1U93B

Crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 in complex with gp41 peptide analog eqdkw-[dap]-s (cyclic)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
235
structure length
227
Chain Sequence
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPGAAAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLQTYTCNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine design implications
pubmed doi rcsb
molecule tags Immune system
molecule keywords ANTIBODY 2F5 (LIGHT CHAIN)
total genus 38
structure length 227
sequence length 235
ec nomenclature
pdb deposition date 2004-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u93B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u93B01
3ARFA 5JQ6H 1JPFA 3ZDZE 5FOBB 5DRWB 3P9MB 3O2DA 4JHZA 1IE5A 1W0WB 2YRZA 1QSEE 3K8KA 3RU8H 4M8QA 5AZEH 4LGRB 3ARPA 4YIQA 3TH3T 3ELAT 3OKNB 3FT4B 4ZO7A 2FEEI 1TXKA 4M93B 3K1KC 1IFHL 3TV3H 3BIKA 5C0IB 3KJ6L 2DD8L 4D2NA 2LFGA 1A4JB 1G7PB 2YD9A 5FYLD 1RZ8B 3TBSA 3U2SA 3WO3B 4YDIH 4D9QE 1X5JA 3T0EE 4OCXH 3D85B 5CHNA 1IZJA 1HILB 4XMLL 3VXTB 2O5ZL 3T0EB 4PJIB 1D5MA 1KV3A 1I1AC 2R56H 1J0JA 2CGRH 1NGQH 4P57B 2VO5A 1ZTXH 5CMAB 3O2WL 5D7LA 4U0QB 1G9MH 4WIQA 4A6YH 2F8VA 4YXKL 2BK8A 3F8UB 4M1DH 4QRPD 4UNVA 4KJPD 4JG1L 5TDNA 4NO0B 1JNJA 3DUUA 2NY2C 4ONHB 3LS5L 3QCVL 5IHBA 4MX7B 1NAKH 2FX7H 4G6JH 1IT9H 2DQEH 1FN4B 3WCYA 1FRGL 4OSUH 1C5DA 2VXSH 3O9WC 3RUGB 4PLKD 3C5ZC 1I4FB 5EUOF 1TCRA 1INDH 4ODXB 5KTEL 5IKCA 4NZTL 2CDFA 1NFDE 2EH8H 3V5HB 4JZOA 2AJ3B 2OTUB 3HMXH 5BV7L 1GGBH 3B9KB 2OP4L 4D9RD 3CSYA 3GSOA 2BVPB 5DQDL 2IWGA 4LCWE 2CUHA 3QZWB 1QBML 3RZCB 2NY4C 2W0KA 3BO8A 2NLJB 3JV5A 5I9QB 4LU5H 4PYHA 3LD8C 4LEOB 2JTDA 3FHQA 2R69L 3LEVL 4FXKA 4DAGH 4MJIA 3CAFA 4LLQA 4QHLA 4PJFA 1IC7H 3GMPB 2X09A 1G7QA 2F15A 2WK2A 3MA7A 2EYRB 3MUGB 5HVFB 1WF5A 4D9QD 4G9DB 4OCXL 1OGAD 2R15A 3BN9C 4YZFF 5AG8A 1MHCA 3TWCL 2R4SL 3H9HB 3X14B 2XQYK 4XCNA 2H8PB 5EBGA 3MLUL 5HHQA 5F9JA 5ALCH 4LEOA 3PABA 2AW2A 4BSWA 5F97E 1BVLB 3CFEB 2BOBA 4XPTL 1R3IL 3M45A 3UJTH 4UU9B 3L1OL 1NAMA 3V52L 1F4YH 3L7EA 2N56A 4CN4A 3CDGB 5SX4I 3ARSA 4QF1A 3MO1B 3KLSA 1KXTB 1B9ZA 4NN6C 1QQDA 3LZFH 3MRLB 2OTWA 4ELMA 5DK0B 2CIIA 4QHMB 2EYTA 1A7RH 4TRPH 1B6UA 3D1MC 5F1SA 1L7IH 3QWRD 2X2YA 1CFVL 2A9MH 2OMNA 3PGCA 3IDNB 3IAGC 2IGFH 1OGAB 5F3HA 5B38A 1UG9A 2GKIA 4P46B 4Z5RA 1MJUH 2OJZH 4GRWE 8FABB 1XR8B 5ERWA 1H9VA 2NX5A 1X9QA 1U91A 4PJDA 5I76B 4YBQD 1KG0A 4NPYA 5I73C 1R3HA 4NO2B 3HG1E 4ZNEA 1IVLA 5IB3B 2GT9B 5BO1L 5K9JH 4AEIH 1UQSA 3C60A 1IC4H 4MA3B 4GXVH 3ARBB 2VDPL 1MLBA 4DW2L 1RUPL 3UTZA 4JB9L 3CLFH 3ZYIA 5MHSD 3MJ8B 1FO0H 2HT2C 1IC5L 1LO2L 2FGWH 4K9EH 2XPGA 4Y8DC 4X4YA 4JPKL 4HBCL 4X6DE 3TC9A 4O4YH 4GG8A 5T1DL 1OF2B 2P5WB 1QSEA 1OAXH 2EDTA 3BGFC 3GGWB 4J3VA 3RUGF 1DQLL 5FHAH 5EU4A 1Q0XL 4RWYH 5DTFB 2A9NL 3MRKA 3RVWD 4NBZB 4P9ML 3LV3A 2E5EA 1B3JA 3ZT6A 2MPAH 4QYOA 5IHZB 1GZPA 1IFHH 1NKRA 2W60B 3G5YB 4JEGB 4XVTH 4D0BB 3P11L 1ZLUH 5T3XD 1I3GL 1RHHA 1GZQB 5C0AD 3U1SL 2DI8A 4R0LA 8FABA 1OAZH 3FRPA 5LWYH 4JFZL 5LCVH 4PD4J 2NX5E 2NW2B 5IESH 4KK8D 1A6PA 4G8FA 1IGTA 2PYEE 4FFYL 3TA3B 1XF5A 1UM4H 4XBPB 4HF5H 5D8JL 5IQ9A 3CSBA 5JOPD 3CX5K 4M3JA 3WO4C 1RZIB 1EZVX 4YDJA 3UC0L 4U6TA 1PSKL 1S7QB 2IANB 5HPMA 3O8XB 3CFCH 2VR9A 4ALAL 3FB5A 2K9UA 5HHME 1K3ZA 1S9XB 1JBJA 4PRIB 2E7CA 2BNQD 3SDXE 3NZHL 4JDTH 4XXDB 3SDAC 2EIBA 3TO2A 4F7CA 4HV8A 3GJEA 3ROOB 1X5IA 2O5XL 3HI1B 5J1AA 4WW1B 3EYVA 5AUMA 2QR0A 1CG9A 1KCUL 4C56E 1TFHA 4NO0A 2OQJA 5I17A 4LVOB 1RZ7H 4U6HA 4N0UE 3G6JA 4JM4H 5DJCA 1CFQA 3DYMA 5D6CB 1U8IB 2R9HD 1KEGL 1A21A 2BSTB 1F45A 1PVHA 3G9AB 2FECL 5IMKA 4YPGB 4P9HC 2Y9RT 2DQEL 2J8UA 2W9EH 3O8XD 5FYJD 1CK0H 3GBLA 4UIKL 3BE1H 5F7YC 5HTSA 1R3KB 1C8PA 1HHKA 3QXDA 1RZ8A 4LQ1A 3TBTA 1N5YL 1MAKA 1A4JA 1SEQL 1RQ5A 2AJYH 4KDTC 1NGZB 4TTGA 1JGEA 1AO7B 1J18A 3DX8B 4Z95H 4H25A 1NGXA 5J13C 3SGEH 4U7KA 2FEDC 1IGCL 3EJJX 3GKZA 5DJCB 1MPAL 4X7SH 5D1XC 4HHAB 1JGUH 5TDPB 4I0CC 2BSRA 3I75A 5GGRY 3FO2B 5J1AB 5SWSD 3ZT5A 3VE0B 2HMID 4TULH 1NSNL 4JQXA 4UB0H 4U1KA 1T89C 2YXFA 4D9LH 2LVEA 1CDCA 3DO7B 4JLRA 1RPQA 3EYQD 3L3OB 3F5WB 4OLWH 5DFVC 3TNMA 4FTVE 4RZCA 2ZJSH 1JYWA 1NGWB 4HUNB 3GFUA 4KGJA 4U1IB 1V7MH 1RZKC 2W0FA 2VLJE 3NCJH 3EW3B 2VDQH 2X70A 4ENED 4OIAA 3NIFE 5I9QC 2F54E 3WS3A 4XNQB 3FOMB 3BDYH 5FDYA 2AQ1A 3SDCC 1TDQA 4L3CB 2GK0B 3MRQA 3LD8B 4LLWB 2NQCA 3RWGA 4C4KO 2QSVA 5KS9A 3CMOH 3WS6A 5EN2B 2F8OA 1A6ZB 4MXVF 5TE7H 1TVDA 4OZGB 4XHJD 4FRWA 1WIOA 1I7UB 1CDGA 1MIMH 4PJ7E 1U8MA 1JN6B 1G7IB 1RHFA 4HWBA 1K85A 5C0FB 3OKEB 5E8NB 3MV9E 1PKQE 3FL7A 4U33A 3WFDH 1OQOA 1CGYA 1J11A 3QJHB 1PAMA 4P3CL 1ITBB 4I48B 3QNYB 3HI6L 3OSKA 3IKKA 2VH5H 4PJ5E 5CBAA 2HLFD 3MV9A 4QNPF 3H7BB 4JPWH 4XAKD 3T1FA 4HMCA 1G6RA 1SYVA 4GW1A 4NQDA 1NCTA 1WICA 4XNUH 4CADA 3TPKA 1QFWI 2V7NA 4GSDH 4GOSA 4P2RE 4KRLB 2PTTB 4GKZB 2XN9B 4OGXL 35C8L 4E42B 3GBMH 3FQUB 3RL2A 4F7MA 3V6FA 3GIZH 1LDPH 2NY5L 1MCFA 3P4OA 4GRWB 4RNRA 3GJFB 2JB5L 4WENB 3QDGD 3ETBF 4U1MB 1F90L 4ORZC 4LFHD 4LVOC 4WWID 2OBGA 2OR7A 1G0YR 1BX2A 1E27A 4OM1H 4LHJB 4BKLB 3CGTA 1JVKA 5TE4H 1H3PH 4YGVA 2P46B 4KKCC 4PJBF 5C0JB 