1U92B

Crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 in complex with gp41 peptide analog e-[dap]-dkwqs (cyclic)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
234
structure length
224
Chain Sequence
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPAAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLQTYTCNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY 2F5 (LIGHT CHAIN)
publication title Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine design implications
pubmed doi rcsb
molecule tags Immune system
total genus 39
structure length 224
sequence length 234
ec nomenclature
pdb deposition date 2004-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u92B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u92B01
1LHZA 1F00I 5BZDB 3BIAX 1UA6H 1G9NH 4PJIB 4LLQA 2OXGA 3BPCB 1CFSB 1UWGL 4FFWD 1QLRB 5FGCB 4YHYB 2BDNH 3VFPA 5DJAB 1FCCA 1BAFH 1G7MB 3PWNB 4OGYH 1BLNB 3CFDB 5MHSE 1GHFH 4JRYA 3UTSE 2BVTA 4WW1A 3CCHA 1XR9B 4LLMA 2M1KA 3HA0A 3D3VD 3EYOB 1TVBB 3AS0A 1ZA3A 5CJOL 5HD8C 3MLTA 1JGVH 4NJAL 2Q20A 3B9EA 5IW6B 2NXYC 2XN9D 5ITFA 2VJXA 4NQCD 3QIBA 3EYSH 1MHEB 2XTJC 1Z5LA 3NVQA 4TNWK 2XN9E 1OW0C 2DAVA 3MJ9A 3V7MA 4NQCE 1FL3B 3H9SD 5FUOH 2LVCA 4JB9H 1YDPB 1Q9OB 4O51B 1WFOA 5IV2B 4WI9A 3IS0X 3ZKXB 5JW4N 2BHZA 2ICWI 3ALXA 4NYLB 1IGIH 3PV7A 3H9SE 4NRZA 4OCWL 2DN7A 4YHMH 4K3DL 2X4PB 1G6RH 4UIKL 2JE8A 1ZWIB 4RAUA 5D1XB 4F7EB 2E8YA 3ROLA 1KULA 4NUGH 3IDXH 2WWKO 5CBEB 4P2OD 3MRMB 4FQXC 4DKEL 4PRDA 4G6ML 4PBWD 4YX2H 4IIQA 2VLKA 3O3AB 4JFEB 3PIQA 2RGSA 4OD2A 4KKCD 4KAQL 4M6ML 5HVHC 3F58H 1Q0YL 3DMMA 4YBLB 5D7SL 2YA0A 4XNQB 1N5YH 4RAVA 3HZYB 2V7HA 2ADGB 4MVBC 1MEXH 2VZ1A 3RWFB 5I1JL 1KN4L 1OAYL 4PJDE 1G7HB 5CINH 2P4AB 3VFNB 3J7HA 4WY7L 1G0XA 1MUJA 3OB0K 5I1KL 1MY7A 1UB5A 3D9AH 4OF7A 4ZYKA 2APVA 4X4XA 2Q8BH 2CK2A 2VQUA 1TQBB 2PUQT 2R2HB 4GFTB 3Q48A 4UTBH 2BJML 1HHHB 1C1EL 1UXSB 4G7YL 4U31A 1WBXB 4RGND 4LHJB 3U6RB 4JG1H 1GAFH 4LLYB 5BVPH 1SEBA 1CXHA 5IHUL 2DB8A 2Y06H 3NZHH 1MFNA 3ZT6A 2AP2A 4K55A 1FFPB 4RGNE 4OZIB 1N7MH 4X5LA 1ZT1B 3GM0A 3BKJL 2VDPH 4KROC 1CGWA 2GTZB 1M1SA 3RVXC 3QRFM 3CXDL 3DSNA 4PP1D 3MO1A 1S7QB 1RZ7H 1RIUL 4JPIA 3N06B 4NHCL 4FMKA 4U1JA 4R97C 3I3EA 4DGIL 1FAKT 1OCWH 1PSKH 3EJYC 4M43L 3S35X 4DGVH 1I1FA 4PJBE 3TJEL 3VXUB 1QRKA 2OJEB 1I8IA 2P7TB 3KPLB 5T1KA 2D9QB 4MA1B 3E3QC 4HFWB 4LSUL 2VMFA 4N0YH 1TTGA 1VFAB 2ATKA 2HTKD 1NCWH 1WTGT 3CIQA 3CSBA 1RUPL 4C83A 3AM8C 4IOIB 1AGFB 4LDLB 1YC7A 3LV3A 3HZMB 1E28A 1K6QH 4U4BA 1SEQL 1SMAA 5F7UA 3DVGB 1Q9KA 1R24A 4HKZB 3LKRB 2FO1A 2YD9A 2AS5M 5E2UL 1KNOA 2DD8H 3IFLL 3HE7A 1NGXB 3W2DL 2XTLA 4LLDA 4MDJB 4XVTL 4HIHB 2OSLA 3K1KC 5DK3A 1FZJB 5BS0A 1RZKC 2AAVA 3PDOA 3S6CA 3H3PL 1BWMA 5KSBF 1AXSB 5FOBA 4TVPL 4DK6A 1CFQB 2ZOLA 2J8UB 2VRAA 5DJ0A 4H88H 4Z78A 1KLUB 2F54B 5DD3H 3T8XB 2B0SH 3P11H 4JPKH 3LB6D 5E8EB 4EZMA 3BQUA 2LU7A 4J2XA 5ICYA 2DM3A 1WAAA 5GGSY 4YXKL 1LNUA 3WIIH 4HIEB 1VB9A 4JRXA 1HH6A 1BMGA 3WL9A 1W72H 3QXWA 4NKOA 2EXWD 2LU3A 4N9GA 3DBXB 1HXMA 1INEL 3F7RA 1GGIL 4JRWA 5F71A 3FFCD 1LEIB 5F72S 1GC1H 1AQKL 5F9OL 4NQXB 4Q58C 4D0CB 5H37G 4XBGB 3QIUD 4ODUB 3O0RL 4Q0XL 2WBWB 5IGXL 3FFCE 3C60A 2R56L 4U6TA 1R0AL 5DRZA 3KDMA 3LEYL 3TZVB 1MCWM 3A0OA 3S5LA 1BQLH 3TVMA 5JXAL 1JMZA 3U7WH 4DAGL 1OAKL 1WGOA 4WW2C 5EULV 3B5HA 1Z3GL 4N1EA 2DQIH 1MCNA 2NY3B 2R9HC 3BGMB 1YNLL 3D39D 4KVCH 4E41A 1T3FB 3P3YA 5D7LD 4GBXC 3SE9L 1JPFB 1IGFH 1QFHA 2BSRB 5EU6D 2NY5C 5D72H 4ODBD 3D39E 4OF5A 3NPSC 5D7LE 3UTOA 4EN3D 4JDVA 4Z76B 3E1F1 3MRRB 3MCLH 3UP1A 3LSOB 4NO2B 1DLFL 4GMTH 2P8LA 3TA3B 3P0VL 1FAIL 2G60H 2PXYB 3BH8A 5E5MA 5I1GH 3WNNA 2WP3O 1DBMH 1G84A 3WNOA 1CFTA 4UQ3B 3BZEA 5EORL 2HP4A 3C5SB 5C0FB 2XKNA 2ZG1A 4ZPTA 4GAJL 3WD5L 7FABH 1I75A 1U91A 1Z9OA 3KLHD 5D6DA 5DUBB 4N5ED 4LASH 2VR4A 1I3GH 4AM0B 4LCYB 5DJCB 5GISH 3CFJB 5GGUB 3EHBD 3JWOH 2BCKB 1P9MA 5D7IB 1DJSA 1QUNA 4G6FD 2DL2A 2VXSH 15C8L 2Y07L 5DUPL 1O0VA 4Q6IC 1BIIB 5C0IA 1C5BL 3DSFL 4NN5C 1QG3A 1LVEA 4QF1B 5E5RB 4YDLB 1IJ9A 2XPGB 4LQFL 4ZTPH 5J7CC 1WITA 4F15C 1P6FA 2Y72A 4XP5L 4QTIL 3T4YB 2DKUA 3ARYA 1JFQH 5J9PA 1YN7A 4KJWC 3H42L 4MA3A 4RGMC 4WHCA 3L3KB 1X5FA 4V1DA 4AEFA 1YUHB 3G5ZB 4S1DC 3R06B 5EG6C 4P5MA 1PW3A 1OM3H 2R0KH 3PGDA 3QEUB 3UDWC 3SKNB 3LKPA 3ZKSD 1T7WA 2UWEB 1A9BB 3QCTL 5ESVB 1U58A 2FBJH 3NOIA 4OQTL 2Y5TA 3DUUA 5HHMD 1H0DB 3JWDL 3TIEA 1QKZH 5D70H 4PJXB 3NACH 3QULA 1OP5K 2IPKA 4ELME 4JY6B 3WUZA 3T3PE 1MWAH 3SE8L 4HDIA 4Y4KD 3RHWK 1U8JA 4JAMA 1ZT7A 3MV7D 4J4PD 3MV9D 1KJMA 1UXWA 4XI5D 4OUUB 1EMTH 5GSRB 5LBSH 1P7KB 3MV7E 1UVQB 3GKZA 4AYFA 4N8PA 3BYTA 1S7SA 5E0QA 1NEZA 1OSPL 4OLWH 4Z8FL 2OX5A 4TSAL 2A6DB 1H8SA 1N3NA 3D87B 3H7BB 4JO1L 4XCFL 3IETA 3TP4A 5ISZB 1JL8A 2AV7A 3FQTB 5TE6L 3WO4C 4ZUSB 4QHLB 2H45A 1X4YA 3ALPA 1ED3A 1X5HA 2VDLH 2B2XL 4IBLT 4KKLC 2R1XB 5DJZB 1ORQB 4JRYD 5IB2A 1MCPH 2C1PA 1CXFA 2EE3A 4LSTL 4L4VE 5DC9B 3T0EC 1CDYA 3WLWC 1S3KL 5JR1H 5DVKA 1M05A 5MEQA 4HCRH 1F11B 1IGYA 5CJBA 3GIZH 3M45A 2DS4A 5TQ2H 3L1OH 4Q9QL 3O3DA 1M7IA 1WBZB 4ZOCA 1CDBA 4G3YH 2FX7L 3RNQB 3BKML 2C7UA 3D85D 4QRSA 3QIBD 2DICA 3VXQA 4AEEA 1L4IA 3D0VB 4JLRA 4HC1L 