1U96A

Solution structure of yeast cox17 with copper bound
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
69
structure length
69
Chain Sequence
MTETDKKQEQENHAECEDKPKPCCVCKPEKEERDTCILFNGQDSEKCKEFIEKYKECMKGYGFEVPSAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase copper chaperone
publication title Yeast cox17 solution structure and Copper(I) binding.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 10
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2004-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05051 COX17 Cytochrome C oxidase copper chaperone (COX17)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1130 Mainly Alpha Orthogonal Bundle Helix Hairpins CytochromE C oxidase copper chaperone 1u96A01
2LGQA 2RN9A 1Z2GA 2LQTA 2HP8A 1HP8A 1U96A 2RNBA 1U97A
chains in the Genus database with same CATH superfamily
1TVKA 2EILC 1QVFU 1WAZA 3JAWB 2KB1A 5TISZ 1H8EG 2UXXA 3SJCC 3N2GA 2DN9A 4QGPA 4JI2O 3HKDB 3LDDA 4FM0A 1S5JA 3OE7G 3FX7A 3SYPA 2PUSA 4LF7O 4DV1B 2ITCC 1TAEA 2ZIOA 2YIAA 1QLEB 1B04A 3CX5F 2ZXWC 4MVSA 1BZKA 2QA4V 3RYHA 3F5WC 5J9PC 5H9CA 1Q6UA 3CRAA 3EFFK 3BRCA 2B1GA 3KKYA 1G1XB 2ZQMA 4X64B 4J10A 4K0KB 3HKCB 3ZJZA 3E8FA 2A0LA 2ZDIC 4L87A 3FKSG 1VQKV 5JWPA 4JZGA 3UT5A 2BSKA 4GX5A 2Q73A 2YXYA 3LDCA 4X65B 4FZ0A 4JAUA 3CXCU 3CCMV 1I94B 1XMOB 1Q3EA 1ZX3A 4DRXA 2LQTA 1Y74A 4EKWA 3CCVV 1SQBH 5FL7G 3ZX6A 4JTCB 1RP3B 2ZINA 2ZXWB 5LYJB 1IBLB 2Q0OC 1QU7A 1ZL8B 4RWUA 1GK9A 1L1FA 2Q0AA 1SQGA 1Y76B 1ZTEA 1S0VA 3ZRSA 4A5UB 4GKJO 4FLYA 2UUAB 1IVSA 1N8RW 2W0FC 3K58A 2QKSA 4BIUA 3K08A 5C8YB 2CTPA 5B66Z 2RMKB 3W7SA 2LGQA 4PA4A 4B7EA 3G6EV 1N36O 1IXMA 3MAQA 4TT3G 5LOVB 5KAFZ 2A7WA 4CS3A 2QWQB 3IJ4A 2E3CA 3K9AA 2Q7GA 2R9RB 1AJNA 2UUCO 2WLIB 1M9NA 1K73W 3AK2A 1GM7A 4XBFA 2N04A 3ETDA 1HNXB 