3MJ7B 5FDWB 5DVLA 2DM4A 4EI5C 5CEZD 4XT1C 3PXHA 4EOWH 5D4QA 4OFDA 4I9WD 4DZBB 1TENA 2V9QA 4TNWK 2CLZA 4K7FB 2BVOA 5EFIB 5EC2B 4M5ZL 1FG9C 1GC1L 4EUPH 3MLVL 4ONOA 1JWSA 4FNLL 1MRCH 4PJ7F 5SWSB 1T03H 3CVHL 3P11H 2Q7YB 1U3HB 1X5XA 1LK2B 2ARWA 3QNYA 4YHLL 4I48A 2J8UF 4X6FB 4IRSD 2APVA 1N5AA 1JUFA 3MMEB 3V5KB 2DQCH 4P0DA 5TF0A 2FX9L 3UBXA 3RPIB 4Q9RL 4EVNB 3TNNB 2YD6A 5GGQH 4MB4A 5E2UL 4CDHA 2QADB 5C07B 1B4JL 4HIJA 4QWWD 3FO0H 4POUB 3DNKA 3UTTB 4ELME 5ADOL 5C2BH 1VFBA 3H9HA 2YHGA 5FA3A 2QSQA 1LE9B 5I19L 1SBBA 5FM5M 1L0XA 3HZVA 4PJ5D 1JZ8A 4EIZC 4TSAL 1YPZF 5ENWA 4G8IB 5IM7A 4OKVA 3L3GA 3QUZA 4U7MA 4LCIL 4E41D 1EHLH 3OMZA 4RMUA 3OKDA 4S0TD 2ENSA 4PRHA 4XP5H 3S5LA 3QXVA 4F8QA 4ZFFA 2AXFA 4ZXBD 3RY6C 1CGUA 1P4LA 2H8PA 2XIDA 3BUYA 4RMSA 4HSQA 4X6BA 3GI9H 5K59F 3K4AA 4ZSOE 5HDBE 4RZCB 2Y07H 1K4DB 3IU3A 4BH8A 2ADFH 5KSBB 4MD4B 3EO9H 2ENYA 3SQOH 5T3XL 4F57H 1JZ7A 1I7ZB 2GK2A 4WFEE 2GJ6E 1TVHA 4OF8A 2IFFL 2NY0B 3RA7H 3U46A 3SDAB 1W72A 3BE1L 4JY6B 4HXAH 4W81A 5HHPB 3FO9B 5HJ3A 3FFCA 4S10A 3KYKL 4GRMA 5F89A 2Q7NA 4L8BB 1FYTD 3LQAL 1KLUB 2D3VA 3QUMA 1WQVT 3NABH 2DJSA 5T3XE 3G6DL 4OZIA 4NM8L 3HPLA 2R29H 3IDJB 3QDMA 4HKBB 5I1KL 3FMGL 5C0RL 4K71C 4KDTA 1AFVH 3V5HA 3T4AB 5BQ7B 3VXUA 2QJDA 4YDVA 4C4KT 3HCVB 4BQBA 3R0NA 3V4PL 4JM2C 4YHML 2Q8BH 2BNRB 4HBCH 1ZEAH 3A6BL 1HSBA 4ZS7H 3CU7A 5DT1L 1FZOA 3QUXD 5IJVA 4GO6B 4JO4H 4HFWA 3LN4A 1Q72L 4QKXB 3HE6B 2VTFA 5HYIA 4PJBB 4J4PA 4DQOH 1K6QL 2BC4A 2OQJB 1ZMYA 4X9BA 5JQHC 3SY0B 5LJYH 2E8ZA 1KLGA 5F7WC 3AREB 5L8JB 1VEMA 5D7LE 1EAPA 3VJ6B 2VZSA 4JRXB 1YMHA 2CLVA 4U6VH 4QY8B 1AD0A 1QBLH 4WW2C 4PJXB 5CGTA 1N4XL 3UTSE 5C0EA 1W0WA 4JZJB 1GGUA 4MA7H 1I8IA 2WBWB 1ULVA 2YEZA 4I2XA 5LCVL 3WE6B 3HZMB 4MJ5B 2D0GA 1Q38A 1RULL 2Z92B 4JFQA 2X4RB 1W72L 4WHTA 3SDXF 3EDEA 3FFCE 5CEYA 3TBSB 3WYRA 3QFJB 3U2SB 1QFWH 2AK4B 3OB0K 1G7PA 2YMXH 3QO0A 4XNUL 3CXHJ 3C60D 4B7IA 5MEQA 5HHXL 2UWEB 4PJ9D 1MCWM 3WS6C 2MKWA 4WFED 2C1PB 3C6LC 2H3NA 3D2UB 1G6RL 4R2GD 3F7VB 4AT6A 5ESVA 3MRJB 1YA5A 1KTRL 3GEWB 2BVYA 3CH1A 2VLJA 3FB6A 2NW2A 5I8OL 1VPOL 1ZXQA 2DL9A 1KYOK 3RX7A 4YE4H 3UAJD 5GHWH 5IG7A 5KSAC 4Y19D 4I5BA 3CSGA 4O2CB 3CIQA 1X4YA 3FONB 3CZFA 3P9LB 2D7NA 3L5WA 1FFQA 1VGEL 3GSQA 3NGBC 2HWZL 1MCPL 4JM2A 2EE3A 4OZHF 5KSVA 1C16B 1Z0NA 4ONGL 3RI5K 1ZHNB 3V8OA 3VXRE 4YHMH 1BZ9B 4AT6B 2A77H 2Q20A 1G7JB 3CFDB 2DQDH 4MNQA 5E8OB 3MPCA 1FDLL 4KTEH 1FG2A 4ZFOL 3QO0B 1A3LL 3HKFA 3I6LD 5IF0A 3H9SE 4PJHA 1PEZA 4NN5B 1NKOA 2GJ6A 4IRZL 1U93A 4M7LH 2K7PA 2G5BA 1WAAA 4JFPB 4ZFZA 1YQVL 2FL5B 1J0IA 4XNXH 5A16B 1QFWM 2F54D 4PD4K 1T1WA 5FO8A 3MYJB 4GMSH 5CP3H 2XT1B 4JRYD 3G5XA 4N0CC 3QFDA 4PPTA 1TPXB 3O4OC 4IMKC 3U7WL 3VFVA 3WFDL 2F58H 5AEAA 5FO9B 3EYFB 3NFNB 4KI1A 1HHGB 4XCYA 1YUHB 4YBHA 3KPQB 4HDIA 4NUJB 3R06B 5HI5C 1BFOB 3KPLA 1NC2B 2CLRA 4LVEA 5C7XH 4Z7WA 1PZ5A 5GJSH 5C2UB 5SX5H 2DQCL 3KPMB 4PRPD 1OT1A 1MCKA 4DKEL 1GGCL 4ZQKB 4IMKA 3RVXC 3O41B 3VRLF 3WLBB 3SJVA 2MQ0A 2BSRB 4FZEL 4L8CB 4HS3A 4XP6H 5LGJB 3N1PC 1NCCH 1LDPL 2NY5H 5IMMB 4FQXB 1U58A 3MNWB 4PJXE 3JV6A 2BNUA 5L8LB 4Y7MA 3BWUC 4MLIA 5E56A 3V8CA 5D2LF 2D31B 5INDA 1MEXH 2GIYA 4Y16D 4NQXB 3T3PE 4PS4H 5A3ID 4PJEB 3SDYH 4JFDD 2UUDK 4KHXH 4JVWA 2APWA 3WEXA 2DOCA 1CIUA 1Z9MA 2IQ9H 2QADD 5ISZE 1S7WA 3U0WL 2GQHA 3LS5H 3QCVH 3SPVA 3V4VL 4U7SA 3VD7A 3H3PL 4KI5C 4HKXA 2XWJB 5T1LA 4G9DA 4M5ZH 1RZFL 2BSTA 5HVGB 1A14H 5D6DC 3LEXB 4GBXD 2R0WH 1UJ3C 2DLGA 4IRZH 4M7LL 4WHCA 3MLSL 3QHFL 4XNMA 4LIQH 5F3BA 5E99L 1T5WA 2FYYB 3P3YA 2ZSWB 1JPSH 5SX5K 1XAUA 2E6PA 5F7EH 2L7JA 1QHPA 3TVMC 1T4KA 1L6ZA 5EO1B 1T89A 3RA7L 4PP2A 4NKOA 3IJYB 4EDWL 2LU7A 5HVHC 1DQQA 2APXA 4L8DB 5H8DA 3DXAE 4OFYD 3X11B 1QEWA 1TVBB 2XG4A 4BFIA 2H41A 3W2DH 2DLIA 1M71A 2H32B 3T09A 3I84A 3T0ED 3FTGB 2VDMH 5DJXB 5E00B 2ADIB 4WFHE 5C09D 1YEEL 3MNVB 3LAFA 3VDAA 4BZYA 5M94B 4TTDD 5C9JA 4HPOL 1JWUA 4WGVB 1OB1B 3RVVC 1MWAL 4ZSOB 1J7VR 5FEBA 2ZCKH 1EO7A 3SHSA 1IC4L 3O81A 2AEPH 3R8BB 3BI9X 5GRUL 3H9SA 5FUZL 3TWCH 3PWLA 2AXGB 4HWUA 2BCKB 1LEIA 2N7BA 2I25N 3IDMB 5EC1A 3BGMA 3CLEH 4P4RA 2X9XA 2X10A 3OKMB 4ZUWA 3S36X 4H0IA 1NMCB 3VH8A 4OV5B 1T0PB 1W0VA 2WSKA 1ACYH 4MNHA 1OAXL 3MRPA 1D5ZB 3B6SB 3IFLH 4L4VD 4MS8C 3PWVA 4ORGB 2CO7B 3JWNC 5I1EL 2AJSH 3DTXB 4LU5L 3GDBA 3DV4A 2XWTB 3AB0B 4NNXA 4N0UA 3WHE1 2OTPA 3EDJA 4J1UA 4X6EA 1NDMB 1T66C 1T5XA 5C0GB 2YS4A 4WTZA 3SGDH 3PQYE 3W81A 3K0WA 3S35X 1UEMA 1TQCC 4N1EA 3QIUB 5C2BL 2Q8AH 1QYGL 3NA9L 1YY8A 3C2SA 5EA0H 3A0OA 1T7XA 2KUTA 3QDGA 1T04A 4WUKH 5IHUL 4OGYH 4Z0XA 1QUNA 4O58L 5AYUL 3GSNH 4PRDA 4X7DC 2HN7A 4FQ1H 3T0BA 3DECA 2SEBB 3RWEA 3GHBH 4Y4FB 3NCFB 5EOQL 4R8WH 4AQOA 2ARJQ 3S98A 1CL7L 3QEQD 3KYOA 4Y5XB 2B4CC 2BCKA 1LEIB 3QG6B 2AXGA 4RAVA 1G7HA 2FIRT 5JXAL 4MCZB 1HHHB 4JHWL 5IG7B 1OP5K 5JORB 4QNPE 3VI4E 1V05A 3DTXA 2Z4QA 2X4UA 5E03A 1IL1A 2YA1A 3SN6N 3VMNA 4LNRB 4JKKA 1DZBA 1JN6A 1G7IA 1NMBL 1RJYB 1FYTE 2R2HA 3LB6C 1QBMH 3REVB 1ONQB 1RZGA 4XWGH 1TJGH 3SE9H 3KDMA 2Q3ZA 3SKMB 4YHYB 2CIKA 2MPAL 4PLNC 1JK8A 2EYSA 4JN1H 3BW9A 1HSAA 1WFNA 5F7DA 1AXSB 1MELA 1JPTL 5AZEL 4AEEA 3O3DA 4LKCB 4ODSH 5EIQA 1FNHA 4HIIA 5ID1A 5IW1A 1MHEB 4ONFL 4OT1L 1WBXA 3VWKD 