4X8JB 1IGJA 3D3VB 4BFIB 1A47A 3BIKA 3P4NB 3GSQB 3GB7B 1UFUA 5FGRA 4MNGA 3MLVH 1V3JA 5J4MA 4KHXL 3I6KB 3S98A 1IE5A 5K9KA 5F88B 4OF6A 5C71A 5D6CA 4X5XA 4D2NA 1OAZL 3VH8B 3G04B 1HOCA 3WV0A 1DANT 2X41A 3RWGA 1CICC 2A6JA 3BRFA 3C9NA 2VAAA 5E24E 1XF3B 5DT1L 3C08L 2VLKD 3OMZA 3UJJH 5C2BL 2J88H 1N4XH 4JO2L 3BXNB 3KYMA 4X7EC 3DMMD 3WHE0 1G9NC 1TZIB 3MRDA 2L0DA 2P8MA 5HGDA 2VLKE 3FB6B 4GW5B 3PWUA 3ILPA 2IBBA 2QKIB 2Z93B 4HS3A 4ZSOA 4P2OB 4CBPA 1Y18A 1JCKA 4MD4A 3LZFL 1AI1L 1FRGL 3G6DL 5J56B 1A6PA 3MACL 4OF8A 1CFNB 5IBUG 2VLMD 3S34H 4H1LG 4IOSD 4PJDB 5IBLC 2X4TA 4TUKH 4F2MB 3SDDC 3SDCC 2FYYB 2BVPA 4KJPD 3T2NL 2VLME 3VI4F 4AEIH 4B41A 1MRCH 1HHIA 5ANME 1TZHB 4RX4D 2DTMH 1MPAL 4JPWL 5JW3H 1NGWB 5DSCA 1FO0A 1L9MA 3AVEA 2IALA 2AABL 2W91A 5E7FA 1CXLA 4HUNB 2YEZA 3ECBA 3MCKA 2VZ3A 3G6JA 3BPLB 4APQD 4FQXA 1AP2A 1QFWI 3BZ4B 4KQ3L 4RGNB 3MUHL 4LCIL 4HIXH 1FDLL 4FG6D 5JMOC 5I8CA 2BOCB 1IQWL 1MCOL 3BSZL 5KVFL 2KUTA 3KPRB 1TTFA 3CU7A 1YJDL 4LSPL 5CZXD 5ITBH 4HMEA 4HK3N 4G7VL 4S2SA 1DDHB 2R15A 4IJ3B 2E27H 3BDBA 1N6QL 3G6AB 3GSOA 1J05A 3W39B 2PYEA 3E6HA 3PP4H 3VRJA 4D9RD 1T1ZA 4LHUG 1TPXB 4PRPA 3U46B 4PJBB 4P5KB 4XNUH 1QLFA 4D9RE 3FOMB 3WFZA 1NFIA 4HX1A 4TQEL 3WFDH 3CK0H 3U79A 1N2RA 3HC0B 2LTQC 3VCLB 4O2CB 3BOVA 5BVJA 3DLQR 2VERN 1YPZF 1T1YA 3T0XA 4EI6A 2EDBA 5DHVH 1T21A 4X7TA 1C5CL 4UQ2A 4XP4H 2A9ML 1L9NA 3FN9A 2XRAL 1P5UA 3QO0B 2OZ4H 2I9LB 4FFZL 5DMGD 3QI9A 4XAWL 3NMEA 5DVLA 2D7OA 3GMRB 2GQHA 4WFED 3DRTB 3BQUD 3O8XA 3WFBH 4Z18A 3EYFB 4X98B 4J6RH 5HYQA 5DD6B 2QQNL 4U1SA 5IVXB 3V4UL 4YK4B 4WFEE 1BOGA 1BZ9B 2EIEA 4AT6A 3MUZ1 1CLYL 3MODL 3G5XB 3O3UN 4JRXD 3U0WL 3S35H 4G42B 2ZOKB 2WUCL 3QCUL 5DMKA 1FYTD 5LKNA 1N0LA 5TF1H 5D9SA 4K3HA 3TH2T 1TJIL 4FQLH 1IBGL 2MQ3A 3ZMRA 3TIDA 5EZLA 4HJJL 1RUML 1FYTE 2E7MA 3O11B 1F6FB 4XTRC 4M7KH 3UYRL 1A7RL 2VDKL 1BPVA 5H2BA 2A6IB 3NGBC 4BZ1L 1V8HA 1H5BA 2X5PA 4NZJA 4RQQB 3TVMD 4ERSH 3FT3B 1T5XA 1IEBA 3FRPG 4KPHL 2VDOH 1YECH 1FNFA 3IB4A 3FFCB 4UV7H 1ZA6A 4NNYA 5HGHB 3QDGA 4GXUN 2CMRH 5AZ2L 3QIUB 3QHZL 4XPGH 3A6CH 1MI5D 2EC8A 4JFFA 4YZFF 3CNKA 5JDJA 3AGVA 1I4FB 1VEOA 3JZ7A 4YNYA 5I75B 3R0MA 3LKOA 1MI5E 5D1ZC 5C0CA 1U0QA 1FVEA 3NA4A 5F9DC 1IC7L 2NW2A 4LEOA 2ARJQ 2IC2A 4MD0B 2AEQL 4XHJC 5D5ME 4F7CB 5IEKB 3PABA 1J8HA 3RY4A 4JHWH 5FCUL 5EU6B 4K71B 4U3CA 1H3PL 2LQRA 2FSEB 3O2DH 3BFOA 3GRWA 3HFML 4I0PC 4FZ8L 2OI9B 4LVNB 3V6OC 3WFEH 1X7QB 1FZOB 5HY9B 5I9QB 4M9PA 5GRWA 5J8OA 4MCYA 1QFWH 2ERJC 3Q6FB 5MEPA 3PV6B 1CE1L 1EH9A 5KSUA 2C5DC 5FUCC 3QG6B 4AMKH 4K7PY 3ARPA 3C2SA 3PWVB 3DUSB 4YDJB 3ULSA 5BOZG 1GC1C 3T0AA 5T1LA 2FX9H 3U9PL 2LAGB 2H1PH 3HMWL 4M1DH 2VDNH 4M7ZC 1RIVH 3IXTA 3UYPA 4K8RH 1NBZA 5IB5B 3S3PA 3SY0B 4G6AD 1I3UA 4XP6H 4UV4H 4E5XA 3E2HC 1CK0H 5EUKA 3ZYIA 2V17L 1BGXH 4GBXA 4G6FB 1CR9L 4WWKA 3TCLB 3RUGB 5F6IB 2CSPA 4QXGL 4UBDC 4V1DD 1UM4L 4Z95L 3AREA 4O58H 4U6YA 5J12B 3WLBB 3QPQC 2H32A 2BERA 4MQXC 3VA6A 3ZE1E 1SY6H 1U8IA 4A6YA 1P4IH 3MGOA 5TE4H 3LHPH 3QUYC 4JN2B 2JJVA 4JO4H 3HS0A 4OCXH 4OCSL 5E8NB 3MRBA 5I17A 2DLEA 3NBNA 1K9TA 2ZG3A 3DETC 5C08E 4KXZI 1I1AC 1ZHKA 5DJ8A 3AY4C 2ADFH 4JFDE 3MXWH 4XNMB 5C9KA 4AG4H 1FGNH 5JIPA 4F57L 4RA3A 1RZJH 4OZGA 3UTZB 4HUVA 2FGWH 4AEHH 3MRKB 1PZUB 2GT9A 4Q6IA 4YH6A 5HHMB 3JWOC 1W2KT 3NIDE 3CU1A 4EEEA 1C5DA 5M7QA 1ORSA 1WCBA 2F8VA 4PGDB 3MX0A 1JZ4A 4P59L 4Y4KB 3ILQC 1VSCA 2DYPD 4PREA 4LU5L 2YD3A 4O02H 3MV9B 4ODWB 4EIGB 4FQIH 5DEFB 4FABH 1I9IL 3F6IA 3C8DA 3NZ8A 3I02B 3PGFL 2A73B 2J4WH 2OYPA 3QFJB 5FK9A 5GGTH 1CFVL 5C0BE 4XWOC 3LS4H 1TMCB 2HJLA 5D8JL 5I74B 1YQ2A 4D9QD 3WS3A 4EVNA 2OJZH 2VLJA 3ZDXE 3TM6A 4Z7WF 4EXPX 4RFOH 4PRID 4ZS7H 3MLSH 4LLQB 5LCVH 4HGMA 1UADC 4D9QE 1AJ7L 2X4SA 4NO0A 3BPOC 4U1IB 2UV3A 5IESL 4PRIE 5GS0D 4JRYB 3QRGH 4WW1B 3CCHB 2QQKH 3HKFA 2DQDL 4LCWE 4U2YA 4LLMB 4QXUH 3ELAT 1Q72L 1V5JA 1CD8A 5EOCL 2ZCKH 3B2UC 1LE5A 3BO8A 1ZA3B 3MLTB 4I8DA 3V0WL 5I73C 4I3SL 5D2LE 5ITFB 4YFLF 2Z0BA 4N8VG 4X9HA 1J9CT 1MHPH 1PDKA 3QIBB 4W4OC 1Z5LB 1Y6KR 4Z7VE 5FO8A 2DQJL 1F02I 1MH5A 3EDDA 1E4KA 3FHAA 4ZOEA 5FKPA 5D93B 2R0WL 2ZUSA 4HWBH 3QUXA 4JKLA 4U1MA 2FLRT 5C0JA 4NQDA 1FFOA 1X5LA 4NRZB 4U0QB 2FJGA 4GG6A 4RAUB 1QR1A 2AW2A 1R3IL 3MBXL 4X0KA 3ROLB 4WO4A 4F7TA 4WUUA 5FUZL 5I1CL 4NZTH 2XG5A 5I6XC 4PRDB 4IIQB 2VLKB 3RAJH 3PIQB 4OD2B 5HD8D 3EZJB 3TLRA 1U3HC 3DMMB 2NXYD 2GJ6D 5E6YA 2DDQH 3MJ7A 3NA9H 4RAVB 2CXGA 2HKFL 3LIZH 2V7HB 2XTJD 3IFNL 1PG7L 3MLYL 4HAGA 2GJ6E 1ZLWK 1AR1C 1I7TA 2GTWA 4WFHD 2XTJE 4U3HA 4NQSA 2MPAL 1NC4A 2E6QA 1E4WH 1MUJB 4WFHE 2R4RL 4YHLH 4LSRL 1JZ5A 1XAUA 1FL5A 1UB5B 5C0RL 4ZYKB 4X4XB 2WAHA 1O7SA 4KXZH 5JA9A 4FTVA 3C6SA 1ZANL 4X80H 3G9AB 1CICA 1WZ1L 4S1RH 4FQXD 3DHMA 1CLOH 1IGTA 1JZ3A 2JELL 1SEBB 4GQ9H 5ICXA 1YEGL 2AEPL 1AXTL 3V4PH 3Q1SL 1IM9A 4MVBD 4R26L 5CHNA 1NFDA 1FSKB 1IAMA 4LLWA 3HI5H 5BW7C 4NSKA 2YSSA 4LAQH 3BIBX 1BVLA 3JSSA 3RJQB 2CRYA 3QXDA 4CMMA 4QNPE 1DBKH 2KQMA 1OGAA 5ABDE 3VDBA 3MO1B 1RMFL 1A7NL 4U1JB 4JPIB 4PRPD 5FECA 2E9WA 1JGLL 4X6DF 4GMSH 1B0WA 5DWUL 4GUPA 3SDDA 4HXAL 1UCBL 5I1IL 1BM3H 4PRPE 5KW9H 3L3DA 1I1FB 4X7CC 1JPSL 2WK2A 1I8IB 3FOLA 1CZ8H 1AY1L 3PDGA 1E4JA 2ATKB 1KXVC 3IDMA 1JGUH 1AE6L 