1XHZA 5KUMA 1VF5B 1FFXA 4W4KA 3KCYA 1N33O 1XL6A 1VQPV 2VS0A 4PJ0Z 3ZMSA 1AP5A 5LBQA 4KL1A 2LJ2A 5BXZA 1KC8W 3G80A 5L3CA 1QLNA 2ODMA 4O4JA 4DUYO 2A06H 4LH7A 4JI0O 1QQCA 2LGWA 1WP8A 1B06A 1PNLA 5J2UB 1YCIA 1P4RA 4R50A 5F2VO 4FMTA 3UO2A 4LFBO 3ZMTA 2XNDG 3CCUV 1YTFD 1D2DA 1YIJV 4YY3O 2XAHA 4EFEA 1IBMO 3HPLC 2QEXV 1NKDA 1R1BA 2P4VA 1AJPA 4KXRA 1E1QG 3K04A 1E1RG 4LNUB 1Q6IA 1MOFA 2EIMB 4K8ZA 3B8MA 3ETGA 2JIZG 1PKXA 1NTZH 4NVPA 2FMLA 4TV9A 2HHHB 4JYYA 2ZE7A 2JEUA 4MVQA 3K0GA 4OGQB 1BT8A 1N0NA 1SQVH 5IJ9B 2HJDA 2WWWA 4NYKA 3FFQA 4PHZA 4GKKB 2H94A 4JASA 4JI5B 4UCVA 1I5YA 5KMGB 1EZVH 1HDJA 2YXLA 2LP7A 3HKEA 4LR3A 4MTGA 1NR7A 1AROP 5GONB 2WA4A 2Q68A 3RYIA 4PV1B 4DR3O 5JH7A 1JOYA 3OT7A 1YTFB 1OV9A 4DV6O 3E22B 3ZHRA 2LFSA 4O2AA 3Q4HA 3GB7C 2QM8A 4H0LB 5EIBD 4LF9B 4O4HB 4UUJC 5LMNO 3ZN1A 1I08A 4NKGB 3WB0A 2QM4A 2QWRB 3BA9A 4H33A 4I7ZB 1OCRC 2R72A 3TJTA 1BL8A 4EFBA 3L70H 4X66B 3E2EA 4XDLA 5ITZB 3D36C 1JX9A 3P3NA 4QIWF 2ZE6A 5KUKA 3JAKB 5DM6V 2RNBA 3PJSK 1I5XA 1JJOA 1F4NA 4UXNA 1SC5B 4O2BB 3U11A 4IYIA 3I5DA 4BWAA 3CC4V 2ETNA 3CJHA 1GTOA 3LDEA 2KKWA 4J7JA 2HJFC 1J5EB 2ZE8A 3JCUZ 1Q6HA 1JCHA 2UUBO 1Q7YW 1PP9H 3OMAB 1ZLZA 4LWSB 2CH7B 1Q82W 3AEIA 1VARA 1BGYH 1FD9A 1PD3A 4I0XB 4MVUA 3ZIAG 4TOIA 4CZZA 2DOSA 1H2GA 1OCRB 5IY5C 1WJZA 4JGSA 4YJ3A 5JJEB 2AW9A 1I0HA 5IYDO 1KU9A 1WP7A 4NXMB 1K4DC 5FLXN 1WA8A 1HWYA 1PNKA 1XREA 5KHHA 5KHGA 4DW0A 1D5AA 4KHPO 2JGUA 3APQA 1H38A 3CS5A 3CYOA 3E8GA 3LNMB 1AI6A 3WB2A 2A9HA 4LF6B 3K06A 3RVZA 1YJ9V 4HNAB 5LMUO 4DXWA 4RQFA 4DR5O 1AB3A 4E4EA 2VWJA 3T1HO 2H3OA 2JJ2G 2VQFO 5EBWC 4RUFA 3W7XA 5IY5B 4BW5A 2QWOB 2RN9A 4LF4B 1CEZA 1XBLA 1H2LA 2Z3YA 4ASUG 1JFFA 1KBHA 2XHBA 1TUBB 4J80A 1ZAUA 3SYOA 5LGTA 4WFBV 2R70A 2KG7B 4X1IB 4DV5B 4MW3A 3CHXA 4LF5O 1M4UA 1OCOC 1BQZA 3ZHTA 4X1YA 4WFGA 3VQVA 5E1AC 