5JLZB 3DBXB 1IEAA 1S7XA 2VQ1A 4PJBA 4CN1A 1C16A 4JDZA 3IFOB 4OZGF 3MUGA 3E1F1 3CDYA 3MRIA 5J11C 3B9EA 5LXGH 4N90D 4DVBA 5A2FA 1NJ9B 1A7NL 5T1KA 3ULSA 3UTPE 4PJFB 3ZKMC 4PJ8D 5GJSL 1U3YA 2VABA 4O2EA 4RWYL 4WNQA 5DMIH 4M7LT 3MXVL 1KELL 4KTYA 3DUSB 2P43B 2X44D 3BKYL 4S1QL 3I9GL 5GS0C 2ADJB 1TPXC 4UT9H 4BQ6A 3HA0A 2A38A 3S3PA 2BHUA 1I3RB 2H32H 1HEZB 1FRGH 4M61A 1I3GH 1A3LH 3KXFA 2ZUYA 3I85A 1OTTD 1FCCA 1NUNB 5F96H 5TF1L 1X7QB 1M7IA 1K8IA 3T77A 2A6IA 1GIGL 4HS3B 3BT2H 4PJCA 4IRJD 1WWAX 2AI0H 3BZ4A 2X4RA 3WEXB 1EO8L 1FO0B 3RTQC 3IKCB 3WXVL 2IAND 5GPRA 4NFCA 5JOFB 1SJHB 2E7LC 4OFKA 3BZFA 3AB0C 4PREA 3DLQR 5T3ZD 4FQQA 3U0PA 3BDYL 4NZRH 4XNZB 1KJ2H 5DHXB 4ZUUB 3UZVB 2XKNB 5FYLE 3Q1SH 1S7RB 5DRZB 3REWB 2CRZA 1OSZB 3QXDB 4PJGB 3IDUA 1LK3L 5EO0B 1FFPA 1BD2A 5AUMB 4DEPB 1CXHA 4L3EA 4O9HL 3QSKB 1IGIL 4G80A 4P5MA 1PG7H 1X5AA 5L2KB 3BKJH 1YMMA 1NC4B 4TYUA 2Y06H 1ZLWK 1HOCB 1KT2B 3UZEA 4X4XA 1M7DA 3SCMD 1OW0A 4K7PX 3HZYA 1JK8B 1I9RL 3BWAB 1T20B 2JK5B 1KCRL 5CINH 4PJCF 4PB0H 3SKMA 2VUYA 4G8EA 3REWA 2G2RB 3ZDXF 5DK3A 2F53D 3A6CL 1K8DB 1S7VA 5ILTL 3VU2A 5EZLB 3KXFE 2AK1H 3NACL 4PRAA 3WIHL 4OLUH 5BV7B 5DHYA 3FQWA 3VI3E 4KDVA 1BM3H 5AAMA 2Z4QB 1K2DB 1NCBH 1D6VL 4W4NA 1DE4B 1T2XA 3V6ZB 1FO0A 4U3XA 1YEJH 2R2EB 2YZ8A 4PGBA 1CL7I 4PV8B 2XRAL 4EN3C 5BRZB 1MCIA 4G6FB 2YC1A 1H8OA 1E28B 2GITA 2W65B 2XXMB 4QXGH 4GAFB 4PRIE 1RIVL 3WFBL 1A7QH 3P73A 4ISVB 1SJXA 2ICWA 5DD5H 2BVOB 5GS0L 4LNRA 1ZOXA 3PV6A 3TIDA 1H3PL 3DYPA 4QOKD 4XB8A 2PXYD 3P0YH 2IANE 4IEFB 3TF7C 4MHHI 4OBSA 1KLFA 2OZ4H 4G8GD 4OUUB 5TFSL 4KRPC 1WV7T 1R6VA 1OAQH 1G84A 3O11A 1ZA6B 3TYFA 3AROA 4QRPB 4NM8H 2X42A 5CIPH 2Z93B 3WFEL 5IFAL 1D5IH 2VDML 1T20A 4Y2DD 3P9WB 2VSCA 1IBGL 3TESA 2CQVA 1J8HE 2OJEB 3WJJA 4QRQB 2PO6A 1CXKA 2CKNA 2EIZB 3VXMB 5GS3A 4L4TB 1MSPA 4J6RL 4KUZL 4FZ8L 3VJ6A 3RWJA 4H8WL 1AY1H 1KCVH 3UZQA 4ZUWB 2GJZA 1B0WA 4UILL 3DI3B 1AGBB 2CR3A 4J3SA 4MJ5A 4RAVB 3S36L 5TE7L 2QEJA 1FNAA 3D0LB 1J8KA 4JHWH 4UDUB 4CN6A 1AD0B 1JI1A 1TJHL 4WFFE 1L0YA 4ZS6C 1SEBA 2DMBA 2J7LA 1SY6L 5IB2A 5L0QC 4Y4FD 4GAJH 4HUMB 4XCCH 3HE7D 3RWIA 2FIKA 4U1HA 5DO2D 1MRFL 4UOJA 4G42B 5EU5A 2OTWB 1TIUA 5C0JA 2PKDA 4MAYD 1BQLH 1WFTA 3JVGA 1ZT7B 3V0WH 5CS7A 3P2TA 3TZVD 3DGGB 5KS9B 1MFDL 4TPRH 1DBMH 1A6WH 3MBEA 3LN5A 2Z93A 5C0BE 5I74C 1IJ9A 4L4VE 1MF2L 4P3DA 4UINH 5LAXA 3NOIA 5IT2L 1PFCA 3K4DA 1XCTA 2VOTA 3BP7A 1VPOH 4PJCB 5SX4H 1KACB 3MV7E 3QDJA 1XIWD 1Q9OA 5MHSE 3QUXC 1MLCB 4RIRB 1E4WH 4B50A 4AK1A 5BVPH 2KDGA 4YHPA 1U36A 3DX6B 3HZKB 3AFLA 4ETQB 1TVBA 3EDFA 1BREA 5KBNC 1KJ3L 5ALBL 3DXAA 4PRNA 1EFXA 4G9FE 3V7AG 1GGTA 2P24B 2YN5A 1JL8A 5FA4B 3MXVH 2FBJL 1AXTL 1HNFA 1FVDA 4X6DA 2RCSL 4BFBD 3IFPA 3HE6C 4OGZA 3I02A 4E0RB 1D5ZA 2J8HA 1ZGLM 2XZAH 2JJWA 4OFIA 1RUAL 5L9DH 5FCUL 5C8JA 4RISL 5EBWA 2VWEC 4KK6C 1E4XI 2IADB 1CFSA 3QI9D 2ADGB 1E4JA 4UIKH 5DJ0A 5JPMA 2E3VA 4P3CH 1JPGB 2BSSB 4HXBH 1MCOL 5CEZE 1ED3A 5EH1A 5DC0A 5HI4C 1GPOH 1KSRA 3RZCA 5D72H 1AXSA 2X1PA 3F7RA 2BVUA 4U1GB 5CSZB 4MJ4A 1KC5L 3AVEA 3HNSH 3GSOB 1FFNA 3LIZL 2OR8A 1N8ZA 4V2CB 1AGBA 1WCBA 3J7HA 4NP4H 1N7ML 1CFSB 3O2DH 3W9DA 3K46A 1OSZA 1RUKL 4JQVA 1A5FL 1ZLUK 5C8JB 5KAQG 3DX6A 3G5VB 3HZKA 1BLNB 4CVZA 3RU8L 1DBJH 3NPSB 1T04B 1YNTB 5F9OL 5J89A 3D25B 1FN4A 5TE4L 2LAAA 5DMYA 4DW2H 3SGJA 4TSBL 1QSFE 2P24A 5DO2C 3S96A 3CFKB 4GT7A 1OWWA 4NO0D 4YAQA 2ZUQB 3L3HB 5BVPL 1AKJB 2I26N 1CGSL 3VGEA 3VXSE 4TUKH 3LKNA 1JF1A 3MLYH 4JCLA 5INDB 1CICA 4ELMF 2GTWB 4DZBA 2WNGA 4DK6A 4JRXE 4BA8A 4L4TA 3KWWA 4PGCB 1XGRA 5LBSH 5D1ZD 3LZFL 3SPVB 3VFNA 4NRYA 4YDLB 4P9HL 4PJIA 1XF3A 3BPCA 3C6LA 1MFEH 4KVNH 2ZPKH 4LLUA 4NQCE 2JCCB 5C92A 3VGAB 2NY7H 3RWFB 3ME0A 2DIJA 2JJTA 1HH9A 3KYKH 4R7NB 1RUAH 4HT1L 2YD3A 4LHUA 1WAAE 3GSQB 3O3EA 1DVFD 3BIKB 5C0IA 3CH8A 3RDTA 5K9KB 3D0LA 4KTDH 3KPLB 3C5JB 3BH9A 3EOBA 3VMPA 2CMRH 2R2EA 1O0VA 3O4LA 4NQCB 1SJEA 4Z7NF 3L5IA 2W59A 4FQXA 1NGYA 4MYWB 4XBEL 2GAZB 1FYTB 3O4OB 4HX1B 4HW6A 1NH6A 5EUKA 3G5VA 3DOSA 3KYNA 4R6UA 4I4WA 5D93C 4WV1C 2ICWB 5ANME 4A2MA 3QHZH 5BV7C 1LEKB 5IV2B 4UILH 5FGCE 5E7FA 4LBEA 1KEML 1QSEB 2AGJL 4I18A 4NCC1 4F37K 3O6FB 2AK4A 1EAJA 1I3VA 4YO0A 5CLTA 1IMHC 5BZWB 1H3GA 3VG9C 1IEBA 3KPOA 5EPMA 4A6YB 5DJAB 1YY9C 3VH8G 3VXSA 3STLB 3MV8D 3B2UD 5GGUB 4K07A 4FXGA 3UMTA 3W0WE 5BMFL 5ESAB 1UWXK 4UT6H 1M6OA 4RFEA 3B2VL 4MDJB 1F3JB 4OQ1A 4KRPB 3V0WL 2WLYA 1AY1L 1KCVL 5GGVH 1HE7A 4DKAA 4MZ3A 5IMLB 5CEZH 1K4CB 4M6AA 4N0RA 3N1QC 4LLMB 5T1MA 2B1AL 3O6FA 4HH9B 3RDTB 3FOMA 4KKNA 3P9LA 1BJMA 4X6CB 5JOFA 2B0SL 5D2NE 3VWKA 3WKMH 4FFWD 2YSSB 1RJCA 4YXLL 4MD5A 5KG9A 1TETH 2P8MA 3PIQB 3CVHH 1GXEA 3QDGB 2YD5A 1G7MA 1HCFX 4O2FA 3B83A 4Z7VB 1H3TA 2PR4L 1JGEB 3RPKA 4IJ3C 3SO5A 4GMSL 32C2A 4EN3A 1OF2A 2NZ9C 1WZMA 3ZKXB 2NZ9D 4H1LB 3HCVA 4JANB 3HE7B 1HOCA 4G9FB 5GIRA 3GHBL 4TSCL 1ORQB 1YNTA 1KEMH 1XZ0B 3KS0J 5EZLA 4EUPG 5T3ZH 4ZAKA 3UTSA 1LILA 2NR6C 1FYHB 1X5ZA 3G6JB 5FOJA 3AS1A 4KJWC 4FG6D 4X8JB 4XP5L 1RUQL 5FCSH 1MHEA 3RTQD 2I5YL 1KB5H 5JIHA 2AQ2A 4Y1AD 1KB5B 1HIML 3THMH 4H8WC 4X80H 2X40A 1D9KA 3I50L 3MCKB 4R4FH 3QXAA 3WL9A 3HNSL 3GM8A 3I3DA 1A7QL 3MLZL 1OGAA 5AZ2L 3QFJE 2V5YA 3HUJB 2WMPA 