV0A 2IZ1A 3VJKA 2QE7D 1V5IA 2YC2C 3LZ6A 4KX3A 3BQNB 1ZD8A 3ELUA 1QHYA 1WUKS 1HKUA 3LLUA 4MQFA 5AJYA 4F9TA 3UG7A 3SU8A 3WLFA 3GMIA 5CB4F 4AIRA 4DIMA 4ZEWA 2AC2A 4A3SA 4ZT7A 2B3DA 2XCSB 1QCCA 1MB3A 1R6UA 1DUIA 3CZ9A 1O6GA 3QKWA 3FKSA 3QU4A 4HNHA 4JVNA 4HYTA 4TWBA 1LLDA 2ZYVX 1DRJA 3DOIA 5EUQB 4KN6A 2QTZA 4XEHA 4IOLA 4ABTA 3HXLA 3UCXA 2A94A 3L8ZA 1HPLA 1CQXA 5IVDA 3IOEA 1ECCA 4J3FA 3D7MA 1Z74A 2CK3A 3EYWA 3B1WA 4PTYA 2BFEB 3W5IA 5HCNA 3WNVA 1EWYA 1TJNA 4K7JA 1YA4A 4ZZ3A 1CUAA 3DYVA 3HG7A 3KSUA 3NIFB 4Q4AA 3F7NA 3SAJA 5IVHA 5G3YA 4INAA 4KK4A 3Q11A 4Q05A 2J5KA 3TRDA 2DH6A 3D81A 3BXPA 3ROTA 2HEGA 3CVWA 1GVNB 4LCBA 3WYAA 2QJTA 5E3IA 4L5IA 3WZ2A 1O5TA 2QYOA 4J7XA 3NC0C 1UEIA 5JDIA 1A71A 2GZRA 3G7UA 5KMGA 3HLYA 1YULA 1TM2A 3GJRA 1PLLA 2RIRA 3DE2X 3E27A 3EUAA 3SHWA 3HXQA 4RVHA 1IHYA 4TZTA 4KXXA 3OUTA 2HF2A 3ZS8A 5I7VA 2FZ5A 1RZUA 3HXPA 2A0WA 3AF4A 3DULA 4OTZA 2I6QA 1Z5ZA 1A27A 3INRA 5C8YB 3NANA 3PFBA 4P7GA 2J41A 2PD6A 1Z4MA 4QARA 3AFHA 4U8GA 3UWOA 1YNSA 4MUGA 4KAXA 1QGAA 2HNAA 4Z3OA 4R54A 4S12A 1EVQA 3KPWA 2EFGA 2J3QA 3E2IA 4WBXC 4GKKB 1YR1A 3LP6A 5SYNA 4LEIA 4YJ3A 1NKTA 1PZEA 2LCFA 3SEQA 4RDHA 2NGRA 4ROTA 4QYMA 4EG4A 3U0BA 1D0IA 1X7GA 1DNPA 3MCAA 4JOBA 4Z4IA 3F90A 1G21E 1WXHA 3BB1A 4C6TB 1C29B 1UIMA 3GLGB 3KXKA 2IYNA 3TZLA 5C7YA 2XXAA 1B0UA 4LJ8A 1PR4A 4EB6B 4UULA 4I9FA 4A10A 1ZCJA 4PLYA 1PUIA 1YSCA 4PGFA 4IG9A 5EJ8A 2JD1A 3PT9A 3LDUA 4YRJA 2VF7A 1XZNA 3FCCA 2IY8A 2Q5QA 4YP9A 2O8BA 3GEDA 4ZYVA 1XELA 5FTWA 5GGXA 4D8TA 5IF3A 5CDFE 4XVRA 2JIDA 3A7EA 4NNOA 1Y80A 3ED1A 4B7AA 1Q11A 2WSLA 2BLLA 1OJLA 1UINA 4JJGA 1G5IA 1X0VA 1Y9AA 3MWGA 2JBAB 1Y89A 1TZJA 5E2BA 1SIWA 4ARIA 4MOWA 3LT2A 1EINA 1ULBA 2X14A 2DJ5A 1SRRA 2XDQB 2E85A 3QBEA 4JGBA 1E9AA 4ZAGA 2ZBVA 2DUMA 2C9MA 3SZRA 3PS9A 1ZW6A 1C7FA 3TTSA 3VU3A 5E6RA 1GPNA 1W52X 3ZJVA 3LY8A 5SY4A 3IPRA 1F51E 3WWCA 2CXNA 4AX4A 5HKAA 1U2GC 1Z36A 1NN0A 1KS2A 1CS0A 2YXNA 3QSGA 4GGPA 4OQEA 3LDFA 4QYTA 1RM3A 3ZY5A 1R0KA 1QV6A 2Q1YA 1XVTA 4X7BA 2IT1A 4XQCA 2IHBA 3NASA 2VTBB 4LXYA 3M9XA 2RGRA 4OFXA 4ERNA 5BN3A 3OJXA 2COKA 2H1HA 4H6XA 4R1MA 4LHVA 1TNDA 2E1RA 2AV6A 2GHQA 2RGEA 4G5SA 1N6IA 4Q37A 2PU5A 4RPHA 2NTEA 4L0MA 3OQIA 7YASA 1XHEA 1P0FA 4J3JA 4HVLA 3QVGA 3GJZA 4B4WA 5B7PA 4F4FA 1YQUA 1OWOA 5CVVA 3GXOA 3WQRA 4DV3B 1R3UA 4MSUA 4KNWA 1C9MA 2C7BA 5EJMA 1YS2X 3ETDA 4DMHA 1N0VC 2GAJA 1E4EB 4RWEA 3SG0A 3AR3A 2AE2A 4LE0A 5AVXA 4IIJF 4F84A 3SLKA 4B3CA 3HO6A 4UU0A 3QJGA 4GBMA 4KPGA 4XPIA 3VPCA 4OHFA 1X1CA 2VSXA 4QTZA 3A4NA 4GT1A 4AT1A 3B9RA 4RL6A 4FYMA 2O0MA 4PR3A 2B7LA 4NARA 1USWA 3IBFA 3D3WB 3I73A 3D6NB 3P97A 3SYNA 2HEIA 1EYZA 1GUZA 1K4YA 1PT6A 2YZNA 5EMLA 1DQRA 3RGGA 4JI8B 4KYVA 1W5BA 2OXTA 3ZHBA 1TC1A 2VSQA 4LZZA 3TUZC 1KEKA 3S7TA 2C97A 1GL6A 1SQGA 3TX6A 4N8SA 1RLTA 2MMCA 4IEEA 5T6MA 1I9CA 4U7DA 2F3UA 4I55B 1GKLA 3PE3A 1OIVA 1FUEA 2JCYA 1PJ8A 5MGBA 5JCJD 5KYYA 1ZZEA 1M1ZA 1R9GA 3FZEA 3OPVA 4FZRA 1HL7A 1G8YA 1XCGB 4IV0A 4MNTA 3M3HA 1CZHA 3S70A 3E61A 3S8YA 4FHZA 2W48A 3NS7A 1CX9B 5KTSA 1M75A 2VTBA 1TKCA 2XE6A 2DCUA 1H9AA 3GO4A 3CUSA 1XVLA 1ZN8A 4MWGA 3SYRA 1D2MA 4TSKA 1ACJA 4RD6A 4R81A 1RFGE 4GR5A 1OLSB 3WS7A 3GLHB 4BNZA 5FBQB 3NVAA 1SG6A 3W04A 2IYEA 3KHSA 4RX1A 1QFZA 4HXFB 2AB0A 4YMIA 2PZJA 3RFFA 4TQUS 3UHFA 4C01A 1YL7A 4C4YA 4LF7B 4YRSA 5IPFA 2PO7A 1U9YA 3QVGB 3B60A 5DP2A 4P86A 4AKEA 1Y4SA 4RV5A 3P9KA 1WL8A 1WPXA 1PUXA 2WKRA 3HSKA 2X4GA 5DASA 1WO8A 5BYKA 5AOVA 2BL4A 1OI2A 1ZCFA 2J9YB 2Q9CA 2X0JA 4OQPA 4UCFA 5E8RA 5GGYA 2NQTA 2X6RA 3F3KA 1GTVA 2WYWA 4U5QA 2RHLA 1ZR2A 5FQNA 4LXUA 3A6FA 4PIPA 2WUDA 3RFUA 3ZQJA 1O3YA 2W6PA 5B4TA 1W7AA 5FAXA 2WD9A 2V0CA 3FCSB 5BV0A 3KB2A 2RGAA 2CLHB 2L2QA 3QE3A 2V74B 3EASA 4URVR 2YHIB 5KJ1A 3E81A 1L4YA 4EI2A 2I8LA 5KTRA 4EYQA 3PLAE 2AKYA 2LIPA 3IILA 4ESEA 3S8MA 5EJ2A 4BVEA 5IDXA 1L7DA 4J8PA 1JTFA 1XUOA 2J6HA 5DHAA 1CEEA 1U3FA 3M6UA 4NQRA 4YI5A 1UZLA 4MRVA 4MW7A 2VF5X 1LVHA 3EZ2A 1ZK3A 3MG9A 3AC0A 1EFLA 2XQVA 5JLJA 1CFJA 4B3BA 1LI7A 1OIWA 2AR7A 2Q8NA 4LMPA 4QUEA 3AVQA 4JT8A 4OHWA 1YXMA 1DAKA 2P0YA 4UTRA 1S4MA 1APBA 4DVJA 2ZUCA 4JHXA 5J2TB 1AJEA 1P91A 1XDGA 2BR5A 2HPAA 3CKLA 3ICVA 3MB5A 3EGDA 1GPAA 3ZR4B 2JAHA 2CFOA 3D6FA 1UQRA 4JT4A 4XFDA 2EFDB 2CL7X 