1U93B

Crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 in complex with gp41 peptide analog eqdkw-[dap]-s (cyclic)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
235
structure length
227
Chain Sequence
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPGAAAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLQTYTCNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine design implications
pubmed doi rcsb
molecule tags Immune system
molecule keywords ANTIBODY 2F5 (LIGHT CHAIN)
total genus 38
structure length 227
sequence length 235
ec nomenclature
pdb deposition date 2004-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u93B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u93B01
3UXFA 4LDLB 1OTTC 1MFNA 4K8RD 4QNPF 3V6OC 3RL2B 5EUOF 1ES0B 5FB8B 1XF1A 5F9JA 3T4YA 2BVQB 3ZTNL 2IGFL 5HHXH 1KCSL 2D7TH 3GSQB 2YS4A 2OL3B 4XGZB 3KLHC 1I7TB 1SJEB 3QJHA 4D94A 4OB5H 2CR6A 2ESVD 4FQHB 4NWUH 1U8JA 1OQXA 3F5WA 1P4BH 4OF7A 3TVMB 4ZYKA 4TRPL 1KJ2H 4GBXC 4RAHA 1CBVL 4OM0L 4PRPA 3B4NA 4HX1B 4LSVH 5IJVA 4L1DA 3AREA 4WWKA 4URTB 1J1OL 3ARBD 3DBXB 1C5CH 3S6CA 3BGFC 3HRPA 1EBPA 1NUGA 2PXYC 3CMGA 5ACMA 2VMFA 1YMMD 2HRPL 4YXHH 3DOSA 4U1JA 4JPKH 4X8JA 3MRFA 5FA4A 1AGBA 5KAQF 2A6KB 4HSQA 4UOJA 1XGYL 1CN4A 3WL9A 4OGYH 5EH1A 3TCXA 2EXWD 1HHKB 1KUMA 1UM6L 3FN0H 1ED3A 3QXDA 4YBQD 3BEWA 3T04D 5DEGB 3BUYA 4QLRA 3MRFB 5D1XA 3C08L 3U30B 1CLOL 3QDGE 1B0WA 4IS6B 3VFGL 1P6FA 5D7LA 1H5BC 2ZUQB 5FUOL 1MVUA 2W65B 3B2VL 4JRXB 3FQNA 3SQBA 2M26A 3MRMB 4U7MA 5C2UB 1XT5A 3ZDZF 2VZOA 3VFNB 1CCZA 4EDXA 5ITFB 5TDNB 1H3PH 5J57B 5L2KD 4PRHE 4Y2DC 5HHOA 4W6XB 2D03H 3AM8C 1X5AA 2DKSA 1QBLL 4OQTL 2NY3C 1AQDB 5D71L 1I8LA 1QFPA 2YA1A 3EO0A 1T22B 1G0XA 1NCWL 5B4MD 3MA7B 4KV5F 1Q9OB 1HSAA 5JO5B 1F45A 3RRQA 3PV6B 3I75A 4OCNC 5LWYL 5E2VL 3VGFA 3S7GA 1QSVA 4U1SB 5DURB 2H2SC 1KYOK 4XNYL 1FLRL 4ZDHB 1A2YB 4QXUH 3EFDL 3LDBB 3PIQB 4I0PC 2NXZB 2YD9A 4RA3A 4Y4HA 2WP3O 4I3SL 4X6CA 5D9SA 1MUJA 3U9UA 3H3PL 1L4IA 1A6VL 5D7IB 4ZDHA 1WQVT 4ZFFA 4G5ZL 5LCVH 4L5FH 2DF3A 2C3HA 1KGCD 2IAND 2R23A 1NMBH 3ZMRA 2VQUA 2CQVA 1ORQA 3B9KA 5KSBA 1H3TA 4YR6A 2YD2A 1MIMH 1RVFH 3MGAA 3I6LD 3MUY1 3BH8A 3CC5B 4KJWD 1BMGA 1BLNA 3UTSA 3FT3A 3P30H 4ZAKD 1DQDL 1JGDA 1KENH 3FMGH 1XGQA 2E6JA 2Y7QA 1T1YA 1YJDH 1K8DA 3H3BC 1QLFA 3ECBA 3HZKB 4H0IA 1NC2D 1G9EA 1JPST 2J8HA 2WW8A 4JR9L 4JFQA 1KLUA 1U8IB 5BV7L 2WMPA 1G7HB 2VXVH 3QDGA 1MRFH 1IEBB 3CSPA 4NKQB 1ZVSB 3KPRD 2IF7A 3PE9A 5MERA 2FWOB 1OSPL 5EZOL 1KXVC 5EU4B 5FGBC 5BXFA 4CVXA 4D9QE 1MLBB 3ARGC 3ARBB 1CD1A 4PP2B 4RFEA 4TOYL 5J56B 1MFAH 3LIZL 2BVOB 1S9WA 1IAKB 1NCNA 2IAMA 2Z35B 4HIIA 4CN4A 1QSFD 3CSGA 1L7IL 2IPKB 1U91B 4IDJL 3ARGD 1R5IA 2V17H 5ACZB 4GKNB 5FGRA 1KB5B 3KPMA 1ZA6A 3VXMB 3IJYA 2DQTL 1J5OH 3FO1A 1A0QL 3GIZH 5JPNB 3LD8C 2HFGH 3UP1A 3O8XC 1QOKA 3IYLW 4QXTB 3PHOB 1T20B 2EH8H 4TSCL 4Z7QF 1RUAH 4NM4L 3LKPA 2V5RA 2J3SA 5J11C 3KYKL 3QI9A 4LSQH 4DN4H 2C1OB 4LCUB 3P0VH 4PJEB 2AV7A 1ZHBB 4O02H 3QWRD 5TFSL 4HWEH 1T20A 3KPSA 5E8OB 3L3OB 3E6FA 1KBGL 5FOBB 3CSYA 4P99A 3GSUA 2CLZB 4CGTA 5J6GB 1I8MB 2FX7H 3FFCE 5I1LB 3NFSH 3TNNB 1A1OB 2XOTA 2J8UE 3OPZL 4GO6B 5FKAA 5IB5B 4F33A 3PWJA 5FYLD 4DCQB 3MRNB 4OUUA 1OPGH 1DUZB 1SHMA 2PW2B 4HMDA 2X44D 3B2VH 2OJEA 1D5XB 4YPGB 3S36L 2Q76B 1AQKH 1Q9KA 4Z7OE 1T21B 2AABL 5LBSH 2WUCH 4M7JH 2A6JA 3MGTA 2Y07L 3EFDH 3SDDB 3X14A 1NGZA 4KXZI 4D8PA 4OCRL 3GRWA 3KPOA 3H7LA 2NY4C 5B39B 4CADB 3WN5A 2XPGA 4K9EL 2WBWB 2GI7A 1T66D 1CDHA 4YFEA 1DBML 2R8SL 2ZSWA 1OARH 5D8JL 4Y4KD 2E9JA 4KWUA 1UG9A 3RY6C 4QRPB 2WIIB 4LCCC 3D0LA 3D0VA 2B4CL 4CVWA 4LLYA 3JBG7 4NNYB 4YNYA 4ZFOA 2X42A 3Q6GH 5HGAB 4RISL 2DD8H 3DPBA 4WW2F 4ZUSA 1I9EA 4F80A 4HBCL 5J1SC 1I85C 4N9GB 4R4ND 3QB7C 4YGAB 3VXPA 5IVZB 4NO0B 1EUTA 3RWGA 1UQSA 2XKNA 1TJGL 4CVZB 3TVMD 4P2OD 2EKSB 5CJXA 1U93A 5JIHA 1AKJD 5EDXA 3OAUH 4XNZC 1J87A 5TF1H 1R3LA 1AXSB 3P0YL 4G80B 5HGDB 4S1RH 4XB8A 4OI9A 1JUFB 3OKNB 4RQQB 3P30L 3L95B 3ARTA 5JW5A 4KRPD 3I6KA 1A7QL 4DUVA 1U3HA 2NZ9D 3K7UA 3KDMA 5CHNA 1OY3B 1CK0H 3MRPA 4XP5H 1U95A 3D3VA 4U1GC 1CICC 2AXJA 4NP4H 4P3WA 4DN3H 4XVJL 3U0TB 4HIJB 4WHYH 5BZDB 1LK3H 2IPUG 3MRIA 1PD6A 2HJKA 2UWEB 2LFGA 3G5XB 1CU4H 4MAYA 2A77H 1AGBB 4Q58C 1HYRC 3T2NH 5I8EB 3BT2L 4PTUB 4JGJA 4K7FB 5B38B 3SGDH 5E5MB 5HJ3A 4P5MB 2DI7A 2CK0L 3ILQD 1WTGT 3ZT7A 2AJYH 4GW4A 2VWEE 3IAGC 4DUXA 3EOBA 1NBYA 1U8JB 1MCOH 1V3MA 4LHUD 5DUML 4XMPH 1OTTD 3HC0B 5C0CB 2GTWA 2D3VA 5INCA 4PUBH 4A6YH 1MCQA 2VLJE 3CVIL 4PY8I 4QHNA 3RUGB 4MAUL 4WRLA 4L4VB 1JF1A 3EO9L 5DVLA 4F7CA 3T1WA 1EBAA 3RVWD 5CJ5A 3QFJA 1QFUH 1JIBA 2X4QA 2VZSA 2YMXH 2IFFL 5AEAA 1RZ7H 5J12B 1ZLUK 4U1JB 4OCWL 4R4BB 2A6KA 1ULVA 4J1UB 1JVKA 4NHCL 4PP1D 4LU5L 3MJ7A 1MY7A 3O4LD 4UAOB 4Q7DA 1KN4H 2DQIH 1IAOB 3W9EB 1FL3A 2IAMC 4NKOB 3QCUL 4XAKE 1EFQA 4ETQA 1SYVA 1GPOH 1X6NA 3FT4B 2A1WH 3BGMB 4OJFL 1EZVY 1FC1A 5CP3H 32C2B 4Y4FC 1MWAH 2P42B 4DKFL 4ZAKB 1YN7A 1TZHA 1LK2A 5AZEH 3WS3B 4H8WH 4HC1A 4NGHH 5L2KB 4MB3A 1V05A 5IHLB 2Y4SA 1IGTA 4WHDA 3AUVA 4DGVL 5HSFA 3PWPE 1B88A 4UNVA 4ONFH 4LMQE 1A6UH 2WIMA 4YWGL 3OWEA 2GY5A 3O0RL 3Q1SH 1JL8A 4P49A 2E7CA 1MFBH 