1YITV 3RWRD 1XNQO 4P30A 2LO1A 3L9DA 3D3QA 4JZ2A 3H1IH 4IL6Z 1NU1H 2X6CA 3O65A 2XASA 2CTQA 3OUSA 2M6YA 3K5NA 3DSQA 4I50B 3UM7A 4LFAB 2JK5C 1SA0B 4X62B 3L71H 5LXTB 4GKJB 4YHHB 3ASNC 4JI8B 1YSCA 1NS1A 4CH4A 1N4CA 4EB6B 3CSXA 2GHYA 2OCCC 4LF8O 1ZUQA 2WLNA 3K57A 1FXVA 4IIJB 1S72V 4N21A 1K8AW 3OTOB 1OCOB 1R6NA 1R73A 4FFKA 4R8CA 4U7NA 5C93A 1HNZO 3DXRA 5LYJA 1PL0A 3P3PA 4QPKA 3OR7C 4BW9A 4FM2A 2UUCB 4X9QA 3AG2B 5LGUA 1HP8A 2LFRA 3FB5C 5GTIZ 3I56V 1MMMA 1FXKA 4QE9A 3QO5A 3ASNB 1CPYA 2UU9B 1K4CC 4W4LA 2JVDA 2L6LA 5D5PA 2OCCB 4YXWG 3OEHG 2RQ6A 4JI7O 4WFHA 1DF4A 3FAVB 1N34B 3JD2A 4PA3A 2E5LB 4UFZA 2AZ0A 4B3MB 1EN4A 2UXNA 3RT3C 3GWOA 1JPXA 1K3EA 4J7KA 5LA6B 4FLXA 3CMAV 3G71V 1QNMA 3ZS8C 2ZIMA 3W7TA 5CBHA 1GMGA 2EZOA 3SYCA 4MS2A 2DJVA 3QVNA 1XOUA 4WBNB 3BABA 5KA5A 5KX5A 3CP1A 5JQGA 4IHJA 2DYSC 2JRIA 3UKMA 4B08A 2WA3A 3TETA 4MVRA 3BAAA 3B8NA 1J95A 3W7WA 4Z2WA 2UXBB 2VQEB 1K97A 2GUZB 2KQXA 1U96A 3BA8A 4DR1B 4FFBB 3S3XA 5IJ0B 3IC9A 3QO7A 2W6IG 2F1MA 1RSOB 3RFRA 3C90A 1PV0A 4KP4A 2ATKC 4TQDA 4J9ZB 5EYPA 1XUQA 4BIOA 1VQ9V 4LFCB 1MZFA 4FZ1A 3RYCA 2Q7EA 1H2KA 3FB7C 3IC7A 3GWKC 3P32A 2F95B 2DYSB 1NH2D 3AG3B 4QNHB 1VIBA 4TV8B 2ZE5A 2PI4A 4YJ2A 4JI3O 2HR3A 4RUEA 3LSSA 4WF9V 3MD0A 3JASB 4FLTA 2IJKA 4JI1O 2DE0X 4DR7O 2QJ1A 3BY6A 5IWAO 1O9HA 1SS3A 2X6BA 5JVDB 3RYFB 1SESA 2NR5A 3ML0A 1XMQO 5E79Z 4F6RA 1AILA 3IGAC 4I5SA 3JALA 4XDKA 3B40A 3F7VC 4NTXA 4GX0A 4UCTA 2XOKG 1Y4MA 2WPDG 1JR9A 2GDSA 4UV9A 4TUYA 3T1YB 4U3JA 5LMNB 3AG4C 3ZHSA 5FNVB 1VQ5V 4X20B 2NLJC 4O4LB 5BMVB 1IURA 4ZOLB 1QBZA 2OTJV 1H2MA 2P90A 5EC1C 5CA1A 2FKXA 1W2BU 3HKBA 1AP6A 2UXDO 2XT9A 1NR1A 1IDSA 2YIBD 3GVMA 1VQOV 3E83A 3CE2A 1NH2B 5GW7A 4JTAB 2FL4A 1BS3A 4FPPA 4ZHQB 4HZ3A 1SQFA 5LP6C 2AZ2A 2UUBB 3NR7A 1HR0O 1YEWA 1Y66A 2E75B 3ZRWA 5J2TA 2BTOA 5B1NA 1W0KG 