4NBVA 5H1YA 4OI1A 3SJBA 3OLWA 1R5JA 2C9CA 1L7AA 3C1UA 3OMWA 3PC7A 2CFCA 1ZRNA 4G36A 3U7RA 3VU9A 1SVMA 3UBMA 10MHA 1F1BA 1T8TA 1WMSA 4K26A 4EKGA 5BUSA 3A06A 4TWIA 1EWVA 4V0OA 2HBQA 3HKEB 3RUDA 1K6MA 1OFUX 1DKOA 1Y81A 4D9JA 3NLLA 3RTEA 1KC1A 1T3LA 3H9CA 3USES 1UP4A 1E1DA 3KEOA 1HFJA 4A91A 2X1LA 2CNDA 2FEOA 2WHQA 3ENWA 1U7ZA 2IPLA 2QAJA 5FLKA 3MCZA 2D1FA 5CA1B 3BWYA 5KAPA 4HSGA 2CDBA 3ER6A 2WK1A 3KETA 2VH1A 5IC6A 5B1SA 5C3UA 1EGHA 3G0BA 2OVBA 1G20E 3B9QA 3BQMB 3C39A 1NVXQ 3H2HA 4WNAA 3ZGXA 3O1IC 1USKA 2QAGC 2O2GA 4XQ9A 3Q7SA 5F1OA 1RAEA 4BKOA 3PJGA 3AGQA 4OI2A 5KVQA 2QWXA 1L1EA 4NDZA 3FPGA 3MK31 1ZH2A 4GMFA 1UM9B 2Q5HA 1J1UA 3THXB 1FB5A 2BFWA 4DA6A 5DSTA 2BFCA 3LVQE 3B13B 3SR0A 2REQA 3OH8A 4LXTA 1MXFA 2XRMA 3MAAC 4IBOA 4JLVA 3SC2A 2ODEA 4C08A 1INLA 1W2HA 2E4VA 2QRKA 1ZN7A 3A26A 1MLDA 2HV8A 2QMEA 1E2NA 1IDN1 3L05A 3U81A 3ZZMA 3J81k 1JSZA 5TGZA 1RPAA 3HGMA 1M34A 3FFTA 1QONA 5AKEA 3AT1A 1VI2A 3ZGLA 2P2ZA 1BGXT 2G04A 1HO3A 2PX8A 1J9ZA 3FZNA 3HVJA 5ALXA 2PD3A 5T57A 5LP6B 3KXIA 4NDNE 1Q21A 2IE0A 3K70B 1VXOA 2HHCA 1QIFA 3AEZA 4OG2A 4BAGA 2A92A 4ZZ1A 4H77A 4NTZA 4D0NA 5ESWA 3KFLA 4PFSA 1FZTA 2V7PA 2YXBA 2ZANA 1I0IA 2WV9A 2PY6A 3C1OA 3FSGA 3K9QO 3EVCA 3ONNA 4H6WA 2XQKA 2JLQA 3IEXA 3IUNA 3NYWA 3DDSA 4UNNA 4CLRB 4NKRA 5IFLA 4JT9A 1EIWA 5FX2A 4A36A 2VLBA 3MWJA 2HA6A 4H4CA 2YINC 4O4HA 5EGNA 3VOTA 2XHZA 1B6SA 1E8MA 3KYCB 4OQFA 2O2IA 3GCXA 3IIEA 2X58A 4IHJF 2FSVA 4JSTA 4Y2HA 2B4QA 1VIDA 3NHPA 2PKRA 1YL6A 2IBMA 4V0SA 1AKMA 1E2HA 1VSUA 3KALA 3FBTA 4YRRA 5K2OA 2GTIA 4LQ4A 1Q16A 5LUAA 3G1WA 3ZVKA 3I9MA 1JILA 3L6CA 4RD2A 1VSVA 3W4JA 1I4DD 2FPMA 3CUUA 3GAFA 2DPGA 3L6DA 3S1AB 4K9NA 4X64B 3QE4A 3FMVA 4DT1A 1OB5A 1L5GB 3S8EA 2XT6A 1HM5A 2RARA 5T6BA 3S29A 3WLSA 4CU5A 2VA8A 4PGMA 4QVGA 5DGCA 4ZYTA 5JADA 4L4UA 4D7AA 3R7WB 4PCAA 2NNWB 1HV8A 2P9FA 4JJIA 4GXNA 2ZI4A 3ICEA 4C7JA 3FM9A 2DQYA 4IM7A 5AR1A 1Q15A 4C3VA 4MHTA 3W6NA 4ZVKA 3W4KA 2YOGA 4KRGA 5AI6A 4Y6PA 3UO8B 1U5AA 4RANA 4U7JA 3D1LA 1WUIS 1SXIA 3NDRA 1YE5A 4X54A 1DJMA 2J3MA 3F9IA 3A1VA 2W6MA 1AKEA 5DF1A 1T5IA 4M9UA 3UJAA 4E31A 4ESHA 5IHPA 1MC4A 3LCCA 1TCCA 3F2VA 1Y3BE 4IKEA 5A3QA 4L9AA 2VDWA 4J1QA 1T6YA 2ZVQX 5TMDA 1NATA 3SJ7A 3ZDEA 4CTOA 2PRYA 4PYKA 4FJ1A 4HNGA 3SSNA 2TMGA 4GSKA 2VC2B 2D5AA 3FMGA 4XWAA 4DA7A 3DLIA 5AJZA 5HUQA 1M3SA 3CNQS 3II6X 4OUDB 5DYIA 5F3DA 4R1UA 4F46A 1CCWA 2RHJA 3QA9A 5LQKA 1O08A 4YCCA 1WPQA 1XO1A 1IK4A 1M2OA 4LSGA 5AKKA 3V00A 4B4OA 4MV7A 3A37A 2V3WA 4RGVA 2X0FA 5JT1A 4NI5A 3EIHA 3X2FA 1GQ2A 3KKKA 2XUOA 3OZIA 4D98A 3QUSA 2FP4A 3GLFB 1RI5A 1ZD1A 2OV1A 2QZPA 2FLKA 3Q3GE 5DN6A 1NONA 1ULHA 4DR4B 4XI9A 3BMNB 1GG5A 5BW6B 3AYZB 3CZ4A 5HE8A 2BHNA 1SURA 3B3FA 3G3EA 4PC7A 5EQTA 4BQNA 1M33A 5JTUA 1DC8A 1VHLA 1KMMA 1OTYA 1I0LA 3OJEA 1TM4E 4U63A 3W8FA 2I80A 1N5KA 4QJBA 4WOBA 1NYTA 3WIDA 4AB1A 4LHSA 1HQCA 3ZHZA 4TMTA 4EYOA 1U9CA 2ZK7A 2UUAB 1JJ7A 1VPEA 4ZCPA 2FFQA 3V1KA 5ISMA 2H4ZA 3F6SA 4Q9DA 2UV8A 3HKBB 4YCMA 1P73A 5BSMA 1RMYA 2CEAA 1KTVA 2OK7A 2OYCA 3VKVA 1OE0A 5KCZA 3CFYA 4P36A 1HDZA 3GMTA 3AY6A 3K6RA 1OV4A 2EFCB 2HHAA 3QVXA 5AVYA 1KXJA 1NOIA 2JFXA 3HKDB 1IH8A 1RLOA 3KC2A 5E3JA 3HVRA 1Q3TA 3ESAA 4E3WA 4ILEA 5LFAA 4YCJA 5L3SB 1E6UA 3TFOA 1TC2A 1DHRA 1P6XA 5NULA 4YJKA 1VYVA 2AW5A 3U31A 5KNBH 1IM8A 3ONFA 2GN9A 1JSXA 3CZAA 3OESA 4RUKA 4I55A 4JBHA 3FOFC 3WK8A 3F8SA 3MTQA 1B26A 1C9EA 2P2GA 1NSTA 2PKWA 5A62A 3O0DA 2JVJA 3OSZA 3DHEA 1ORVA 1W8IA 3UAOA 2IA5A 1Y1LA 3V55A 1FFXB 2QTGA 3ZVMA 3QBVA 4CIXA 1JPNA 2QM3A 2BPOA 3PRJA 4D9MA 2BM8A 2DPLA 2BJVA 5CLHA 3W5VA 4ND8B 3IGFA 1Y7TA 4X6YA 4LNAA 4ONEA 1T6BY 3LXMA 3N5KA 3ZWAA 3SX4A 1MABB 1SHKA 3E03A 4IIBA 5FIUA 3QVWA 2JCXA 1OFGA 1JZQA 5AQEA 4N0PA 2QTNA 1IHOA 2QYSA 1VJDA 5D51S 3P9RA 1IG3A 1PQUA 2VUTA 4ZEMA 1UC8A 3GG9A 3WLEA 1GN9A 1WBDA 2RCYA 2RHOA 1LF0A 2JEZA 2VDUE 2GCOA 3IOCA 3OZFA 1T2DA 3U4HA 2VRWA 3MIZA 1XZ8A 4M1MA 1XU9A 1Y6ZA 3QTTA 1IZ0A 3W05A 2VNKA 1ZGGA 2GR9A 4NZ9A 5IBPA 1HEYA 1SHJA 4LYFA 2F90A 2AS0A 4NH4A 4KMOA 3L9XA 3ZZ1A 5BSWA 1E7YA 1DEOA 2NWQA 3Q6IA 4V0ME 1L4HA 2MCFA 4AF8A 4YJHA 3C7TA 1P0QA 1TRHA 3NBKA 4WN3A 5JYDA 1W6RA 4V2IA 4D4MA 2D5CA 2FKNA 3C43A 4HQKA 1DGQA 4EZIA 3IOBA 1OT3A 3O4FA 3IUYA 3KFVA 2DLCX 4PZZA 1L5KA 