3IKCA 1CGVA 1HI6A 3RNKA 1KACB 2IMNA 4C83B 2C4XA 1YEFL 2DRUA 1X5JA 5F7NC 3LV3B 1E28B 1A1OA 1U8OA 1Q9KB 1R24B 4L5FH 4PUBH 1QEWA 1JN6A 2E3VA 4KROD 1KNOB 2ZP0T 3HE7B 4LLDB 1RZFL 2J8HA 2OSLB 4B50A 3O4OB 5ETUA 3PDDA 3P4LA 3RVXD 5BS0B 3PDOB 5H8DA 1DUYA 4Y8DC 1GYAA 3ARVA 3HZVA 3HC3L 5FOBB 3FCTA 2DWEA 2CK0H 3VMNA 2ZOLB 3LCYA 5DJ0B 4Z78B 3EJYD 3MOQA 1CFBA 4FP8L 1F4WL 4ESKA 3LQAL 2MJWA 4ZO8A 4GRLC 1IFHL 3BQUB 5HHXH 5GS0L 3DIFA 5ICYB 4H8WH 1ZHBA 1EJOH 1UM6H 3E3QE 3ISWA 1XEDA 2AJXH 3V5DA 2VXQH 5T1DL 1LNUB 1NGPL 3MRPA 4YLQT 4I3GA 1LO5A 4JRXB 1HH6B 3GO1H 3WL9B 4BSWA 2EIZA 4E42A 3IDYB 4W4NA 1LO3H 4NKOB 3UYOD 4N9GB 1HXMB 4QOKE 2ZSWA 3QHFL 5T33L 1ZLUH 3W9EA 1J7VR 1QSEE 3C60B 2EYSA 2VABA 4JFFD 2DLTA 3KDMB 5DRZB 3QSKB 3UX9B 3TVMB 3S5LB 4F8QA 3V4VL 1S7RA 4J3SA 4WHDA 3MUY1 2NPLX 1HH9A 1MCIA 3LVEA 2FEDD 5CUSH 1RV6X 2GEEA 4E41B 2NQCA 4DKAA 1CE6A 1W8OA 1MCRA 1LMKA 2Z4QA 2IG2L 4PJEA 4PS4L 4YEEA 4JDVB 1MAJA 3CSYA 1EUTA 5HDQL 1FC2D 4N1HB 2C1OA 3TYGL 2P8LB 4GAGL 4WEMB 3SE4A 1A6WL 5EWIL 5EUOF 3BH8B 5E5MB 1VFUA 4P49A 1HWHB 2NXZC 4JCMA 1CFTB 4MAUH 1JNNH 3BZEB 2ZUUA 2RCSL 2XKNB 5T1LD 4CN6A 4ZPTB 2DBLL 1U91B 3UPRA 3GHBH 4LSDA 1T89C 4LDOB 1FPTH 5IK3A 1CD9B 5EFIA 1FO0L 4S10A 3BW9A 1RURL 4LNRA 4GBXD 3KS0J 4WWKD 1CU4L 4KV5F 5C0IB 1DSFH 2OP4H 2P5WA 4P3CH 3WXWL 3ARED 3BZDA 1TXKA 2DQEL 4PB0H 1ZMYA 3LEXA 3VFVA 1WUNT 2BX5A 4OB5H 5J9PB 2ZNWA 4JY5H 3LN9A 1YN7B 2EDTA 4M62H 4MA3B 3G08A 4DVBA 2J12B 2AJYH 4V1DB 5E7BA 2VR5A 4G6JH 3JVGC 3P2TA 4XBPA 3GNMH 1HYRC 3VD4A 5GJTL 4P5MB 1BBJA 3PGDB 4IHOA 4J8RA 3LKPB 2VXUH 1W72A 1NQBA 2BNRE 4HH9A 1GPOH 3MGTA 2NCMA 1FC1A 1U58B 2YMXH 3M17A 4F7MA 3BT2L 2Y5TB 3DUUB 2IPTH 1EFQA 3QULB 4KUZH 5A16A 4CUCA 4IM8A 2IPKB 1WWWX 1IT9H 4HDIB 1TVDA 4FZEL 2BFVH 1U8JB 4O4YL 4JAMB 1ZT7B 4K8RC 3RP1A 2HRPH 5K9JL 5EIQA 1KJMB 1UXWB 4G8GA 1NKOA 4I18C 4KJWD 5JW4Q 4NWUL 2F58H 1S7SB 2B1AL 1NEZB 1F3DJ 4S1DD 4WTZG 2IQ9L 1N3NB 2IADA 5HHVH 4ZAKC 2NNAA 4KY1L 1FIGL 1QSFA 3IETB 3FL7A 2VLJD 1BFVL 4P46C 2AV7B 2BNQA 2GITA 1REIA 1MIML 3MYJA 1ED3B 2VLJE 4NO0D 1J0HA 4M7JL 4S11A 4LIQH 2XACC 3X3FL 3EOTL 5IB2B 2JJTC 1A6UH 2C1PB 4JQXC 3P9WB 1LQSR 3QJHA 2CLVA 3AY4A 3EOAA 4YC2C 1RJLA 3RY6C 3TN0A 3ZYZA 4PJ8C 1E6OH 5D2NC 1ZTXL 1IQDA 4UT7H 3N50A 1M05B 4YO0A 4HULB 5MEQB 1IGYB 4XNZC 1VADA 3I3BA 2J8OA 1WIUA 3TBVA 1J0JA 2F19L 1M7IB 2CUMA 4OZHF 3TYFA 2C7UB 4QRSB 3VXQB 1WJ3A 4KQ4H 5L88H 1FG9C 5EH1A 1RZKL 4JLRB 3STLA 1IGJB 1A6VH 3BIKB 2HT2C 3BWUC 1P53A 1PGRB 3VFSA 4Y16C 2BY3A 1A5FH 4MNGB 2HVKA 4P23A 1SJHA 1JHLL 1RZGA 3UTQA 5K9KB 5J11B 2AEWA 1HNFA 4JGJA 4XWGL 1VEPA 5D6CB 4X5XB 5CZVH 5I18L 3VWJA 4PJIF 2WIMA 1HOCB 4GG6E 3RWGB 4LSSL 2A6JB 3BKYH 5C7XH 3C9NB 2VAAB 3T0ED 3GRWL 1GGCL 4Z7NE 1JF1A 3KYMB 4LARH 5CSGA 3MRDB 5AD0A 2P8MB 5HGDB 3T0EE 1YEJL 1QRND 5CJXC 4U05A 1RIHH 3PWUB 3ILPB 5B22A 2FLBT 1RULL 4KK9C 4K3JL 1RUAH 4HS3B 1NBVL 1A4JA 4ZSOB 1QRNE 3NIFE 4GRMA 2BRRL 1Y18B 1MRFL 1EHLL 5DYOA 5I8OL 1MWAA 4MD4B 4UOJA 5BRZA 1NC4D 2NXYB 4RNRA 2ORBH 4XP1L 2P47B 5HVGB 4YXHL 5C0DA 1YY8A 1UH2A 4CU7A 2X4TB 4XCCL 3MJ8A 2BVPB 1OWWA 1VFBA 1U93A 2JJSC 3IJHA 1HHIB 4R7DA 1CICD 8FABA 3RRQA 3KYNA 4TRPL 3U4EA 4AIXA 2P42B 3ZSTA 2DLFL 4CVUA 1S7WA 4UU9A 5DSCB 1FO0B 5B21A 2D7TL 5JMRA 2I5YH 3WHE1 2IALB 1IM9D 1X6LA 1TQCC 3SGJA 1I9RL 1P7QD 2YEZB 3ECBB 4J3WA 1KBGL 3MCKB 3G6JB 1IZJA 4FQXB 1AP2B 1N0XL 3RWIA 1TNNA 4OM1H 3S7GA 4KHTH 4QO1A 3FB7A 3QWRA 1MRDL 4TPRH 1G0DA 1OGAD 5I8CB 5KSVA 3LPGA 4YQXL 2JCCE 4NFBA 5C6PB 5GGVL 5JPNA 5IBLD 1MFEL 4LHUD 1OGAE 4W6XB 4X7DC 3SDDD 3SDCD 4S2SB 5JHDA 2XXMB 25C8H 3GSOB 1J05B 1P1ZA 5F1KC 2PYEB 3E6HB 1V3MA 3VRJB 2W9LA 1T1ZB 3WN5C 1B0GA 3QEQE 3CFKA 1J1XL 4PRPB 5DZNA 1QLFB 3HC4L 3U0PA 1NFIB 4PLKC 4PGEA 1I8KA 2MQCA 1UWXK 1N2RB 4HK3J 3ARUA 4RRPA 1U8MA 2HMID 1FQ9C 3TH4T 4LRIC 5FF6A 2XQYK 5BVJB 1H9VA 5A43C 4OZIF 3P77A 3KYAA 1T1YB 4EI6B 4NN6C 1T21B 3TGXA 1L7TH 5DQDL 1JI1A 4JQVC 1UQSA 4X7TB 1MFDH 3TO2A 5EZJA 4Q74A 3NCJL 5GHWH 4UQ2B 5JLZA 2EDQA 4H20H 4EDWL 1NLBL 5BW7A 5SWZA 1MJUH 1BEYL 3RX8A 3QI9B 5EA0H 3VD7A 2CJUH 3FFDA 5HI3C 4PRNA 2Q8AH 4P99A 4ZFGH 5F97E 4Y88A 4CRPA 1JHKL 2ICCA 3BAEH 3O8XB 3FQNA 2WBJC 4HMCA 5HYQB 3QG7H 4U1SB 1YYLL 4XVJH 5LGKA 4MNQA 2KPNA 4TULL 2Z8WC 3O6KH 1BOGB 4AT6B 3CVHH 1R3HA 1KCRL 1S5IH 5DMKB 1F4YL 3CMOH 3RWEA 5D9SB 5FDYA 3DX7A 5KVEL 4M4PA 2EO9A 3TIDB 1Y0LA 5EZLB 4RCAA 4JFXA 3QZWG 5DJXA 1AO7E 4XCNA 5H2BB 3IGAA 1QNZL 4LK4A 4TN9A 5DGRA 1H5BB 1X6NA 3F6LA 2QEJA 2XKUA 2WQ8A 1Q8MA 1T5XB 1IEBB 1QFPA 4QTHA 3RPKA 2J8UF 5E99H 3KS0H 3A6BL 1ZA6B 4PJHA 4NNYB 3QDGB 2X1PA 4HPOL 4M5YL 2WMPA 2B5IC 1TJGH 1XZ0A 4MSWA 3WO3B 4JFFB 2CR3A 2XQYG 4M6NL 4YNYB 4CNIA 4OIBA 3LKOB 1NGQL 5C0CB 5IROA 3WUWA 4GRLA 1FVEB 4DW2H 2E9BA 1IM3A 2NW2B 4LEOB 1W0WA 4Q6YA 1D3CA 4U1HA 3PABB 3BKCH 1J8HB 5D1QA 2X4UA 2ED9A 4HXBL 4H8WC 4LMQI 4TYUA 5IVZA 1GH7A 3UPCA 4MCYB 4FQ1L 4FQ2H 2D4FA 4ETYA 1KJ3H 5MEPB 4ODHL 3U4BL 5KSUB 3ES6B 1ETZA 4WEUD 1HKLH 3IDUA 4ONGH 1AGCA 2AJ3A 4JFHD 4UIMA 4D3CH 2V9TA 3S88H 3ULSB 4L8DA 5T1LB 1DL7L 3QXUA 1CXEA 4JFHE 2P5WD 4J3XA 3IXTB 4UI2A 2K3TA 5D1ZD 5A2JH 4HK0A 1NBZB 1LP9E 3ZTNH 1G9NL 5DZOA 1IEAA 3BZFA 4E5XB 4RFNB 4PJCA 4XHJD 2PNDA 2YRLA 