1F5WA 5BJTA 5GS0H 4LP4A 5BZWA 1EAPB 1J1XH 1RJLB 4LNVA 5MI0B 2ZCHH 4RRPA 1BD2D 4P48A 5HPMB 1LGVA 1WBXB 5I8OH 4WWKD 2UWEF 2VZOA 3HAEA 2HJLB 5DQJA 5DHVH 2G75B 1YY9D 2AEIT 2P8PA 3HNVL 4LLAA 3WIIH 4YHKH 1R5WA 3WFHB 4R90H 5F89B 3F7PC 4OZFA 4JFPA 5DS8A 5HDQL 1MCPH 2ZUSA 4PG9A 1X5YA 4OT1H 5DC4B 4OQTL 1EEYA 4Y4HB 1HHHA 2VN4A 1ED3B 1E4KA 4W68A 2PYEA 2QHRH 4WJ5B 4NYLB 1HXMA 2OSLA 2EDBA 4ONHA 2NY6D 2R1YA 2VH5L 3AS2A 1PKQB 4WI8A 3HRZA 2GSIB 2SEBA 4M48H 5EUKB 1R3IH 3VFRB 5I1IL 3ROLA 5ITFB 4D0DA 2F5BL 5L6YH 4O5LH 2XKUA 3IF1A 4MD5B 5KG9B 4RBPK 3MV11 2EH7L 1YMME 2DJUA 4U6YB 4EQ2A 1UACL 1J8HA 3RIFK 3PDGA 3P4NA 3MNZB 4UDTB 2ESVD 1D7FA 3N0PB 1FL5A 3CCHA 5DQ9A 3OAZK 4CBPA 3IDYB 5C08E 4MQSB 4LHQB 2F54B 5C09B 3T3MF 4DKFL 3B2UC 4X9IA 3DMMB 4C56A 4BH7B 4PBXA 3FCTB 4BFGA 4I3GA 4Q58C 3O2VL 3O9WB 3MJ7A 1F4XH 5LGJA 4OFPA 3OGCB 4Z95L 5JUEH 4R7DB 5IIEA 1L9MA 3PDOB 1FJ1B 3SY0A 1KOAA 2A6KB 2PF6A 3N1GC 1JNNH 2R0LL 4XP4H 5FHBL 5LGHL 4F2MA 4J3UA 4A2LA 4ZS6D 1KIUA 3HE6A 3D9AH 4MCZA 5J06A 2X1WL 3HZYB 1ZK9A 4Y4KD 3ORJA 4EDXB 1INEH 1MQKL 1N8ZB 1UZ8B 3X13A 4EJ1C 3WNNA 4XZUA 3ZZ1A 3H9SB 1JHTB 1R3LB 4LLDB 3TYGH 3D25A 3OF6D 4F7MB 3PWNA 1NCWH 1MCDA 4IRSC 3L7FB 4HIJB 3GMOB 2MTPA 1A6AB 4JRXA 5KVDH 4RRPG 5JXED 4U0RB 3GHEH 5DD1H 1MCEA 1AO7E 2VLRA 4NNYA 5HHOD 1NBVL 2X4NA 1CE6A 5E0QA 5FUZH 3HLAB 4MQXC 4BELD 2I60L 1BQSA 1AHWC 4BH7A 3IJHB 5DDHB 3X13B 4BZ1L 3MV7A 1LWRA 1KLUA 1WLHA 2XYCA 5E4EC 2Q76A 3EYSL 2OL3B 5TPWL 5DD3L 3VG0H 3MNZA 4UDTA 4LGSB 3ULUH 3LEYL 1S3KL 1YPZA 4GMTL 4BQ8A 1FDLH 2QTEA 3MZTA 1AKJD 3QRFM 1CFBA 1NEUA 3O9WA 5T5FH 4YXHL 4HC1L 5D5MB 4E5XB 1P4IH 3MA9L 4YK4C 2APBA 4PJCE 2F74B 3UO1L 3QWOA 5F8RC 3VFRA 3E6HB 5DUBA 1KXQE 2UWEE 4HT1H 2P5EA 5D8JH 2GSIA 3QXTA 2OXHA 1MJ7L 2AK4E 2DQUL 3FFCB 2JJSC 1DFBL 5KS9E 3PABB 1F11A 3C9NB 2VLJD 2F58L 4Z76B 2V6HA 4E42A 4KUCD 1P7KA 4HIHB 1IAII 4ZNEE 4XVSH 3VD9A 1PDKA 4LCUB 5C9JB 1A1MB 4K9EC 2FHCA 2P8PB 1CXFA 5HYSB 2HJLA 3OZ9L 1LE9A 2CRMA 3QUYA 5D5MA 4XC3L 3WIFA 4PJBE 5IW1B 4N8VG 3RAJH 5DURB 5CJQL 1CDYA 4NDMB 3AREC 4ZFFB 2FSEA 1F58L 3PWLB 3O41A 2B1HL 4GKNB 5LAXB 1FLRH 1R3KA 2CK0L 3K7UA 3MLZH 2HJFB 1WIPA 4JM4L 4JFHE 4IOSD 5J7CC 5JW4R 4PJFE 2J5LC 1R5WB 2VXTL 4RAHA 1OAYH 2AAVA 3QI9A 4MX7A 5FGBA 3OXSA 3EO1A 2P42B 3QCTL 3SE9L 4OTXL 1QLRA 2PW1A 3IDYC 4PS4L 4X8JA 3BKCH 5EN2A 4GSDL 4BYHA 5I17B 1ODAA 1R5VB 3MROB 4ZAKC 4OZ4A 1OGTA 2V2XA 1HNGA 1VKXB 5IFHH 3RZCC 4ZUVA 3D2UD 2DTML 5IGXH 1FIEA 3RKPA 2X4UB 2P5WE 4XCCL 1S78D 3SQBA 4XMLH 1HN1A 1UXSB 5DZNA 5E6ZA 4J3XA 1A4KA 1HI6A 5ECJE 3RVXD 3OB8A 2RBLA 3RQ3A 2GJ6B 3WSQL 4PLJC 1EO8H 3C5ZD 1N64L 4HIEB 2ILLA 5JNYA 4R96B 3BISA 4JQVC 4RGMC 5K33A 2V5SA 1QFWL 12E8L 4UINL 2CSPA 4LSPL 4PTTB 5C0CA 1VACA 3TA3C 4KAQL 5CKGA 4J2XA 4PJHE 4Y5YB 1LNUA 2C1OA 1NCDH 3OR6A 4GKOA 4YBLB 2X4OA 4YFDB 1KTDA 4XVSL 1NBZB 2X89A 4M4RA 5D7IF 5IJKA 1BX2B 4WEBL 1Q0YL 4JKWA 1TJIL 1QLEL 3ES6B 3GK8H 3TN0A 1PG7L 2G5RA 4GRLB 4NZUH 4Z7OE 1FL3B 2J4WH 4C59B 5MI0C 1NAMH 1IAOA 1XT5A 4H20H 3K8LA 5BVJA 2HTLD 5E2WL 1FLRL 2CK0H 3GSUA 5HGGS 4LSDA 4R3SA 5FV2A 3RX8A 5ISZD 1SEBB 2UYLB 4BQCA 1ZA3B 1YN7B 3WXWH 1BOGB 1I8MB 5IEHA 2Z91A 3SE3A 4XXDA 4DGVH 4WUUE 2XTJE 4QGYA 5KJRH 1JJUA 4TVSa 1NJ9A 5T1KB 4G8EB 5IB4A 2LQRA 4AIOA 1M7XA 1XEDA 4AZ8A 4Z0BH 4DN4H 4JHAL 4NGHL 2CIKB 2FO4A 3KPSD 5JZ7D 2NY0D 1U95A 7CGTA 5DS8B 1RK1A 4QT5A 3M8OH 2R1WA 5CZKA 1CF8L 5F7MC 2YMXL 3ARBC 2UY6A 4FQ2H 1YN7A 3SE3C 1UB5B 5IR1B 2X7LA 5HDQH 1BEYL 5C0CE 2WUCH 3CFBB 2C7UB 4R3SB 3TFKC 3FN3A 2VLME 4L8SC 2O5ZH 3VA2C 2X4PB 5BVJB 2XXCB 1FIGL 3SE4C 4QRUA 5HGHB 5E2TH 3UYRL 2XA8L 2YPVH 1XGTA 5JTWA 1GYAA 5KN5A 2AJUL 1KIPB 1FL3A 5J1TC 3BQUB 3ARBA 1HCVA 3V7MA 3QDAA 4EQ3A 3KVQA 1UKTA 1FG2B 1VGEH 2CLVB 1MFBL 1UYWL 1H8SA 3KYNB 2D9CA 2XZZA 2Z9TA 4IRSA 4KGLA 3MGTA 1UZ6E 3ZE2E 2A0LC 5F9WB 4HK0A 3VFOB 4JO3H 3SE8H 3MBXH 4HFUH 2D0FA 5HDLA 3LQZB 1AXIB 5EZOH 4BK4A 4X80L 5D2NC 5ADPL 5MENB 5C6PB 4ODVL 3V4PH 4PREB 3LPWA 5DUPH 5ACLA 2VQTA 1PX3A 5FYKU 1J86A 1HSBB 5KZCD 4JY4A 3MUJA 1YEGH 4QOKE 4WI9A 2GFBA 1AQDA 4ZO9A 4PG9B 1LNUB 1FHGA 3D3VA 1IM3B 1NANI 4PLJD 4DVRL 4QHMA 3S4SB 1L7TH 4XPAH 4S2SA 1C08A 2HLAB 3QQ4B 4M7JH 1DSFH 1CDHA 5DJ6A 2P48B 5F7NC 1G7LB 5EU6D 5B39A 1U9KA 3CDCA 3D85D 5DRZA 1WT5A 3ZKSD 3EYVB 1MRDL 3L3HA 4OIIL 4I0PD 1E4XH 3SDDB 5JPNB 2DLFL 1VEOA 3LH2L 3Q48A 4JFEE 2YPKA 4PJEE 4NWUL 5F3HB 1NC4A 3VXQB 1CU4L 4N8VB 5IB1A 1G9NC 4AM0A 1MHHB 5IVZA 3OKEA 1KENL 2GT9A 2DMCA 3O6KL 3BXNB 3QULB 1UFUA 3V5DA 3Q6FB 2DRUA 1BWWA 1I7UA 4YK4B 4Y1AA 4LLYA 3FFCD 5JHLH 2EXYC 2EH7H 3F58L 2DI9A 3O2DL 4KROC 2CDFB 1IT9L 2XWBA 3PXJA 2XN9D 1SVCP 5ESAA 4U1JB 2MCPH 1S3KH 5CSZA 3B2VH 2EC8A 5BRZE 4DKFH 4QXTB 3QEGL 4O4YL 2FJFB 1I8KA 1CGWA 3PQYA 2CDGB 5KTEH 4OCYH 4LDOB 5EOTB 1B6DA 1JNLL 4LSUH 3TT1L 4B41A 3NMEA 4JGMA 3UTTD 3T77B 4LLYB 4JJHA 3QIUC 3KXFB 3MLYL 3Q6FA 3LEXA 1PSKH 3MRDA 4LCWD 5CGMA 1N0XH 4Q97A 4H5SB 5J13B 4WFFD 4K7PH 2IFGA 4FHBD 3PIQA 2GY7B 4KMTH 1LO3H 1A7BA 2YA0A 5JPNA 3NTCL 4ZTOL 1T4KB 2F9BT 3BYYA 1HILA 3VFMA 3S88L 1R5IA 1MIML 3X14A 4K3DL 1DSFL 3B9VA 2AV7B 3QNXA 2AXHA 3AC0A 3BW9B 4HG4J 3JWOL 3U82B 4OKDA 2OL3A 2Z35B 3F7YA 5GGTL 4P4KA 3DGGA 1E6OL 