4CF6A 5EE3A 4D97A 4BLTA 5EYPA 1GL9B 4DILA 1PNQA 1B00A 1H2EA 2J3IA 2X9GA 4I3HA 2YZ2A 3HB4X 4TKVB 2FOXA 1G4UR 1KBQA 4CKCA 2RGDA 2NQ2C 1RCUA 3B6MA 1JF8A 3EFBA 3EVFA 4DN6A 3JRXA 4HCJA 4D9FA 1E3MA 3DBLB 2PUAA 4F3RA 2YS7A 1B2RA 3G68A 2FE1A 3B2NA 3CKMA 1OC4A 4JAVC 5IBCA 2AC7A 4EARA 3QY9A 4KVFA 4JJAA 5J1TB 1PN3A 3K5IA 1HMPA 1ORRA 3O8OB 2CJWA 1CUYA 1WZNA 1X86B 2EJCA 2VYVA 2ZBGA 3INNA 3IKTA 5EKSA 1R5OA 3EZGA 1GZDA 3RV4A 3O82A 5ADHA 2JCSA 4Z0PA 3U44A 2H1LA 2P2LA 3AHIA 4ODIA 2QTHA 3AP1A 3WLRA 3QOXA 2QI9C 4P8RA 4F96A 1BCSB 2IQ5A 3HBJA 5FOSA 2G5GX 4KPFC 4G0UA 4PGAA 4Y3UA 1H0KA 1T3HA 3F5DA 3NTLA 3V4RA 5GPBA 3RO7A 4HAZA 1XTIA 4K3VA 3TJRA 1C9JA 1O1YA 2HA3A 1NNSA 3E2MA 4UPDA 3PVSA 2ZCVA 2ADFA 4BJHB 2D3TA 4W8HA 3E0XA 1C3XA 1PZHA 3AMVA 3IBSA 3CISA 2PGJA 3Q7RA 4H1VA 4LN1A 5DWQA 4CKBA 2ODPA 1YI1A 3WDMA 1IWPB 2PWYA 1Q44A 1KZ7B 4HFMA 5AICA 1AZWA 1FEZA 1D1TA 4BMCA 1W2WB 2OT3B 1K8QA 1QTIA 3JWGA 4CTJA 4ZYLA 1O89A 3MIIA 5E0KB 3ZG6A 4NYMQ 3DXYA 4OUKX 3VJLA 3EARA 3KXDA 1RADA 1U4SA 3WMEA 1X87A 1G3RA 5KOIA 2P67A 1UPUA 1W34A 1ZI6A 1VG9B 1OH8A 1SHTX 1ZK4A 2JGDA 2PGXA 4J2OA 1PR3A 5C4GB 1PJ3A 3NBYC 3A4YA 2PX2A 1OZGA 2D74A 2VPZA 2XUDA 1DB3A 3O3CA 1IB0A 3ZD9A 4H6VA 1B6GA 3IEIA 3TBKA 2X0NA 4FYXA 4E33A 2Y99A 3OZDA 5HKKD 2VJYA 4JD5A 2BSXA 4MRSA 1UZMA 4NU5A 2JZCA 2P40A 1UPTA 5AOAA 4ZAXA 3D3NA 3RSHA 1F7VA 3LQ4A 2O07A 1Q3KA 3N0XA 4MAMA 4L3WA 5IF9A 1FZQA 2WF7A 4C05A 1AN9A 3KO8A 5JJLA 2XQFA 3PL5A 2C2ZA 3LOUA 4Q15A 4XVQA 3UWMA 3IVRA 1M2WA 3F6BX 4ZI2A 2E37A 6AT1A 4OLAA 4CG3A 5L4LA 2ZR8A 4HB4A 2BEUA 4CUKA 3MB8A 3V6LA 2K6GA 3RYHA 4B79A 5DM60 2PUDA 4UEJA 1U94A 1A8SA 4JB3A 3VO2A 4BQSA 5G0VA 2QOEA 4L02A 1HDIA 1TA4A 4LKOA 3KPVA 2NU6A 1RHMA 5DH9A 3T3GA 1CRWG 2PQ0A 3KEGA 1U2SA 5A3JA 4Y9UA 2Z2ZA 4AXXA 1NV8A 1PD0A 2G0AA 1I33A 2GZ2A 4LWZA 3WNZA 1V7PC 3OWOA 4PLVA 4ZYUA 4DJDC 2JAOA 3W9BA 3MZ0A 2NZ2A 1RFLA 3MRVA 1QGUB 3EN0A 2PRJA 1DVRA 1XCJA 1QYWA 2VT7A 4TRMA 4ZQCB 1WHSA 1FCJA 5THQA 5IULC 4AY6A 1GZSA 2ACEA 2Q99A 4BV9A 5LMZA 2EFYA 2GBGA 3SI7A 5DM70 3AL0C 4DM4A 1TU3A 2XVMA 1TYAE 3HCNA 3WKAA 4B7XA 2WINI 2H4YA 2PT6A 2WSBA 3BK1A 3GCGA 4IVQA 4II2A 5JCOC 4EG1A 1PFQA 3EVTA 2IYRA 2RH4A 4MGIR 4QUBA 4CIBA 1C1DB 4KXVA 4B4DA 1KJIA 3HEMA 4FS3A 5AXAA 4H1WA 1C3VA 4AG6A 4XPZA 5AVSA 1M72A 3ZDCA 2J3JA 4RQAA 3ITKA 4MRPA 2IBSA 5DO9A 1KRXA 4KWIA 4GO1A 4B48A 1DAPA 1A2QA 1J33A 3TR6A 1L6IA 2W11A 4HHEA 3DNPA 3H2KA 1SK8A 1BEZA 1AH2A 2OAEA 3FLBA 5JCJA 4YAEA 3FCAA 4AY2A 1DZIA 3O95A 3P2MA 4TMZA 2I3AA 3WKCA 1V5WA 2I6UA 4N1AA 1Y1KE 2O4CA 2AOTA 3QMVA 5DLQC 2E4ZA 3SNKA 4OP1A 1SHZA 1Y8QA 1K3TA 1ZOIA 3TL3A 2MJLA 2WF9A 1V11B 4UHBA 3FYDA 3WB0A 3I30X 4YEDA 1J2EA 1EFHA 3CF4A 1EAYA 1NMEA 1KI3A 1P77A 1W47A 2GD0A 4BPBA 2JA2A 2O8DA 1R15A 3LF1A 1JJIA 5C8ZA 4EAAA 5JO9A 1N2HA 4TMVA 4EKDA 1ZMRA 4UD6A 1KVTA 4KN9S 2AOUA 1C4OA 4B6SA 2HSEA 3COSA 5H3HA 4U7FA 4ZZIA 3Q3EA 3IE2A 2GD2A 4BNFA 5CDGA 3MBIA 2WYOA 2DHCA 3N53A 1QVZA 3IHTA 3SM9A 3AYXB 3A4LA 2I7VA 2ZP1A 3RU2A 2GGSA 2IF2A 2IKQA 1RVV1 2A7QA 2UYOA 1JVBA 1NYRA 5TB5A 5TPZA 4FZJA 3QVTA 2OBMA 4M1YA 3ZI4A 4E4TA 2LBPA 2JAWA 4NONA 4ZOEA 3DJFA 3O7WA 3Q5GA 4EB3A 1QBKC 4LF6B 5B7NA 3GZ4A 1C30B 1BKYA 2DLNA 1SU4A 4E13A 4Q03A 1JP7A 1UZUA 1Z63A 1SUPA 2JLRA 1KSFX 2IXEA 3CNEA 3I9KA 2NO9A 3IPCA 2UVQA 3U4AA 3VR4H 1N34B 2V8OA 2PBRA 3L0OA 4A7PA 1MEEA 1WCIB 2E4WA 3L7CA 3WBFA 2FEAA 1GGJA 5GM1A 3JWHA 3WNQA 3E22B 5AESA 1VKRA 3COWA 3BE5A 4IVPA 4NLLA 3ZWPA 2GMWA 1KI6A 4AMBA 3WDLA 3CVJA 4U7HA 5K6TA 5F78A 4Z6KA 3U7FB 1UK6A 2QI9F 5CU7A 4FWTA 2I9KA 5EPEA 2ZJAA 1COZA 1JHMA 2BW0A 3OCYA 3W5UA 3VZPA 3UAGA 5ALSA 2VPWA 3HB7A 4BZPA 2BWJA 1IL0A 3UENA 2VBFA 3ENKA 1P7VA 3REQA 3SYTA 1D3AA 1YZUA 1DXHA 2J67A 2PJDA 3QWFA 4H7IA 1VC2A 2BKEA 3TAUA 1TAQA 2C2MA 1SVOA 5FBWB 3WFJA 5FTJA 2GCEA 1S3FA 4L51A 5K8CA 4LJ6A 4QEZA 3W5HA 3TD2A 2V4MA 4BB6A 4EMBA 2POQX 1V1RA 3D6UA 3MPUA 4I19A 3U0VA 2HF7A 2XD4A 2HI0A 4G5OA 4IXNA 4RFSB 3E4DA 5JI2E 3I5MA 4CG2A 1POWA 4FGJA 2IZ0A 3FUTA 4PLHA 2JC3A 4Q1BA 2JI4A 5FTNA 2QVZX 3MGGA 1IUPA 3RRZA 3NTVA 3H5LA 3L1KA 2GB4A 3E53A 4L2IA 3WGKA 1BWSA 4MWOA 4QUAA 2ZYHA 4NU8X 4O4IF 1Y6GA 4O63O 1P3DA 3CN7A 2XUGA 4M0KA 4KHZA 4EUEA 4JDUA 5AJUA 4UM9B 3V9AA 2VPTA 2A0FA 5AKLA 3QWHA 2DBRA 4G5RA 