4L9LC 5D71H 1WZLA 5EUKB 4WNQA 4GBXB 3ZDYE 4WWKB 1F3DH 4OGYL 3EAKA 3F5WA 4PJ7E 1GHFL 5JUEH 1NCAH 3AREB 3EFDH 2OCFD 4PV9A 4U6YB 3KPMA 5TGBA 4OCLC 2H32B 5D96B 2EC9T 1F13A 1U8IB 4A6YB 3V6OE 2X70A 3HMXH 3MGOB 3ZZ1A 5F7EH 1IKFH 4Z7UE 1JGVL 3ARRA 3HS0B 1XGRA 1QYGL 5FUCE 3MRBB 4OD1H 3EYSL 1V7ML 4JN1H 4I3RH 5I17B 3B43A 4JKWA 4ZXBC 2IQAA 4YR6A 2GCYA 5FUOL 1KTLA 1ZHKB 4JB9L 4M8QA 3TC9A 3WIHH 5DJ8B 5D7IF 3O6MH 1A6TA 3UEZA 1F4HA 1AQDA 5HXMA 2DQCL 4OZGB 4GAYA 4WHYH 2HFEA 4HUVB 2DI8A 5IMKA 4MZ2A 4JGUA 2NY7L 2GT9B 4Q6IB 4X6EA 4UBDD 4OCMC 2QHRH 5H35A 3DRQA 2Z31C 4GSDL 3GUTA 2HKHH 3MOAH 3C6LA 1C5DB 3IDXL 1ORSB 1WCBB 3QPQD 4PV8A 3LKSA 4MQXD 4YX2L 1QP1A 3EO0A 2HT3C 4PREB 3P9LA 1FE8L 3QUYD 2BNQD 1N5YL 4DKDC 4XX1G 4PGJA 2HT4C 2XY1A 3NZ8B 3Q2CA 4YHOL 4M7LH 4RMWA 5AZEH 1M71A 3L95A 1MEXL 3JVGA 5FK9B 2NTFA 5BMFH 3DETD 1U92A 2HJLB 3KHQA 5CKAA 2O61A 3PL6A 1I1AD 2FHBA 4LPTA 4X7SL 3IRZA 3WS3B 4EVNB 4UTAL 1U8QA 2VLJB 5IMLA 1T83C 1HCFX 4PRHA 4PJXF 4YE4L 4J12A 2X4SB 4NO0B 3D9AL 5TDOA 3GFUA 4NC1C 3IAGC 3E0GA 4HD9A 2R1YA 2ARJA 1TETH 3K80A 4L3AA 4UTBL 2G9HA 2BHUA 5E2TL 3ILQD 3PWJA 4JG1L 5TDNA 1QTYT 1LE5B 3BO8B 5BVPL 2FB4H 1EX0A 5I66A 3NZHL 3BN3B 1DQMH 1T03L 2Y7QA 3SDXE 5L2JB 3O4LE 2RR3A 1UWEH 4AIZA 4XWOD 5FO8B 4ZAKA 5HYSA 1MH5B 3QCVH 3ZKNC 1AHWC 5FKPB 4HLZH 4P46A 3QUXB 1HCVA 4U1MB 3WBDA 1SY6A 3HNTH 1RZ7L 4NQDB 1FFOB 2HLAA 2MHAA 3BEVA 3HG1A 1E27A 4JFZH 2FJGB 1OCWL 2D7QA 4GG6B 1PSKL 1QR1B 5IF0A 1FNEA 5L7XL 2JJTA 1KB5H 2CLRA 4X0KB 2OK0H 4F7TB 4WO4B 5JW4R 4WUUB 5KTEH 2O93L 1UZ6F 2XT1B 2EKJA 1TIUA 3ZKMC 4R0LC 2N4IA 1J0IA 4DGYH 2UYLA 4N0YL 4XC1H 3AUVA 3B2UD 3JTSA 1NCWL 4N90D 2KZWA 1TDQA 4ZD3H 5BRZD 5EOQH 1HSAA 5DC0A 2QSTA 4OT1H 4HQQH 3MJ7B 4N90E 1ZLSL 4WU5A 4DK3A 1D6EA 2J6EH 4H26A 4WTWA 1I7TB 2GTWB 5CCKH 4GRWB 2C3GA 1UCTA 4Y16A 3RWHA 1LK3L 4NQSB 4OSUH 5DZLA 1NC4B 3U30C 5E6IA 3U1SL 4N0CC 4R4BA 1FL5B 4NQUA 3SKUD 3LQMA 4H88L 1MCEA 3ESVF 5KANI 2N7BA 5DD3L 3TFKC 4FTVB 1XGUA 3C6SB 3BD4A 3T77B 1CICB 3P11L 2VLLA 4JPKL 1VHPA 3EYUH 1IGTB 5EIVA 4ENEC 5C0AE 4Q7DA 1U3HD 5ICXB 3U7YH 2Q7NA 2YD4A 5CJXA 5TE7H 3WIIL 3NABH 3OG4B 4MMZC 4MAYC 4P9HH 1IM9B 2BVUA 3DI2B 5CHNB 1NFDB 1MNUH 3ARBC 1W72L 5JHDD 4LLWB 1AR1D 4NSKB 2YSSB 4NHUA 3MV8E 3O9WC 1BVLB 3QXDB 4CMMB 3QBTB 4PJDF 1GC1L 1L6ZA 1Y6MR 5JHDE 1OGAB 4OF0A 5F7YC 1Y6NR 4HBCH 3HAEH 4YIQA 4KDWA 1JPST 5DRWA 5HDLA 4GUPB 4RMQA 3SDDB 2W0PA 3DECA 1DBBH 5C9JA 2Q3AA 4OFYA 1BQLL 3L3DB 5HVWA 3U9UB 2P5EA 3HRZB 3U7WL 3VRLE 3FOLB 1GCFA 2EH8H 2DQIL 2ZUQC 5GS2D 2WM0A 4KVCL 3IDMB 4HWBA 3VGAC 3IKCB 3ARXA 1HI6B 3RNKB 4WFGD 1SMOA 2X1OA 4OM0H 5D72L 4H0HB 5E9DD 2AERT 1WT5A 3MNVA 1A1OB 1OD9A 1T2QH 1U8OB 3MCLL 3LH2H 3ZHKA 4PFEA 1QEWB 4RWYH 1JN6B 4W68A 5E9DE 2CD0A 2PR4L 3EJZC 4GMTL 1BVKA 2I27N 5SX5H 5I1GL 5ETUB 5DDHA 1DUYB 3VRIA 3HZVB 3FCTB 2DWEB 2FEEL 3RL2A 4KTEH 3WJJC 1HZHH 4MNQD 7FABL 3VXOA 4BUGA 3MMEA 4QLRA 5HHNA 5HTSA 3CZFA 1WV7T 4LASL 1I3GL 3BESR 1G9MH 2PW2A 2Y5EA 2FJFA 1HXYA 4FNLH 3DIFB 2H9GB 1ZHBB 2OQJA 2VXSL 5E00A 3V5DB 4GW1A 5D7KD 3MRPB 4XRCA 4Y4FA 1LO5B 1GL4B 1QOKA 1U95A 2EIZB 4BSWB 4ZTPL 5J0BA 3RA7H 4E42B 4WI4A 5D7KE 3WKMH 2GK0A 3SQOH 2ZSWB 4HT1H 4NQEA 1T1WA 2R2BA 2VZOA 4POUB 4XH2A 3W9EB 4JQVA 3GHEH 4HPYH 3D2UA 1JI2A 1JYWA 2EYSB 2VABB 1X5IA 3UXFA 3A6OA 2BVYA 3B2VH 2P8PA 3PWNA 1S7RB 1OM3L 2R0KL 1A9EA 4GRLD 2MNUA 5FO7A 5IVXF 1HH9B 4MXQC 3OR7A 4EUPG 3RHWF 2FBJL 2VTFA 1CE6B 2FECI 4H0GA 4NKIH 3U36A 2Z4QB 4QCIB 2NZ9C 1QKZL 3RIFK 5D70L 1N6UA 3NACL 4PJEB 4P9MH 4MB5A 4IEFB 4UT6L 1MWAL 5D7JC 2WNGA 4OCYL 3CSYB 4Y5XA 2C1OB 5A3IC 5EIIA 5JO5B 4MJ2A 3QO1A 2X42A 4PJAE 1EMTL 5LBSL 1GZPA 5EO0A 1LO2L 5FV1L 3NGBB 3GSNH 5KVDH 3UPRB 5T5FH 4Z0XA 3SDAA 4BQ9A 4L1DA 5IK3B 4POYA 2EDDA 1B6DA 5EFIB 3ZSSA 2IAMA 3BW9B 4LNRB 2R29H 1MCKA 6FABH 1FGVH 2VDLL 2F53D 1QBML 1J0ZA 1MIEH 1NMCC 4UAOB 1MCPL 2P5WB 2AJSH 4GH7B 2F53E 3GJFK 3PUCA 3LEXB 5A2IH 1A02N 2RQ8A 1MCDA 5CIPH 3VFVB 1PVHA 3GIZL 1A3RH 1K3ZA 2NXZD 3FHQA 3QDJA 5FA3A 4G3YL 3FRUA 4DVBB 3G08B 3D1MC 3O45A 1BP3B 4M48H 3N1GC 4XBPB 2WQRA 1RK0A 2R4SH 1H8NA 2ERJB 1BBJB 5CGYC 3HB3D 1UB6A 1YEEH 3QUMH 1FHGA 4IHOB 4J8RB 4BK4A 3M07A 1W72B 4KRNA 3SE3C 4GS7B 3K2UH 4NZUH 4HH9B 2FHFA 3KJ4C 3MLVL 4PJ9C 4QRUA 3MGTB 3K8KA 4XT1C 2V5SA 1ZLVH 3VJ6A 3M17B 1MAMH 2R0LL 3QISA 4F7MB 5FEBA 5ALBH 4J23A 5DR5H 5E56A 1LD9A 3BISA 5DI8A 1KEGH 5A16B 4BK5A 1QBAA 2QADC 1MLBA 2APFA 5F6HI 5IR1A 4PY8I 4S1QH 3UJJL 3RUGF 2J88L 1N4XL 3QXVA 4MJIA 4OLYH 2SEBA 2YWYA 1IILE 3LOWA 3VI3E 1G7LA 5J13B 4QRRA 4XVSH 2HTLC 3HN3A 4YPGA 4U7SA 4G8GB 1S7VA 1FIEA 5F7LB 3PHOA 3TT3L 1ZGLA 4Y2DC 1VENA 2VE6A 3H6JA 1S9YA 2APWA 2BVOA 5GZOC 1NC2A 3GMOA 2IADB 4G5ZL 2NNAB 4Y1AD 3PL6D 3PWLB 1QSFB 3UJTH 5EPMA 2Z35A 4R8WH 2BNQB 2GITB 1QO3A 1PLGH 4FXLA 4R2GC 4Y1AE 3MYJB 4PRHD 3S34L 2Q7YA 4F80A 4IMKC 3FJTA 2G5BA 4TUKL 1IAIM 1PBYA 4YFEA 4PRHE 4MQTB 4AEIL 1AGFA 1MRCL 2X05A 5LGJA 5JOFA 4U0RB 3QJHB 2CLVB 2DTML 3EOAB 1RJLB 2HH0L 3LKRA 3GIVA 2WBKA 3TN0B 1SHMA 1IQDB 5JW3L 4YO0B 2Q6WB 2AXHA 1VADB 3TBVB 2VL4A 1NAMA 3GSXA 3TYFB 5ACZA 2F5AH 3GKWH 2XZQH 4U1GB 5E5UB 2VXVH 3V8CA 4ZAKD 3QWQB 3STLB 4PR5A 4KUCF 3ZE0F 4HIXL 3VFSB 3SDXB 4P46D 5IFAH 