5DEFB 4BZ2L 4ONHA 1NH6A 2APXA 4JM4H 4LPVA 5IB3B 2DLFL 2ORBL 4QTIH 5ERWB 1PQZB 3FFCA 3V0VB 3VDCA 4NQCA 1U42A 3EAKA 3ZO0A 5LGKA 3E2HC 3Q3GA 4M7LH 2XXCB 4NJ9H 1N0LA 3MXVL 1C08A 3UBXG 5E4EB 2LU4A 1X9QA 4C56D 1ORQB 3V0VA 5K9QG 5D7SH 5J6HB 2P48B 1CL7L 4HIHA 1S9VB 2QV2A 5KVFL 1VERA 5C0BD 1MQKH 1F4HA 3VXNB 4XWOD 2APFA 4OKDA 3IDYC 3SDXF 2BSRA 5D93B 3DXAE 4PJAE 4S11A 3UYRH 3K4AA 3VFUA 5E94A 3V52L 5TQ2L 3OXSA 3DSNA 5A2LH 1CL7I 4RWYL 2VQTA 5BCAA 3FRUA 3L3HA 4MXWL 2CLVB 1HILA 3UJJH 2Y07H 5EZIL 1T6VN 3QQ4B 5CILH 3SE8L 1FZJB 3L95A 5B8CB 5IBLD 2XY1A 3OKOA 4JG0H 4OUOA 2YUXA 4LOUC 4AENA 1JBJA 5D5MF 3MODL 2GJZA 3TV3H 1K6QL 5C0RH 4TUOB 5IW3A 1HHHB 4Z7UA 3O4LB 5EO1A 3NOIA 1FBIH 4F37F 4UV7H 2PYFB 2Z91A 2LE9A 5CSZA 3DXAD 1AR2A 4S0TD 1GRWA 1MFCL 43CAA 2OXHA 5L6YL 4LLDA 1RULH 3VG0H 5IP4A 2X4NB 2RQ8A 2ERJB 3IU3A 1KEML 4R7DB 1SY6A 3VGDA 1TCRA 1G6RB 5DI8A 4G7YH 4EI6B 4PJ7B 4XPBL 4PJ9D 2YUZA 1WF5A 3FRPG 4GSDH 3RVVC 4ZO9A 1P7QB 1TCRB 3VFMA 5HYEA 4TVPE 5HHMB 4N0YL 2IFFH 5CMAA 1DCLA 4N0CC 1NEZA 4LSTL 5IBTL 2DL2A 5BOZG 3KYOB 2DM4A 3CLEL 3FZUD 3PDDA 3VWKC 3L3JB 4AL8L 1KLGB 4AH2A 5GPRA 3VI4E 4X9GA 2V6HA 4FNLH 4G42B 2IMMA 1YUHA 5F71A 5KVDH 4L8CB 1U3YA 3BPOC 1VGKB 4JRYA 5IMLA 1TQBC 4ONOA 3O11A 5DJ2A 2KZWA 2P43B 4ONFL 1FRGL 3OAZH 5F6IC 4NO3A 2CRIA 4J3WA 1PEZA 4G9FE 3VWJC 3BKYH 5ADPH 4I48A 5AG8A 3O41B 2DQGH 1Y6MR 2NZ9C 1PLGL 3QNZA 4XMKH 5IVXE 1IGML 3N85L 4X7TA 2HVJB 4XX1E 3JWDC 3ZDYF 4ELME 1CFTB 2AXFB 4J4PA 3WBDA 1CZ8H 1NQBA 3IFPA 1CVSC 4D9LH 5T5FL 3BPNB 2XTJC 1W72B 3QYCA 4KZDL 5E4IA 5ADOH 4FOMA 4YHYC 1DDHB 1GVIA 3D2UA 2NNAB 5TGBA 5DMIH 4KZEL 1C16A 2HJFB 3PUCA 2DWDA 4JZJA 2BY2A 3RX7A 4Z76A 3H7BA 3CFKA 2APVA 4O5LH 5BQ7B 3PV6A 3C8HA 3HR5A 1P4IH 2R1XB 4LLQA 5I9QC 3FB5A 4WWID 4LPCA 4GKOA 3ROOA 4CU8A 3GBMH 4DK6A 5BS0D 3TT3L 4NQSB 4F58H 4HCRA 4LLVB 5FB8A 2NW3B 1DVFD 1QSZA 4IOIB 3VGBA 5DFWH 2FH8A 2D7MA 4O4YL 1FDLL 3MA9L 4PJAB 5JXAH 2UV3A 3GJEA 5TQ2H 2V7HA 3EJZC 4GSDL 1Q72L 4G6JH 3S5LA 3NCCB 3KPLA 1IEAA 5GS2H 2KUTA 3O4OB 1WWWX 4HJGB 4X98B 4KK9D 3WKML 3UAJD 1OD9A 5HHOD 4UTBH 4EXKA 3HUJA 2R2EB 5BV7C 4CW1A 1NAKH 3BT2H 1I1YB 3OKEA 4L3AA 4MVBC 5GGVY 3T65B 4TNWF 5J1AA 3QO1A 4DVBA 4K7FA 3H6JA 3QSKB 5I17A 2BDNH 5EPMB 2D4FA 2GITB 2HRLA 4HZLA 1P9MA 1PG7X 2HT4C 2VAJA 2Z31D 4YC2C 1R3JA 2C3VB 5LBSL 1N64L 1XGTB 4MA3A 1HN1A 5DA4A 3GJFK 5ANMA 3MRQB 3MUJA 1KPRA 4TVPH 1SM3L 5D2LE 2PR4H 2V2TA 3IJHA 2X7LB 4UAOC 5T33L 1BQLH 15C8H 4HFUH 4KVCL 4NRXB 1QA9A 1QPPA 2FWOA 4U1HA 3VXMD 1XF2A 3DVNB 3QIUA 4IS6A 4XVTH 1CGYA 4L4VA 2NTSP 3VXUB 4OKVB 4QHKJ 1A14L 4XHQA 1KCLA 1YMHB 3VD9A 4D0CB 2VYRE 4LBEB 3WJJC 1I3VA 4MSWA 4QTHA 3H9SA 1I1RA 3HPJB 3UROR 1S5HA 1YEFL 4KHTL 2WWMD 1RHHB 3IKCB 2PO6C 3AS2A 5EFIA 1GGYA 4L9LB 5CJQL 4ZXBD 3T4AB 4JRYE 3U7YL 1JTOA 4PY8J 2BNRE 2VDKL 3K74B 3IJSA 3FJTA 4NFBA 1IQWH 1G9ML 1OAUL 2JE8A 4I0PD 1M7XA 1D9KB 3JSSA 3ZDXF 3ULUH 5E00A 4GG6F 3OGCA 4MQSB 2XY2A 2JCCA 4I5BA 4WENB 1M7IB 5C9KA 1F4YL 5E5RB 4W70A 1DVFA 3UPCA 2NLJB 2BSRB 3S36H 2VZTA 5D7KD 1MJJA 4O2EA 1WVZA 3SJVE 5EUOE 1BGXH 3QFDB 1T5WB 4MX7B 3UTSB 4GXVH 7FABH 3GBLA 3BDXA 1JZ6A 1LDSA 1BVZA 3QIBC 3RU8L 3LN5A 1GCFA 2VSCA 2DQUL 1FCGA 3KXFE 5IT2L 4XP6L 3SKNA 4OZIE 5M7QA 2OM5A 1CIUA 1G84A 2X09A 4KROD 4OZIF 1KJ3H 2AK4B 4M7LT 5HHPB 2BY0A 3PGFL 2ARJB 1LO2H 4X80H 3X3FL 1KTKE 4KDTC 2FBJL 4OIBA 2X4SA 4OTXH 3CFIC 3GSNH 3IRPX 1J0IA 1LEKA 4WFED 3W5MA 4IM8A 4PJGB 5DGQA 2HTKD 4KRLB 5EU4A 5BXFB 4HWBL 4X6EA 2OR7A 3TGXA 3MLTB 1UZ8A 4LLYB 3VRIB 2RJMA 3HB3D 1CK0L 3R0NA 4XP5L 2G60L 1RZFL 4ELMA 4MA1B 4HQQL 1KACB 3ME0A 1AD0B 4OD1L 5D1QD 1HHJB 4H0GA 2A9NL 2C9AA 5A2FA 1N3NB 3FB8A 1TQCB 4UI2A 2HTLD 4I0KA 5IHZA 2GK0B 5ICZB 4KUZH 3C8DA 1G1YA 1PGRB 1H3XA 4YX2L 3VXSA 5IHUL 4GMSH 3L3GA 3W2DH 1RHFA 1NKOA 4POZD 4BH7B 1EO8H 2YPLB 3QXTA 5F1IA 3RNKB 1I1CA 4U3XA 1JPSL 4LCUA 2ICWI 1CICA 5CAYB 4OV5B 4LLWA 5DMIL 4OBSA 5F7EH 5TH2A 2ZCHL 4MJ5A 4ZODA 4XPHH 5DGRA 2B1AH 1S7SB 2QSTA 5IBUB 1SJHA 5D7LE 1OT2A 4Z0XB 4IRSD 5JZ7C 5B3NA 2ATKB 1XIWA 1DBJH 3PQYA 2V2TB 4P5TC 5ICXB 5ISZD 4HCRH 4QRPA 2QBWA 4FQQA 3BIKA 3F12A 4NO2A 5CJXC 3MRJA 5L0QC 2WLZA 3OR7B 2FZ3A 1R3KA 5JQ6L 1Q9KB 4FTVE 2F58L 2BSTB 5JR1H 5HVGB 3WJLC 1D9KD 1FZMB 3RX8A 3C60D 3BKYL 1AD9A 2X40A 4KTDH 3QCVH 3T09A 3EO0B 5E2UL 5IKCA 1TFHA 1KJVA 3EYSL 1A1MB 4PJCF 1TTFA 5HVWA 2MCPH 4TOYH 4HAFA 5DFVD 2QQLH 5GRXG 5HHMD 2CKBA 1FIGL 3DYOA 2QSQA 2VH5L 4X6BA 1HK6A 1CFVH 3LDBC 4AK1A 3ARDB 4PRPD 1JN6A 3W9DA 5D2LA 3DTXA 3QWOA 1OCWL 1OT1A 2F8VA 5I74B 2XA8L 2B20A 4M6ML 3ZTNH 5D2LB 2CKBL 3N50A 4PJ5D 2VXSL 4LSPH 2Z8RA 3IVKB 4J3XA 5H37G 5FM4A 3MUGB 4MD4B 5F89B 2RHEA 3I3EA 1IAOA 3W9EA 3LEVH 1ZLWH 2BHUA 2DJSA 4J8RA 2VDPH 1JJUA 1K5NA 4C55A 1WWCA 3QIWA 5FUOH 3WUWA 4NNPH 4GS7B 4M03A 5C09B 1XGPA 2HT4D 4YDIH 2NNAA 2XYCA 2EDTA 2XRAH 4X98A 4PJBB 3G5VB 5EUKB 4DN3L 4BSVB 1DN0A 2HFEA 2F9BT 4HGWA 1PX3A 3RGHA 4IRZH 4OSUL 3EYUH 2XQYG 1HH9B 2DDQL 2Z92A 4ZFZA 1IEBA 3HE7A 4FFVD 2JK5A 4PR5A 3F7YB 3QDJD 3UBXB 1X5FA 4DWHA 3CCHB 5EWIL 3EHBC 1G6RA 2AI0H 4NQXA 3O6MH 3ULUE 1H3UA 4WDIB 3UC0L 1YDPB 5FGCE 5I1CH 3EO1B 1FGNH 4NO5A 4HJ0D 4TUJB 5AYUH 3ZYZA 3BO8B 3VA6A 3WLWD 1A7NL 4PRHA 4PJFB 1VB9A 