1RYFA 3FAZA 4CW7A 3V6MA 5DOVA 1VB5A 1SOWA 2C9OA 3O3OB 2J30A 1V7QA 5HQJA 3WE7A 4W9MC 4Q3BA 1H0SA 2RFLA 4KLZA 1DPFA 4RTRA 3K30A 1N5RA 1DFIA 2H7XA 2OCDA 4W1RA 1JH9A 3ICOA 1MPTA 3T7EA 2HCJB 3SZOA 4P22A 3LBYA 3PHBE 1JXOA 1UKAA 2JJ1A 1N25A 2B4AA 3MTIA 4GZ6A 4EFLA 1CEYA 4HNAA 1FDTA 5HGJA 5C1IA 4V1CA 2M1ZA 1WZ2A 2A2ZA 1B3RA 5HHTA 1Y5LA 1JHAA 3GRVA 3U40A 2PX0A 3K5WA 3I0MA 1CUBA 2PZKA 2ZAOA 3GJQA 2C1XA 3DAYA 4HLCA 4K6CA 4BFTA 1N92A 4GUDA 4UNIA 4ZVSA 2OTCA 2I22A 4QSHA 3TQHA 3PU6A 2WD7A 1ZRSA 4DUYB 1R66A 1XEXB 3A1SA 2H51A 4B3MB 4R0VA 4PNZA 2FPXA 4DV7B 3AXTA 5A4AA 3EIEA 2GVZC 5JE8A 3T3NA 4H1UA 4HRVA 3U7EB 1HTWA 3WYGA 3BTVA 4QDJA 3ZHUA 1T91A 4B31A 1WD5A 3AWDA 1PSDA 5IEJA 2VJPA 1G1MA 2AG8A 1FE8A 1NKSA 1UZAA 4RHEA 3K1ZA 3ZXXA 4CT0A 3LWDA 1V0JA 4J16A 4TX1A 4D6PA 2O8FA 1I2BA 1J8DA 3RJZA 3U7QB 2OHXA 3IP7A 3NHMA 3EGDB 2E82A 4PWYA 3HCWA 4KUGA 1Q0UA 5H0IA 3UXHA 2B30A 1EFTA 3O26A 1Z0SA 4XOIA 4DXHA 2M6RA 4PXSA 2AFHE 1A5BB 2VKQA 4EATA 3HYNA 2PK3A 2Q5CA 3LXXA 3M4NA 4IS2A 3EXFB 4N0EA 1Z75A 5E6SA 5A4FS 4FCVA 1OHHD 1P5RA 2IE8A 4W5NA 1E20A 2FFJA 3GFBA 1C8BA 3OCUA 4B1FA 5EJ4A 1JG6A 4R1PA 3L92A 5AXCA 5JLAA 4OIFA 4I46A 1FU8A 2DWQA 5J4HA 1AUOA 1H1LB 4UTZA 2AD1A 1MAHA 1T1IA 2CWDA 1F2VA 3EW7A 3JQGB 4KXMA 4M21A 4ZVPA 5HE9A 5LLSA 3PT5A 3QOWA 2PZ8A 4N5HX 3N2YA 2IV2X 1NNI1 1G6Q1 2IDJA 3VHLB 2NMVA 1SBHA 4U7WA 1LRJA 2O3TA 3I76A 4AS1A 2PZFA 3KQLA 3ZD6A 2NQ8A 2C2XA 1TOAA 3OZAA 4EHJA 2B4RO 5LQDA 1UFQA 1FNBA 1HQDA 3MJSA 4C4ZA 4B3HA 2OFXA 4BNTA 2OAQ1 2JBWA 2EF1A 3NBQA 4XX1A 2AG5A 1RM5A 4TKZA 1YKFA 5FUXA 3JSAA 4DIDA 2QNBA 2HMTA 4NL4H 5A05A 2XNSA 3GRPA 3KZMA 3N87A 1V6AA 5C81A 1HKHA 1FUIA 1Z34A 3AB7A 4HX9A 1ZJWA 1SXJC 3UUFA 3PP8A 3M8KA 3QKSA 4Y30A 4EB8A 5IBRA 1F6DA 1T3ZA 2XECA 3KOWA 3A6JA 2F67A 1U63A 2G7ZA 1K8YB 2ZSDA 1MDFA 3KAPA 3M83A 4OLHA 4V38A 3ZJUA 3M0EA 4Y2QA 4M9ZA 3OFSA 5TQ2A 4AMYA 1LWOA 5I48A 1C3LA 1R8XA 2Z1MA 3KSDO 2Z5GA 1XJ0A 3PNVA 4ZK6A 1JIQA 4MLZA 5A7GA 4F2WA 3I09A 5D5PA 5J5AA 2FWAA 5K8JB 3FCOA 1ML4A 1VE7A 1TYEB 2XZTA 1IQPA 1NC3A 3QF4B 5JPIA 1HSZA 1V16B 2QXTA 3C4JA 4J90A 3TL6A 5D3KA 3NDPA 3UMJA 1P61B 4AJ1A 1DV1A 3P5BA 2XGJA 2QUKA 3JQGA 4N5NA 5E1MA 2PQ2A 1E8DA 2GXAA 3KEFA 3F6EX 1KAMA 3RCBA 4IHAA 1A5AB 5DN9A 3AOGA 5CB4B 2XXBA 4Q7EA 1Z38A 1JEQB 3LYHA 1V96A 2ISCA 1N9GB 2PFGA 1RBMA 2OYRA 3TOXA 2AR0A 1AGPA 4BNGA 1NNLA 3ZC3A 1A88A 1VL2A 2GWHA 2JFQA 3W5AA 4GI3A 4WVFA 3SM3A 1HORA 4UCXA 5LZ7A 4JI6B 4BC0A 3MQ2A 4E2ZA 3UK0A 3IXQA 2H4WA 3BWVA 2VDPB 4PYMA 3VZSA 2Z6VA 4CF4A 1CSEE 5K45A 4FJ0A 2CLCX 5BNWA 4HEQA 1SVIA 5HIIA 4HN9A 1VLJA 1SM4A 4AD8A 3WOHA 2CMKA 2D1RA 4G0WA 1KDZA 1QYCA 2FW8A 4FB5A 1JU4A 2VF4X 2JFPA 1SA0A 3DPIA 1SQ0A 1FP1D 1DKQA 1OTHA 3KHKA 1QBGA 4Q4AB 4F4IA 4Y2GA 3T15A 5AFSA 2ZCUA 3HQ4O 1XOIA 5D3QA 2ZJYA 2ZYRA 1GLGA 1WZUA 1DMRA 2OP1A 5DWVA 4AAYA 2XD9A 4G24A 2VHYA 3QV2A 4Q3AA 8ATCA 3DS8A 4HDCA 4QE3A 4V0RA 2AXNA 1XEXA 1AIPA 5EZSA 5JD3A 1R8QA 3GNQA 2H52A 4WADA 2NU6B 3COYA 1TEHA 4H7DA 4FZ3A 1JW9B 5HEKA 3HXMA 3SOPA 5A4IS 5CB8A 4ROSA 4AKSA 1W0CA 3FUVA 3EOBI 1QG0A 1QTNA 4JLWA 1IWBB 4FI3C 4QHYA 1I30A 1R0ZA 1TF7A 2R66A 2XNJA 2JH3A 4MUHA 1RKBA 4F6LA 1XJQA 2EQBA 3BPSA 4XYGA 5CD9A 3ROFA 4IVRA 4NHOA 2ZSJA 3Q85A 1YZHA 2OFOA 3O8OA 1RAFA 4B4VA 2XB6A 3RLIA 1V48A 2A9QA 1O9HA 4K9PA 4TS1A 5GOZA 1VMKA 5I8PA 4Q9HA 1RRPA 1T9KA 4RYDA 1CR1A 2NX2A 1WTCA 1VMEA 1YBMA 4YMSA 3AR2A 4Q5IA 3UKJA 3VAAA 3L2OB 1Y5RA 3JATB 3UK7A 4ZWNA 4HVCA 5BP7A 5KINB 4ON9A 1E64A 3UOAB 4ECAA 4BGEA 1U0FA 1I5EA 2CVHA 3FW1A 1V71A 2WLSA 3IA2A 3GFGA 1T6NA 1VL8A 1WVIA 2QN8A 3K53A 3GFVA 4BX8A 4X66B 4RQBA 1AMOA 4EHKA 4JI2B 3O83A 5I5GA 2F3QA 1N2ZA 4BMNA 1I1OA 3ABIA 3QFRA 3ACDA 4DYHA 2XXAB 4IF4A 4F72A 3PI6A 1BFDA 1DBPA 2BRUC 1VJ1A 3NEJA 2NSHA 3QG1A 2C4KA 4OOEA 4D45A 3DOHA 4U2BA 2FXVA 4QO8A 4XTCS 3BICA 1RYMA 3RFTA 2C8JA 1CF2O 4GSYA 1FXUA 1LZKA 2A9OA 2RAPA 3R3YA 1LD3A 1QWSA 4PLPA 4D6YA 1FUYB 3DPSA 1B1AA 3KHUA 4GRAA 5B36A 3NBMA 4XLTA 4A8TA 1I32A 4YUAA 5CDYA 2YNMC 3HHPA 3V48A 4KRYA 2R6AA 3L8MA 4BWGA 5CXUA 8OHMA 3TLBA 4WN9A 5F7OA 1QFMA 1RPZA 2OXFA 2MSCB 3ESCA 3JPWA 4PBTA 5GP1A 5CCDA 16PKA 3GHHA 3FVTA 2RGXA 1L1FA 3WGTA 1QQBA 4JOSA 4B6OA 4FXOA 5G1OA 1N2CB 3D6HA 1AHNA 3LUBA 1DXYA 2VP2A 1SC4A 5FHQA 4ZDWA 