2HVKB 1DVFC 5KS9A 3ARDA 4GKOA 4M93C 4P23B 4DOHE 1SJHB 5B38A 4JO3H 4NRYA 1RZGB 3UTQB 4M61A 5ITBL 4YHIA 1UH4A 4HUWB 1D9KA 5JPMA 4NQVA 4L3EA 5IB4A 5FYJL 3VWJB 1GSMA 5DF0A 5E1AA 5DURD 4O9HH 1FVCA 3PP4L 1FORH 4PJ8D 2R2CA 1CD1A 2MCPH 4XNUL 3RVUC 1JF1B 3BPOB 3SCMC 5AD0B 2D7PA 5D2NE 2PYFA 3IJYA 3CK0L 4QYOA 1MAKA 4FQQA 4MQ7A 3C2AL 3UC0L 3SKJH 1OTSC 1A4JB 4XMLH 4GRMB 3D6GA 5GRYA 4WHYG 4YUEH 2O5YL 5DYOB 4Y16D 1MWAB 3TV3H 4M6OH 5BRZB 3GMLA 2E9IA 4RNRB 5E6ID 4GW4A 5C0DB 4HWEL 1YY8B 4XP4L 5T3ZH 2OZ4L 3MJ8B 4LL9A 5DJ6A 1VFBB 2EDEA 1U93B 3CFEA 1BD2A 2XZAL 3IJHB 4R7DB 3BX7C 8FABB 3KYNB 3U4EB 2MSPA 2ICES 3QUZC 2NY0B 1JV5A 3WFBL 3NAAL 4J6RL 5HYJA 1S7WB 4UU9B 2BVQA 4M9OA 1AGEA 2DIJA 1DP0A 1UACH 1NL0H 2XA8H 3S35L 5I0ZA 1A4KA 1DZBA 4KK9D 4G80A 4ONHA 5TF1L 3CZJA 3U0TA 5I6XB 5JIKA 3RWIB 5B4MC 4FQLL 4KWUA 4ZFOL 4JFOA 1BFOA 3FB7B 3P0YH 3WFHA 5KSVB 1U3ZA 4KMTH 2X1XR 3NCYS 4M8VA 3CDFA 4EBQH 3RGVC 2FX8H 5JPNB 3T0BA 2P46B 1U8KA 3QDAA 5JHDB 1VGEH 4ERSL 5ADPH 1F3RB 3CFCH 2P5ED 3D25A 2VDOL 1YECL 5INDA 3SOBH 1P1ZB 4UV7L 4I0KA 2CDFA 1A8JH 1CVRA 3TF7C 3CFKB 3HUJA 4WI8A 3KXFA 2CMRL 4XPGL 4JHZA 3OKYA 2P48B 3U0PB 4G8EA 4OCNC 2AK4D 4XBEH 4YHZL 5AUMA 4PGEB 3K1DA 1I8KB 4R4FL 2VNCA 5FYLH 5FYKU 1CIDA 5TQ0H 5DVOA 3IXAA 2DQTL 5GRXG 2AK4E 1U8MB 4HIJA 3G5ZA 4LPUA 5FF6B 4IMLA 4P2CG 2FATH 4J3OC 1B4RA 3P77B 3BJ91 3PGCA 1KGCE 3EKCA 3VGFA 1SBSH 3LY6A 1UQSB 3TO2B 4MAYA 3T0DA 2AXJA 5EZJB 3WFEL 5JLZB 5DA0B 2VB5A 5SWZB 1QFWL 1S8DA 4P9HC 3FFDB 1MQKL 4X9GA 4PRNB 3R8BB 3B9KC 3VGDA 2RB8A 4UNVA 3ZLQC 1B2WH 2VSCA 4AMKL 4EI5A 2A1WL 5BJTA 4G8IA 5FO9A 3FQNB 5F7MC 1YEHH 5F9WC 2FX9L 4MNQB 4ISVA 2H1PL 4M1DL 1F90H 4PLKD 2VDNL 5ENWA 1GZQA 1RIVL 1R3HB 3L5IA 5KSBE 4XP6L 4OFVA 4UV4L 1J88A 3DX7B 4KDTC 1N26A 1Y0LB 4DTGH 4K3DH 1CK0L 1BGXL 4NQED 3ZT5A 4JFXB 3QAZB 4HWNA 3FQUA 5C6WH 2IPUK 3MNZA 5DJXB 1I7ZA 1EBAA 3R4DA 4O58L 4XCNB 3D2UD 3RU8H 1WCQA 4NQEE 3IGAB 5HI4C 4HS6A 4UINH 5J6HA 3MSPA 1MELA 1SY6L 1KOAA 4KAQH 5HI3D 2VOTA 1Q0YH 4QTHB 3K74B 5TE4L 3WCYA 3LHPL 4JO4L 4LPCA 3OGCB 2HJFA 1S7TA 4PJHB 3QHTC 1EPFA 5K59E 2WBJD 4G9DA 4C56D 3UTSA 2NY1C 1XZ0B 4MSWB 4JANA 4XPBH 1N5AB 5I1JH 1OAYH 4HUXA 5INCA 2PTUA 5C09D 4YFDB 4CNIB 4C56E 3V95A 3IU3A 2ADFL 3MXWL 1HSBA 1WAAF 3WUWB 3CVIH 4GRLB 4AG4L 1IM3B 1FGNL 3K7UA 5C09E 1RZJL 3OKEA 1A7QH 3VG9C 1W0WB 4LPXA 1KPVA 2FGWL 4AEHL 4U1HB 1G9MC 3HAEG 4CVWA 3F8UB 5D1QB 2X4UB 4KRPC 2O5ZH 3H9YA 3EUUA 2F15A 2KBGA 3QP3A 2XN9A 2CGRH 2XQBH 5IVZB 5CEZH 4NQCA 5GGRA 2YZ1A 4JFPA 1DANU 3G9VA 3SDAD 1PKQA 1QLEH 2XIDA 1ETZB 4O02L 4MS8C 5FXCH 3H9SA 5ESAA 2UVFA 1AGCB 2AJ3B 4W70A 1OF2A 2IAMD 4FQIL 1EGJH 4UIMB 4FABL 5CZKA 3OB0H 2J4WL 4ORGA 3BKJH 4IRZH 4L8DB 5F3HA 3UJIL 5CJQH 4UT9L 3OZ9L 4JY4A 4K94L 4JREC 3EOYG 4M3JA 4HK0B 4UB0L 5GPRA 4RFOL 4ZS7L 2IPUG 3DARA 1IEAB 1F42A 2FRGP 3BZFB 3MLSL 4LDEB 4PJCB 5C07D 5LCVL 5AEAA 1CBVH 1UC6A 1X5AA 4DGIH 2ZJSL 1OP3K 4WNQB 1IKNA 4M43H 5J1AA 3QEHA 3C5ZC 3OAYK 3F5WB 2OTWA 5C07E 4PGZA 3QRGL 2QQKL 4HS8H 4MXVE 4PV9B 3FQXA 3KPMB 4LSUH 5TGBB 4QXUL 2H26A 4HUMB 2OL3H 3CVHA 3OF6A 2ZCKL 3AC0A 2X70B 4MGXA 5HDBE 1XCTA 3O3EA 3HNSL 2PW1A 1SYVA 1XGRB 4YAQA 2X40A 5BQ7A 1K8IA 4PBVC 2O26U 4XVTH 3DHJA 2IQAB 4I77H 4KK5C 4YR6B 2GCYB 5F96H 1KTLB 1DE4A 4M8QB 3KPSD 2UZXB 4HWBL 1A6TB 1U3YA 1ULVA 1AQDB 3MA7A 4TVPH 2AK1H 1INQA 4GAYB 2HFEB 1NBYA 3L9RA 4QRRD 3KPSE 3IFPA 5IMKB 4X6EB 4KKAC 5H35B 3EZ8A 3DRQB 5E4EB 3GUTB 4QRRE 1ZV5A 3C6LB 4B53A 4FXGA 4PV8B 3LKSB 1H3UA 3EO0B 1P84K 1NCBH 4JDZA 4KI5F 3ZE1F 4LBEA 3P9LB 4XX1E 3CSGA 4I2XE 3VXPA 1OAXH 3ARGC 2DDQL 1BZ7A 3S4SA 5KANG 2BSSA 3LIZL 1M71B 3L95B 4PJBA 4CMHC 2W07A 3GSRA 2NTFB 4ZXBD 4FFVC 1U92B 2QQLH 1CL7L 4Y1AB 5KJRL 2O61B 3PL6B 2YD5A 3MFFA 1WTLA 1U8QB 3SE3A 1P6AB 1E4WL 4F3FA 5IMLB 1EO5A 4W81A 2MQ0A 5FGBA 4PRHB 5IGXH 1WEJH 5CSZA 1YEIH 4WVRA 5IVOA 5TDOB 3LEYH 5AYQA 2Z31D 2EE9A 3V5HA 3RDTC 3LN5A 2R1YB 1OAQH 2ARJB 4X80L 1CYGA 5AG8A 1CLOL 2G9HB 2X10A 5DVNA 3PWJB 4ODTH 2HT3D 3HNVH 5TDNB 4YHYC 1QHPA 2QSQA 3L5HA 4GQ9L 5I66B 4PP2A 5T3XH 3V4PL 2E7BA 3QNYA 2AI0H 2HT4D 2Y7QB 4OFPA 1S78C 3H8NA 1N8ZA 4YBQC 2GY7B 4AIZB 5HPMA 3HI5L 3D5OF 4ZAKB 2IWGA 4LAQL 4L3ED 3L3IA 5HYSB 4WI7A 4DOHB 4LFHG 1UZ8A 4P46B 1EERB 5I1LA 2FR4A 3FQWA 3VXSD 2HLAB 2MHAB 3BEVB 4GMSL 1ZSDA 1E27B 1A6AA 4FFYH 1KV3A 4ELKA 5IF0B 1FNEB 1BM3L 5KW9L 3VXSE 5CEYA 5DD0L 2CLRB 1L0QA 3P9MA 2A6IA 4NC1E 3X11A 4H5SA 3JTSB 4HZLA 5JIIA 15C8H 5D1XC 3CXHJ 2RBLA 2Y07H 1HSAB 4M1GL 4BA8A 2VH5H 3DSFH 4MB3A 5JQ6H 4L5FL 4PUBL 4CVXA 3GEWB 3QIUA 1ZVYA 4LP5A 4WU5B 3MUJA 1D6EB 1Z6JT 2RHEA 4H26B 3V6BR 4QT5A 4QTIH 3B5TA 3RVVD 4Y16B 2NTSP 2R23A 3RWHB 4MD5A 3BD3A 5A2KH 3PHQA 2APXA 4CL7A 1S9VA 1T4KA 2JK5A 5E6IB 5HYJD 2CK0L 4R4BB 2CIKA 3P73A 3D39A 3GBNL 1T66C 5D7LA 4U6HA 4ZO6A 2XFXA 5EBLA 5HYJE 2MCG1 4Y4HC 1F97A 1XGUB 5IB3A 1TLKA 3ZKMD 2VLLB 3A67H 3QCTH 4EN3A 4UNUA 2RIKA 5HHXL 3UBXA 4P2YA 4H8WL 2DLIA 4OQTH 1EJOL 1UM6L 1RVFL 3VI4E 4LIQE 1JUFA 1MREH 2FGZA 2VXQL 1TQBC 4PJ5D 3GI8L 4OLUH 5K9OA 4MXWH 1HQRA 4N0FA 1EVTC 4PJ5E 4NHUB 3BP7A 2FD6H 1CGXA 5MI0B 3EDEA 3QPXL 1YMMD 3MREA 3DX8A 1JWUA 5HGAA 4N0CD 1OSPH 1ZXQA 2VUYA 3BPNB 2MKLC 3MLRH 1NPUA 1YMME 4NC0B 