1WIOA 4U2YA 2R4SL 4ODHL 4F8QA 2G2RA 1UKTA 2VO5A 4E0RB 2D9CA 4LCIL 1ZA6B 3VXMA 3K80A 3KNBA 4QTHB 1I3GH 1YEDB 1J5OL 2KL6A 4KPHL 3MLRL 4Z7OF 1DUYB 2EH7H 5GXBB 3PABB 2JF1A 5HYSG 5C0NC 2FO1A 1Z9SA 1FNGA 1NLDH 4DK3A 2IH3B 3IDNB 3FQUA 4OT1H 4YBHA 2MSPA 1LEIB 4NDMA 3ULVH 5D7LB 2W9DH 1BFTA 4NCDA 3UYPA 4JFEB 1XF5A 4Y16C 4PJIE 2X7LA 3X3FH 2YPKB 4G9FB 4NRZB 5EZLA 1A6AA 2DM3A 3V7MA 3DYMA 3GMPA 1NCUA 1BFVL 5HYJD 3WV0A 4J23A 4P2OC 2I25N 5F1NB 5H2BA 5F7FA 1KB9J 3MO1B 1D9KC 5HVFB 5IOPB 3FT4A 5C0AB 4TUOA 2D4DA 2XWJA 3C09B 1CDGA 2YD8A 1Q9OA 5GRZA 1RUQH 3VXSD 2DOCA 2OJEB 5I76B 3E2HB 4NN7B 1NMAH 1J1PL 1FP5A 4JZOB 4RNRB 3SGKA 4OCYL 1K4CB 5DSCB 2YN5A 4ALAL 1LP9F 2LABA 1I7UB 3MNVB 3NBNA 3P40A 5IG7B 2EDJA 3HCVB 3VU2A 3ZDYE 2A1WL 1REIA 3G5YB 3I6GA 1KJMB 4R4FL 3UPRB 1AXTH 2LVCA 5C0DB 1P7KA 4NQUA 3T4YB 1DL7L 2AK4D 3H2WA 1FH5H 4CJ0A 1DEEA 4EI6A 3GSQA 3L5HA 1E27A 2GSGB 5GJTL 5DLML 3U7AA 5J9PA 2UYLA 1TJIH 2X89A 3D18A 3KPSE 1KCUL 4ZFOB 5I1JL 4PBXA 2F8XC 1U3HD 3FRPA 3DVGA 1ZT7A 4I3SH 3BRDA 5DJ0A 3G08A 3STZA 4R97B 2VZVA 1Y6KR 2YSSA 5F3HA 4OZIB 3HRZA 1A7OH 2D31B 4WY7H 1U3HC 1AO7E 1J1OH 2BNUA 3QBTB 4QRQB 1QFHA 4XNYH 5T1MB 3BE1L 2KPNA 1J88A 1F4XH 3QDJB 5J1AB 5E0QA 2AJUH 2OP4L 1F4XL 1VFMA 2IJ0C 5KTEL 2DIJA 1B2WH 2V7NA 3JTSB 3LN5B 5AAMA 2Y23A 1A6TA 5IQ7L 2L0DA 3SKJL 5E99H 3MV8D 4YK4C 5CHNB 5GGTH 3B43A 2DDQH 3PXJA 1HCFX 4Z7NF 4HFUL 15C8L 3BQUC 3QQ4A 4KVCH 3RGVC 4QEGA 1N5AA 3RA7L 4LSRH 4F7TB 2VDNH 3PP3H 4ZUVB 4WUKH 1DN0B 2JELH 4PJEE 4V1DE 4ZXBC 1IJ9A 1EJ6A 3EYSH 4HKJA 5BRZB 2D9QB 2CGRL 3V0AC 3ALPA 2DBLH 3EDKA 3ULUD 5ACZA 4HWZB 5C0BE 4RDQG 3EYQD 2Y06H 1S7VA 5CEZH 2GT9A 4JJHA 4JCMA 4YUEH 2YC1B 5E95B 1JHLL 1NMCC 3EOTH 5K59E 3BESR 4MA7H 3TBSA 1NAMA 1I3RB 3G6JF 4OCYH 4W81A 3RIAK 3TFKD 2P44B 5ISZB 1KIUA 1RZJH 1DQJA 1WZ1H 3F5WB 4LLVA 2V2XA 5JHDB 1H3WM 3L3OA 5L9DL 2EE2A 4NN6C 3LV3A 4IIQC 2Z31B 1EK3A 4ODXB 5IFHL 5GIRA 4WFFD 3SGJA 3SGJC 4RISH 2HKHH 4MNQA 3QIWC 3OF6D 1IARB 3TC9A 5GS0D 4WO4A 3SKMA 4KJYA 2OXGA 2ENSA 2O26U 4FQXA 3OX8A 1TDQA 5F7KC 2W9LA 4LSSL 3C2AH 4KK5C 3MRBA 2ZUXA 3T1FA 3DETD 1K8IA 5FKPB 5FM5M 2P47B 3GSRB 2DICA 3GEWB 1T1WA 3QHZL 1OAYH 4FQQB 5AWNH 4GW5B 3WXWL 4Q0XL 4M1GH 4CRPA 1S7WB 4M1DH 3NTCH 5D6DC 3AS1A 4BK5A 3B3IB 4TNWK 2E9BA 2IAMD 2I9TA 1BBJA 3MSPA 4PLNC 2VQ1B 1RULL 5AYUL 4OD3H 2HN7A 3QCTL 4OKVA 3CNKA 4F7PB 3MV11 3F6IA 1BBJB 4Z7UF 2F15A 4PPTA 3TA3B 4Y8AA 4OD2A 1M6OA 3Q5OA 4CDGC 1E4WL 4D9LL 2X4PB 1GGTA 3EDFA 3LZFH 4MD0A 4WFHD 3LEXB 3RKPA 3H7BB 4PJBF 2RCSH 2F54B 1BF8A 1D5BB 2UWEF 2EDNA 3ARYA 5BRZD 1BFVH 2PW1A 3DBXA 5CEYA 4L8BB 3RI5K 4MD0B 3OQ3B 2E6PA 2HFGL 3U30C 2GK0A 4JHWL 1WCBB 4MJID 5IBTH 5C70A 2IGFH 4QOKB 4JG1L 3FOMA 3HUJB 5LAXB 1I1FA 3S3JA 4Y1AE 4M9PA 2R4RL 4OF0A 1YPZF 4XCFL 5T3XH 1WSST 1YEHH 4WI9A 1IAIL 4UBDD 5IJKC 1RIVH 1XEDA 4MGXA 1SY6H 3GSUB 5CZXC 2BC4A 3ES6A 3DHJA 3HZMB 1L7TH 4PJCB 5H35A 1QNZH 5DEGA 2OK0L 2HJKB 5J4MA 3QUZC 1FNFA 2NY6D 4ERSL 3QFJE 5CZVH 3RZWA 2EE9A 4CAGA 4KI1A 1Q0XL 1ZHNA 2AGJH 2Z92B 5KSBE 5ITBH 1X5GA 4RFOH 5IGXL 2YD5A 1NBZA 2FCBA 2NY0C 3C6LD 3E3QE 3TP4A 4AIZB 3SDDA 1SEBB 1KIQB 1CDCA 1JPFB 4ORGA 3FCTB 1WFUA 4IOSD 3WHXA 2AJXH 3TV3L 4MS8D 3CXHK 5EN2B 4FFYL 2HLFC 4I1NB 3MLSL 3H9SB 3FKUS 1ZAGA 4HH8A 1G7QB 1YEHL 2DWEA 1ZVYA 4EDXB 2XWJB 1AGFA 3QNYA 4JFPA 4M48H 4DKDC 1Z3GL 2ZJSL 3JZ7A 4PGCB 1UWXK 4ONGH 4HK3N 3O45B 2PR4L 3SE9H 4HPOH 4OAWA 4PLOB 3V5HA 2GHWB 2XZZA 3UTTA 5FYLH 3MX0A 1OP5K 4CJ1A 4R2GB 4PG9B 2R0ZL 5I75C 12E8L 4QXTA 4Z7WF 1CVRA 1RHHA 1MAJA 2Y72A 2Q86B 4FXKB 3IFLH 5HI5D 1U6AL 5I2IA 4IRSB 1QACA 4RGMC 5ACLA 3BWAB 4Z7VB 1AI1L 4Z7UE 5E9DB 5F7HA 1M4KA 3MLVL 4BUGA 4LVHB 1S5IL 8FABA 4KRNA 4M43H 5IOPA 5GISL 4AM0B 3RVVD 4JPWH 1RZ7L 1FAIL 2EICA 3O3BA 3ZL4L 4E5XA 3P3YA 2AEWA 4YFDB 3BN3B 3TPUA 2GJJA 1QKZH 3WXWH 1DBKH 2CDFA 1DQML 1M7IA 5IROA 3UO1L 3BVNB 3MNZA 2RAMA 3RQ3A 5D1QA 3PL6D 5CFHA 4RX4A 3MJ6A 1UWGL 4MQ7B 4KK5D 4LIQE 2IH1B 2R15A 3NN8B 4OZGB 4Q2ZB 4U6YA 1FL5A 1HZHL 1D5ZA 4G6ML 3PHSA 3OZ9L 3D48R 5D7IF 5D4QA 1CE6B 5C0CA 4GKNA 2VLMD 4ALAH 5C0GB 4G6MH 1F58H 1EA9C 4H88H 4FFVC 1MLCB 2VLKA 2XZAL 1KG0B 4XP1H 4KMTL 2YSSB 5CWSA 1TXKA 1MCSA 3E6HB 1UM4L 2ZUUA 3ARFA 5GSRA 4LSVL 5DMYA 4L9DA 4TSAH 4KMTH 4U6VH 2PETA 5JQHC 2AXHA 4PB9H 4KI5F 5GGRY 4DZ8A 1DBKL 1DQTA 4OZHB 4YXKH 1NFIB 4P9ML 2W9DL 1MNUL 2VN7A 3HC3H 1KSRA 5J0BA 4UT7H 3SKOB 5IVNA 3FN3A 3E8UH 3DROA 4K23L 5JMRA 5AZ2H 3OKNA 4RQQA 4LCWD 3UPAA 1RZIA 5H94A 4JFFE 4W68A 5I73B 4GQ9L 4OGXH 3BEVA 3BDBA 3LKQB 3V5KB 1WC7A 1U6AH 4PJEF 4UB0L 3T65A 1QZ1A 3EFFB 3SE4C 4JGUA 3QRGH 4JKPL 4EI5C 1NAML 4OZ4A 4IEFB 5T5FH 2ADJA 1DSFH 1ETZA 5KS9B 4Z7NE 3MACH 3GO1L 1CF8H 3MQIA 3JTTA 6FABH 1R5WB 3V6FA 4JPWL 3NCJH 4HXBH 1ZXQA 3C60C 1IC7L 5DI8B 3C8KB 2BHZA 5HY9A 1ZHKB 5ETUA 3IXTB 1PLGH 3LKNA 2VISA 3PGFH 5C8JA 5CGMA 1LO5A 3NAAH 4P23C 4HUXA 3RBGA 4MJIE 1Z6JT 3KS0H 1IAIM 4M5ZH 1VPOL 4Y5VC 1HQRA 4ODVL 1FBIL 5H37H 4EN3D 4YQXH 2FO4B 3I75B 4IOFC 5CBAB 1HDMB 2COQA 1T0NA 4DKEH 3RDTD 4AEFA 5DR5L 4BSJA 1YEIL 3RPIB 1DLHA 2YHGA 1PJ9A 5CP3A 1OAQL 1T0NB 3F6LA 4LSTH 1KBGH 2WM0A 5I6XB 1JV5B 5IV2A 2OI9B 1FNSH 3TA3C 4J1UA 4M43L 3EW3B 2KH2B 1A6ZA 4KQ3H 4ODBD 3MLUL 