2NADA 3MJCA 4DLYA 1MRZA 1XN1A 4NC9A 2I0FA 3MRTA 2Y1CA 5B5SA 1BU8A 1X7WA 3MS2A 3VNRA 1UKBA 4B81A 4DUPA 4HK4A 3PNPA 5JZMA 3CCCA 2DY1A 3B78A 3BXEA 3GARA 4R2MA 5JH7A 3JASA 1Z33A 1T25A 3RVDA 2IS1A 4M8SA 2A9JA 4MPDA 2E5WA 3G89A 5AM3A 3E9RA 1A82A 1I8TA 1GEGA 1MNQA 2ZRCA 3HLTA 1T26A 5BOVA 2W6ID 3RSFA 4ZOLB 4NRDA 4Y8VA 4IHJA 1P45A 4MVJG 1JIJA 4O02B 3WFIA 3WIVA 4BV2A 3AUYA 3R8FA 1L4EA 4K03A 1XCLA 4OHMA 2V7QD 3U80A 2QMHA 1VCOA 3QW2A 4PZAA 3TWOA 2GA9A 3MXTA 2YKGA 2L69A 1WSWA 3LCJA 2D5IA 2FDRA 5KNCD 1Z5VA 1N8SA 3NKLA 5E7IA 1EWRA 2Q4RA 1FTSA 2CSUA 2N46A 3R0VA 4QOSA 3KDAA 1DAIA 3EQZA 2AI1A 4RFVA 4XSVA 1CQIB 5L6LB 1CHDA 3OY7A 5JMPA 1VL5A 2FKAA 3QKUA 3ZWXA 3STTA 2HLDD 4DLBA 3MTEA 1QK5A 4U4AA 5DHRA 3R8XA 4QBHA 2P5TB 1RZ3A 3ONDA 1GPJA 3WKDA 3ZCQA 4FFOA 5EJIA 4AUNA 3IELA 1XYYA 3IUMA 4G1VA 1KQGA 4ZARA 3KQNA 3ZCUA 4FILA 1FMLA 1KP2A 3NEAA 3DLPX 3EIOA 4H7EA 2YJ4A 4U7TB 2HDWA 4GOJA 1M0EA 2YIDA 3CMMA 4QXPA 2UUOA 3WX0A 2W90A 1CJMA 2UUPA 1TA0A 2AMVA 2GK6A 2WKWA 1YHYA 2F9LA 2Q1TA 3GR6A 1NVMB 4WZAA 3R24A 4GZMA 4WGFA 1K0FA 1PHRA 1QYXA 3IQWA 1ZQ1A 3OTGA 4CDMA 5D6OA 4D8VA 2WTEA 1K3UB 1WPGA 2GOYA 3FSJX 1BCRA 4CM4A 3CW9A 1UT6A 5ALGA 4X94A 1Q20A 4B7UA 1THGA 3T99A 3G79A 4CKYA 5JJKA 5I51A 4RMHA 5HF5A 2E21A 2F00A 3F9CA 5F1PA 3TDMA 3U26A 5E1OA 4MP8A 3W1VA 1XXLA 1OREA 4EKNB 3QVUA 3RC9A 3HVUA 4WNAB 4CMAA 3PQ2A 2NZ8A 4BB5A 2JF0A 2PUHA 4HG2A 3NP7A 3RK4A 1MV5A 2PTGA 1U8YA 5ED0A 1LBQA 2VSYA 1ILWA 2QNRA 4JLPA 4OP3A 2I3DA 2YFKA 1W9MA 2AG6A 3AESB 4R8RA 4F3NA 1DL5A 1KK3A 3HO1A 4C5BA 1IBMB 1BE0A 1ATIA 2V6JA 2ZJ6A 3ANYB 4MINA 3VTFA 1ORTA 4CT5A 4Z3KA 2P4HX 1IXYA 2R5WA 3DL7A 3RC7A 3WGQA 2E5LB 1GSOA 1QIKA 1B0PA 1RPTA 4DJ5X 3LECA 2QAGB 4KIWA 3A9TA 3FDJA 3CVYA 2CV2A 2ID7A 1XPUA 2WHRA 4F4DA 4L9RA 1FP6A 4MVJI 3OMXA 3SZ3A 1E4YA 1X1SA 2AQ8A 3D2CA 1U02A 3R7WA 3DT8A 2I3GA 1G6KA 5DEIA 3SR4A 5DCWA 5J4YA 5L45A 2F1KA 1FJXA 2H0RA 2H1FA 2H4XA 1TMOA 2Z56A 5DNUA 2QJOA 1ZBDA 1ORDA 3DWGA 2OZLA 5BYBA 1YBHA 3N6VA 4I6JA 3UMRA 3IE0A 3T4XA 1Q2UA 1CUEA 4AMUA 1K89A 2RGCA 1VZ2A 4KB5A 2IRWA 1WB4A 4X93A 3TKLA 5EZ5A 3UMCA 4KMMA 1UQTA 4CL2A 3DHWC 3LDGA 2CT8A 4KFCA 4YMUA 1S3SA 2DLDA 4REMA 1K5DA 3VSEA 1VYHA 1QMPA 1XZPA 1CG6A 4KQMA 4RIGA 3UJ8A 3KQYA 1KJ8A 1YZVA 3JVDA 1M1NA 5BSTA 3UHPA 1QUFA 2C96A 4CLEA 5KTPA 1XFAA 2P5YA 1ELOA 2WJ4A 5E2AA 2V7VA 3MD0A 1B0ZA 4PV7A 1JWBB 1Y6JA 3UC9A 3RIMA 2YWRA 2DFTA 2HO5A 3OT1A 3VVBA 4DV5B 1Y6QA 4EMUA 3ZE8A 2HX1A 1NNUA 1SD1A 2CHGA 4GICA 1GFSA 1IRXA 2FPPB 4HVTA 3GZNA 4S1NA 2PJRA 4FNGA 4MS3B 1HF3A 1A7KA 4ZCQA 1QRUA 3TW8A 3NOOA 1G0NA 4KDEA 1KQFA 1TM5E 2DECA 3E2PA 4L73A 1F8FA 1WDTA 4MAFA 4BAUA 4U9UA 1NVGA 4AJNA 2WM2A 1BW9B 4PGHA 2R8EA 2P0EA 2XGMA 3H4VA 3CRW1 3OQBA 5JCXA 4W8OA 1BTOA 1ICIA 1XZFA 3QELB 2SHKA 4BE9A 1T4MA 5K09A 3WGYA 3AEUA 1FVFA 2C9BA 2NVWA 3A6EA 4V39A 5FOQA 1BC5A 2XBUA 2ATIA 4UVDA 2X1HA 2AXPA 3IUBA 1BRMA 4PAQA 2ZRDA 5GQSA 5K8LA 1U8AA 1MFZA 2I5PO 4P54A 2D8MA 4XYBA 3QWIA 5E9JA 1YTLA 1Z0IA 1PHPA 4CKEB 5FWAA 4KQHA 5EE9A 3QOFA 1WMDA 3TIVA 1IVNA 1GHTA 2TMKA 1IBRA 2CXTA 3MCWA 4HDNB 4MUEA 4XRGA 3PR3A 1B8PA 2CD9A 4ARBA 2UYCA 2RMKA 1L3BA 3E1SA 4X7RA 1SUEA 4ND8A 1KZ1A 2FPGB 4PO1A 1RQRA 4XDHA 2WZDA 2GASA 4C89A 1AKNA 2HK6A 3DTVB 5A71A 5IARA 4URXR 1TKBA 1DQZA 4ZVQA 4EJFA 4XIIA 2IPMA 5IEBA 4I4IA 4IWNA 1Q22A 1NI5A 2NO6A 1S2LA 3KKQA 4ZI7F 3LC2O 4KQWA 4YJ2F 1SZPA 3I4LA 3PXAA 4DIKA 1P0IA 1AUXA 3MUFA 2FHPA 2QIOA 3T1VA 4W5JA 3FWYA 5AW2A 1QAMA 1JJVA 3U9TA 2E4UA 2QIPA 3DHNA 1M2VA 4WXYB 1V4BA 1GTMA 1EM8A 3Q72A 1RPJA 2WOOA 3DQQA 2Q5FA 5LCXA 4LYYA 3V4VB 4LZOA 3DE4X 5FDFA 2C5SA 2CYCA 2QTRA 1LLFA 4R3NA 1HNNA 2XUFA 1A4UA 4NOMA 3VTAA 1E0AA 2KM1A 2Z2KA 5KC8A 3ETJA 2O8FB 1CNFA 1IWOA 1DLJA 3DR3A 4TTJA 2EFHB 1D0SA 4QOHA 1O03A 4HNTA 3EXHC 4LOJA 2R2AA 1LA2A 3ZCSA 2C58A 5JUWA 2P6RA 3B3JA 1H8HD 4Q9KA 4ZT5A 3SBEA 2BFBB 3PGXA 4AY4A 1QGOA 1UKZA 3MWLA 4EG6A 1ZFNA 3SHQA 1PFGA 1Z0FA 4UVHA 4RTKA 2EW1A 2WT9A 5ALFA 3NATA 3RVOA 3WYEA 5IH7A 4JXKA 4MV3A 1CS0B 3PF8A 1F9AA 4X8HA 3A4MA 4ZYXA 2PV7A 5H7XA 1U2TA 2P3SA 4JLSA 4Q4JB 1XAJA 1MIOB 1I13A 2Z30A 5EKUA 2HRCA 1BN7A 1CC1S 1PT8A 3CRZA 5CVDA 2H4JA 1QIMA 2ZJ8A 5HKLA 3A28A 5GTDA 4NV0A 2R4UA 4H0CA 1AUPA 2VJMB 3LQRA 1JEDA 1G19A 1NTRA 1ZU4A 