4YIQB 5DRWB 2C3XA 3STBA 4Z0BH 4KZDH 5C9JB 2OXHA 1JP5A 3OPZL 1OP5H 3TFKD 2RAMA 2CH8A 2P5EB 4BUHA 5EB9A 5F7DA 3RVWC 5CUSL 4ENED 1UG9A 2GI7A 3D0LA 2W92A 5GRVK 2PO6C 4NCDA 1T0MA 4BQ6A 2V2TA 3TNMA 2D4DA 3G6JF 4I5BA 3O3BA 1T20A 2XWJA 4MAYD 3MNVB 1H3VA 4NP4H 5EU7C 1TQCB 3ARBD 4KKBD 5DJ2A 4ORZC 3MTRA 2Y4SA 3KJ6L 1S3KH 5T5NF 3O9WD 1BVKB 4ZG1A 4PRBA 4ZDHA 3VXNA 4Q9QH 1UJ3A 5DDHB 2L7UA 2AVGA 1PG7X 3VRIB 5IFJA 2A9NL 3BKMH 4KFZC 1JNNL 3HHRB 1GOGA 3RGVA 3OTTA 3RL2B 2C4FU 5GRVL 5AYUL 1GIGH 4ELMA 3VXOB 3DX9A 3MMEB 3GHBL 2VL5B 1JZ6A 5HHNB 3F7PC 5DK0A 4N0UA 3B9VA 4ODSH 3CZFB 1FPTL 4H1LH 4QHMA 2J6EA 3UZQA 2PW2B 2FJFB 1HXYB 2A74A 1KSRA 7CGTA 5FDWA 1VKXA 1WSST 2OQJB 3MV7A 4GXVH 5E00B 4UMGA 4J4PA 1BQHA 2WP3T 4GW1B 1DSFL 5GS1A 2OP4L 1P4LA 4P3CL 4OZFA 1X3DA 4CW1A 4XRCB 4Y4FB 3OKMA 4PB0L 5DK2A 4OLXH 2VO5A 1QFOA 2DI7A 1U95B 3NFNA 4Z6AT 4M03A 5C2BH 3EJZD 4JO2H 5IWLA 4P4KC 2GK0B 5C0GA 4DZ8A 2E7LC 1OVZA 2ESVA 2YD8A 4NQEB 2EDNA 4OB5L 1T1WB 4JY5L 4PG9A 2R2BB 4LPVA 4NWTH 3SQBA 3DGGA 4M62L 4XH2B 4WCYL 4MWFA 5MHSD 3D2UB 3UTSD 4G6JL 3CJJA 2W60A 4C58B 5LXGL 1V3KA 5EU4A 3GNML 4L4VA 1FNAA 4U1IA 5IMMA 2P8PB 1VPOL 2X2YA 2UY7A 1A9EB 4U1NA 2VXUL 3G6DH 2JB5L 3UAJD 2NYYC 4JHBA 3VFRA 5EOCJ 4NCC1 5FO7B 3OR7B 1IGCL 5C1MB 2W65A 2IEPA 2YMXL 3H2WA 4D9LL 1JVKA 2E7CA 1ACZA 3TZVC 3T2NH 3U36B 2IPTL 4E0RA 1U8NA 2BMKA 1JNHA 4Z5RA 3D85A 2YC1B 1MPAH 1IT9L 3CLEH 5HPOA 4Y5XB 3H9ZA 2BFVL 2ZNXA 2YD1A 5EIIB 3FN0H 5L0QB 1KN2H 2HRPL 3QO1B 4M6AA 1GZPB 3BUYB 9CGTA 2AABH 5EO0B 1KJ2A 1PKQE 3WIFA 1M7XA 1R3JA 4ONFH 2ZSVA 4K2UH 5HDOA 1YY9C 4P2QD 4Z0XB 2PXYC 4OGXL 3SDAB 1LO4H 3PXHA 3TJHC 3BSZH 4P2QE 4MXQD 2IAMB 3IDNA 5IJKC 1KCKA 4YDKH 5DEGA 3IFOA 1BQSA 3BP5A 4LIQL 5B39A 5EOTA 5D7JD 3LRSA 2M26A 3MFGB 4WI3A 3D69A 1OWRM 3OF6D 2OR7A 4UT7L 4TQEH 4V2CB 2COQA 3QDJB 5FA3B 4R90L 3FRUB 3GBMH 3O45B 4ONOA 2IAND 4YDLC 5IM7A 1AGBA 3EO9H 5ANMA 4NUJA 1RK0B 1A6VL 4QGTA 4L9DA 5DFTA 5ALCH 2IANE 1UB6B 1I7RA 5TPWH 2YD6A 4RX4A 1A5FL 4QRUB 1HHKA 2EDFA 4Z9KB 1C5CH 1L7IL 3MBEA 3N85H 3VJ6B 5DMIH 4FFZH 1CDGA 1LD9B 5CZVL 5DI8B 3VW3H 1KJVA 1YC8A 1R3KA 2VXTL 3QUKA 2VC2L 4L8SC 1MLBB 3BKYL 5IR1B 3GSWA 4POZC 4MJIB 4APQA 2QQNH 1NMBH 2SEBB 1BIHA 1G7LB 3NIGF 5E70A 4QRRB 2FNBA 4LCCA 4LARL 3X17A 4YPGB 1J1PH 5HSFA 1D5XA 1S7VB 5IHLB 3PHOB 1WLHA 2XZCL 1ZGLB 3MODH 3U0WH 5IHBA 2VE6B 3J8F7 3DYPA 3DXAD 5KOVC 1S9YB 2DQHH 2XYCA 3WJLA 2BVOB 2XOTA 1NC2B 3CLFH 1IBGH 3GMOB 1AH1A 5CGYD 3MV11 3T65A 3SEPA 3BWAA 3DXAE 2I25N 3V52H 5I2IA 4G9FE 1JGDA 2Z35B 5EPMB 3UYRH 1MCSA 4PJ9D 1QO3B 3MJ9H 1CLCA 2ORBL 1RZ8A 2VDKH 4PB9H 3CUPA 3LN4A 2Q7YB 1RUQH 1SM3L 1QSVA 2G5BB 4PJFA 2VZUA 5DRXA 2CKBH 4OZGF 2B4CH 1DBAL 3VA2C 5LGJB 5JOFB 1I85C 4X5WA 2QADD 2KZ1B 3ZTJG 2V5RA 4U6VH 3GIVB 2X4OA 5AZ2H 4XVUC 2HTLD 3T2PA 3S36L 2I5YL 4Y2DD 1NAMB 1ZGLM 3GSXB 5ACZB 4O5LH 4Z7WE 3JUZA 3T2QA 4KHTL 4PR5B 3IT8D 3B9DA 4XMPH 4TPRL 5FCUH 3W82A 5CD3A 1I8LC 3ARGA 5KS9B 3ARDB 5B38B 2H2PC 1UKTA 2DF3A 2X4QA 4NRYB 1ITBB 3TESA 4M61B 4YHIB 4OBSA 1D9KB 2HJKA 5JPMB 4NQVB 1C7TA 4L3EB 5IB4B 3SPVA 25C8L 5E1AB 5CP3A 1FVCB 3RWDA 2R1WA 4ZUVA 4Y19D 1FYTA 5CMAB 1MVFA 1CGTA 2LFGA 2J5LC 4TVSa 1CD1B 1T7VA 3V7AE 3HMWH 4JKKA 4Y19E 2R8SH 2PYFB 3IJYB 1TJHL 4QYOB 3RDTA 4FQQB 4MQ7B 3QDMD 3M8OH 2XICA 3JTTA 3RWCA 2ZCLH 3QDME 5TH2A 1MSPA 3L7EA 1UEMA 4CU8A 5DUML 3CX5K 3GMLB 1M4KA 5F8RC 3X13A 1L7TL 4Z95H 3NN8A 4GW4B 2IMMA 3B4NA 1GXEA 5GHWL 4P2OC 2XZZA 4H20L 1MI5A 4MA8H 5DJ6B 3WXVH 5EA0L 3VFTA 4JZNA 1HNGA 2CJUL 3CFEB 1BD2B 3ARSA 3RIAF 2Q8AL 4ZFGL 5D5MA 4GG6F 1KEMH 1JV5B 2HVJA 4OCSH 5DA4A 1UT9A 2NY2B 5B3NA 5HYJB 1SJVA 3QG7L 3RVUD 3K81A 4XVJL 2BVQB 3OKNA 3ARTA 4UDUA 1AGEB 3SCMD 3O6KL 3UTTE 4X4MA 4PJGA 1MFBL 3X12A 3CVHL 1X5ZA 1QA9A 1DN2A 1A4KB 2PKDA 4G80B 1F4XH 1OTSD 4ONHB 4F57H 4NQTA 3U0TB 4RISH 2DJ4A 3NIFF 4X9IA 4JFOB 4R3SA 3VH8G 1BFOB 1JJUA 1HYSC 3SGDI 4JM2A 3WFHB 1JYNA 2EZ0C 3SGKC 2NY4B 4GRWF 1FL6A 2WIIA 1G7QA 1U8KB 2AKRA 1NUNB 4LU5H 1LDPH 3D25B 1HDMA 5INDB 3ZDZF 5E99L 2CDFB 1WWCA 4LMQE 2CLZA 3HUJB 3KXFB 4KTDH 5AAMA 4G8EB 3HPLA 5AUMB 4IJ3C 4B0MM 5D8JH 1CQKA 1DN0A 4Y4HA 4Y5YC 1D7FA 2EDXA 1KXTB 3IXAB 4DW2L 4HIJB 4X6DE 5B4MD 1PX3A 4RDQF 4IMLB 1IEHA 3PGCB 4K7PX 3WE6A 5JQHC 4RMTA 1NFDF 2ZUWA 4DKFL 5TF0A 3RGVD 4MAYB 4DQOH 2DQDH 5C08A 1VESA 2D31A 1X9QA 3VG0H 1ZEAL 4FQ2L 3OB8A 2FIKA 1KJ3L 1S8DB 4JFDA 5EOCH 4QHUA 4K7FA 4QEGA 4HKBA 3AB0B 1HKLL 1U3JA 3QEGH 2I26N 4N0UE 5FHAH 2AXGA 1PQZA 3ZL4H 1R5IA 4EI5B 1G1CA 5BJTB 1NSNL 4G8IB 5FO9B 3S88L 4Y5VC 3R1GH 4ISVB 1D6VL 3K4AA 4QRTA 2DWDA 2IF7A 1GZQB 5ENWB 5B8CA 2MOVA 1K8DA 1RUKH 2UVEA 4L4JA 3ZTNL 2Z8RA 3EIFA 4WTXA 1UH3A 2ZUQB 3BD5A 1KT2A 1W0VA 1XF4A 5D71L 2ESVD 3HCVA 2PO6A 2DYPA 5IBTH 3FQUB 1YEDA 5JUEL 3RBGA 3MNZB 1NCAL 1I7ZB 2ESVE 5C0BA 4H0IA 4HAFA 4M00A 2ZCHH 4HS6B 4J1UA 1A21A 5J6HB 4L4VD 4ZUWA 3HMXL 3V5KA 3VGBA 2CRMA 1IKFL 3DWTA 4JDTL 2HJFB 3SBWA 2EDKA 1S7TB 3LPFA 4PRIA 1T0PB 1PG7H 3MLYH 4G9DB 4JN1L 4OD1L 4I3RL 3UTSB 4JANB 4HUXB 5INCB 4LCWA 3HE6A 2DMBA 2EIBA 3WIHL 3U83A 3IU3B 2GK2A 3O6ML 1HSBB 4TSCH 2Q87A 3PJSA 1BBDH 4HFUH 5C3TA 1J18A 2R4RH 4LSRH 2UUDK 3OKEB 1VDGA 2BNUA 1KPVB 5EZOH 5C0RH 4ZUUA 5D2LA 4KZEH 3BE1L 