3GHEL 5DJZB 4ZTOL 1FHGA 5DC0A 5FO9B 3DGGA 1Q9LA 1BHGA 3VW3L 1NEUA 1EERB 2WK2A 5I15L 2VLRE 5IB4A 1NCAH 5JXED 4X4XB 2NY6C 4I5BB 4EUPA 3FOMB 5F96L 5JIIA 5CD3A 1YMMB 4PYGA 4K8RC 3G5XA 5LGJB 3QULB 5AYQA 3RWCA 1FDLH 3MA9H 4O4YH 3TBWA 3FFDA 5EIIA 2FHBA 3B9KD 3X13A 4LARH 2FB4L 2R56L 1ZSDB 1RK0B 3CMOH 4EIGB 2O61B 3M8OL 4MZ2A 1INQA 1MHPH 1K5NB 3NA9L 2GIYA 3WIHL 1KELL 4NPYB 2NY3D 1S9YB 1KB5H 5ID0A 2P8LB 3O2WH 3JWDL 1A7OL 3T08A 3MNWA 5I18H 3TBYB 1X4YA 5CEZE 3KJ4C 2J88L 4MA1C 4KTDL 1TPXC 3BO8A 4Q9RL 2F54A 4F8TA 1P4LA 5JQ6H 3CZFB 1MCWW 2LQRA 3FO9A 3QFJB 3R4DA 5C3TA 5DQDL 4RFEB 4MQXD 2NY0B 3IF1A 5JXEA 2BRQA 4JFEE 2J8OA 3TBTB 3OJDA 1ZHLA 3DX8A 5TDPB 4UNTA 4QRPE 1G7JA 2R0WH 5DQ9A 2I9LB 1FSKC 3NACH 4P5KB 4GLRI 2IQ9L 1D6VH 3RWHB 3D69B 1S7UA 1UZ6F 2C3WA 4MHHG 3S88L 3ELAT 1JWUB 5I66B 1MCFA 4Y4KC 4AQOA 3K46A 2V5SA 1YUHB 4BFEA 4XTRC 3PHOA 1JK8A 4UTBL 4YHML 3S97C 1KPUA 2GITA 5F97E 4UILH 4HWEL 5T1LA 4JO4L 4LMQI 4G43B 3O6FA 2OR9H 4QWWD 1A6WL 4PG9A 1X5KA 3SJVB 4JFFB 2JLLA 2NY7L 4FABL 4WTXA 2DQHL 5TQ0L 3VFNA 2Y25A 1ZGLP 3KPQA 1U8MA 2W0FB 2D0GA 3CFBA 5DVKA 3C60A 3WFCH 2AABH 3GMQB 2R0LH 1A0QH 1T03L 5TQ0H 1CFTA 2AXFA 4X6FB 6CGTA 1V8HA 5MHSE 5A2IH 4PJ5B 5IESL 5HYIA 2XXMB 4XP9H 2ADJB 4ZUVA 1NLDL 2DQFA 2D2OA 1RPQA 1HYSC 4ZPTA 3UPRA 2G5RA 3U9PL 4IDLA 5I75B 3IGAB 2EIBA 5AZEL 2AV1B 5LVEA 2AJVL 4PGBA 1ZGLM 3RHWK 4YJZL 5C08D 3WFBL 3WN5B 4DFHA 1C1EH 2R1XA 3PGDA 2DLGA 3IS0X 4JZOA 3VFWA 1QSFE 3WFHA 3OJMB 5EU6B 2OR8A 4WI2A 5EO0B 2EH8L 1WZ1L 3ARZA 4GFTB 1ZT7B 2A0LD 2Q20A 5DT1L 1RZ8A 3J7HA 3RWFA 1UB5A 3O6LH 5I1CL 4Q0XH 5ERWA 5CINH 4OZIA 4MJ6B 2AEQL 1T1ZB 3OKKB 3V4UL 1LP9A 4LQ1A 3GUTB 5C0RL 4OZFH 1W0WB 1QEWB 1CLYL 3DV6A 2DQCH 2GTZA 3MLZL 4I18A 2Z31A 1BZ9B 5JHDE 2CXKA 3BP6A 4DEPB 5C0JB 3RVXC 5CWSB 1UACL 4KK6C 4GKSA 4JM2F 4JFYA 3M17A 3NCYP 3FO2A 5ENWB 1MFAL 2BOCB 2EDYA 4G6AC 4XRCA 3L7FA 1A3RH 4V1DD 2CH8A 3RIFK 1S9VA 4PJCA 5H35B 1VEMA 4I2XB 3SQOH 3PHQA 4I18B 3CH1A 4XWGL 1A5FL 4WI8A 2HVKB 5FDYA 4L5FL 3A0OA 3D3VD 3LSOB 3T1FB 4GAJL 1FFPA 4MNGA 5EO1B 1F6FB 4KKNA 4MQ7A 1ITBB 5EBLA 1WBZB 4KDVA 4DOHE 5C07A 2PXYD 2CIKB 1VFBA 4PS4L 5DJYA 4GAJH 4PREB 4IRSC 5JZ7D 3T2NL 3BPCB 2DMKA 3QUMB 3F7VB 4P59L 1VGEL 4X6EB 1MCNA 2DYPB 4NQEB 2F5BL 4HKBA 4UT7L 1DEDA 2HMID 4XCFH 3D87B 2X1OA 5DMJB 4L3CB 4X5XA 1YA5A 4LVEA 4WV1A 2MNUA 4HW6A 5ISZA 4PJXF 1R5WA 1UYWH 2APBA 5CIPB 3TESA 3HI1B 5L7XH 3V95A 1DBJL 2HP4A 5CEXB 1IGFH 3P11L 4MNHA 1HINL 4EN3A 1U8LA 4F7MA 1VFAB 4QXWA 4HUWB 1P2CB 4KVNL 1KLGA 3ZT6A 3QZWG 3LD8B 2EDHA 3DX7A 5D1QC 4ZYKB 3FQXA 3CFCL 3QCVL 3SKOA 3UEZA 2ENYA 1JGVL 2M2DA 4PRPB 1Q94A 4HLZG 5IEKB 4Y19D 1S7TB 2CLZA 5J6GA 4QHLA 1I9JL 3IETA 4TNVF 4NRYB 3UMTA 1MVUB 3RGVD 2V2XB 5JHDA 1S9KC 2Y36L 4OUUB 3MFGB 4O02L 2X1PA 1WK0A 1OF2A 1I1AC 3LRSB 2IFGA 4MLIA 5HHOB 4UU9A 3K2UL 3TH2T 5I8CA 4YAQA 2FR4A 5IVOA 2YPVH 3G5ZB 1A4KA 5CJOL 2OX5A 4JFEA 2VDLL 3C5ZD 5IESH 2MQCA 4OM0H 3HR6A 1A64A 5HY9B 1KFAL 4KVNH 2EXYC 4LDEB 3RKDC 2CJUL 5GRWA 2JB6B 1OLZA 4LCWA 2VDRL 4MQTB 3P2TA 4QOKE 2BSTA 1IL1B 4GOSA 2A9ML 2NX5B 1CR9L 4KGLA 2BJML 1RIHH 5IHUH 3MXVH 4WW1A 2R4SH 5L2KA 1YC8A 3ARFC 4NHUA 3MRKA 4M7KH 2EDBA 4AEIL 5F7WC 2YZ8A 4DGIH 1XGYH 1AFVH 5B22A 1MCEA 2DBJA 2NX5A 4Y16D 1EGJL 1FORL 1FGNL 5I30L 1KJ3L 2X4RB 2O61A 5C07D 4JRWA 5KOMC 1PKQB 1FG2B 1DBBH 3EJYC 4U1NB 2JCCE 4LBEA 4U6XA 3MLTA 4ZOBA 3KPRA 2P46B 1UM4H 4KROC 3WNOA 2VSDA 4ODHH 3VFTA 3KYKH 5I16A 5FO8A 3KXFD 5IMKB 1H9VA 4U6XB 1N26A 3DXAB 1RZ8B 2NTFA 3GI8L 4OB5L 1Q9LB 1CQKA 2EDKA 1QSEA 2R0KL 3BPNC 2O5ZH 5LXGL 3OR6A 3MJ8A 1QLFB 2HKFL 4WTZG 5C0ND 1BZ7A 5I2IB 1I1YA 2OSLA 4M3KB 4MNGE 5E1HB 3ZE1F 4Y5XC 3X13B 3AREC 3FO2B 5ENWA 1GGBH 2G75A 2E6QA 2CO7B 4JY6B 1X6LA 3ZT5A 2UWEA 3GJEB 3FT3B 3MOAL 1PEWA 4NPYA 3CLEH 4JO3L 1IEAB 1E28B 1TTGA 2YMXL 4M6MH 1EUUA 5I8OH 4O2EB 4XB7A 1XIWB 3ETBF 1WICA 2DM2A 3HAEB 5IQ7H 3C2SA 2VOTA 1HYSD 5JIKA 1HHGA 3BVNA 3MNZB 4PLJD 5EU7E 3FO9B 4PJXE 4JQIH 4ZG1A 2ZNWA 5E2WH 4FQCH 3WSQL 2KQNA 4L9LC 3PP3K 3NZ8B 5C8JB 4KKCC 5L2KE 4B0MM 3R06A 4TULL 5E7FA 1BPVA 4XAKD 2AK4A 1UADC 1ZT1A 2QHRL 4KC3B 4M4RA 1S7VB 4E41D 2O5XL 4MYWB 4PJAF 3U1SH 3QWRA 3NABL 4R3SA 4U0RC 5DWUL 3RWDA 4P3CL 5D7KE 4IMLB 4RGND 2BK8A 1EO5A 1QHPA 2IQAA 2NY5C 1U8LB 5GS1C 4F7MB 4P46B 4CMHB 2IH3A 2V2WA 4WTZA 2OLDA 4JDVB 4LGPB 5JNYB 3AXLB 1JCKA 4PJHA 5IQ9A 4TTGA 2ICEB 4PGJA 3PQYE 3CPLB 2GJ6E 3LMJH 4UT6L 2EDDA 5BMFL 4IBLT 2ADGB 3WKMH 4QYOA 4MJ6A 2VIRA 5GJSL 4QWWC 3BW9B 4HCRL 1YQVL 1RURH 1QEWA 4KZDH 4DW2H 4FQIL 5E1AA 2D0HA 1AGDB 4O2CB 2F5BH 3MV8A 3OAZK 4B50A 3LN4A 4WHYG 3DMMA 1DSFL 4OI7A 4FTVB 4NM4H 1K8IB 5FKPA 2D03L 4LAQH 4HFWB 4N0UE 4LQFH 4F3FB 2ZG1A 4IIQA 2PW2A 3RGVA 3RWEB 2FX9L 2X1WL 2RIKA 2NLJA 3GI9H 4YHIA 1VFUA 1MLBA 5IB3A 3AB0C 1CE6A 1QYGH 4KK8D 3ZZ1A 1DFBL 3GJFA 4O5LL 5J9PB 2FHFA 2X4TA 1RSFA 4C56E 2YD1A 1G7MB 3HAEH 4YE4L 4LVNC 1IGCH 1EXUB 3BKCL 1BP3B 5I1AB 3O8XA 3FB6B 1IVLA 1T1ZA 4A2LA 1WBYB 2OTPA 2VERN 4HS8H 2ZPKH 3DV6B 3FO1B 1WFTA 1CZ8L 5DJ6A 3BRGC 1ROWA 2VLJB 3L9RA 3KAAA 3NACL 4P2CG 4RAUB 4Y2DD 3RAJH 4WHTB 4HC1H 4AIXA 1F11B 2ADFL 5DMGD 3GMNB 2B1AL 1BF2A 5T3ZH 4ZSOB 3WNNA 1A7RL 2AJ3A 5EBGA 4DAGL 3ZDZE 2R1YB 2N4IA 