2IALA 3MXWL 5D7JA 4ZFOB 3T65A 1ZLVH 3TPUB 3VFNB 2VZVA 3FZUC 2VDRL 1RIHL 3MRRA 3S35L 1W0YT 2DM3A 4LIQE 4W4OC 2JJSA 5EDXA 3CVHB 2ICEA 3IDIB 4JO2L 4JE4B 4PLOB 3KLAA 4ODHL 5F44A 3GGWA 4FQ1L 4IHOB 4YGAB 1FLTX 1YPZB 3STLA 1QSED 5I1GH 4OV5A 3SDYL 4CAGA 1YZZA 2XFXB 1PLGH 4XP9H 5GS2H 4Z8FH 4B7LA 4LSQL 2HKHL 1JNHA 2DKMA 4JHBA 1KYOJ 1MH5A 4RMWA 1YUHA 2Q7YA 3G08B 4ZPVB 1FQ9C 1P4IL 2AJ3A 3NCYP 3QUYC 3MSPA 4GKZA 2PTTA 3C60B 1XR9B 4NNPL 4L8CA 1Q94A 1NCCL 2NTFB 2ATPA 3HMWL 4MNHB 3AREA 4NQDB 4M1CC 2AEQH 4EI5A 3FN0H 3VGGA 1FSKB 4U1NA 1AD9B 3OKMA 4Z77B 5KJRL 4QRRB 2AJSL 4QF1B 4P23C 3JUYA 4NT6A 3FTGA 5DJXA 3P30L 5CHNB 5J3HC 4BKLA 4MNQD 1BF8A 2VZ1A 3GRWA 5CJ8A 1RFDL 1Q9WB 4JPIB 3RUGE 3K1DA 4JKPL 1XGUA 1EFQA 2VLRD 4TNWF 2AKRB 1QRND 4WRLA 1KN2H 1TQBC 2AJYL 4AL8L 2DQIL 1VFAA 2P5WD 2GJ6D 4NRYB 3VI3F 4AQ1B 4P57A 5BS0B 5K9QI 1VENA 2BY0A 1YYLH 3CK0L 5CFHA 1BD2E 5ADPH 5KSVB 4HUWB 5D1QA 1GAFH 4KPHL 3OTTA 2CO6B 4MS8D 1FVDB 5ADOH 5L9DL 1MCCA 4P3WA 4PJ9B 5HDOA 1WBZB 1A6UH 1DP0A 1ZWIB 5E2WH 1WFUA 2NY3B 5LBSL 5ITBL 2FYYA 2VB5A 4OQTA 5FECA 1BZ9A 1VEPA 1PW3A 4OB5L 3OXRA 4Q9QH 3S34H 5DJDB 5HXMA 3ULUF 3IXAA 2FJGB 4JRYB 4X5WB 5F1IA 5I16B 1IM9A 3TBWA 3BKMH 3LPFA 2E27H 2Y5TA 3BOVA 4ELKB 5FKPB 5EU3B 2G2RA 5A3IC 1HKFA 1U8OA 3ZLQC 1FFNB 1EDQA 1MFCL 1QEWB 4BFIB 3SDCA 4JPWL 4Y1AE 2ORBH 3KR3H 3DVIA 3EFFB 4PIRF 4RSVA 5ENWB 2DICA 1JWUB 4U1JA 3W9EB 2FD6L 1U92A 3QHZL 4MXQD 3RVUD 1U8MB 4O51B 5DR5L 3NCCB 3BX7C 5E7BA 4LOUC 3GIVB 4FMFA 3V0AC 3B5HA 1F90H 4OLYH 5JDSA 4NKIL 1Q1JH 5FYLH 4XBGB 2QSCH 4JAMA 2WBJC 4WUUA 5E6YA 1BZQK 2VXUH 5K59E 3ZKXC 4MAYC 1WTLA 2NY4B 1MCQA 4APQC 4NQEE 2FEEL 4PRIA 3ULVD 2OL3H 1CN4A 2MSPA 3LRSB 3RX5A 5DYOA 3VFGL 3HE7C 3F12A 2GI7A 1MOEA 1PZUB 4XPBL 3HC4H 4LLVA 1A9EB 3QDGE 5GISL 4OLEA 3PWPA 4FMKA 5GS0D 2BY1A 1K5NB 5HGAA 2ZPKL 4HKBA 4X99B 1GC1H 4DOHB 1DN0B 3MYJA 1ZTXL 3FQRA 1HEZA 1C12A 5EBLA 4UTBH 4RIRA 1U8JB 5HY9A 4YXKH 4O2FB 2W9EL 2BMKA 3EFFA 3AS3A 3S4SA 4FQQB 3U0PB 4APQA 3X3FH 1QRKA 1RZFH 1F8TL 5I1LB 3HE7A 1XCTB 3O4LE 2W0LA 4ERSL 2JIXB 4OB5H 4YDVB 4C83A 1YECL 4LSVH 5EUOE 3VXUB 4KZDL 1SEQH 5JW3H 5F70A 1K8IB 3TZVA 1RHHB 3H3KA 3NZ8B 3VFSA 2VDKL 4M7JL 4Z7VF 5IMKB 4QXGL 4X7FC 3BMWA 3I6LE 4KXZH 2HFFA 1A1MA 3S5LG 4K71B 4HUKB 2PCPA 5L2KD 1K4DA 1X5KA 3GSRB 3RWIB 5B39G 1VHPA 1F3JA 1TQBB 3QDJD 1S9KC 1LO4L 4ZQKA 4CADB 4HD9A 2VUOA 3U7AA 3GMMA 4B0MM 2NY1D 4HIXH 4LMQI 3VWKB 1A2YA 3U6RB 1RURL 5CBEB 1N7MH 3GMLA 2QQLL 4EZMA 5EU3A 3AU1A 3D69A 1E6JL 3HNVH 4XNZC 1BF2A 1AGDA 1T0MA 2CK2A 3JV4A 5B4MD 4X8XA 3D0VB 1EJOL 5ANMB 5KSAA 3CVIL 3WIHA 3RWHA 5J6GA 3EYUL 1BWMA 3CSYB 1EFXD 5KSBF 1YEHL 1RUQH 2YEZB 1KCRH 2NCMA 5JHLL 1MJJB 1X6NA 2QSCL 4G9FD 4E5XA 3AAZB 5FA3B 5C0FA 1XMWA 5EZOL 3G5XB 3TYGL 1P2CA 1EUUA 1BGXH 5IVNA 1K8DA 1S7VB 3B9AA 3BMVA 4N9OB 3QYCA 5J4MA 2OLDA 2AKRA 1CXIA 4HZLA 4XCEB 5AZ2H 1A22B 2J8UE 3UBXB 1KCSL 1D3CA 1CGTA 2AI0L 3VFWB 4NQSB 3LOWA 4LCIH 1EHLL 3BEVB 2XTLA 3RWCA 1AQKL 1C7SA 5E8PB 5DMIL 3D6GA 4MXWH 5DF0A 2PXYB 1X44A 1ORSB 3KGRA 1AIFB 3QIBA 3UTQB 4PRBA 5B8CB 3O11B 4PGDA 2Y5EA 4UT9L 5I2IB 4GMTH 3QUKB 4DN3L 3ZYZA 5KVFH 1ZA3A 3LRGA 2CXGA 3SGDI 1Z5LA 1BD2B 1A6AA 3EJYC 1J05A 1G6VK 1U3ZA 2I27N 2VKXA 4KKBC 4Q6YA 1L0QA 5J6HA 4N9GA 4ZPTB 3G08A 4ZPVA 5BZDB 1QBBA 3MMEA 5CGYC 3MRKB 5IK3A 4KK5C 4OZIB 1AC6A 2WIMA 4PJ7A 4M6ML 4MGXA 5D1ZC 3S7GA 3IYLW 4P23A 5H94B 4OF6A 1HH9B 3CFEA 3VXMD 3MRNB 5AWNH 3ESUF 3MXWH 3OKNA 2R0ZH 1KN2L 1MCHA 1TZIA 35C8H 4U3CA 4L9LC 1DBKL 4F33B 4Z7UE 3FCTA 1YC8A 5JHDA 1UACH 1JNHB 4GW4A 3QUZD 2VXSL 4KHTH 4KWUA 4ZD3H 43CAA 4O9HH 4GRMB 1R24B 5J9PB 5D7KD 1T7WA 4WDIA 4P23B 3QH3A 5HGDA 4HGWB 2P45B 2FLRT 2FR4A 1U6AL 3BUYB 4YHIA 4ZXBA 4DJMA 5CD5D 5HGBA 1M7DB 2H45A 5HPOA 2C5DC 5BZDA 5D7JC 3GMRA 2EE9A 4P5TD 4YHNB 4OCWL 1A9BA 4XPTH 5GGTA 5KSUA 1VKXA 1JFQL 7FABH 1F3RB 2V5TA 4OJFH 1RY7B 1DQJB 5FFLA 2VLLB 4FN0A 1LO3L 5DK2A 2ICCA 2KL6A 1N4XH 1OTUC 1QQDB 2OXGA 1RK0A 2Y25A 3U36A 3PGFL 3TLRA 4WW2A 1WZLA 4CMMA 4KQ3H 2GUOA 3PP4H 1FH5L 4UV7H 5GS1A 4WCYL 2ZUQC 1YNLH 4OBRA 2EDHA 2DM7A 2HJFA 1FVEA 4G8IA 5IM7B 2BMKB 2O93L 4RCAA 2BZDA 2BVPA 4N5UA 1QACA 5EZIL 5TGBA 2OJZL 4B53A 1SBSH 5FUCE 3ET9F 5FK9A 1B2WL 4ENEC 2M26A 1DUZA 1N26A 5ACMA 5IKCB 3TNMB 4LDLB 4S1RH 4PJXF 4ZS7L 5KW9L 2E6JA 4PRPE 1ZLWH 2J3SA 1U41A 3PQYD 5T1LB 4M6NH 3IFPB 2CXKA 3QWQB 4MD0A 4QHLB 1UB6B 3GRWL 1JGVH 2ESVB 2BJML 5CZVH 3ULUC 2LV4A 3SO3B 4N0FB 5JW4N 3U30B 4WO4D 4WNQB 1ADQH 1YNKL 2UZXB 1W8NA 4ODBD 4K2UH 3ULVH 1FO0L 3I75B 3PL6B 5E8DH 4YHZL 2LABA 3TO4A 2AJVH 2QL1A 4NKMA 4KRMB 2GSGA 1DLFL 3K80A 5I1HL 2IGFL 3GJFA 2RAMA 4R4FL 1DN2A 1IZKA 5D1XD 3L3DB 2DDQL 5GZNC 1KJVA 1XH3A 1UH2A 1IQWL 5D93B 2IFFH 3JV0A 1A02N 5CSBA 2YPLD 1NEZG 2YA2A 4F3FA 1JF6A 1LO0L 1SY6A 5GGSB 1MAML 5C3TA 2MFNA 1S9WB 4GXUM 3BVNA 4X5LA 4P4KD 5ABDE 3MV9B 1G7LA 2QHLA 2B2XH 4M00A 5B39B 1FGNH 1V8HA 4HS8H 5D7JD 1G9MC 3NABL 4MQ7A 3OAZH 2KBGA 3BFOA 2Y06L 3TN0C 2WIIA 4U3HA 2IAMD 2ZCLL 1U8NB 1ES0A 1VFBB 3MLUH 2Y7QB 1JWSB 3WMSA 3PP4L 2R2HB 3D18A 1Z5LB 4Y19A 1CG9B 1PYWA 1A3QA 3PE9A 4JO1H 1MREH 3F12B 1U8KA 4OCRL 1SM3H 1MHPL 5JHDE 4PRBB 3E3QE 2D7TL 2FL5A 3KLDA 3PWNB 1OAYL 2DLHA 4YUEH 1BEYH 4LK4A 