3OGOE 3BEWA 5I75C 1DLHA 1JNLL 4H25A 5E94A 5SV3A 2XN9B 4Z7VA 1MVUA 4LNVA 2DQGH 2JIXD 3IKKA 5HI4D 1WZ1H 2ITDA 4ZQKA 4NQCB 3NFSH 5GGRB 2HAZA 1ZLWH 4JFPB 3I75A 4Y2OA 4P4KA 2E7LA 3BHBA 4NJ9H 1PKQB 1Q9WA 3MLZL 3SGDH 3H9SB 5ESAB 1OF2B 2BXZA 5K9QI 4LVNC 2OI9C 5AZEL 4M7LL 4QHNA 4NO3A 2PF6A 4FMFA 4ORGB 2NY1D 3S96A 5F3HB 5EUOE 1KXQE 1T7ZA 1F6AA 4JY4B 4YBHA 3MLPA 1O7VA 1PFCA 1XMWA 3V0AC 3KPOA 4PJEF 1DTUA 1QVOA 1JYXA 5J1AB 1UCBH 4KRPD 3QEHB 3C09C 1WQVT 2OTWB 1JRHL 2GJ6A 4N5EC 5LG1A 1F4AA 1HIMH 5CJ5A 1TETL 3FQXB 1CG9A 3PNWA 5ILTH 1KCSH 3UROR 2X9WA 2H26B 1J11A 2EEBA 3CVHB 1OW0A 3TPKA 4U3XA 4MS8D 2FB4L 3LD8B 5F6IC 4WJ5A 1XCTB 3O3EB 1AKJD 4MX7A 2PW1B 1SYVB 3WFCH 4YAQB 1T1XA 5BQ7B 3HI1A 3MBED 4CADA 2CUIA 5CFHA 1K8IB 3OSKA 1UWEL 4AIOA 1HK6A 3FZUC 1XCQA 1P2CA 3BP4A 1BF2A 3GK8H 1CXIA 3L6FA 1DE4B 4QRPE 3JV4A 3HNTL 5IFHH 3MA7B 5L2KE 3I9GH 1INQB 2V2XA 4F9LC 1NBYB 4JFZL 3L9RB 1CDIA 2IBZX 3IFPB 3C5ZD 4P3WA 4I48A 5GIRA 2VISA 1KB5L 1NBQA 2OS7A 2OK0L 1PKOA 5KTEL 4FXGB 3E8UH 1RY7B 3N9GH 4MCZA 4DGYL 4LEXH 5SX4H 4XC1L 2ITCA 4WHTA 4JDZB 4LBEB 4IDJH 2VDML 3VXPB 5I71B 4OFKA 4HQQL 4BFEA 4QXTA 1BZ7B 3S4SB 2BSSB 3Q0HA 1DQQA 4Y4KC 4HJ0C 4I13B 3GSRB 2J6EL 2XWBA 1JPGA 4U6XA 2AXFA 4Q9CA 4KK5D 5CCKL 5KSAC 3L5XL 4PLJC 5T33H 3MFFB 5ACMA 1KTRL 4N68A 4PJFE 4OSUL 1MJ7H 4F3FB 3W5NA 2MMXA 3K4ZA 3VXRD 1TZGL 2FHCA 5CSZB 4UUJA 2CRZA 2DOCA 2Y23A 1QBLH 2BOBA 3VFGH 1EGJA 5I74C 4KKAD 4UOW0 3JWNC 3VXRE 4LSVH 3V5HB 2D0GA 3LN5B 2GY5A 3SGEI 4L8SA 1BJ8A 2DQUL 3EYUL 4PTTA 1WFTA 1MJJA 3HR6A 1C8PA 3O41A 2X89A 3RKPA 3GBLA 5MENA 4PP2B 3ARGD 5TE7L 4PS4H 1DR9A 3QNYB 3NABL 4P9HL 3MGAA 5AG9A 5C6TH 1MNUL 4X9FA 1N8ZB 2P49B 3NCCB 5HPMB 4FFVD 3STZA 3NCMA 3L3IB 1OD7A 4KRLB 3KG5A 1UZ8B 4OZHE 4O2FA 4KRMB 5IOPA 5I1LB 2OL3A 1K85A 2FR4B 1UENA 3CXHK 3FQWB 3OAZK 3MYZA 1ZSDB 4HBCL 5HYEA 1A6AB 2DBLH 4LLVA 1EAPB 4ELKB 4RBPK 3PXJA 3QQ9D 4B5EA 4ZPVA 3AM8A 5TJWK 3RDTD 5CEYB 1OLZA 5D93C 4PLNC 1CDJA 1I85A 4KC3B 3P9MB 4QOKA 2BY0A 3X11B 1OQOA 1Q0XH 4H5SB 1ZHLA 4ZNEE 2W0KA 2B4CC 2YPKA 4HZLB 3IYLW 3K8MA 1KJ2L 1CU4H 4PJIE 4UILH 1NCCH 5BXFA 1QSEA 2OR9L 4OM0L 4HUUA 4MDIA 3HRPA 5FGCE 2ZPKH 1S78D 2YA1A 4XXCC 3LH2L 3MUGA 1DQJA 4JE4B 4CVXB 4RWYL 4IIQC 4ALAH 4YWGL 3W81A 5L6YH 4QT5B 1W0YT 1XF2B 3DMMC 1ZHNA 2R23B 5E2VL 4MD5B 3PHQB 1I8LA 1S9VB 4JKPH 1T4KB 2JK5B 3LS5H 1P4BH 4M93B 1VGKA 4DUWA 5JTWA 3RJDA 4WENB 5L9DH 4KTEL 4D8PB 2CIKB 1HZHL 3P73B 3D39B 4J7RA 3WHXA 5D7LB 4U6HB 2RFXA 2XFXB 1Q38A 5EBLB 1JWMA 4F33A 5IG7A 1N64H 3I50L 1AIFA 5IB3B 3MR9A 1G9ML 2QSCL 4EN3B 4X4ME 4PJGE 4WUKH 3UBXB 5ADOH 2YUZA 2VKWA 4FNLL 1S9WA 1RPQA 5D1XD 1ZAGA 3ES6A 4JM2D 5DQJA 3B8SA 1JUFB 3SCMB 3O6LH 2DJSA 4K3EL 5K9OB 1HQRB 5FCSH 1CGSH 4P5TC 3RA7L 4N0FB 5A2FA 4JFED 5EU3A 5EO1B 1I7UA 3BP7B 3SQOL 4X6CA 1KPRA 5I19L 1KCLA 3IRPX 1TCMA 3MREB 3DX8B 1JWUB 4JFEE 1V7NH 5HGAB 1M7DA 4WW2A 1EK3A 2EDHA 2B1AH 1FSKC 4FOMA 5KG9A 2QSVA 1T66D 4KY1H 1FIGH 3LEVL 1A3QA 1KYOK 4Y4HD 4OI8A 3RIFF 3TWCH 4R4ND 5J6GA 5DVMA 2EC9U 5F7DB 3MLXL 1TENA 1J0YA 3D0LB 4DUVA 1T0MB 2V2TB 3TNMB 3X3FH 2UY6A 4I5BB 4P9ML 3O3BB 1T20B 2XWJB 1DBJH 4OQ1A 5C08D 3SGEH 4KU1A 1T04A 4LGPB 5DJ2B 2H6PA 5IJVA 1XGYL 3F7VA 4JFDD 1ZTXH 5HGGS 2BNRA 2W0FA 5I1AA 32C2A 4PRBB 4ZDHB 3VXNB 1EIBA 1UJ3B 3SGKA 2OTUA 5IFJB 3NCBB 2W1NA 3PE9A 5F1NA 3RGVB 3QWOA 2QHLA 4OZIE 3FQRA 3MXVH 3HE7C 5KVDL 4ELMB 4ZS6C 3DX9B 5DK0B 4N0UB 3O4OC 3TNNA 4KGLA 3PWPA 5T3ZD 4QHMB 2A74B 5F44A 2R29L 4YGVA 6FABL 1ADQH 1FGVL 5FDWB 4XPAL 2PO6D 4XXDA 3MV7B 3BI9X 1XGPA 3JBG7 5T3ZE 1VKXB 1BQHB 4OLEA 1Q94A 1MIEL 4BH7A 5I18H 3VXUD 5GS1B 3IU4H 3KPNA 1P4LB 4OZFB 3ULVF 2AJSL 5C0BD 4CW1B 1JE6A 4Y5YA 3OKMB 2Z8SA 5DK2B 1OPGH 4LSSH 4ZOAA 4Z7OF 3NFNB 1OARH 3VXUE 3BQUC 3VXTA 5EU7E 1GGCH 4DZ8B 5C0GB 2VDQH 3MLWL 3VD5A 2ESVB 4LSQH 1RSFA 1A3RL 4LQ1A 3UDWA 4PG9B 2Q76A 1H3TA 2YKLH 4BQ8A 4K7PH 3DGGB 4LRNH 2GHWB 5DMJB 3KWWA 4MWFB 4M48L 4BQBA 2W60B 3IDYC 5EU4B 4XC3H 3OXSA 2GSIA 2R4SL 4LCWD 3HE6D 4L4VB 1EHLH 5IMMB 5I8OH 1YEEL 1HHGA 1PEZA 5CP7A 4U1KA 4U1NB 4NZUL 3GMQB 3K2UL 3VFRB 2E6PA 3TH3T 3CC5A 2W65B 3F7YA 4YXHH 3C60C 4Y5VA 1MAML 5ALBL 3OWEA 4KTYA 4E0RB 1U8NB 2BMKB 1JNHB 2EO1A 2J8UE 3Q5TA 2AEIT 4Z5RB 5ERWA 4TRPH 5DRNA 3D85B 5L2JA 4HHAA 2EYRB 4S1QL 2F54E 5FYLD 4OLYL 4P4KD 2DKMA 2YD7A 4XVSL 2D7TH 4BFGA 2H32H 5FYLE 5GRUL 4A6YH 4XPHH 1KJ2B 1J86A 3WIFB 1KBGH 1R3JB 3S37X 2ZSVB 3IDJA 1UM5L 4PJHF 4BSVA 2D2OA 5JNYA 2Y25A 3UJTL 1X5XA 2NYYD 4R8WL 4YQXH 1PLGL 3PHSA 3DTXA 3IDNB 3T0EA 3FKUS 5DEGB 1A2YA 3IFOB 2NY1B 4MHHG 3RWJA 3TZVD 1T5WA 2YR3A 3BP5B 3LAFA 4JJHA 5B39B 1QPXA 1QRNA 5EOTB 3VFWA 1FV1A 1IMHC 2IBZY 5JW5A 1CDHA 4WWID 3EDFA 3MLUL 3PP3K 3LRSB 1J1XH 2VWEC 3JV6A 3SO5A 3D69B 4TNVF 1P9MC 4H1LA 3S5LG 3VG9B 1HE7A 2FECL 3BDYH 1J0KA 4KJQC 2F5AL 4RAHA 2XZQL 4LP4A 4EQ3A 5IM7B 1AGBB 4G6AC 1YY9D 2E5EA 5ANMB 4NUJB 2XXCB 4LVHB 2PXYD 5J06A 5DJDA 4Z7QF 1I7RB 3TJHD 2K9UA 5IFAL 3T77A 4KI5C 5DQDH 4DCQA 4GOSA 1HHKB 4NDMA 3MBEB 1BEYH 3ARWA 5C0EA 2YZ8A 5J57B 1KJVB 4AZ8A 1R3KB 4PJCF 1HILA 1QHOA 3GSUA 4O9HL 1UWXH 3QUKB 1UJTA 1WWBX 1NAKH 1FORL 2ADJA 1P7QA 3GSWB 1IARB 4APQB 1YEKL 1QFUH 2MCPL 4Q9RH 3RL1A 1I8MA 2B1HL 2JCCA 3JV0A 4LCCB 1VFOA 