1BVLA 2W9EH 3DGCR 1GGCH 5C0BA 3TVMA 4BQ9A 1NDMB 2X1QA 1JHLH 3RY5A 4YXLL 4HZAA 4PJHE 4ODUB 4WW2A 2YN3A 3VMNA 2NX5E 1S3KL 1EMTH 4RGOL 2WBJB 1BFOB 4OV6F 4P5TB 4U1KA 2BY1A 5CKAA 1LO4H 3P0GB 4M00A 1MHCA 2NY3B 4P23A 3P0VL 4N1HB 5F89A 3REVA 4U6HA 4BK4A 3F62A 1JNHA 3HZYB 3S35L 5AWNL 4PLKD 1PY9A 3I2CH 3SGKC 4KKBC 3RJQB 2BX5A 1LDPL 3KWWB 4Z5RB 2R56H 5J3HC 5E8PA 4YGVB 5F1KC 3CDGB 5EOCH 1NGZB 2VDOH 3C5ZB 1L0YA 4HZLB 2HTKC 5INCB 3OR7A 1XGTA 3O6KH 3S3SA 2J88H 2YC1A 3SDXB 4XBGB 1IC1A 4Y2OA 2NX5D 2XNAA 1WV7T 4HKZB 5CEXA 4LASH 4GMTL 1OVZA 43C9A 4ZS7H 3ULVF 2AP2A 3HNTH 4LSPL 4HUWA 2KBGA 5KVGL 3BX7C 1HDMA 3V6OA 3VXUA 4XMLH 2YXFA 3MFFA 1VFOA 3VGGA 1YMME 1YNTB 4MA8L 4GRWH 2XN9B 4JN2A 4KUCD 4L4VD 4ODXA 5GGVH 4ZXBA 5ESAB 1CFQA 3GB7A 5IMLB 1FIGH 5IEHA 3JVGC 2B4CC 2C4XA 1ACZA 5ALBH 2DLIA 3V7AG 1M05B 4LVNB 4NOFA 1R3LB 1I8LC 1S7QB 2C1PB 3TYGH 1Q9WA 5C09E 1PG7L 4BYHA 4MXWH 4KRMB 3QUXC 5BVPL 4IRJC 1XAUA 5FUZH 1CIDA 3WD5L 2ARJQ 5JLZA 3TBWB 4H0HB 1K6QH 3LSOA 1AR1C 3TIDB 2ITCA 5CGTA 5BZDA 2ATPB 1MFDH 4WU7A 1FVDA 4MJIB 1CFNB 4ONHB 35C8L 1DDHA 4C56A 1FFNA 4N5ED 4S1DD 4WEBL 3MREA 1RK1B 4QXUL 1FLRH 4LARL 5DD0H 3EUUA 2NPLX 1SMAA 1JTPA 5DD3L 1J86A 4NWUL 3R8QA 2B5IB 4ERSH 2XWBA 2ZOLA 3UTTE 4YDLC 1A4JA 4PV8A 4KKLC 4MDJB 4BZYA 5MERB 3MNVA 4K7PH 4HS6A 4TNVK 3SCMB 1HHIA 5F7DB 1ZLVK 1JI2A 2IADA 2AKRB 3L6FB 4NWTH 1YY9C 3PWUB 2X05A 2XWTA 5HHPA 2IG2H 2PW1B 2FIRT 2FATL 3MV8E 3FONA 1E4XI 5T3ZE 1FGVL 2AERT 3NZ8A 4OD1H 4DGVH 2VLLB 3IDXL 4JAMA 2IALB 4RGNE 4F9PA 5I1HH 1NFDA 3NMEA 3U7WL 1IQDA 1I75A 3IU4H 4UIKH 4XPTH 3L9RB 1FZKB 1Y18B 3DNKA 5TE4L 3H42H 5K9JL 3S5LG 5EU3A 1MCCA 5DR5H 2VLRD 3GMRA 3PWPA 3DRTA 4OZHE 3IDNA 3BUTA 1K9TA 4PRAB 4P2OB 3B9KC 2BMKB 1HHKA 2F53E 4W4OC 5FYKE 4YXHL 4J2XA 4PJFF 3VFUB 1NGQL 1A1NB 4Y16A 2DMBA 3SDAC 5A2KH 4J6RL 5GS3A 1JYXA 3OKYA 3T2QA 3VFSB 4P46D 1OGTB 3QUYC 2R0ZH 1KPUB 4MLSA 1JPGA 1GOGA 1RZIB 5H94B 3DRQA 4RMRA 1EHNA 2X4NA 4H88L 4BFIA 5EN2A 2A6DA 1T2JA 5E8PB 5FUZL 3SKUD 2DQIL 5C0IB 3P4OB 4LFHG 3C5ZA 3LQAH 5I1HL 4Z0XA 3O4LA 3PQYD 1H8SA 4CNIB 1A21A 1F2QA 5FK9B 3FTGB 2FRGP 1A7PL 1MRCH 1T0MB 4JRYD 3VFPA 4HG4J 1TIUA 3O3UN 5I0ZA 3NIDE 4FNLL 1A9BA 5FYJU 2G5BA 4OD2B 1NCDH 4QXGL 1UB5B 4Y4HB 2Z4QA 5FYKU 4APQC 2B8OT 2ZSWB 1MRFL 3VFTB 1MFCH 5IGXH 4RMUA 1I3RA 1FAIH 3CVIH 4Q9BA 4YBQC 4FQPA 3B83A 1A5FH 3U46A 3LS4H 1J18A 2YKLL 3HRZB 5AG9A 4Z7VA 5HVHB 2GCYB 1FYTA 5FHBL 1IGJB 8FABB 4Y88A 5D1XD 1WZLA 1N8ZB 3QZWA 5I1DB 1C5BL 5D1ZC 2PXYA 3PNWB 3QEGL 5GGUA 4LIQL 4XVSH 3W39B 3S37X 2EEDA 2CDFB 1JNNH 4XX1G 1OF2B 3PDOB 1GC1L 3DGGB 1LK3L 1AC0A 4XVJH 4LCYA 3SE9L 4GUPB 3PWLA 1IC4L 5IB4B 4MXVE 1N5AB 2FGWL 3LH2H 4NNPL 2J8UA 1DP0A 5C0CD 1JPTH 2RFXB 3CFKB 5I19L 2DLHA 1EHXA 1FVDB 4MJIA 3QUZD 3HS0A 1HH6A 2BVTA 5HHNA 1NMCB 3KPNA 2VZ1A 2ZCKH 4MDIB 3G5VA 5EIQA 3RPKA 1OGAB 3KXFB 3RWIB 4FFZH 3TNMB 5F7UA 5I30H 5INDB 5D2NC 2EECA 4RAUA 2Z31C 1WZMA 4G9FD 1HWGB 1F11A 1JZ8A 3QXUA 1EJOH 3P77B 1QVOB 1P2CA 3RY4A 5JOFA 4ZSOA 4KDTA 3BZEA 1AGEB 4PGCA 3V9FA 5TJWK 1NDGB 3VD5A 1O7SA 3BYTA 3B8SA 3RDTC 2JCCF 2WUCL 1UCBL 5IVXA 1GSMA 2QQLL 4FFWD 4OLWH 3TN0B 4H8WC 1J0KA 1OAYL 1RZFH 2C1OA 3B6SB 2NY5L 4MNQD 5ID1B 5CIPA 4F7CB 2QADB 5CJOH 3QIBA 1BIIB 2Z9TA 1KIPB 5C0EA 3L3GB 1DBMH 4JO4H 1D5MA 4H26A 3B9AA 5KN5B 3QEHB 1DL7H 4HDIA 1P1ZB 3GBNL 4HT1H 3U83A 1S8DB 4QRPD 2AQ3A 3QPXH 3BEVB 4QF1A 3D85B 3EFFA 2YRLA 1SBBA 3V52H 3VD3A 5TDNA 5ITFA 1AGDA 1LILA 1HSBA 1KIRB 2ZSVB 3C87A 3QXAA 1LHZA 3TYFA 3OKMA 1XR9A 1YYML 4J3VA 1FVCA 3WDIA 1RUML 1E4KA 4KJPD 1A9EB 4WO4B 3SKMB 3I50H 5IWLC 3ESVF 4HMEA 1LO5B 2F5AL 2W65A 3NH7L 4R2GC 1A9EA 4XZUA 2Z8SA 1U8KB 4J12A 4YZFF 3W0WB 4AYFA 2ATPA 5ICYA 2FL5A 1F90L 5BW7C 2DLFH 4QTIL 1NCTA 4M7KL 3EYUL 1MPAH 3S96A 1T2XA 3MRRA 3ZSTA 5E6IA 2VAAA 4N90E 3TM6A 4U7SA 1D3CA 2ZOKB 3T0BA 2DAVA 2NY4B 5E2JA 1ZT1B 4UIMB 1MELA 4O51A 4R3SB 1N6VA 5E4EC 3D39D 3MJ9A 3H3PH 5E24E 3WLBB 1HHIB 5AD0A 3F7RA 3JWOC 3VE0A 1BZ7B 4GXUN 3SO3B 2C4FU 1NC4B 5GGSB 1KXTB 4I3GA 4GRWB 1YJDL 2RCSL 4X9BA 5CBEA 5GZOC 5I1EL 3VXOB 1W0WA 1NFIA 5D7IE 5FA4B 1YQVH 1RUKH 2IANB 4C4KO 5CCKH 2H3NA 5IT2H 2ICES 2XACC 3W39A 4NZUH 3T0EE 1TZIB 2HT3D 3X3GL 1R3JB 2C3VA 4X7SL 2HFEB 2P8MA 2VN4A 5LAXA 5C0CE 5TF1L 1W72H 1S7RA 2GJ6D 4DKEL 2VE6A 3V5KA 1YNKL 4OCWH 4GS7C 3MOAH 5KAQG 2KKQA 1QRNB 4AG4H 2VLKE 1KIQA 3ZE2E 1UB6A 3MYZA 5GGTL 3U2SB 3ECBB 3EDJA 3QPQD 2HA1A 4Z7VE 2E27H 5EC2B 5F7DA 1CWVA 1WUNT 4WNQB 1IM9A 1MJ7H 2ITDB 1O0VA 1QRNA 2PTUA 2QADD 4WDIA 1YMHA 2UUDK 5I1GL 1R0AL 1WFNA 2GUOA 3C2AL 3TZVB 3PWVA 1H15A 3VWJD 4YH6A 3FQRB 5BS0B 1FLTX 4KROB 3WNKA 3GSVA 3O45A 2CK0H 1WJ3A 2YWYA 5F9JB 4ZOEA 4LLUB 4Q6IC 4N1CA 4NOBA 2X4SB 4JB9H 1HKLH 1AIFA 3U4BH 5E2WL 4JDVA 3S36X 1T89A 3FTGA 1NSNL 1YPZB 3A6OA 3TBSB 3QIUC 1DBBL 1F13A 3MYJA 1TZGL 4RMQA 4ISVA 4K3JL 3PWNB 4OM1L 5HYSA 3H9SE 5IROC 3SY0A 4JDTH 5IJVB 4P3DA 3ET9F 4WFGE 1QBMH 1A1OA 5FKAB 1Q9WB 2ORBH 4ISVB 4I77H 5DRXB 1OOAA 3KJ4B 3IS1X 3N1GC 3BGMA 2LAAA 1Z5LB 3LMJL 1KCVH 4XCNA 3G04A 3SE3C 4I77L 4QHUA 1VADB 3WEXA 2B7DT 4GG8B 1ZGLB 3T77A 3HNSL 3CPLA 3VXQB 1WWBX 1GZQA 1JNHB 2IANE 3AB0B 3HZYA 3QULA 2UZIH 4PJ7E 3R8BB 4U1GB 2NY4D 2BVPB 3QA3B 3FFDB 1KLFA 