2F43G 4YIOA 4DV7O 3AG4B 3JARA 1VQNV 3OGCC 4JYBA 1L0NH 1SRYA 1KUQA 3HR0A 2OIGA 4ZI7B 2PY5A 2WLLB 4JI4O 2IJIA 3SJQC 1V54C 4FM1A 4ICGA 4JI6O 4JV5B 5CB4A 4D7SA 3PN1A 5BR8B 5CMUA 3CXHF 3OTFA 4B3RO 5L3GA 2F4VB 5DECA 5LP6B 5KLVH 1VQMV 1HNWO 4KFMA 1Y6XA 3JSLA 4DR5B 4DV3O 4TWKA 1Q90D 4DR4O 3JATA 1XDCA 3JCZA 1T5EA 3A2FA 2IU3A 4PA6A 3B2EE 1JA8A 2D2CB 2QWPB 1R6KA 4R6ZA 2DW4A 3E8HA 3M8AA 1JQ0A 1L0LH 4TQFA 5IYZA 1V54B 3K5LA 1IBKO 2EIMC 5BZBA 2HVJC 3G67A 4UV8A 1GAXA 3SR2C 3OGIB 3N2KB 3ZRVA 4PDLA 4PDMA 3K59A 2BTQB 1R3JC 4DK0A 5EZYB 3E35A 1XILA 2IH3C 3ETEA 1KECA 2P5OA 5JCOA 3SPHA 5B3SC 1N0JA 1G4YB 1NQTA 2ILMA 3BFRA 4WFAV 2ZM6B 3U10A 2XAGA 1SF9A 4JF3A 4UB8Z 4DV0O 1SETA 4MVMA 3CCLV 4I55A 3ZHVA 2AHZA 3ASOC 1AJQA 2P06A 3EVKA 2JGDB 1TVKB 1PM9A 4AHCA 4JTDB 3SPIA 3ABMB 5B1OA 2JS3A 1R6TA 2V4DA 3FD9A 3N2GB 5EC2C 1VQ8V 3CCRV 4B3SB 3K03A 3JD4A 4P9OA 4BR6A 3E86A 1SKVA 1ZWIC 2RCVA 2HP8A 5B3SB 4KUMA 5LXTA 2CGOA 4JYAO 1CXZB 3ZRXA 4DUZO 1EN6A 3HB3B 1NBMG 3RYHB 1NJIW 5IT9N 3B77A 4GX2A 3ASOB 2QKCA 4I4TA 2EJ7A 2QWNB 2EIKC 3RVYA 2BOCC 4G27B 3G4SV 3QO8A 2V7QG 4QJFB 3B4SA 3ICXA 2YEVA 4MW8A 3SPGA 1SQQH 1VEWA 4X1KA 1GO3F 3E8BA 4X89A 3AG1C 4DV4B 2HVKC 1XQ8A 1GKFA 3CRQA 3UT5B 2BSKB 4DV1O 1S76D 1N32O 1TGOA 2K1EA 3ABKB 2Q4PA 1XL4A 4CBCA 2FTKA 3SYQA 4DRXB 2Q8VA 1Y74B 5HFLA 3CPWU 1H2NA 4F6EA 2ARHA 5JJNB 4B3TB 2X7RB 1Z2GA 4NXNB 1IZ3A 3AK1A 1MSWD 3CWBH 2H8PC 2GTSA 5EIBC 1XEQA 1WLEA 2EIKB 4DV2B 4X64O 3C3SA 4DO2A 4K0KO 4RO2A 2EJRA 1YDXA 1P84F 2Y4UA 5KA6A 3EXAA 3OD4A 4U7OA 1XNRB 1Z5VA 4R7CA 3AG1B 4X65O 3K0DA 1I94O 3AK3A 1XMOO 5CA0A 5H6QA 1B6QA 4PDVA 1Q86W 2C2AA 1BHBA 1IBLO 2HG5C 2CE4A 4DR6O 2F23A 4I9WA 5HFMA 1THZA 1XHXA 3VOUA 1GN2A 1JVMA 4JI3B 2OYQA 1RM1C 2UUAO 4O4IA 4GYCB 2A3QA 4H44B 1EZJA 4JI2B 4Z1MG 4JI1B 4Z1VA 4CS4A 1FFXB 2P67A 3L73H 2WLKA 2ZR2A 