1YEFL 3PGDA 1P5VA 4NRXA 4YPGA 3VRJA 1ADQA 2HFEA 5TE6H 4WU5B 1JGUL 4PJAE 4PGJA 3PF2A 3CFCL 3CXDL 2EXWC 3RTQA 4KUCF 1TNMA 1BM3L 2VC2H 5DJ2B 2FWOB 4V1DE 3RDTC 2PNDA 5HHMD 4KTEL 3KLHD 5A2KH 1I1FA 5CZVL 3BKML 4XH2B 3V79C 4X9HA 5CMAA 4IOIB 1DTUA 3GKWL 4M1GH 4TUJB 3M07A 2RGSA 5JXAH 4FFVD 1BFSA 4MWFB 5H2BB 4LSTL 2A2QT 4M6MH 4UQ3B 1LEGA 3LKPA 2V17L 1BQHA 3T1FB 1IILE 1VCAA 2VDQL 4K8RL 4L8SA 5AWNL 4GG6E 2F53B 1NLDH 2XZQH 4MHHG 5F7HA 1E28A 1Z9LA 4BSWB 2VYRE 4Y8AA 4MMXC 1NCUA 1WIUA 1IKNC 4YIQB 4JFFA 4KTDL 5IMOB 4NNXB 2B5IC 4BK5A 2AABH 1CXEA 1FNFA 4XPHH 1C5BL 1IEHA 1MNUL 1Z3GH 3ARDB 4HJ0C 3L3IA 4F7TB 5GGTH 1HHIA 1AO7A 5IB4B 4HS6B 3BP5B 1BQUA 4L8SB 4F8TA 2BHYA 4HLZG 4AMKH 4H20L 5L2KE 4KKLC 4GRWH 1S5IH 1BQHB 3VXRD 3WDJA 3OHXB 3AXLB 2BRRL 1HQRB 3EYOB 5GS2D 1G0DA 1FIGH 5SWSE 2G60H 2XTJC 5CIPA 5E8NA 3EGSA 4JFHD 5J12C 3B9DA 2DWDA 4JGJA 3K3QA 1GHFH 4X0KB 5CJ5A 2FH6A 2APTA 5F9WC 4HKJA 5SWZA 1ZGLP 1XF4A 1KGCE 4FQHA 3DSNA 2HRPH 4JFZH 4D0CB 2VXVL 3PL6A 3HPJA 4I2XE 5EZJA 4MJ6B 5D1ZB 3U7YH 2Z92A 4PG2A 4LSSH 5BJTB 4S1SL 4X4XB 1URLA 5FKAA 4K23H 1BQLL 3G6AB 2EXWD 5C0EB 3SKJL 3MCKA 4NUGH 4U1NB 1KJVB 3FJTA 5JMOC 5EO1A 2MWCA 1CBVL 2H6PB 5DRXA 4H5SA 6FABH 3A67H 3CC5B 2BOCA 1T5WB 3KPNB 1DQML 1MF2H 2HMIC 2GCYA 1DLHB 5IOPB 4PJAF 2ZUVA 5FGSA 1NSNH 1EGJL 3HI1A 1CFNA 3HPLB 2YOCA 2X9WA 4XNYH 2IG2L 2X05A 1U8QB 4PJ5B 3U9PL 1MCSA 2R2CA 3BZFB 4ZUSA 3O3AB 1JMZA 1OPGH 3QCUH 4OLWL 1YYLL 1JIBA 1D5BA 4H88L 1WGOA 4YNYB 4Y19B 3MRMA 3U36B 2VDPH 4R0LB 4ZNCD 2WP3T 1DQTA 4PV9A 1CIDA 4P59L 4TQEL 3S8WA 2WIIB 4UOW0 2WAHA 3EUUA 3WFZA 1ZVSA 4HAGA 4DUWA 2D7QA 3MA7B 2ZCKL 4L8BA 4X6DB 2ADJA 5A2JH 4LLQB 4LDEB 3WLBA 1QFHA 3W11C 4QHKJ 5DHVA 4NWTL 3X3GL 2WW8A 3LDBB 5I1CH 3T0DA 2I9LA 2BJMH 2ARJA 4JM2B 5D70H 3SKUD 3GUTB 1KJ2A 1O5DT 4OTXH 2FHBA 4MNGB 4N5ED 3FQXB 4RGNE 1UB6A 5D71L 1ND0B 1GOFA 3NBNA 1KF9B 3MBEC 2OM5A 4OLZL 2EE2A 4L4VA 1ITCA 2XQBH 4NC1E 4NHUA 5IQ7H 4FQLH 2RHEA 4QYOB 4LSQH 5LVEA 3FB5B 4J8RA 4AG4L 1AP2A 4DEPC 5JQ6L 4X5XB 1KC5H 2Y23A 4WHYG 4F7PB 3F7VA 5FXCH 4TULL 1QD0A 4M62L 1J0ZA 5E5RB 2VR5A 3HN3A 1RJYA 3SO3C 5CJXA 3ARGD 2CDGA 1OOAA 4BJLA 3H7LA 5KSAD 5JA9A 2EECA 4ZUSB 5GS1B 2DL2A 2M8XA 5IW6A 3W2DL 2W91A 4HUWA 1XGPA 2QV2A 4JG0H 4Y16A 4PLKC 3DVFA 4MDIA 1QFUL 3C6LD 2HVJA 2R0KH 2F5AL 1I1CA 4YHLH 4QXUH 5IK3B 5HVWA 3FB8A 1CE6B 1MLBB 4JFED 5DUML 5SWSA 1XGQA 2VNCA 4UV4L 5E6IA 4JKPH 1YMHB 5DMGC 2AXJA 5E8OA 3HB3D 1CD1A 5I0DA 4YHNA 5MEND 1N6QL 4Y4HC 1J0HA 1I7TB 3VXQA 1KN4H 4JDVA 2A83A 4H0HB 1GL4B 3FMGH 1ADQL 5GRZA 3CK0H 1DBBH 1SYSB 3O45B 1BP3B 1AGCA 1UXWA 2FR4B 1DJSA 1H15B 1IAIL 1NAMB 3OGOE 1KIRA 1HKLL 4ZUTB 3TT3H 4X6EB 3ARYA 1FJ1A 3Q1SL 3WXWL 2AK4D 1GZPB 3MLVH 4M4PA 5I0ZA 3ZKQD 2Z31A 3QO1A 4ZOBA 1IM3A 3LV3B 1XGRB 2CMRL 4KQ4H 1UZ8A 1EERB 1R3JA 1JTTA 4MQ7B 4OLZH 4JN1L 3ZDYF 1FH5H 2V2WA 2XFXA 1RZJC 5D1XB 3SDXB 3RVTD 1TCMA 1R3HB 3M1BB 1N2RB 3BDBA 4NBYB 3VWJD 5MEPA 3IRPX 2R8SL 3SGJC 4Q0XH 4AEHH 1VERA 3NFSH 4UNUA 5CP7A 1MCBA 2YUZA 5INCA 3BO8B 3WNOA 3OKLA 4HXAL 2JELH 4JFDE 1G9ML 4A6YL 1RV6X 5F6IC 2NNAB 4FS0A 1G7QB 4O5LL 3QEQE 1BBJB 1X5HA 3ZYJA 1NCBL 1Y0LB 1RJZA 5SV4A 4YHKL 4NQDD 3VXPB 4JZOB 1I7RA 2ED8A 2H26A 2ZOKA 1AGEB 2C26A 4Y4HA 5GGRB 2X4OB 1NCAH 1WJ3A 2NMSA 4P46A 5E8DL 5ISZA 4Z5RB 5L2JB 1UADC 5IJKC 3FQWB 3QDJE 1J10A 5H2BA 5L0QB 1KCSH 2VXUL 3EJZD 4YFLI 3L5JA 2XZCL 3O3UN 1EHNA 1N3NB 5I1JL 5EBLB 3E6FB 1DQLH 3WLWD 3GBNL 1GHFL 4PP1D 1IAIM 2W0FB 1Q72H 3HAEB 5DQJB 3FAWA 4HWNA 2QQKH 4NCC2 3VRIB 4Q6IA 2YPLB 4FQXC 2BVQB 1OAQL 4PJIE 2VAAA 1UM5H 1QLFB 2JIXA 3E2HB 1HINH 1A4KB 1HI6B 5I74B 2JF1A 1L7IL 2LAGB 3EOAA 3DARA 5F1OB 5E2VH 4Y2OA 2FX7L 3D0VA 4NN7C 1DQQB 3WFHA 3UBXI 5CBEA 5DFWH 5F21B 4KJPC 1DL7L 4YEFA 2IBBA 1QPXA 4P2OC 5DHVB 2VLMD 4AH2A 2AJZA 4PJEA 4GAGH 5IVXB 3WJLC 2ZNXA 4XWOC 2ZP0T 1INQA 4RFOL 3FQNB 3O2VH 5FGBC 3T0VA 2NNAA 3W0WA 1HXYB 4LARH 2VDKH 1I1AD 3QIWD 1OCWH 4HKXB 4N8VA 1FP5A 4AYFA 4GH7B 2RQ8A 3S36H 4ZFGL 4JJ5B 2CDEB 1FAKT 1NLBL 4W6XB 2ZOLA 1NBQA 1UEYA 4KXZI 2C3VA 5F88A 3FT3A 4NQXA 3SE4A 3HC0B 4GG6A 4DGYH 1MWAH 2WANA 3O6FC 4PJ5A 3EHBD 3X12B 5C07D 4DUVA 4R4BA 2IPTH 1JGDB 1IC7L 2J88L 4NQDE 4JQIL 2MCPL 5T5FL 4N9GB 4PV9B 1CFQB 1N6UA 3MA9H 4I0PB 4YDKL 5D6CA 3CX5J 3MGTB 1UVQA 4WVRA 3BKCL 3CC5A 3IFNH 2H6PA 3EDKA 1VADB 2FJHA 4MB5A 5EBMB 2YUVA 4GQPH 3QAZB 5IGXL 4NBXB 1UM6H 4OV6F 1PZ5B 1CE1L 3CX2A 3VXUE 1WC7A 4OCMC 1CFNB 3LQZA 4R0LC 2DIBA 4QOKA 4F37F 1OSPL 3DROA 3LKSA 5DI8B 1MNUH 5I30L 4OZHA 5T5NF 5K93A 4MDJA 3NTCH 4P2QE 4ZTOH 3LSOA 2ZUWA 4KKLD 5CD3B 3FRPG 4NO5B 4P2OA 4OI7A 3MUZ1 4RMTA 2PO6B 2OL3L 1PJ9A 5KN5B 1A6ZA 1DBAH 1TTUA 5HI3D 5F9AC 4PP1C 4P5KA 3BRGC 4KV5F 5HYQB 2WBKA 2BRRH 3EJZC 3QJFA 3QDMD 1JPSL 4NQSA 3T3PF 1F97A 3BZDA 4I18C 4LCWB 3M17B 3OWEA 3UEZA 4H26A 1PQZA 4KUZH 4YPJA 4C54A 1EEQA 1U92B 3G6JF 1CZ8H 3BEWB 5GQBA 5FYJE 3EGSB 3QUXA 1KJMB 4DKEH 3GSUB 1NGYB 3HFMH 4O02L 5DD0L 5FOBA 1HQRA 5L2JA 3B9KD 2FCBA 4JVUA 3PV6B 4Z76A 3ARFB 3SE8L 4XRCA 5J11B 3VGDA 2VE6A 3GB7A 2HFGH 3R0MA 1WBYA 1NMBH 1Z9OA 4YC2C 2X1QA 4LCWA 2FBJH 2H2SD 1MFAH 1FE8L 4Q0XL 1P7HL 2NY0C 3TVMA 1WUNT 2DQTL 2ZOLB 3PDOA 2HVKB 1PD6A 3VWJC 5H35B 2VXTH 4Z0XB 4OUOA 