3MV7E 4P57B 1KC5H 1BQUA 4H8WL 4AZ8A 5GRUL 2OQJA 3I02A 3GSNL 1G6VK 3H9SD 3GJFB 3PDOA 1NCCL 3G6AB 4P2QE 4JRXD 5SWSB 2P8LA 1JPSH 4UBDC 3DMMB 3L3KB 4BQ6A 2A6JB 3MGTB 2OZ4A 1J1PH 1JGVH 4XCEA 5GHWH 4L8SC 1SJVA 2YRPA 1OGAD 2R2HA 3VXUD 1T83C 3BKJH 3UO1H 3HNTL 3L3KA 2VNCA 7FABL 5IKCB 3WFEH 5ALCH 5F72S 1IAII 5T1LD 2D7TL 1O5DT 3DX8B 4D0BA 1LE5A 4OZGF 3LAFA 2Y6SD 4P46C 3VMOA 4CMHC 1RU9L 4G80A 4GKSB 5HGDA 5EU3B 3U9UB 3BN9D 5EBMA 1JZ7A 1WT5C 1KTDB 3ARBC 2WWKO 3PDGA 2AQ1A 3BHBB 3U4EA 2KDGA 3RHWF 1EGJA 1GOFA 2FBJH 1D6EB 5GHWL 3PF2A 3CFDA 4P59H 5HD8D 4MZ3A 1XF3A 4QOKA 4D3CH 3L7EB 3LB6D 3T8XB 4K3GA 1E6JL 4G8FA 3AREB 4CU7A 4XC3L 3B2UD 3UTSD 2ED8A 3QDMA 4NM8H 4PREA 4ZOAA 5KN5A 1MVFA 2QQKH 1DANT 1TZIA 4JKKA 2A77L 4XCYB 4JFOA 1BX2B 1NMAL 3RWIA 3F7YA 4DAGH 1RZKL 3QEQB 3RIAF 3S8WA 1XIWC 4E9LA 5GGTA 1U8HA 2MCPL 4KJWC 4Q9RH 2XPGB 3BUYB 4PJ5E 3IU3B 4X4ME 2VDPL 3BZEB 1GGUA 3FAXA 4O00A 3FQNB 5FM8A 5JTWA 2P4AB 4FP8H 2B0SH 3LIZH 2H2PD 3QUML 5FYJL 3T0EC 5FV1L 1ONQB 1K4DA 3MLXH 5SX5H 3WIHA 1IKNA 2UVEA 3RTQB 3NIFE 2JJTC 3UYRL 4YE4H 2DWEB 1NBYB 5GSVB 1ZTXL 1YEDA 2XNAB 1CR9H 1R3IL 4NNXA 4OM1H 1MQKL 1QSFB 2VKWA 4NO5B 1U8NB 1DJSA 1TETL 4XPBH 4G8EB 4Q6YA 4YEEA 5TDPA 4JDZA 3SDCB 1CFVL 4NKOA 2E7LA 4D0DA 4P9HL 3QI9D 5FYKL 3HA0A 4K3EL 2OCFD 1QLEH 4RBPK 3P9MB 1X3DA 3NA4A 5E8EB 4PIRF 4HUMB 2YD3A 4LSDA 3ULVE 5E2UH 4FQIH 5D7JC 5FECB 5GRJL 5E8OA 3WLBA 3MV7A 5D96C 1CGWA 4HT1L 3MROB 3UTQB 3QRFM 4RGNC 3EYVB 4LCYB 1GGIH 1SBSL 3AFLA 3VXRD 1JHKH 1CT8A 2EXWC 1UEYA 3GMLB 2JCCB 4WW1B 2F19L 5KJRL 3WE6A 2NY1B 4M8VA 2I9TB 2WSKA 4R6UA 1T66C 3L5XH 3N9GL 4Z8FL 1P4IL 1BQHA 1OPGL 5ID0B 4E5XB 4POUB 2VITA 4K94H 3RZCA 1T1YB 1S9XB 1TZGH 3M1BB 3CDYA 5CD3B 4XP4H 4HS6B 2OI9C 4QGYA 3QG7L 1ZLUH 3ZKQD 1MCHA 1FSKB 2FECL 5CCKL 1DVFC 1TQCC 3RL2A 5IM7B 4OCXL 3EOAB 3QDGB 1H8NA 1ZE3C 4XVSL 1FNLA 2UWEE 2AV1A 5SX5K 4G3YL 4GKZA 4ZQKA 3TBVB 2RR3A 5I16B 4L4TE 1ZANH 3D39B 3MRDB 4PJIA 5I71B 2BERA 3OKDA 5HHOE 3HLAA 2GSGA 2B39A 3DRTB 4XP9L 1DQMH 1OAKH 1AKJA 1MJ7L 1PAMA 4GT7A 2HFFA 1CDIA 3LPFA 1JK8B 1IGJA 1Q94B 1Z9LA 2WZPD 5IEKA 4PUBL 2EC9U 4QT5A 2R2EA 1X5ZA 2I60H 2WP3T 5JW4M 1T5XA 2OTWA 5F3HB 3MBEC 4OLZH 4BUHA 2BRRH 2XG4A 3KPPB 3O9WC 1SYVB 4LIQH 2CD0A 1CDYA 4F7EA 5EOCJ 1UXWA 1VSCA 5DRNB 1JWUA 5I66A 1M7DA 4CKVX 1A4KB 1LEGB 4X83A 2VDKH 4XXDB 3STLB 4BH7A 1A6TB 1R3HB 3MRCA 5F6HJ 1M7DB 3GKZA 5EUOA 4YZFE 3V6ZB 2ADIA 3MACL 3TIEB 4Z7WA 1I9IH 1HZHH 5D1ZA 5I8KL 3UJIH 1E4XL 4LNVA 3F58H 1EHLL 3VXRB 4GQ9H 4GAYB 1QBBA 2BRRL 1RFDL 5EBWA 4APQB 4HEME 2W60A 3DMMD 5CMAB 1JFQH 3L5WB 3ULVD 3OF6A 3IKCA 4HF5H 1EGJH 1FORH 4LCCA 3HB3C 2FZ3B 3HN3A 2RGSA 2OBGA 1T6WA 1N5YL 4UUJB 1U0QA 4NIKB 4APQA 2A74A 4LGRB 1ZVHA 3VFPB 2L7JA 1RUPH 4ZS6C 3D0LB 1YEKL 2GTZB 3D0VB 1DR9A 2H32A 1D9KA 5KSUB 2Z4QB 1U2HA 3T0VA 5C7XH 3G04B 4LHUA 3RZCC 3TJHD 2J12B 3CVHH 4JFYB 1Z0NA 4KTEH 4X99B 5E2VH 5D7LD 3WEXB 1IM9D 1QNZL 3FRUB 1NGYA 5T1KB 4HPYL 5DJDB 2IPTL 3M07A 2XG5A 5E6YA 4GW5A 2DQEH 3U0WH 1NCAL 4TYUA 3RVWC 3D85A 3K1DA 5I73C 3TH3T 3QUKA 3VG0L 4L3ED 1UJTA 4JZJC 2YK1L 4IIQB 3ESUF 1QBAA 1HSBB 1KIRA 1PG7H 2VE6B 3I3BA 4J3UA 2IQ9H 2VR5A 1BQLL 1W72A 4NBXB 3HS0B 5JLZB 2HLAA 3LQAC 3U0PB 5D1QB 4IJ3B 3N9GH 4Z8FH 3SGDI 1VDGA 3FB7A 1TNNA 4G8FB 5D7JD 2CDGB 1XZ0B 3UZVB 1N5YH 4X7TB 4Q6IB 4DJMA 4KTYA 4NSKA 3ULSA 3D2UD 5IIEB 4RIRA 2AXGA 4N9OB 2BVQA 5F8QC 4YXKL 5JDJA 4HUVB 2E7MA 3UZQA 1V5JA 4WFGD 2JB5H 4KHXL 3KPTA 3FQRA 5BS0A 2W9EL 5KBNC 3X11B 5T3XE 3GJFH 2XWBB 2CRYA 3BGAA 4PLJC 1PX4A 1FE8L 4V1DA 1NAMB 1I7ZA 3HMXH 4S1DC 5DO2C 3TBVA 2FD6L 1JI1A 3TNMA 4P9HH 2X9XA 4O51B 3PWUA 4K3JH 4GG6A 5C0BB 2DD8L 3RNQA 5K9OA 2YK1H 2ZCKL 2OJZH 3ABZA 3LEXA 3WIFB 2IEPA 5BVJB 5BRZE 2ZWLT 4WV1B 1XR8A 2FSEB 4H1LA 1CTNA 1MRDL 4J4PD 4Y4HC 5ESVB 2HFFB 2CUIA 4Y5YA 1BZQK 4HHAA 1W0VB 3CSYB 4JRXE 3VH8B 3FN9A 4POYA 4UQ2B 1S7UB 2A83B 1YNLH 4NO3B 5I1LA 2DLTA 2MQ0A 5MENB 2C3GA 4Z5RA 1JNNL 3CVHB 5JW4Q 4MJ5B 2FJFA 1E4XH 3ISWA 1QFUL 4NZJA 1CD8A 4UQ3A 3QUXB 4Y4FD 3RWJB 3ES6B 4JFXA 3O3AA 5MENA 1KTLB 4TUKH 3KG5A 5EOCL 3EO9H 3ZHDA 5JA8B 4EXPX 1IT9L 4NKDB 2DYPD 4NQED 1KF9B 4D8PB 2R29L 3R1GL 2CIIB 1UA6L 4OCSL 4ZFOL 4XCCL 1GIGL 2SEBB 3S96B 4JREB 1AD9B 2ADIB 1SEBA 4F2MB 5E6IB 1KEGL 4NNXB 1CGSL 4JZJB 4X8XA 5KVGH 4Y1AA 2AEPL 1FPTL 1U41A 3D3VE 3BSZL 5KSAD 1FO0L 3HPLB 3WFBH 1G9NL 4NQVA 4WUUB 4UDTB 4PB0H 4DQOL 4FQXD 5D70L 5FO8B 3JV4B 2FHCA 4ZTPH 2P5WB 1NBVL 3MPCA 1WIUA 2F53A 2Q7YB 5DD5H 5FHAL 3V4PL 1IT9H 4PLKC 4HJJL 1V7NL 4OQ1A 2AK4E 1TCMA 3RVUC 2FJHA 1I1AA 1W8NA 5D6DA 3ZKXB 3P0YH 4XAWL 4UNUA 3O3BB 1UCBH 4YHYB 5C08E 2VR4A 3E8UL 3KPSD 3BRFA 4JPVH 1MJJB 2Q8AH 3MUHL 9CGTA 3LZFL 2NY7H 3NCMA 3RFZC 4CW1B 2BOBA 5FCSH 3G08B 1EMTL 4RGOH 1S3KH 5KVEL 1T0PB 4JQXC 5HPOA 2HWZH 2X2YA 3BDYL 5E94B 1MRDH 3HE7D 3HC4H 3QQ9D 4WO4C 1HIMH 4Q97A 4FRWA 4UV7L 4UINH 1I8KB 3IFLL 2BVPA 3QA3A 2GJ6A 5GRUH 1UKSA 4PJDA 2VDQH 5DUBB 1CE1L 12E8H 5BS0E 2HT3C 3GIVA 1YYMH 3ROLA 1RZJC 2QHLA 5CIPH 1TJIL 4S2SB 5DK0A 1KEMH 1TVBA 5F9OH 1MWAA 3FN0L 4IMKA 5C07B 3SDXA 1JGEA 2YD7A 4YDJA 1U2CA 1T22A 4WI3A 1G1CA 2CDEB 5BVPH 3MA7A 2X10A 3F7VA 4MDIA 4XCEB 4GBXD 5EB9A 1EV2E 3OAYK 2IALA 3VMPA 1UJ3B 1A6UL 