4ZKIA 4LF7B 1M1KW 2ZT9B 3OMIB 3QNEA 1VF6A 2PYLA 2WLJA 3LUTB 4IYHA 2DWDC 5DEDA 2ADPA 4DR2O 3CMEV 2YDEA 3E89A 3CC2V 4LP8A 3JAWA 4FLVA 4O4JB 3EHBB 5A2QN 3TK1A 3H01A 2YUAA 2EIJC 1HNXO 4C7UA 3HKDA 1RM1B 4J41A 1RPOA 3T2MA 2DYRC 1K5QA 5KHJA 4H37A 1H2SB 1NVPD 3M7MX 3TXQA 1K9MW 1DF5A 1OJHA 4HBNA 5H5NA 3AG2C 3J81N 3UCSC 3ABLC 1OCCC 4NTWA 2GTAA 2NNUA 2E76B 4DK1A 3HKCA 2EX3A 4TV9B 5IE9A 3RN4A 2O57A 1PL4A 2EIJB 5LHGA 2YI9A 3FYEB 3FB6C 4ZBMA 2ZKOA 1EM1A 2DYRB 2RJZA 5L3BA 3P30A 4XDJA 2X6AA 4CH3A 1N36B 3QG5A 3CRMA 1MNGA 2PGGA 1KKDA 1M57C 1BE3H 1ZL8A 3HKEB 1YJWV 3ABUA 4N23A 2YS8A 2E74B 1HNWB 3H9VA 1Y76A 1NI8A 4J42A 3ABLB 1OCCB 1F4MA 4DV3B 4GLXA 3OEEG 2PYJA 3A0BZ 4QE7A 3RYIB 5LHIA 1A32A 5JH7B 4AILC 2HHHO 1TA8A 2VWKA 1M90W 5C8YA 3ZHQA 1Q43A 1N33B 2MW2B 2ZDIA 4O2AB 4GZRB 3Q4HB 3AG7A 2Q7HA 2QSAA 1UJWB 2WLMA 2LW7A 4J7ZA 1K7DA 4GKKO 1BHAA 1FS0G 5LOVA 3VBBA 4JI5O 3SJAC 2FB5A 3APOA 4FLZA 4DUYB 2WLIA 1M57B 3TXSA 4JI0B 4WFFA 2BCCH 3S3WA 3KZIZ 1AR4A 3CJHB 2MK3A 1WB7A 4LFBB 3FYIB 2PTMA 1FJGO 2PF4E 3AG3C 3G6BA 3CEIA 4LF9O 4OPAA 4JPRA 1KB9F 4GT1A 1Q8IA 4YY3B 1TUEB 1IBMB 2JS5A 4B7KA 3CCEV 4MT8A 1G8MA 2A79B 4X66O 5FPRA 1MABG 1YF2A 4YJ3B 1JJ2U 3F7YC 3R65A 1YVWA 3DTUB 1WA8B 5J2UA 1S5HC 4F4LA 4J9YB 3K79A 1SQXH 1J5EO 4JYCA 4HYOA 1YHQV 3SYAA 5GTHZ 4DW1A 1GM8A 3WG7C 1M93A 3BEHA 5DN6G 3STZC 2IW5A 3ZHUA 1D5NA 4X8AA 4AI8A 4YIPA 3FB8C 4LNUA 2JGDA 1X59A 1WB8A 2R9IA 4GX1A 2Q6AA 1V55C 1YXBA 4UCSA 3T4ZA 2AXTZ 2GBOA 1R3LC 2V1DA 1QCEA 1R3KC 4NXMO 1MG1A 2JDIG 3OFNG 1URFA 3OAAG 1JMKC 2R9AA 4DR3B 1S3JA 4AQYO 2HFEC 1JFFB 2P22C 1MA1A 4DV6B 2LW1A 1S77D 2ITDC 2WAMA 4HAMA 3DC5A 5IJ9A 4LF6O 1FYJA 3SGIA 5D5QA 1NZ6A 1N32B 4X1YB 2IJHA 4E2LA 1FXHA 1KYOF 4Q20A 3LSQA 5KMGA 1IXBA 2G38A 2CTRA 3WG7B 4FLWA 1LR1A 2YXHA 3THOA 2CDYA 1NTKH 5EBMC 4GUNA 4PA9A 2P7TC 3CD6V 