4FD2A 4S1OA 5TEWA 4X62B 2NYUA 3EZ7A 1NMYA 1XQYA 3T0FA 3GJ6A 4FDMA 4KXNA 5CLIA 4NE9A 5LKAA 4HJXA 3CZQA 4BLOA 3WAKA 1X1BA 1KYXA 3PTLA 4GI1A 3ELYA 4HMQA 2VVTA 2HH9A 4IEFB 4UHHA 1R50A 3AHEA 4I0WB 3G2QA 4XUCA 5FPYA 3GNTA 2GSDA 4C2AA 4LF5B 1YR7A 2H0QA 1R4NB 3DVLA 3H11B 3WRYC 1N7HA 5DDIP 4ENRA 3QH4A 2QD2A 3P0HA 4Q9JA 2RKWA 1PW7A 3VJRA 4PPYA 2W37A 1Z68A 3JWEA 2JIPA 3SOZA 1ADCA 3T1YB 3EB9A 1JFSA 3RAEC 4S05A 4TMWA 2PH1A 3BWCA 3KOMA 4BKPA 1JNYA 3DGFC 1T9ZA 2MINB 2QSJA 3PRHA 4B8YA 5JNLA 2V4ZA 3AW9A 2FPRA 2OD2A 2P9BA 3WKEA 1PVVA 4RLHA 4X20B 1XCPA 2E7ZA 4BO8A 1Y1TA 3C41J 3T0GA 5D2CA 4GPD1 1J0AA 5K03A 2HL6A 3HDHA 2ASEA 4NENB 3V2UA 1E3JA 2QYTA 4ZOCA 1C30A 4CZ2A 3QXJA 3FOEC 3MHPA 2QG6A 1L8OA 3TSOA 4PVCA 1TKAA 4D9KA 1U98A 1OBFO 1U8UA 4YRTA 2ZI9A 2OC9A 1EDZA 3C3WA 4ER5A 1T1GA 4ESVA 4JLOA 3V4ZA 4E5DA 1P1JA 3A0RB 1KOLA 5AMXA 2BMJA 2C57A 4Z53A 4I7EA 5KMGB 2B83A 2JIZD 2ZUVA 5DTRA 1UAYA 1JDJA 5HTOA 2NPOA 4FFBA 4QNNA 2PEZA 4I50B 5JSZB 4CKEA 3TVTA 1SR8A 4E14A 5C7LO 4COOA 1GNTA 4Z4HA 5HOEA 4IJKA 4IKPA 2B78A 3G6KA 4CKWB 4KVGA 3NTXA 3K4HA 4J6EA 1PNRA 3ZZ0A 4E5PA 3W3AH 1JJBA 2PZEA 3PUZA 5FOVA 2LP4Y 3C5HA 5F73A 2ID8A 4FHEA 3VVMA 4WPGA 4Z2AA 5AW1A 1G6OA 3TKAA 4RNDB 3SDSA 3VR1A 1M8KA 3DBVO 4TV9B 3ACBA 1KGSA 2FRDC 2BFFA 2UZIR 1NV9A 1JWAB 4IDAA 4PS0A 2GEJA 4B3FX 5HXAA 3THXA 4DANA 3AR8A 4B7ZA 3EA0A 4FFNA 2PNFA 1AQYA 4IGFA 3C3CA 1N32B 1B76A 2FX2A 3EHEA 1VQ1A 5CAEB 3QFTA 4MR9B 1JUDA 4BGIA 1OXTA 2G83A 4GLJA 2W98A 2J4DA 4LDZA 4CFYA 5HIKA 1YFJA 4K8RB 1QKJA 3IO5A 1XDSA 4TMYA 1JPUA 1XZMA 1DEAA 2Y71A 1DELA 3DEIA 4S0XA 4U9HS 2I1WA 4WK2B 4BNVA 2J7PA 3EUEA 2VWHA 3GUUA 5DNVA 3D54D 4BO0A 4DADA 5K6AA 2IX3A 1NJ1A 1Q7CA 2GUGA 4XYEA 5JRZA 2AHRA 3AB8A 3NAMA 3CZRA 3T7TA 1JXMA 5E3HA 5K05A 3D6VA 3O4VA 3W5DA 4CQMA 4MCAA 1GKKA 2YXPX 4J0EA 2PL3A 4Q47A 3L0DA 2OD9A 4OQDA 1FS4A 1R8YA 3FOWA 3ME5A 4JKIA 3ND6A 5KVCA 1XPJA 4J7CA 1R64A 1Z0ZA 1GR0A 5KTKA 3E5HA 1W30A 2C4MA 3JQFC 4G5QA 5LD2C 1X3LA 5JQGA 2HDNB 2QN6A 4QQNA 4Q3NA 4XYMA 5FYQA 5ICSA 3EQ2A 5J2UA 1T36B 1QFYA 1J8FA 2B6NA 2J32A 4G4GA 4B76A 4BP8A 4FT2A 2I6FA 4WXHA 1R1DA 4R3WA 3PX2A 1E8NA 4X1IB 3ZZNA 1XGKA 2JLWA 3IEMA 5EPUA 3W79A 3ZE9A 2TSYB 3DO6A 3H4IA 4F93B 1UJ4A 1ONBA 4J16C 3ICCA 5EG5A 5JASA 4OCZA 2R97A 3LTNC 5B2FA 3RWBA 5CVJA 2WA1A 1XTTA 3TD6A 4ML3A 2JB9A 4B40A 1TAHA 4M4SA 4LUCA 2F4NA 3QELA 2RD2A 2LCQA 2X5OA 1YU9A 2EYQA 1ADGA 1QH8B 1XQWA 2FSUA 2CGEA 1WDLA 3L77A 3QE0A 3STUA 4D8UA 1GFIA 3C6ZA 3O8NA 3HYCA 5K3FA 3L7AA 3H65A 1CY7A 4BLPA 2QN9A 4LDQA 1HE3A 3VYSB 4AS2A 3CEAA 4LK2A 2Q7DA 3W5SA 1QPGA 4L4YA 2PMDA 3ZWWA 4HT3B 2B8TA 1GA1A 2C0QA 5A6SA 1EG7A 1F3LA 4HZIA 1QCZA 4R31A 1XWWA 2J3DA 4BQRA 2R6R1 3WFZA 4TTPA 4F11A 2WYIA 4ZICA 4LHYA 4TPKA 4F3KA 5H9VA 2G1JA 1R9MA 4RJ2A 1IU9A 4QSMA 3STHA 1DG1G 4W82A 1VGQA 4CM5A 1EE9A 4NOJA 2O0HA 5HG0A 3JPYA 3V1UA 2QMQA 2YZMA 3PIDA 1LC0A 3H9JA 4K0RA 4YDHB 3AVOA 2SCUB 4H7FA 4WUTA 1Q7RA 4RZUA 3ROQA 2JLUA 1FSPA 1DTWA 2ZYAA 5IVIA 1OC2A 2FG6C 1UH5A 2J87A 2QPTA 4R16A 2PXAA 3CLRC 2YZGA 3ED5A 3T1HB 2A57A 2X2FA 4WNIA 4QOEA 4LDPA 4D9IA 2R6FA 1QYRA 1ZSYA 1CQPA 4HQOA 4HLQB 5TDHA 4PN7A 2D54A 2XE8A 2PCJA 4US2R 3EOZA 4YAUA 1RT9A 2IXGA 4G9BA 3KVVA 3M7IA 2A5DA 2VTDA 3DBLA 4K5QA 1EDEA 1XLUA 5AYVA 4AX8A 3GROA 1GL3A 1SVWA 3DKPA 1MENA 3WJ7A 2VK8A 3LT0A 1OYOA 1CQJA 5BXQC 3RJ5A 4H2DA 2LV8A 2XT9A 1QNFA 4LV6A 2OB2A 1NUTA 1XQXA 3MA0A 4HTFA 2DPHA 4CM3A 5KVAA 1S01A 4J4BA 2JFGA 3OIUA 4F8EA 3R3JA 3M34A 4FLFA 2H7YA 3IB6A 4DMFA 1W36C 3D2BA 1DIBA 2ADMA 1QH8A 1V26A 2ECOA 1UOOA 3E3MA 3FYUA 1HOTA 3RW9A 4ZK2A 2XMSA 2DAPA 2ZR9A 5GZ1A 5ITVA 3TINA 1TUIA 1NXPA 4H0NA 2B34A 2FZGA 3R5KA 1NQAO 5DULA 3H0EA 3URKA 3L02A 4UNRA 2EZUA 3GDGA 2B7CA 2HA4A 3L8FA 3WMRA 2X19A 3M82A 5TQJA 3Q10A 4IFEA 4RCZA 1ZKDA 4PYIA 3RHFA 3SX0A 1FNDA 4UMEA 3RV3A 3IVCA 3ODGA 2QZSA 4E5YA 1FFBA 1CY8A 4W63A 1N6PA 1Z83A 2QP3A 3TD9A 3QI7A 5A2GA 1E6CA 2PZMA 3UUGA 2OLEA 1F7UA 4EOGA 1KMQA 1U2DA 4KO3S 1PYGA 4RTSA 1CP2A 1TZKA 1VTKA 3IAM1 3PQ6A 4AMVA 1LU9A 4Y2PA 4IVNA 5CXQA 1H94A 2HU8A 4F4CA 1FYWA 3IV9A 1W4ZA 1AVTA 5GVSA 1FF9A 2JDID 2R1VB 3KWLA 1UBNA 3JTMA 4Z9BA 3UATA 1V4VA 1VSTA 3CIOA 4QATA 2RHMA 4EI9A 2O5RA 1GAJA 1H66A 1XVIA 2V7QA 4FGKA 4QTXA 1L4UA 2XKKA 4LYHA 