5CSZB 5BRZA 2QSCL 4OZGA 4HLZH 1AQKL 4K3DH 4LSUL 1MJ8L 5L8JB 4PJFA 2HJLA 3LKSB 5GGRA 4APQD 2GFBA 3H9ZA 3J8F7 4E0RA 3WMSA 5C86A 3JWDH 5JXEC 1ZS8B 4KK9C 1NC2A 2VDQL 2VLJA 1LD9B 4NYLB 4EIZC 5IB1B 5KTEH 4YPJA 1ZEAL 5LWYH 4ZFFB 3UBXI 3B9DA 3DO7A 3RZCD 3QJFA 2QHRH 1UXWB 2NYYD 3C6SB 3FQUB 2H9GA 3ZKND 1G7LA 2FNBA 3VGAB 5EA0L 1S78C 4LLWB 3GRWH 4KK6D 5FGBA 4JQVC 1CFSA 4ETQB 5DHVB 1AP2B 1U8QA 3P4NA 4H5SA 2WBJA 1HXYB 3MBXL 1A02N 1GGBL 5MEOA 4YK4B 4XNXH 2R4RH 3O2VL 4RRPA 4M61B 3QO1B 2VUOA 4DVBB 4Z7WB 3MMEA 4HFWA 5C0AA 1CLOH 3TT1H 3VFGH 3DX9B 4FQLH 1GXEA 1I8MA 4WEUD 2NR6C 5CGYC 2D7PA 4K8RL 5IB5A 5FUCE 3LHPL 3MRBB 1CGVA 1YNKH 5A3ID 2K7QA 4NFDA 2XTJD 5B39G 1T0MA 2Y36H 1GZQB 4N5UA 5D2LF 4X4YA 4FP8L 4LCWB 3T0EA 2W38A 1P7KB 1I9JH 5DUMH 1UCTA 3ARBA 1C5CL 1FPTH 3VFOB 3FB7B 4PJGA 1XGUB 1C5BH 2VXVL 5DQJB 3UJIL 3UCRA 1J8HD 1PKQE 4FXGA 4JFZH 1ZA3B 2DWDB 2W07A 4XBPB 4ZUTB 3G6DL 1EFXA 1BECA 2AJ3B 1HQRB 4XC3H 4TUKL 3MUGA 7CGTA 1UFUA 3K4ZA 3ARFD 3TT1L 4AY0A 3IU4L 4UIKL 4XPTL 3ULVL 2VDOL 1J0YA 3FZUC 1N0XH 1TVDA 5DJ6B 5E7BA 5I1JH 2MWCA 2R2BB 1YMMA 3U4AA 2VLRA 1C8PA 2XZCL 3DXAA 3BZFB 4NHCH 4P2OA 3ZTJH 3T0AA 1MREH 1OM3L 1H0DA 5KSVB 1N0XL 1YEGL 3PP4L 1I3GL 4YHZH 3S35X 3VXOA 4HIJA 3S34H 4XPFL 4JO1H 3RNKA 2BFVH 1RU9H 3NIGE 1KTDA 2X9YA 2DTMH 4LEOA 1CICB 5EOQL 5IK3A 3K4DA 4DVRH 3D1MC 4I8DA 1NDMA 5LQBH 1FFRA 3F65A 3SKJH 2Y7QB 2NXYB 2R9HC 3TIDA 1SJHB 3ULVC 5DDHB 5CS7A 2EIEA 5DRWA 2AJUL 2OP4H 1GC1C 2ZP0T 4NP4L 1PW3A 2N7BA 3EOBB 4TQEH 4JLRB 3ZKXC 5I1IL 2BNQB 4P4RB 3EO1A 2F53D 4Y7MA 5FYKD 3TCLB 1BQHG 3IRZA 2FEEL 3PL6B 1MWAB 1TMCB 4R8WH 1HI6B 1GHFL 4NKIH 4YDJB 2ZPKL 3WLWC 1NCCH 4PJ7A 4Z95L 5HHQB 1MIML 4L4JA 2X4QB 5FO7B 2PCPA 2IMNA 4HULB 2CPCA 2DL9A 1IGIL 2H8PA 3VRLF 3O6LL 4PJGE 1G7PA 5KSAB 4ZO7A 3LKRA 2A73B 5HHQA 3RI5F 4MWFA 1RZGA 2PO6A 3RVTD 1EIBA 2XV6B 5HDOA 4GXUM 4QHLB 3L3DB 1IQDB 2LTQB 1JV5A 3U4BL 4YHOH 4LKCB 1HKFA 3BAEH 2J5LC 1VGKA 4QHMB 3ILPB 5HYSB 4TTDD 2ZUTA 4LFHD 3CIQA 3P4LA 4HK0B 1UVQA 3OX8B 3O4LE 3FQTA 4U1LB 1OARL 1VCAA 3VJ6A 2NZIA 1XCTA 4Y4FB 2F54E 4YIQA 4XWGH 5E70A 1I1AB 3QG7H 3UX9B 5B3JE 3DIFB 3IFNH 4Z0BH 4OQTH 2X70B 3VCLA 5HYJA 1B6DA 3CFEB 4XPGL 1F6LL 3D9AH 1A7BA 5EIIB 4GQPH 3BP4B 3BW9A 1KN2H 2N7AA 3GKWL 3VFRA 1PYWB 5SWQA 4LPUA 3V4VL 3SDDD 4K3DL 3G5YA 3CUPA 4Q6IA 4WWKD 1V3JA 3S34L 3CFEA 4OT1L 4WFHE 5IM7A 5GRYA 4YDKH 1RZKH 4KQ4L 1URLA 2PTTB 1R0AH 2HT2D 4WI6A 1TNMA 1UGNA 4GKZB 4RZCB 3U36B 4PGEA 1JGLL 4CMMA 4EEEA 4NT6A 4R0LB 3FB5B 3UDWA 1CI5A 4DOHB 4PJ8D 3QQ3A 2CGRH 3BH9A 3GSWB 2W92A 1EEZA 2ERJC 1SJEA 2IH1A 1OSPH 5EZOH 1BBDH 4GBXB 3B5GA 5GS0H 1Q38A 1RY7B 4GG6B 2FJGB 3ARED 4U6YB 3GMMA 5C0FB 4EBQL 3EDEA 1PQZA 3FFCB 2MHAB 4NN7C 3ULUC 4ZQKB 5DD6A 2NXYD 4A2MA 1CGUA 4JN1H 1HCVA 4RA0C 4OFDA 2IADB 3L6FA 3T3ME 3BD3A 5HXMA 5C0FA 1B2WL 4M7ZC 5MP6H 4IHOA 4M6NH 1K8DB 4K71C 4JY6A 4MCZA 5E8NB 5KVDL 1MHEA 3VDAA 5JPNA 3K8KA 1WEJL 1BVLB 4CL7A 3OSKA 4ZOCA 3BKCH 1FVEA 4G8GB 5EPMA 1F00I 1CTOA 5IR1A 5CKGA 1IAIH 4X5WB 4J8RB 4MA3B 1FFOB 3EJZD 3PV7A 1YEJH 1YN7B 3RX5A 3MTRA 4PRIB 3V4UH 4NKDA 3VXRE 4N8VG 3KJ6L 5DHVA 3THML 1CD1B 5D72H 1LMKA 4HH9A 3VXTA 4OLUL 4HWZA 2XA3A 4DZBB 1LO3H 3R0MA 1ZWIB 1OL0A 2EDLA 5IMOB 4RX4D 4HV8B 2JIXB 2CR3A 1MI5B 3MV9E 4IRJD 2AEPH 1HH9A 5HD8C 3STLA 2E7BA 4PGBB 3QUMA 3KLAA 3NH7H 2ATKA 2EXYD 1FC2D 3GZKA 3UBXA 2JIXA 5DQDH 3VGAC 2AJZA 4G6FD 4HKBB 2NMSA 4UDTA 5A16A 2APWA 4NCC2 1DEEB 3VFVB 5EWIH 3V0WH 4ACPA 3DURA 5EIVA 3WDJA 4LPWA 4G7VL 2NY2B 2EDWA 3RDTA 1RMFH 1QHOA 1P84J 3BFOA 3GGWA 4QO1A 1T3FA 4NRYA 1MJ8H 2CK2A 3U7WH 2FGWH 3LRHA 1AP2A 1T2QL 1P5VA 2AJSL 2D0FA 1OGAE 4QYOB 4YDIL 5LJYH 1KFAH 1NEZB 3S37L 3PL6C 3PWJB 2VXTH 3DSFH 1N59A 1R24A 4JPKL 2QR0B 2EDEA 4UV4H 5IF0B 2BCKA 4H1LG 4JB9L 1NANI 4I4WB 1JP5A 2V9RA 6FABL 3UTPE 5JPMB 1TJHL 5JOEA 5FECA 3CVHA 3D39E 1AXIB 4LRIA 4PJ8B 3A6BL 3CVHL 4TQEL 5GS1B 1YZZA 2CDGA 2ZSVA 3QXAB 3TJEH 2VQ1A 5E8DH 4DTGH 2FB4H 1CICD 2CIKA 3HZVA 4PJDB 4YHIB 2F74A 4N8CL 3ULSB 5IIEA 2R69L 3HMXL 3MO1A 4FQ2H 3GNML 3NPSB 1IGTB 3QIUD 1G9NC 4NUJB 1BM3L 1RZJL 3DARA 3GM8A 3C9NB 4P5TD 1IGIH 4FXGB 2VL5A 2RB8A 1BJ1J 1HINH 4ZUSB 3AAZA 4Z77A 5HHME 4ORZC 2BHYA 4ZUTA 5L2JA 2IAMB 2Z35A 2E7LC 1G6RL 1PFCA 4YHOL 5DUPL 2MOVA 4HUNB 1N4XH 2ZOLB 4FQHA 1XH3B 3KPNB 5I8KH 4HJ0C 5HYJE 5EU5A 1NEZG 2E9IA 1A6PA 4IOIA 2VLME 4JFDE 5KANI 1AD0A 4U05A 4YHPA 3JV4A 3PIQA 2OMBA 4IOFD 3B6SA 3O3DA 3QXVA 4RMSA 4G5ZH 5J13B 1WTLA 1NSNH 1JUFA 4G6KH 5DD6B 5JW5B 2XN9D 3V4VH 4LLAA 3MLWL 3RUGF 3LQMA 1N7MH 2IC2A 5GGSA 3UTOA 3RIFF 5CEYB 2D31A 4JRYB 4D3CL 5KG9B 4GAFB 1BOYA 1C7SA 1QRNE 1YEFH 5JXAL 1HXYA 4Q9QH 2W59A 3N06B 3KNBB 3CC5A 4Y4HD 2Q8AL 3WO3B 4WJ5B 4K23H 4JQIL 4M6OH 3MBEB 4DCQA 2EDFA 1QUNA 5KG9A 3WIIH 3QEHA 3H42L 1K85A 5MEPB 4NRXA 4P5MA 2BY3A 1KV3A 2HVJA 2EDQA 3QRGL 4JKPH 3WIIL 2GJ6B 1BD2D 1HOCB 4AMKL 2BNQD 3V8OA 1MCIA 4KKAD 4UQ3B 5IWLA 4ZTPL 3ARXA 3QNYB 2OL3H 4NC1E 2FIKB 3OKMB 2APTA 1RUMH 4KV5E 4U1SA 4I0PB 2YRZA 2PKDA 2PYED 1PZUB 1FG2A 2XN9A 2J8UF 3MLWH 2XKUA 4JN2B 3P4MB 4P46A 4OTXL 2EYSA 1OW0A 4PY7A 4UOW0 3IGAA 4PGEB 4K07A 4XCCH 3ILPA 1AO7D 3REWA 2W0PA 5ILTL 3CXDH 1A9BB 1FNAA 1NUNB 5CUSH 3WNPA 3A67L 3EZ8A 