2IQAB 3IFNL 5D96B 4HHAA 1J1PL 1MJ8L 2CKBL 5ESVB 2E7MA 3V6OE 3HG1A 1JHLH 3RNQB 4MXWL 3CLEL 1U3HD 5FGCB 3V4VH 4N5EC 1NGXB 1J0YA 2ED9A 3QIUA 2A1WH 4P2OB 1JPST 1A1NB 4DUXA 4L9DA 4WV1B 3RHWK 3BZEB 4OD3H 1KPVB 4JY5L 1KLGB 3WKML 1W8OA 1YC7A 4LPTA 4TSBH 3UYOD 1OSPH 3VXRA 5KVDL 2WUCL 3R8QA 5DZOA 1BBDH 4LAQL 3VG9B 1MPAH 1MVUA 4X7SL 3MLSH 3QHFH 1KULA 1KCKA 4IOFC 4ZTPH 3BWAA 5D2NA 4UQ3A 4P2QD 1NL0H 3PHSA 1OAZL 1I8IB 1UJTA 2R4SH 1BMGA 3MLWH 1CQYA 2VRAA 2DQDL 2MNUA 4HJJH 4GW5A 2EC9U 4YH6A 5A2LH 4CU6A 3PGCB 3E8UL 1FNGA 1UKSA 4P4KC 2HA1A 4L1HA 1NGWA 4X9FA 1JF1B 3BKYH 5DJ8A 2C9AA 4U1LA 4U1SA 4ERSH 4JM2D 1A6UL 3T8XA 3L3OA 3MLRH 3IDJA 4URTB 4NYLA 5ITBH 3GIZL 3CFKA 5C0ND 5IHUH 1ZSDB 5A1AA 3OPZL 5HDBF 4PGEA 1JGDA 1UXSA 3HAEG 3GSNL 2QSTA 3BD4A 3F65A 1EEYB 3RY5A 4ODTH 3G5ZA 1EH9A 1CDUA 5KVFL 5DUPL 5FCUH 5C08A 3ZHLA 5J1SC 4NZUL 1MVFA 5GRWA 4HEPG 4HKZB 5I6XB 3STBA 1QA9B 5F6IB 1DEEB 5HHOB 1P4BL 1EHAA 2KZWA 4HQQH 5FAAA 1MFDH 4G7VL 3E6FA 3ULUD 3RZCD 4OCWH 1BIHA 1BJ8A 1N3NA 4R4BB 5I1HH 5BXFA 1UA6L 2AV7A 3OKLB 5DGQA 3QXAB 1OWRM 3QI9C 4AEHL 1OAUH 4R4NC 3DUSA 2JKXA 1ZVYA 5E5MA 1TJGL 1WWCA 3SDDA 1KB5A 1RK0B 2E7BA 1EFXB 4YHIB 4Z0BL 3QNZA 4XNMB 3EOYG 1FZKB 5C0BA 1KPRA 4HBQA 4NSKB 1YDPA 4PTUB 4HMDA 3BGAA 3BXNA 4LSRL 1NFDF 4AENB 1N6QH 3RHWF 1NEZA 3WJLA 2ICWI 1N6VA 4FQ2L 3MRCB 3DPBA 2AJZB 5BS0A 4MJIB 3MLPA 3W39B 3UX9B 2O5YH 5CKAA 2Q86B 1QA9A 1ZT4A 1AQDB 4F15C 4OLXH 1D5BB 4UNTA 1D6EB 2YKLL 3Q6GH 5I15L 5IB5A 1YQ2A 3IVKA 5DFTA 2GUOB 1IM9D 4XCFH 3BIAX 1JUFB 1LEGB 1U8JA 3RNKB 4GW4B 4L1DA 4TUOB 5I30H 2I9TA 2X89D 4QXWA 4U2YA 1ETZA 3MJGX 4JFDA 1QVOB 4K23L 4DKDC 4F33A 4HGKC 1P69B 2VLRB 2E8YA 3SKJH 3HTLX 2Z31B 2L7UA 1RJLA 3BPNB 3DRTB 4FG6C 2HT2D 3DO3A 1D5XB 2VZ3A 5IB1B 1IGTB 4P46C 3LN5B 5H94A 5KOMC 1D9KB 1C5DB 1E4XL 2C4XA 4YFEA 3MV7B 4PGEB 4LSTH 5FYJU 4K3HA 4EXKA 3PGDB 1HH6B 2X4PA 3VXPA 1F3DH 4U1HB 1NBYB 2VISA 5T3ZL 5I73B 3B8YA 2GTZA 3I6KA 3QFDB 1IRAY 1WVZA 3SKNB 3IS1X 1OAUL 1QSZA 1UKQA 3GSVA 2H2SC 4NC2B 3JWDH 4Z7UF 4OFYA 1EXUA 4MZ2A 1QSFD 5CGYD 4M03A 3VFUA 1DUYB 3ARDD 1MH5B 5E1AA 3T0EA 4KK5D 4P4KB 1VGKB 3TEUA 2Y1VA 1S8DB 1MVUB 3RWDA 2A6JA 4AIXA 3OQ3B 3ZT7A 3MV8A 1R24A 1ZEAL 3A6BH 3EJYD 5J9PA 1I75A 2NXYC 3BUTA 1UGNA 5GGSA 1FL6B 4XVJH 4RWHA 3OAUL 4CNIA 1EBPA 5JHDB 4AMKL 3IJSB 3IXAB 3P4OB 2L0DA 2VZUA 4S2SB 3SEPA 3UTZB 3KPSB 4OZGE 3QFJD 2YPLE 4X9GA 4JFOA 4F7PA 1KNOB 5DJZB 4EEEA 1I7TA 3ROLB 4KZEL 1UQSB 5FECB 3MCLL 4CU8A 1UH3A 3SKNA 4JY5H 4I77L 1KB5L 1JTPA 4K3JL 1LP9F 2IC2A 4NSKA 5IROA 5JOPE 1EVTC 3N85H 3BP4B 4OZGA 1J8HB 3NACH 3U4EA 4NHCH 4HS6A 4OLUL 2DMKA 5TQ0L 1SBSL 4YR6A 4N0FA 1BZ7A 4XHJC 1I8KB 2XA3A 4WI7A 1FPTH 5KVGL 4WTWA 1Z0MA 4DFHA 3QZWA 4IRSB 5JR1L 4IBLT 4APQB 3ZL4L 5DJYB 4TUJA 5CAYB 2BP3A 5L8KB 1T7YA 1VFAB 2D7TH 3QUMH 4EN3D 1RIUH 1UWGH 3WO4B 3HR5B 4JFDB 2R1YB 1AHWB 2EDEA 4L4TD 5ACZB 1P1ZB 3MRLA 5TE6L 4GUPB 2YC1B 3VFPB 4TUOA 5E4EB 4R97B 1IGJB 3VXOB 4ODHH 1L6XA 2R0ZL 3ZDZF 4YNYA 2WQRA 5ICYA 4QXTA 2OK0H 5DYOB 3T2PA 2HT4D 5D7IB 5KVMC 2GK0A 4JREC 1KPUB 2H9GA 3D69B 3L3JA 4PY7A 5JIIA 1MI5A 2YR3A 4JQIH 4NZTH 2ARJB 4MLSA 2KZ1B 1P4BH 3I3EA 2IPUK 2D2OA 2FBOJ 5GGQL 3VXUD 2NTFA 1I9RH 4X7TB 1DLHA 4JM2F 1UVQB 5GJTL 1U6AH 1YEDA 5GISH 1B4JH 5C6TH 3PWPB 5BCAA 1ES0B 1T21B 3WXVH 3WNMA 4XGZB 5DEFA 1BIIB 1DQDL 5FF6A 1KPRB 1TITA 5D7LD 3K8MA 3HS0A 4U6VL 1BJ1H 3TZVB 2AK1L 3MOAH 3NH7L 2DJ4A 3TJHD 3MFGB 2VLKA 4WI4A 4YHOH 4RMRA 7FABL 3FO1A 5DVNA 4WI6A 5EZJB 4D94A 5F71A 5TDPA 1W72H 2HFTA 2Y7QA 4CW1A 2DBJA 3GI8L 3QIBC 2DLFH 3RJDA 3QQ4A 4O51A 4XGZA 3R1GH 1F6AA 4R90L 3L9RA 3F7YB 4ODWA 4KK9C 1I9EA 4IOFD 4D3CH 1AJ7H 4YDIL 2WBJD 4WHYH 3P9MA 2HH0L 1WFOA 3LN9A 2P8MB 1RUKH 15C8H 4XTRD 3NN8B 4KU1A 3P40A 4NJ9L 1BFTA 3ZL4H 2VC2L 1FCGA 3VXNB 1XF2A 1GGYA 4PJ9A 2A6IB 4QCIB 4TOYL 4TPRL 5C0DB 3O2WH 4HJ0D 3VGFA 5JO5A 3UPCA 5C9KA 2JB5H 4Z7WF 1WBYB 1IKFH 2OI9B 3MODH 5AD0B 4ALAH 1HXYA 2OMBA 4LCUA 1FZMA 3MRDB 3O6LL 4LEXL 4OM1L 2NY3D 2F5AH 3T2QA 4NZJA 3ARTA 3BEWA 4Z7UA 3G04A 2ZG3A 1UB5A 4Q7DA 5IBUG 5EWIL 3QI9B 1J8HD 4ODTL 3IXTA 3BQUA 2HT3D 1NLDL 1M4KA 4HH9A 2DTSA 1KJ2L 1GAFL 1D5MB 2EIDA 3SDCB 3W5MA 1INDL 4X7CC 5K9QG 4R26H 5ICYB 3L1OH 5DMKB 1KN4L 3LKPB 3D39B 4N0YH 2VITB 1S7XB 3I2CL 1QG3A 1A1OB 2VZTA 4MWFA 3EZ8A 5DMJB 4K3EL 4LVHB 4ZYKA 4AEIL 1OAKH 5I71B 4F7TA 3ULVE 2UYLA 1V3JA 3OXRB 4YHOL 2DD8H 5KSUB 3P0GB 4POZC 3RNQA 4JHAH 3JWOH 1ZKAA 4AM0B 4C58B 4GS7B 3EOTL 1C7TA 1YYML 4G8GB 2BRQA 3M8OL 3FO0L 3LB6D 2X1XR 4MA7L 1X3DA 3V2AR 5T1DH 2D03H 5JXEC 3BP5A 4CU7A 1RJZB 1S7SB 4NQVA 5F1IB 1OM3H 5AG9A 5CSGA 1AJ7L 1BOYA 4JO1L 4OCRH 3J8F7 4ZO6A 4MVBC 2HN7B 2VN7A 3OR6B 1XF3B 4H1LH 4JR9L 4GXVL 3ZYOA 1P9MA 4D9LL 1I9IL 3MV7D 5TDOB 1OLLA 3QBTB 3QG6A 3MLTB 4HUVA 4BSJA 1QRNA 2YKLH 3Q6GL 5I15H 2ESVE 4RX4D 3U1SH 1RIVH 2HYMA 3ZKND 5D1XA 3SDXA 3RTQB 2NW3B 3TYFB 3C6SA 1VGKA 4XVJL 2DBLH 1T6WA 3GJFK 4I2XB 3WE6A 3QEHB 3U79A 5JW3L 2H1PH 5CEZL 4YBQC 5SV3A 4HMEA 3ARXA 1TZGH 1XFPA 1MAJA 1UWEH 5CZXD 43C9B 2QBWA 3CDFA 3QQ3A 4G5ZL 1S7UB 3MRHB 3DRTA 3U7WH 4KAQH 1MCRA 3ZDXE 5AYQA 2Z8RA 3FAXA 2DYPB 3CXHK 3RGVB 2XZQL 1OPGL 4NQVB 2I24N 4N0YL 1Q8MA 3QDME 5ICXA 1AIFA 3QIBB 3LKSB 2AV1B 