4D57A 1Y6FA 3P0EA 5BV8A 3FNIA 1GAQA 2G1UA 4KCGA 2X1VA 1PJQA 4IQ8A 3KJFA 2HJVA 2WJPA 3BDIA 4IQ4A 4W9NC 5TVKA 4C78A 4IJ5A 1FFSA 3PVCA 2W58A 2B0CA 3CSDA 3PLNA 5IJ0B 2MSEB 3WYFA 1MX5A 3HBMA 1GLVA 4MWEA 5CDFA 4EJSB 3MMNA 1R6AA 1SUBA 3OQMA 3DVSX 2YWEA 4BO6A 4KPEC 1EUDA 3P9SA 5JWRA 4YJ2A 2BMAA 4W4TA 3K96A 3DG9A 3AONB 3A4TA 3F0TA 4EO7A 1L7EA 1BS9A 2R86A 2X9LA 2XYRA 4FIDA 2R7AA 4FFVA 4N7RA 2IXDA 5EWLA 3S44A 4F0JA 1XNRB 2I62A 2D0IA 2ZI6A 3P2EA 5DCUA 5J63A 2P79A 1T4CA 2O5EA 1ZUNB 1E61A 2BHLA 3GMSA 4RKQA 1NRJB 1VPDA 5CBPA 2HR1A 1UAGA 5KB3A 4RZXA 2V0NA 3WWOA 3DGEC 1U6KA 4BVGA 5BUZA 2J0VA 4EL5A 4ZGWA 1V8DA 1Y8ZA 4GS5A 3F6RA 1M1YE 3UJ3X 3UHJA 4M55A 5K0SA 3S99A 1JSCA 1CZRA 1VLHA 4EZBA 4F5YA 2GEUA 1JHZA 3SYKA 5FFFA 4AJHA 1S8FA 1MT3A 3PQFA 3TVYA 3PZBA 2EKDA 221PA 4CQLA 1XL1A 2HIMA 4PAOA 2HIAA 2IK8A 4KJXA 3IIMA 1GLNA 2VT6A 2RG7A 2H16A 4MJ3A 2REXB 1QPZA 1NXWA 1GDDA 5HJ7A 3EXG2 4B73A 1W36B 2IVFA 2AOTB 1UANA 1OBVA 4OXKA 4H15A 4WEOA 5EVJA 5C18A 4ZT3A 3LUPA 2C4TA 3WK7A 1U0EA 4LOIA 1ZK2A 2A59A 3TQRA 3EEQA 3VPBA 2J9ZB 4I8XA 4BWYA 1CY2A 3TUJC 2GZDA 4NATA 2IH2A 3WMWA 1WSDA 2EZTA 3PFNA 3ZIAA 1YDFA 3CS3A 2CN1A 2F59A 2HQBA 5EJ9A 3O91A 1DARA 2Q6KA 4WZBB 4YLEA 3RDPA 3M49A 4UHJA 1NUQA 1ZNWA 2CBZA 1JQDA 3CRVA 3Q6NA 3L8DA 4TLAA 5EP4A 2AJBA 4NJEB 5BR1A 2ISQA 4AN4A 4ARZB 2ZSEA 3CO0S 3JCZA 3FSGD 4RSMA 4HEA1 2MSWA 3TJMA 3ZTTA 3I1FA 1M0TA 3UWSA 3EXEA 3W8EA 3JQPA 4D0LB 4DCOA 1G55A 5EJ7A 1TYZA 3MYYA 2OQIA 4IG4A 4U5XA 3B8HA 2XB2A 5F2EA 1I4LD 4DIOA 2Y4OA 1XZHA 3N07A 1N1DA 4DUGD 4L0DA 2CXXA 1DI0A 1VE5A 1H1TA 3UBTA 3U7JA 4MGHA 2R5NA 5F3RA 2QW8A 1NR7A 2MHCA 4P92A 1YIOA 4P4SA 5B37A 2X6QA 1E0SA 2V98A 1G291 4OGGA 3DEZA 1H2AS 2YWJA 5CFOA 1IY9A 3AFMA 5TF0A 4R1NA 1RM0A 3S2YA 4XSHA 4YAGA 3D1JA 4Q4HB 4E4YA 4ZN6A 1O95A 2QN3A 4LY0A 3R40A 3CC8A 4QGGA 4ZANA 3V8NA 4CYMA 2Z6QA 3GBSA 4X24A 1A9ZA 5BV2P 4CCAA 4BFSA 3ZI0A 2JD2A 3N2KA 5AVTA 1CQZA 1U7TA 1J39A 2C8VA 2L18A 5LZ8A 1WBBA 4CQMB 3GLFA 2G6BA 1DG3A 1EJ2A 2HXYA 3BAFA 4JC0A 2HKIA 5DI3B 3VSBA 3PNOA 3MFYA 3P19A 5LR6A 1QK3A 4WXEA 3AY0A 4CF5A 2VATA 5ARDA 2V3CC 1JFVA 1LVUA 3VR2A 4UU7A 3K8YA 1V1MA 2Z3VA 3VC7A 4GPBA 4QBTA 4LZLA 4CE6A 1IN4A 3H2JA 2V45A 2NV0A 3VMMA 3U4QB 1Y4ZA 2H8KA 3T41A 4LWOA 1DBVO 1U28C 3L8HA 3MT7A 3WRWA 1CDOA 1YQQA 4QQ8A 3ZGOA 3DOUA 1C5KA 1T4GA 4G09A 2VQ6A 4NAVA 4J7AA 4Z5XA 4KO8A 1X1QA 2FUCA 2PKQP 4H7HA 2PQ6A 4XXHA 4A5OA 2HV9A 1LX6A 5ER6A 4YRIA 5JCOA 1SA0B 1VMIA 4DMRA 4EWLA 3JWIA 4ARCA 4LRTB 2FCRA 2ATXA 2IPOA 4LFBB 2IZOA 2XE4A 4MUXA 3MQ4A 1AS0A 2WIFA 1ZXBA 2Y1EA 3GT0A 4TRJA 2J6IA 5FWYB 2XVZA 4JBXA 2C82A 4EJ0A 5FV4A 2P6OA 2C9YA 4UUMA 3QOYA 3RHTA 4BCCA 2C2BA 4K9RA 5JV5A 5JS6A 4B9EA 1MX3A 4J49A 2HNBA 5KTOA 2FWMX 4M6WA 3BCUA 2GJSA 5LQCA 2VHJA 2NUTB 1EM8B 3DLCA 3IAHA 5JATA 3EVGA 4ZXPA 2Q46A 1YRAA 2I7CA 1U9IA 3H5IA 4GPIB 1QK4A 1NGSA 1W44A 1HK7A 3LGAA 2WU0A 1TD1A 3KK0A 3F97A 4D99A 4DYVA 1K7XB 3N70A 2WICA 2I2AA 3U62A 4BNJA 2FEPA 1BO6A 3CX3A 1HZZA 4JR0A 4KK3A 4HF7A 3L0BA 1OUMA 2EKPA 5GONB 1WOYA 4BQEA 3RTCA 1C3OB 2OCAA 2WT4A 3PI7A 1PBTA 1XZLA 2BFEA 3G9UA 1N6LA 3MN1A 4AO8A 3F67A 4AURA 2IEZA 4L27A 3BXZA 2Q3EA 1AQJA 4Y1RB 1A50B 2BFMA 3A6PC 2J0UA 2QRVB 3VKGA 4GX0A 1PKXA 2WM9B 4G8DA 3H5OA 1OROA 3R0JA 2D5LA 2R96A 4US1R 1ZHOA 3K1AA 1P9OA 4NU0A 5BT8A 4BRZA 4PIMA 2FRXA 4IWXA 3DQPA 2POCA 2MSKA 3F7OA 3K9WA 5D01A 1KAEA 1D8TA 2FZCA 1M2FA 3AERB 3O47A 3UAVA 2UVPB 2Q5EA 1NT2A 2Z2IA 1HMYA 1IDOA 2PX4A 1HT1E 3NBUA 3NAQA 4DYDA 5JWOA 3I37X 4GG1A 2DHEA 2LE0A 5A0VA 3E5NA 1T8WA 1HETA 2HM7A 4EFMA 2FN7A 4B6FA 1Z2EA 4OGFA 5B58T 5EIAA 3KLMX 1KR5A 4DDVA 5E6UA 3OZVA 1IEVA 1X80A 1I36A 2BR3A 1HDEA 5EERA 4NESA 3B6JA 2G25A 2OY0A 2Q1WA 3RYFB 1WR8A 4DQKA 4Z49A 2H00A 2H9AA 5CGQB 3U4MA 3GY0A 4NXNB 3GLVA 3WHPA 1X9HA 4N7MA 3T3HA 3BILA 3C4QA 3DD5A 2BI4A 6YASA 3LCRA 4X3CA 5GINE 1WKVA 4YASA 3PHJA 3E9CA 4DIBA 4GRDA 1RKVA 1DWOA 2WWHA 2WSYB 5U1PA 3ZK7A 3TLEA 2OGUA 4KUEA 3WGJA 3SEZA 1YR2A 4MLPA 5EJ6A 4JGIA 2C3OA 3EUWA 1TMYA 3HM9A 1P2VA 5FEMA 2BKLA 2VJBA 1RP1A 3AZQA 3C3XA 4FSDA 5DXAA 4KHPB 3TRFA 3FIJA 2OKCA 1V7CA 1ZRMA 2RH5A 3OQPA 4ZVTA 1PFKA 1R7RA 3GWZA 1XFDA 4P08A 4EABA 3K15A 4TTTS 2BMVA 3LZCA 5DLDA 5FPPA 3RU3A 1EFPB 3SDBA 4BO4A 3HDTA 4PHGA 3ZHVA 