5GONA 4CS2A 1V55B 2EILB 1FXKC 4ZIBA 4LF4O 4FIPC 2Q9LA 5LHHA 3L75H 2P4KA 3E22A 2ZD9A 2B5UA 1COWG 2DMXA 4DV5O 2AHYA 1FPOA 4O4HA 2ADQB 3A0HZ 1K5SA 1VQ4V 2Y4TA 3X2QC 3T1CA 5K1PA 1W0JG 4WCEV 1LNQA 2F66C 1AI5A 3DXRB 1F23A 3DC6A 5ITZA 4DR6B 5IYCO 1US6A 3JAKA 2IBZH 3CCJV 3B09A 4X88A 2QR4A 3WU2Z 2Y0PA 2Z0AA 4LFAO 4X62O 4O2BA 4KHPB 4YHHO 3UQ8A 3A8TA 4JI8O 1FXKB 4G2KA 1HW7A 4LCUC 4JAVA 3OR6C 1K92A 3A0RA 2L35A 1SERA 4LWSA 2CH7A 4FVMA 5LMUB 3OTOO 1NTMH 2WLHA 2WSSG 2HKOA 1FKAO 1IX9A 4I0XA 2JEXA 2RDCA 3T1HB 4DR2B 3X2QB 2VQFB 2Y69C 4P9PA 3RGBA 4RAIA 1DLBA 3D36A 4ABMA 1KD1W 2OIEA 2YIDA 3H1JH 3K9SA 1EFRG 4MTXA 3RW0A 5B1AC 1GN3A 5KX5B 4LF5B 5JQGB 2UU9O 4IHJB 4J11A 3JD3A 3L72H 4CC6A 1AVMA 3ZEDA 4OX9O 4HNAA 4IT5A 2ZR3A 3ABMC 5A9GA 1N34O 2E5LO 1XNQB 2D3OW 4B3MO 3ZBHA 4PD4F 4UVBA 2PZSA 1BSMA 4PDRA 1V9PA 1MZEA 2YI8A 3MHSC 4H13B 5EBLC 4PI2A 2F93B 2Y69B 4U3FH 3OMNB 2GV9A 3H1LH 5EYPB 3ZMVA 3ZMZA 4MSWC 3RYCB 1TUBA 2KG7A 4X1IA 1K34A 4LF8B 5B1AB 1AI7A 3I55V 1QR8A 1MSDA 2UXBO 2VQEO 4YJ2B 2YSUB 4CC5A 1HNZB 2K9PA 2YICA 2UXCO 4DR1O 4D7TA 1DGSA 3H1KH 1AR1B 2IJJA 1W59A 4I50A 1Q81W 3ABKC 1SA0A 3J7AU 3LSUA 5LL6Y 2BOBC 2ZNJA 3KG2A 3H1HH 2OCHA 4EB6A 4LFCO 2QTSA 2QTOA 4F6RB 1UPGA 1AR5A 3JALB 3BVOA 1VQ6V 1BCCH 4IIJA 1KP2A 2Q67A 3CC7V 4TUYB 4U3JB 3OW2U 4MVZA 4JI7B 4TSFG 4Q6GA 5B1BC 3DGEA 2NN4A 5CA1B 3SDLA 3HKBB 1F51A 5L3FA 1ROPA 4K8XA 3K5OA 1O9GA 1GN6A 1K33A 4WFEA 2B1IA 2CGNA 1VP7A 4UCUA 1VQ7V 4QPJA 1M56C 2IU0A 5K1XA 4EEQA 3D8CA 3WB1A 4PELA 2N05A 3VQYA 1FJGB 4LC1A 2W6JG 1VMGA 2CK3G 3KCXA 3STLC 4P2ZA 1UFIA 3OM3B 3T1YO 1CP9A 3FAVA 3TCUA 3ZRWB 5J2TB 3ETQA 4GCZA 3JARB 1LUWA 1AI4A 1WNSA 1YJNV 4LBEC 5LA6A 2QKAA 2FYUH 2XAQA 5B1BB 1PPJH 4FLUA 2IM9A 1XI1A 5H2FZ 2VRZA 3CRCA 1F7YA 3N27A 4WBNA 1E79G 5CB4B 1M56B 3L74H 4MVOA 2XTAA 2ZCEA 1YZBA 1P7BA 