2ICWJ 3RFZC 1H15A 2Q76B 1U91B 1AGCB 1UXWB 3QPXL 1PKOA 2W0PA 2EC9T 5FYJH 2VDOH 3FZUD 4MJIE 1C1EH 1F00I 2FJFA 3PQYB 5T1LD 5J6HB 2XOTA 4WUUB 1J87A 4FZ8H 3H0TB 1DBAL 4DZ8B 2NYYC 3BKJL 2A73B 1RZ7L 4NDMA 4IDJH 3TBVA 1XIWB 4LF3A 3W39A 5HHNB 2G9HB 1OP3K 4HWBL 1H5BC 3MREB 5I1DB 3OAYK 4XVUD 1TNNA 1FFOB 3ZTNH 4KRPD 1NCDL 4JPKH 1K6QH 3T4YB 1LO4H 1T1ZA 5C08D 4AIZA 4UUJB 4CMHB 2P7TB 2DWEA 4OGXH 3FO9A 5HJ3B 4JPVL 1Q9KB 3VFMB 1BOGA 3K74B 1I8MA 1MY7A 4P9MH 5HGBB 3F58H 1KBGH 4M8VA 4Z7UB 2HFGL 4P2RA 3INUL 3MCLH 4HGWA 4WUUD 3L3DA 1ROWA 1CGSH 2WINA 1CLZL 4LCYA 3S9DB 1A7PH 4KKAD 4Y88A 5E9DD 2FHFA 3QWOB 2AERT 5ANMA 4S0SD 3GMRB 4JFFD 3SDDD 4G3YL 5TQ0H 3WD5L 3TBYA 2Z0BA 1S9VB 4M3KB 3UPAA 1EMTH 4NP4L 3IKCA 2WWKO 1UWEL 4OAWB 4Q2ZB 4HKZA 3GMMB 4NKQB 3DSFH 4LL9A 4PRNB 5DUMH 3VMOA 2P7TA 1AQKH 4KQ3L 3KJ6H 2B4CL 1YN6A 1X7QA 5F9DC 3G5ZB 1IQDB 5F7KC 3T4YA 5MERB 3C8HA 4S1DD 1UWGL 1R3JB 3UTPD 4UBDC 2XWJA 1EV2E 1ZHBA 3KYMA 3ARWA 3H9SD 3IAQA 5FK9B 5E08H 2JJUA 3EZJB 2X4NB 3DRQA 5F1NA 3NCJL 1D5IL 3H2WA 3RVTC 3MRMB 2FGWL 3NCBB 1FAIL 5I8EB 2BDNL 1CTOA 3DURB 3N06B 2ZKHH 1OP3H 2P1YA 2D4DA 4J12A 4M6NL 25C8L 3V5KA 4KMLB 5SWZD 4CL7A 5CLWA 5IBUB 3L95B 4HWEL 5I19H 1VESA 3FQRB 4L3EB 2EEBA 4M7ZC 5DK2B 5FO9A 4KZEH 5CUSL 1K5NA 3IETA 3RRQA 2BY2A 1J05B 3GSXA 4RQQB 1GPOL 5DXWA 3IDXL 3BZEA 2V9RA 1DLFH 4PJ8B 1B0RB 3GJEB 1KIQA 4PGDB 4YFLF 3MV8E 4X0KA 3DVGB 3EOTH 2J88H 2NR6D 5HD8D 1QZ1A 4G9FA 3VXSB 1S9XA 1G0XA 4NQUA 3H9YA 4X83A 1O7SA 4NGHH 1SY6H 2EYSB 3PL6C 4NNPH 1X6LA 4N0CD 4G7VH 4PYGA 1N5YH 4X98B 3CMOL 2EDXA 3IU4H 4JVPA 4J3WA 5I66B 1YEIH 3LKRB 2E9JA 3GSWB 2BVEA 4QRTA 4E41E 1FNEA 3SGKC 3GJFH 4OM0L 2V7HA 5D96C 4PUBH 1QSFA 2BX5A 3DJ9A 3DX7A 1A2YB 5F6HI 4IMLA 1CTNA 3BPLB 4XMPH 5DZLA 3ZKMD 3V6FB 1YJDH 4WUKL 3UJIH 1XF5B 4DAGL 4O58H 5AYUH 1GVIA 4J8RB 1JMXA 1JZ6A 5EB9A 1T0NB 3F7QA 5E70A 3O4LB 1KTKE 2ZUXA 1F11B 2AJUH 1S7TA 2A1WL 3FB7A 3KYOB 3HR6A 2VABB 3GMNA 3ARBD 1Y18B 3W82A 1AGDB 4FFWC 4QRPA 4KVCL 4NQEA 4TN9A 5ELIA 3ES6A 2I07B 3TN0B 1QP1A 2PN5A 3S3SA 5JZ7C 2W60A 3FQTB 2ERJB 5D1QC 4P2QB 4YDKH 5BRZD 2C1OB 4CJ0A 2DLEA 1LDSA 4LVHC 2AJVL 2N7AA 3VGHA 3MBXL 4XP1L 4OI9A 4L3AA 1IKNA 3KPTA 2R2BA 4TSCH 4IOIA 4XX1G 4YLQT 5EU4B 4NFBA 5HI3C 3VDCA 5FYKD 2V9TA 1HXMB 2OSLB 4HGMA 1GOGA 1WWWX 4LLVB 4PJGF 4UMGA 4M5YH 1C1EL 5C6WH 5HSFA 3BEVA 3UO1H 3FOLB 2HTLC 1CVSC 2Z8SA 5E1AB 5HYQA 1I1YB 5KVEH 3L5XL 2YZ1A 3PNWB 4M9OA 4Z77A 4LARL 1CT8A 3TN0D 5IEHB 4JGUA 5T3ZE 3DX7B 3B5TA 3WFBH 2J6EA 3MV9D 2IPKA 1MIEH 1OGTB 1RZKL 2V2XB 1CICB 1DVFA 1PYWB 1WT5C 4HWZB 1I1RA 1B88A 3QT2A 2GHWB 2YXMA 3LKQA 3MQIA 4J4PC 4M1CD 3BH8B 2AS5M 4DCQA 3RWHB 4V1DD 4QHNA 3BPOB 5EO9B 5C09E 4BSVA 3JBG7 4PY8I 2DQFB 3MOBL 5F6HJ 5TJWK 3VRJB 3EBAA 3LDBC 3T2NL 5EORH 4RAUA 5GZOD 1YMMB 3P0VH 1G6RH 4JRYE 4GXUN 3RGHA 4LEXH 1JHKL 1DBJL 1DVFC 3A6OA 3BZ4B 4R7DA 3BPCB 1ZLSL 5IIEB 3GBML 4OFVA 1LO2H 5JDJA 2PW1B 1JRHI 2C3HA 3BSZH 1VACB 1H3UA 1IGMH 3GM0A 3MUHL 1ZHBB 3UPRB 1BFVL 2VIRA 5I8CA 3RNKA 2X1OA 5I1AA 3VXSD 2R39A 5DA4A 3W9EA 2VLKD 5CWSA 4Y5YC 2NTSP 5I18L 3OJVC 3GO1H 2HRLA 1HHKB 4OJFL 3C9NA 3KLAB 4K8RC 3X3GH 5I1CL 3LRSA 4POYA 1EBAA 3MTRA 1P84J 5D70L 4LCCB 5E95B 1L7TL 2J8UB 3LQAH 1Y6MR 4P9HH 3QB7C 2Y5TB 1YMMD 5HYSA 3Q3GA 3UJTL 3PHQA 4OD3L 4AENA 3MFFB 2E7HA 4E41A 4X99A 3N1FC 1YDPB 4PRHD 4LPYA 2FECI 4PTUA 1YNLL 2OZ4A 3SCMA 1F4WH 4XPFL 2X4QB 2HG5B 4OLVL 4F57L 1MRFH 5CJOL 4IIQB 2DKSA 5DRXB 1JE6A 4TRPL 1A0QL 2X4SA 4LRNL 4FOMA 2DI7A 3HUJE 5DWUH 1LP9B 4M43H 4QRRE 3QUML 2PW2B 2P44B 2RR3A 1T7VA 1XGYH 2PYFB 4TVPD 2LU4A 1XGUB 2VSDA 4M48L 3WLWC 4ZUVB 5HVHB 1CVRA 3VD4A 3U4AA 4QRPE 1U8HA 5MENE 4L5FH 3IFOA 5JDSB 3IDGB 5JMRA 1FZJB 4F9LA 1ZT1A 3BD5A 4QRRA 2R69H 4RGMB 5CCKH 5DD6B 3BQUD 4G6JL 2M2DA 4OSUL 3QA3A 5CEXB 1MQ8A 2EXYD 4J6RH 4K7PY 3OKDB 1CDIA 5BOPA 1FYTA 4WTXA 1X5LA 3X11A 1M1SA 3C5SB 3OKKA 4FTVA 1XR9A 4A6YA 3L3GB 3QUZB 5EU6A 5EUOB 4UT6L 4X6CF 4HG4K 5FA4A 1BZ7B 1AI1L 4YBLC 4NQTA 2EH8L 1ZWIA 2Z8WC 4PJFF 2EDDA 4WU7B 4NRZB 3HRPA 3R06A 3BIBX 4BUHA 5IBTH 3GI9L 2IADA 4OD1L 4EOWL 4PB0L 4RMQA 4EBQH 3UP1A 4XAWH 1HHIB 3CPLB 5ETUB 5C0AA 5CJBA 4DOHE 4NOBA 3FN0L 4G43B 4DN4L 3QDHA 1HYSC 5GRVL 2OZ4L 4XHQA 3S97C 3U0WH 4MQXD 1M05B 2VDNL 2WLZA 1TZIB 4NZDA 5D2NB 3DETC 4JY4B 2AVGA 1QO3A 4I77H 4G6KH 4CVWA 4Q9CA 4S1SH 1SQ2N 1S9WA 4R7NA 4M9PA 4Y4FA 1TZHA 1NBZA 3RWEB 2RFXA 4MA1B 4U6YA 2GW5A 1WITA 2CJUL 2NXZC 4Z7VA 1LMKA 3DV4B 1MLCA 2I60H 4YDLC 1OTSD 2HTKD 1U8PB 3VFOA 3C87A 1CI5A 1NAKL 4RX4A 5F7LB 3BD3A 4FQCL 4RA0C 4EI5B 1LO5A 3VD3A 4EXPX 4ZG1A 1QKZL 5DEGA 2E7LA 2R4RH 3U9UA 3IB4A 1NGPL 4FA8A 4Y4FC 4IRJB 2DQFA 1MI5E 4LP5A 2EDFA 5FUOH 1CR9H 4NRZA 2PXYC 2HFEB 2DQGH 2QQNH 4K94H 1V5JA 4DCQB 3MACH 4MAYA 5B8CC 1IC5H 3PDDA 2Y6SD 1A7PL 5DHYB 5DVMA 3U30C 3DXAD 3EO9L 4FQPA 1Q94B 1PKQA 3MZGB 3TFKD 3KPPB 5DD6A 1U8NA 2LU3A 2EDNA 3ARGC 4MNQE 4XPAL 3H8NA 3FOLA 2YWZA 3QJHA 3HZMA 3DHMA 5HYJA 1HDMB 1U2HA 4KROD 3PWJB 3I6GB 3PP3H 4LRIA 1WK0A 4QRSB 3UYPA 3WS3B 2EEAA 3BN3B 4L9LB 5GXBB 4P5MB 4XP6L 2G75A 1H0DA 1C5CH 1MUJB 2XQBL 1RUPH 3BHBB 5GSRA 1AFVL 2GAZA 2DQHH 3GSRA 3HE6D 5MP6L 2VLLA 3OBAA 3P4MA 1AP2B 2WP3O 4Y19E 3QG7L 4GJTB 4PG2C 1M71B 2JK5A