2HGSA 1QFJA 1CE8A 1E9SA 1NBMA 3CMCO 5G40A 1GPUA 3H5RA 4EA8A 2ZZNA 3V5NA 1Q0ZA 2LXNA 2HCTA 3STWA 3TLKA 3EZFA 4YAFA 4DWVA 4DSNA 4J9UE 3EZ6A 2HRBA 3I12A 2PH5A 2NUPB 3V7YA 4R7ZA 4EVRA 2FXIA 1O6ZA 1YF3A 1HNXB 4X60A 1UT8A 1IEWA 1ENOA 3HBLA 2Y4NA 2MINA 4HN2A 1MQ8B 4FWIB 1Z56C 3BJEA 4L16A 1T2CA 3TZ6A 1RPNA 4D4HA 2NU7B 1PR5A 3TKYA 1KFEB 2XWPA 5JZBA 5JQGB 3LBIA 1RHRA 1U5BB 1RHUA 1X74A 3ZBUA 3KSBC 4G56A 3K1AB 1YCFA 3GH1A 3IIKA 5CCEA 5J2UF 4G1UC 1POXA 3IDOA 3CSUA 3R6DA 3DL0A 3TS1A 1LJLA 4OMFG 3B48A 1F4LA 1GAEO 1RR6A 3ORFA 5AH0A 5FR2A 4YQYA 4DMUB 1P31A 2R84A 4IJVA 1ZM2A 2QRLA 4XAQA 4GUAA 2GAAA 4KR3A 5H4GA 4FDVA 5CD1A 2IGTA 4G86A 4I2VA 4JP3A 3ZU6A 1YFKA 3LWNA 3RC2A 3JAKA 3B1VA 2EBUA 5M7EA 1X7ZB 1Z5PA 3ZJ4A 4HNAB 4BS9A 3GAMA 3IP8A 2NW6A 4KBYA 4LHWA 2C2HA 3HEBA 4Q24A 1PWEA 1G1AA 4RTPA 4TKUA 2X9VA 2I4IA 4WXMA 1XALA 5KPDA 4F3TA 2X4LA 1J7KA 1PG0A 2JH9A 2PGOA 3JTEA 4FBLA 4OQNA 1LV7A 1HGXA 4E7PA 1WX1A 4DLXA 4M6WB 3ZYZA 2PSDA 2L19A 3Q3VA 1RLJA 2R6DA 2OGWA 4ZP1A 1K75A 5G53C 4CMKA 4ZVMA 3D7SA 1MB9A 3EA4A 4EA6A 2CHFA 3AGPA 3FMIA 3P4XA 1T9HA 3D7KA 4HAVA 3IRUA 1W1WA 1JZSA 4XD7A 2A5YB 3PXBA 5G4KB 1NQ5A 2NTYC 1VRVA 2PHZA 1DDIA 3CLUC 2CUKA 2R6HA 2Q1SA 2QL5A 1CJKC 1YJBA 2FPUA 2VAMA 3D0OA 4ER0A 3VKUA 2YRXA 4DXAA 5KYYB 5HF6A 3O2NA 721PA 1HE2A 3BUSA 4QU8A 3O9VA 5EOVA 1CJTC 1LS1A 4GLLA 3L43A 3O1JC 4GD3Q 2QTBA 4P0QB 3IUJA 2QORA 5EE0A 4CM7A 4YRNA 4KV7A 4DLRA 1CZKA 2YWXA 1UKVY 2ODNA 1GNSA 4O2RA 5H82A 1F8XA 2Y27A 3RBAA 3GLHA 3OP4A 5I4CA 4RH1A 2NO5A 2ZRAA 1L7XA 3KCNA 4M7RA 5ECGC 1QDLB 3CBQA 4WKPA 3KU1A 1C0LA 5M04A 5AI0A 2O2JA 3B82A 3R1IA 5DT2A 1JFTA 1A3CA 5CNKA 2X9QA 2Y1XA 3R9WA 3Q7EA 2PCLA 1U1EA 1HDCA 3ZWNA 3IS3A 2IP4A 4JKYA 3OT1B 3PR2B 3ET4A 5B3JC 4FFMA 3VR0A 3UEOA 5JNUA 1RAAA 1MBZA 2VDRB 4KIJA 5ULLA 1KIMA 3C6XA 2HZ7A 2XYGA 2DT8A 4R83A 4ZDJA 3B5EA 4J0GA 5KYWB 3ANXA 3AHCA 3D0RA 2QR5A 2R1ZA 4KXWA 2ONZA 4IDFA 5LWHA 1IJBA 3ABOB 3OQIB 5DU2A 1ZHHA 1OAAA 1F4VA 3GJ0A 4KQ2A 3KJXA 5SZJA 1WIWA 1GTSA 1CF9A 4X20A 1PGJA 2HNKA 1F5SA 1Z6YA 5JS7A 2JHAA 1NQUA 2R1VA 3ODPA 5FD8A 4AY5A 4P7KA 4QT0A 2X3UA 3U5TA 3RIEA 1EP1B 1XMSA 3GEPA 4DJTA 3SZLA 1KDYA 4TZKA 3GJXC 1SKBA 3Q9LA 4WOJA 2GM9A 1S1MA 1E1NA 421PA 1ZQ9A 2UYQA 4D8YA 1EG2A 3VH4A 1RTKA 1J22A 3M3DA 3H11A 1D4ZA 3HVIA 4PC1A 3WBBA 5IXYA 2CJPA 1ZX1A 5ALEA 2NZYA 3B7GA 5CIWA 5FCDA 5B4VA 1KAOA 1YDWA 4JLKA 2B9VA 4R7GA 4KXYA 1A4RA 4S1PA 1DOAA 2R6CA 3L0CA 2FGJA 3C15C 3CXRA 4AZ0B 2BMEA 4UAUA 2AOUB 1SC6A 2WHPB 3ZIUA 4CN9A 1ZDMA 4FONA 4DIFA 4UVIA 3BGDA 5EI5A 2QX4A 2XCQA 3QQPA 1WWKA 2V65A 2WTNA 2XJ4A 1JT9A 2EDCA 3D7RA 5CCBA 4ETMA 4F92B 2CJFA 4HR7A 1CIPA 5CNJA 5HKOA 4Y18A 3ZI7A 4FEEA 1RWBA 1AQUA 1Z8DA 2ZWVA 4C6TA 1KJYA 3PFCA 4JWKA 4OATA 2NO0A 2ZIEA 1T6XA 3FVQA 1JLLA 3R6WA 1YZLA 3FBGA 1GUAA 1TGYA 3E7PA 4HFNA 5LQAA 3FPJA 4HWKA 3L7KA 3OT5A 4OXRA 4R2IA 5JS2A 1XJWA 4YMGA 2BH2A 1FSFA 4MLCA 1EK2A 2DUUA 1YAJA 3GMDA 1YS9A 5ER9A 5JNWA 1JDBB 2WDZA 1UDWA 4BO9A 4QTYA 2JJ2A 1I10A 4PBSA 5ALMA 3PKZA 2G40A 1LLCA 1Z35A 1MB4A 1SCKA 2Q5IA 3B5IA 4XUDA 2R79A 1NZFA 1VA4A 3CNBA 4I1VA 1JYFA 2YIVX 1P1CA 1TQHA 2HSDA 2Y2VA 2A9FA 3G8AA 3M2TA 4GR9A 3VU0A 1Z0UA 3WL3A 4AUEA 2BFOA 2F3TA 5LZ4A 1R8JA 4PG4A 2YQ5A 3NBFA 3GLGA 1ESNA 5B6JA 1P9NA 1Q1NA 3MJDA 2PGDA 2CHUA 3WR5A 1JMKC 1UMCB 5DTJA 9ATCA 1I2AA 2V03A 5GY7A 1K5PA 2WR8A 1OWLA 1N33B 2O2XA 4QPJC 2BR4A 1E58A 1O94D 1BMFD 2JK1A 1ES9A 2IZZA 3TJZA 3R3XA 4RWZA 2WHPA 4UZFA 2G1PA 2CJXA 821PA 2ZYGA 3L7OA 3QFSA 4GKAA 5DM2A 4YQEA 3ABRB 4WBNB 1S5PA 1AUVA 2ZTSA 4LJLA 5JU6A 4BMSA 4GL2A 4EGQA 1A69A 2AL7A 4F6RB 3DWEX 4ITRC 4B82A 4CV2A 3VNUA 3QFHA 3L0ZA 4FOSA 3LIIA 4I08A 4CNBA 1CDDA 2OSBA 3ENVA 5BOSA 2ATVA 2EX0A 3AFNA 1RWXA 2D7CA 2EX1A 3DDUA 4X8OA 2EZ4A 4M49A 4P34A 5TARA 5C5CA 1ILEA 4PTLA 1IXRC 1Y5NA 3A1NA 5D3MB 2Z43A 3CPHA 5DYTA 2RONA 3WIUA 3NM4A 3T7IA 2GF0A 4LWPA 3IC5A 4INPA 4FE4A 1N5IA 1E9BA 1QF6A 3WLTA 1X1RA 2CF5A 2C92A 2ENUA 2J9FB 1SXPA 1NJGA 1H05A 3S5UA 1US8A 4YJGB 2ZRMA 1J2RA 2Z5LA 1IVYA 1IZZA 2II6A 3B6EA 4MWCA 4WKNA 1UXOA 3KELA 4JFRA 5K4GA 3GLKA 3HU1A 1HT0A 3C5WP 3MTDA 3SQOA 3DDOA 2X0DA 4N0DA 2GZ1A 1KTIA 1EBFA 4ZV4A 2W2LA 1U1GA 2COUA 3HR7A 4KLRA 3I01A 4DDMA 5CA0F 4LJ5A 2V55B 4H16A 4ZCIA 2G08A 3LF2A 1SELA