1D5XB 5D7IE 4YDIL 4JFYA 5J89A 5IW1A 1ACYH 3MA9L 4D0DA 2J7LA 3SKJL 1OL0A 4XMLL 4QRQA 4LHUA 3SDCA 3UCRA 2C3VA 4YUEL 3T65B 3TV3L 3BWAB 4OIIH 3QEQA 4N8CH 4ZTOH 3U9UA 5CEZD 4M6OL 5I2IB 1JGDB 3HRZA 2XA3A 1KB9K 3ABZA 1RZ8B 5TDPA 3CUPB 5IB1A 3LN4B 5CEZE 1QNZH 3T4AA 2R0ZH 4PJFB 5T3ZL 5C3LD 3SN6N 5DRXB 1E4XI 4K23H 4X5WB 3FONA 1G6RA 3A6BH 3S8WA 3DNKA 3NCEB 4POZD 4M5YH 2X4OB 2ILLA 3G5VB 2QTEA 5KOMC 4F9LA 2X89D 1N59A 5C2UB 1EO8L 5MEND 4E9LA 4YHKH 1UACL 4M6NH 2XA8L 3LDBB 3MCG1 4HMDA 2Q86A 5MENE 4PJXE 4FXKA 3LQAC 3E6FA 3UMTA 2IH3A 5F93C 2D9CA 3P0YL 2YXMA 1T0NB 5CD3B 3ARGB 4KMTL 2I9TA 2QJDA 3IJSA 4NRXA 4GRWH 2X4QB 2FX8L 3KLSA 4HWUA 1VEMA 4NFCA 2H9GA 4FQ1H 4K9EH 4CMHB 1M6OA 2HJKB 1VGEL 4ODHH 3U4BH 2EXYC 4GQPH 5ADPL 5C86A 1C08A 1F5WA 3CFCL 3SPVB 2BY2A 4Y7MA 5ISZD 5KSAA 2H41A 1ND0A 3SOBL 1NEZG 4QOKD 1AD0A 2R1WB 4ZUVB 3RWDB 1FZKA 3OBAA 1FYTB 4HGWA 1E6JH 5ISZE 1NDMA 1AO7A 2PCPA 4NZRH 5J11C 4TVPD 1QSED 4XBEL 5LQBL 5SV4A 3X14A 5FYLL 1BOYA 5TQ0L 3RDTB 1TNMA 2CDGA 3FRPA 1FCGA 3EBAA 4TVPE 5IMOA 1U2HA 4R7NA 2OR8A 5MP6L 3JTTB 3RWCB 2FATL 2I07A 4KVNH 2A77H 5TH2B 1JIBA 3L7EB 2YS4A 4FRWA 5GSVA 1SBSL 1UZ6E 2H2PD 3X13B 3NN8B 3DI3B 5ELIA 1I9JL 3OX8A 4OJFH 1MI5B 4XNXH 2EE6A 4QCIA 3VFTB 3VWKC 4JZNB 4G6KH 3D3VE 5D5MB 4XPTH 1QYGH 1B2WL 3FO0L 2HVJB 1KIRA 1NUDA 4ZNCD 1V7MH 5JO5A 1YEHL 3U4AA 3OKNB 1F90L 4UDUB 3FMGH 4F8TA 4PJGB 3X12B 4NKMA 1QBBA 1QA9B 1B9ZA 2DQCH 5AAWA 2CKBA 4W6WB 4DTGL 4PYHA 3NFPA 1CTOA 4R3SB 1EEQA 3EW3B 4MMXC 2NY7H 4JM2B 5JOEA 4HG4K 4GSDH 4X6CE 3RU8L 1WICA 2IGFH 4XXCA 2R9HD 4CU6A 1T2XA 5T3XD 1FL6B 3DUHA 2WIIB 1G7QB 4PG2C 4UINL 2FH8A 4NT6A 4LVOB 2AKRB 1XH3A 1LP9A 1JZ7A 3HI6H 4HV8A 1FE8H 1HDMB 5T3XE 1KCVH 4GKZA 1IAII 5D1ZA 1R3LA 1OHQA 3BUTA 1ZVSA 2CLZB 4YHOH 1H3WM 4OLVH 4PJ7A 1MCJA 3CGTA 4XPBL 3I85A 1CXKA 1EJ6A 1NCDH 3HPLB 1AGDA 2ICWA 2ENYA 1E4XH 4X7SH 1G7JA 2VDRL 1DN0B 4Y4HB 4UTAH 1GVIA 5EC2A 3CVIL 2G2RA 4I0PA 3V6OA 2AJUH 3OJ2C 4Z7UA 2BNRD 4JCLA 3FO9A 1A7QL 1NGYA 4YE4H 5K9QG 1OAUL 4F7PA 4C4KO 1HYSD 3WE6B 1S7XA 2EZ0D 5E95B 3SJVA 2O5ZL 3RZCC 3OKOA 2CGRL 3FB8A 1TITA 2XQBL 4XP9H 4JGMA 2D31B 5C08B 5CEZL 1T6VN 4JQIH 4P5TA 5E2TH 4NBZB 2FIKB 4DN4H 4JFDB 5I15H 4QHUB 4K7FB 3PWPD 1NMAH 1QLEL 4HKBB 3AXLA 1OQXA 1JHTA 2NLJB 3KPRD 4K07A 1T03H 2AXGB 1PQZB 1EGJL 1R5IB 2FEEI 3PWPE 3KPRE 4LCUA 4IRZL 3W5MA 3QI9C 3BP6A 5CJQL 5T5NG 4QRTB 2DWDB 2Z8VC 5I0DA 5B8CB 1K8DB 3ARFC 3RPIA 4HF5H 4WV1C 2H8PA 4AK1A 1FN4A 4OFDA 3O8XC 1KT2B 1CBVL 2ICEA 1W0VB 1XF4B 3Q3GA 2HYMA 2OMBA 3HCVB 3PWLA 2PO6B 5DFVC 1XF5A 2DYPB 4CVZA 5IP4A 1G9EA 2IJ0C 2UZIL 4GJTB 3QUYA 1YEDB 5L7XH 5GRJH 5KN5A 5C0BB 4HS8L 1AFVH 4J1UB 3AMKA 5HYFA 4ZUWB 3N1PC 2OL3L 3UO1H 5I76A 3AS1A 3V5KB 2XWTA 1I1AA 1QSZA 3GZKA 3LMJH 5EU5A 4TTGA 3GJEA 2KQNA 1CI5A 3CAFA 1ZLSH 2LE9A 4PRIB 1H5BC 2Q6WA 5GGQL 3QIWC 1UKQA 4LCWB 3HE6B 4I77L 5F96L 1LK3H 4DEPB 3PJSB 3U1SH 2AK1L 2A0LC 4N8VA 5B3JF 2BNUB 3ULUF 4ZUUB 4RMVA 2K7QA 1X5KA 3DV6A 5D2LB 3SDXA 3BEWB 3O4LA 1DLHB 5GGSA 4DN3L 5IVXE 2A6KA 4H25B 5E94B 1SBBA 2AQ3A 4QWWC 4Z7VB 1MVUB 2KDGA 2WUBL 2ITDB 4ZQKB 4OF3A 2FEDC 1OGTA 3MRHA 4HUWA 4KKLD 3I75B 2Y1VA 1DEEA 1NCBL 4P4KB 3BHBB 4NFDA 1Q9WB 4M7LT 1OAXL 2NZIA 3MRLA 4TSBL 1YZZA 5J1TC 4JZOA 2MTPA 3WLWD 2K7PA 4QHNB 4NO3B 3O2WL 4RGOH 3MOBH 5K59F 2J2ZA 3UTPD 3S96B 2O5XL 5GJSL 2QQLL 4JHAH 4CAGA 1F6AB 1RU9H 1JPTH 4J3VA 3MRGB 1IAIH 3UTPE 2WWMC 1NLDH 4YXLL 3KPOB 2CRIA 2AGJH 3MNWA 4XPFH 1WEJL 1QVOB 1YEIL 1ZKAA 1IGMH 5TFSH 1K4DA 5CILL 4WEBH 4OTXH 2GJ6B 3C8HA 3FO2A 1OAQL 1CG9B 3PNWB 4W4OA 2XTJB 4RFNC 4ODTL 3HNVL 3D18A 1UYWH 4FQJH 4MB4A 4WWKC 1SYSA 4WJ5B 3V9FA 5T3XL 4MX7B 5EC1A 2RJMA 3QDHA 1AD9A 4LKCA 4ZFZA 2AI0L 3AREC 1T1XB 5LJYH 3HI1B 2NY5L 5EU6E 4CADB 5D96C 2PR4H 1OTTC 1XCQB 4OIAA 4U2ZA 3S37H 1P2CB 3BP4B 3L6FB 2AJZA 5C0AA 4X6BA 2YRPA 3ALWA 2HFGL 3JV4B 4GT7A 1JF6A 1FP5A 4WU7A 2V2XB 4WI6A 3KPQA 4FFYL 2Y6SC 4EQ2A 1EZVX 1FNSL 1U3HA 5HVHB 4I48B 5GIRB 5E8OA 2VISB 4EUPH 2BSTA 3MV8A 4HCRA 3FTGA 4MXVF 4MCZB 2W9DH 4ZMAT 2ITCB 4WHTB 1TFHA 5DS8A 2D03L 3QEQD 1ZT4A 3RI5K 3Q6GL 4W6YB 2ZUYA 5HDBF 4QXTB 2VH5L 5F7FA 3VGHA 1S7UA 2LV4A 1HINH 3RUGE 5JQ6L 1DQQB 2DTSA 3I2CH 3IAPA 4L8CA 3FZUD 2XWBB 5KAQF 1JPGB 1IC4H 4U6XB 2AXFB 5FHBL 3WEXA 1KFAH 3EOBA 3VXMA 1KENH 1WFUA 5FM4A 3QA3A 2DI9A 5IQ7H 3KVQA 4LF3A 3OAUL 4B7IA 5GRZA 2BC4A 1BFTA 1INDH 4M4RA 4XNYH 4UUJB 2BOBB 3T3MF 3D48R 2BXYA 4GKSA 1DEDA 4DFIA 4YFLI 5E9DA 4ZO7A 2X1WL 4L8SB 4Q9BA 3A67L 4PTTB 3CDCA 1SVZA 1MJJB 2ZZUT 4KROB 3O41B 3WMSA 2YN3A 4F58H 1GGBL 1MREL 4NOBA 5I16A 5MENB 3ETBF 1S9KC 1KTDA 3ZHDA 4UT6H 4OLUL 4MXWL 4OCYH 5HHME 4R97B 5I8KL 4HJ0D 4XMKL 1NEUA 5EZIH 5C70A 3ESUF 3STZB 1RJYA 4YJZL 2FD6L 5KSAD 4PLJD 3RIAK 4ZOBA 4O2FB 5IOPB 4KUCD 3HR5A 2OL3B 3QXAA 1LO2H 3OKKA 3T04D 3QFJD 3MV9E 1AO7D 3MLRL 5BV7H 3S3JA 4LLVB 3ZE0E 4Z0BL 3OL2A 2YPVH 4KZDL 1E4KC 1FBIH 4ZPVB 3QFJE 5LGHH 2JLLA 4UOW1 3QUXC 1B4JH 4QOKB 2Z91A 1ZHLB 3L5WA 2YXFA 2YPKB 5F1OB 1QBMH 3BYYA 2IFFL 5BXFB 1QSEB 1NANI 4HUUB 4MDIB 5HJ3A 3OGCA 4PRAA 4HLJA 1RI8A 3NTCH 4WO4C 4IRSC 4L29A 4NP4L 1A6ZA 1EEZA 3P30L 3MUGB 2CQVA 1DQJB 3HTLX 2W9EH 1YMHA 4JRYE 3ZE2F 2ADIA 1N5AA 4MZ3A 1LO0H 3GI9H 5KS9F 3TBWA