3MXWH 3MRRB 1KTRL 4JFDA 4PJ9B 1LD9A 1QSEB 1C12A 5A43C 5KJRH 2CSPA 3KPRE 1RJLB 2R2BA 3CK0L 3HHRB 1RJCA 4JANB 5AZ2L 5MI0B 4YO0A 1TZHB 4L3EE 5GRVL 3TPUB 1F4WH 3D25A 1TVHA 3QUZA 2X6MA 5SWZA 4NKMB 2VXQL 4UTAL 3TYGL 4EDWH 3CGTA 3QZWB 4BA8A 5I1DA 2GAZB 1UWEH 4H20H 2OMNA 5ALBL 5DZLA 4FQLL 4X6DB 2NXZD 5T1MA 1H3VA 5E8DL 3VH8G 2VDRH 1BFSA 5DZOA 3U36A 1T1WB 4G9DB 3MJ9L 2A6IA 4U33A 4WNQA 1N6QL 4NT6B 2DIBA 3SDCC 5F88A 1XCQA 2P45B 2BVEA 5IR1B 1KCRL 4NQCB 5B8CA 4GRMA 5E08H 5A1AA 1BIHA 4PG2C 2P8MB 4XPAH 3AC0A 2HWZL 4DUWA 1KNOB 4DW2L 4OCXH 3ZKMC 4N68A 2JJSA 3CU1A 4KTEL 4ZS7L 1ZVSA 4S1QH 2QQQA 2P7TB 2B0SL 2BZDA 4HGMA 4LPTA 4RCAA 5SV4A 1JF1B 1NC2B 1G7MA 2YD6A 2VTFA 4GRWF 1AC6A 5I74C 4P2RE 4R90H 3FFCD 1MCPH 4LLQB 4FG6D 3SN6N 3RU8H 1NC4D 1L9MA 1XGRB 1U8NA 5IFJB 4UZGA 1U3ZA 1CGTA 4JEGB 1P7HL 4XT1C 3NFSL 5L88H 1A3LH 4LKCA 3IB4A 3SDCA 1IKFH 3KVQA 4N0UA 5CILL 2PNDA 2I27N 4BQBA 3LKSA 5GGRB 4Y0GA 4CVZA 4FZEL 1X5YA 2PYEB 1GC1H 1U8QB 3P4NB 3IJYB 1Y0LB 4GRLB 3L3IA 5D1ZD 1X4XA 1BIIA 4F33B 2ILLA 3T77B 1JPGB 1NAKL 4NRZA 1QFOA 3BMWA 4JPVL 3VH8A 4TSCH 3QH3B 2WBJD 1UXSB 2H9GB 1RIVL 1AH1A 1OAUH 3NCYS 4LEXL 2FYYA 4PJCE 4YDVA 3JTTB 2QEJA 3BP4A 5GRVK 1CF8L 1L0QA 4UINL 4N8VB 2XZQH 3HC4L 3U0TA 3O11B 4JY4B 4KJQD 5DJ2B 1RV6X 5C08A 3F7PC 43C9B 1JF6A 4XMLL 1J0JA 3WFZA 2ICWJ 3FQWB 5GZOD 3LKQA 4GAYA 3LH2L 1S9XA 4JO3H 2XICA 3OHXB 4ZD3L 3MFFB 2HH0H 1MIEL 4ORGB 5IB2B 1ETZB 4LCCB 1D5XA 4YPGA 5D93C 2CIIA 4JQVA 3SQOL 4HKXA 5HYQA 3O0RH 2FO4A 3Q1SL 1MIEH 25C8H 3HE6C 4M5ZL 4QRSB 1E4JA 3F58L 5IB2A 1EHLH 3LKOB 4N0RA 4HJJH 1I8IA 2QQNH 4PJIB 3Q0HA 3CZJA 4YHMH 1NGWA 3VRIA 2VR9A 2GYSA 4LLMA 2CXGA 2EIZB 3TF7C 3GI8H 4QRTB 3JUZA 3MLYH 4KKLD 4F7PA 3S88H 3BIAX 1X5IA 4PB0L 1BJMA 3EOTL 5FCUH 4AQ1B 5K9JH 1T80A 3K1KC 4M6AA 1X4ZA 1FNHA 3INUH 4LLMB 5D9SB 5C2BH 4GAGH 3O3EB 1NAMH 3MJ9H 4EVNA 1EFXB 4XMKL 2OK0H 3ARGA 4UMGA 1RZKC 3HFML 1CXIA 1HIML 1AHWB 4WW2C 4WU7B 3RWGB 2P8PB 3DUSB 1PSKL 3MOBL 4C83A 3QXWA 3QDMB 3GBNH 4V2CB 2L7UA 3OR6B 2J8UB 4HC1L 5J11B 3LEYL 1WBZA 2RFXA 3O8XD 3EJJX 2OSLB 5I8EA 3TLRA 4NSKB 1B4JH 5IFHH 1IGYA 2CRZA 2FGZA 2GSIB 4ZFZB 1LGVA 5FYLE 3WE6B 1ADQL 1QKZL 4MAUH 5DC9B 2R2CA 4NJAL 5EORH 3TJEL 2ZG2A 1B4RA 1P4LB 1X7QB 4YBLB 4OFPA 4LCWE 1G7HA 3T0XA 1SYSA 3KLAB 4X6CE 3F7QA 4CN1A 2GTWB 3M1BA 3CXDL 3AVEA 2KZ1B 2JJWA 3IF1B 3BPLB 4JFOB 2WV3A 1QVOA 5JOFB 2DQEL 1L6ZA 3VD7A 2W60B 1O7VA 5J12C 1ITCA 4LVOB 1P7QD 1A1MA 3QCUH 2H2SD 2AVGA 3QIWD 4HWBA 2NQCA 2JJUA 1NFDF 5DTFA 1XR8B 4G8GE 5C0GA 3HNVH 1NUDA 2V5YA 1T3FB 4I0PA 3OXRA 2P49B 4KI5D 3AMKA 3IDGA 1SVCP 5DJAA 4DGYH 1QRKA 2OL3L 1IKFL 4UQ2A 3SEPA 3QG6B 2UZYB 1K3ZA 2V5TA 1QR1B 1R5VA 1HHJA 4UTAH 1AXTL 1VHPA 4KI5C 1BGXL 2IG2L 4MWFB 4RWHA 1X5XA 4U6TA 1A6ZB 4HIXH 5CLTA 3CJJA 3PWPB 4WUUD 2Z8WC 1FYHB 1JWSB 1OP3H 3ZE2F 5HPMB 1MHEB 1R5VB 3OMZA 4UU9B 3TYFB 3L3HB 4G8EA 3KHOA 1DLFH 4ZAKC 3G5ZA 4HPYH 1KPRB 5JUEL 4D0DB 4ENED 3AMLA 4FQCL 3KYNA 2ICCA 2MFNA 3WSQH 1QP1A 1YNLL 1CBVH 2FLRT 3LY6A 4K94C 5T1LB 2E8YA 5CUSL 1MHHB 4K3EH 2DKMA 4N8CH 1SVZA 3MCG1 3TWCL 5C09A 1W2KT 5GGVL 3SJVD 1RK0A 1RQ5A 4NHUB 3IFPB 2XI9A 5HBBA 2NY2D 5DEFA 1QG3A 3EYOB 5EO9A 4HBQA 3U48A 5CZVL 1A4JB 1DZBA 5F70A 2UY7A 5DJCB 4AT6A 5I15H 1F8TL 1L7IH 4KMQA 4U0RB 4HF5L 3S4SB 1RJYB 2BVYA 5J13C 2V5MA 5C7XL 2I60L 2R9HD 4JQXA 1GAFH 1ES0A 3ORJA 4WEMB 4HLJA 3IJSB 4M5YH 5AUMB 1Z9OA 4R4FH 4JVWA 1RJYA 4P9MH 2EO1A 5TPWL 3VE0B 4WUKL 1FO0B 1QO3B 5LGHL 3WFEL 1RMFL 3N0PB 1MCDA 1OW0C 5T33H 5EU6A 5BVJA 3SDXE 1RUQL 4I13B 5E99L 3GNMH 3F8UB 3PHQB 4I3RL 3A67H 3TO4C 5C0AE 3KPLB 5J1TC 3KLDA 3W11D 4KKAC 4NO0D 4FQJL 1FFPB 1MH5B 1LEIA 3BJ91 4OFVA 2H6PB 4OZFB 1DTUA 3GMOA 4LNRA 1IC7H 5DUBA 1OTUD 1JF5A 3I9GH 4IHOB 3ZE0E 4OZHA 1A6AB 2HLFD 4B7IA 2WLYA 4I2XA 5TE4H 1RIHL 4KJQC 2P5EA 5F6HI 1KNOA 3L3IB 1U3HB 1Q8MA 1T4KA 1DQLL 1YEJL 3HNSH 3Q5TA 4DFIA 1A7QH 2V17L 4WGWB 3TVMC 3SDAA 1U95B 1XGPB 3D3VB 5C0IA 2MJWA 4HWNA 2VDLH 4BSVA 5HI3D 3MBXH 4W4OA 3JXAA 5T3XD 1UYWL 3QEUA 3NZHL 5A3IC 3ARSA 5I6XC 2GJZB 2NCMA 4M4PA 1GJIA 3TO2B 3CLFL 3D2UB 4YHKL 5TGBB 1GL4B 4KK8C 1WWAX 2BNQA 4OIAA 4P4RA 3A6CL 1FN4A 3E1F1 4MSWB 5HI4C 5CJBA 3HAEG 3FQWA 5SWSD 1MJUH 5ID1A 3WFHB 1A3QA 2ZUSA 4YXLH 3FB8B 1YECL 2HMIC 5BV7H 3RP1A 4OAWB 3GI9L 3V5HB 3HFMH 4GW1B 3PWNA 3CFCH 4EBQH 5JNYA 2AJZB 1NDGA 1RIUL 5KSAC 1E6OH 4A6YA 1BBDL 5GIRB 3O3DB 5MENE 4XH2A 3VG9C 4XBEH 3LOWA 2I07A 1MWAL 1RJLA 1NBQA 4GRLD 1M1SA 1HEZA 1HE7A 1KCKA 4YUEL 5ESVA 2WWMC 4WWKB 2ARWA 2IPUK 2ICWA 4PJBE 3QHZH 3OKLB 1JWMA 1MCWM 5FYJH 5KS9F 3MMEB 2P5ED 5ADPL 4M1CD 4FA8A 1RJZB 1S7TA 4GLRH 5JW3H 1OTSD 3BD4A 3BPOB 4LU5H 2Q76A 3HZVB 1XGQB 3H9HB 3IFOA 1ZKAA 5JOPE 2MPAL 2FECI 1QQDB 1JWMB 4MNQB 4NC2B 5FXCH 3WNLA 3MV9D 2CUMA 2YPKA 1MHPL 1RJZA 4AMKH 5JHDD 3VI3E 3BP5A 4NZRH 5FGCB 5HDBF 1WT5A 3ROLB 2OTUA 2DMCA 4MA8H 1VACA 4HUVA 5GRJH 4TPRH 5GS1A 4MD5A 1ZTXH 4U1MB 4U1NA 5GISH 5EOQH 2MTPA 3KPRB 4XMPL 2A2QT 2H1PL 4I18C 4QOKD 5D71H 3BE1H 3BIBX 1BVKA 5GS0L 1JN6B 3WHE0 1JGUH 4S0SD 3MLUH 4U1IB 3KHQA 5JDSA 3SBWC 1D5BA 1NC4A 2XA8H 3O6KL 3VFWB 2HJFA 2Y06L 2CRMA 2DQTH 3T3MF 1Y6NR 4G8GD 3BH9B 3GSWA 2AS5M 3U6RA 1CU4L 4L9LA 4QCIB 4XP4L 3MC0A 3ARGB 1ZLSH 1XF4B