2DQ0A 1EN5A 3VQXA 1KQSU 1WPXA 1P7GA 1ZSPA 2GUZA 1H8HG 2QDOA 3JATB 1BQ0A 4FFBA 5JCOC 4L8JA 1KP3A 5IJ0A 3O9OA 4DR7B 5KHIA 5IWAB 1S5LZ 2CAZC 1RSOA 3D3IA 3K5MA 4FJCC 5CN0A 1EBOA 2EZPA 1XMQB 3BCCH 3NXSA 5IYZB 4UCRA 3ZCCA 4AQYB 4JV5O 5BR8O 2OTLV 3WFVA 3ZMUA 1QHTA 2HLDG 2F4VO 4TV8A 2DQ3A 2DWEC 2CTWA 5L3EA 2M7WA 1SZTA 5AG2A 1B3QA 2UXDB 2N74A 3JASA 4DYLA 1WPBA 4UB6Z 3M99B 2EULA 2QE7G 5JVDA 3RYFA 3SPJA 2W0XA 4IGGA 4OXSA 4NB5A 2QGNA 4I55B 2XAFA 3F5TA 1HR0B 5LGNA 2OWOA 3W7UA 5H6RA 1FAFA 2BE3A 1SZXA 1X4TA 5FNVA 3CCSV 1I7FA 4X20A 4O4LA 5CA3A 2OT5A 5BMVA 4DV7B 4ZOLA 5JJJB 5BY1A 1FFTB 2Q69A 3BPZA 4CH6A 1G6UA 2ZNIA 4CH5A 3CCQV 4JI4B 3JYCA 5L3DA 2ZM6O 1RPRA 2B9ZA 1RFYA 2EBOA 4JI6B 4D6TH 3MDSA 1WN7A 1Z5WA 4ZHQA 2Y0IA 1OHHG 5CBFA 1BMFG 1ENVA 4B3RB 3IFXA 4I4TB 2XAJA 4BIZA 1Q5OA 2IH1C 2Z5UA 1GN4A 1M5IA 3SJBC 2YC0A 4DR4B 2QM7A 1GM9A 2YEVB 3U0ZA 3IAYA 5CBGA 3K3WA 4X1KB 4ZI7A 2KSDA 1ORQC 3R66A 1NVPB 4B3SO 3JD0A 2WLLA 1L8DA 4PA7A 1OCZC 3SPCA 4LH6A 1YI2V 1Y67A 1IBKB 5IYBO 1PNMA 3J80N 1VQLV 3RBZA 4MTFA 3VQWA 4UCOA 5LP6A 4OX9B 2GSMB 4NR1A 5KAIZ 1GRJA 1VF7A 2EINC 4G28B 3CRRA 3BHPA 2YIBA 4RQEA 3C3TA 3JAMN 1QR9A 2X0LA 3LNNA 2CUGA 2P6JA 1OZ0A 3JSNA 4DV4O 2JJ1G 1SQPH 1DK1A 4K35A 1VF6C 1KKCA 1OCZB 4DV0B 3ABTA 5CA0B 3QTCA 4UVAA 3QF7A 1LUVA 2Q5ZA 3T4DA 3JD1A 3ZN0A 4B3TO 2Y48A 4OPHA 3N2KA 5IDJA 4NXNO 4UVCA 1GH6A 2BTQA 2HEPA 1U97A 5EZYA 5KHKA 1NT2B 4DV2O 2EINB 3CB2A 1R3IC 4PI0A 3OUFA 4O4IB 5EK0A 3TGUH 1QVGU 4JAAA 2UXCB 2XUMA 3MHHC 1XNRO 4MTOA 4BAYA 2PI5A 2AGAA 5B5EZ 1QLEC 4JYAB 1KMIZ 1DTOA 4DUZB 3UO3A 4FK5C 4I9QA 1P49A 4NTYA 5FPOA 4K3AA
chains in the Genus database with same CATH topology
2LGQA 2RN9A 1Z2GA 2LQTA 2HP8A 1HP8A 1U96A 2RNBA 1U97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LGQ A;  2RN9 A;  1Z2G A;  2LQT A;  2HP8 A;  1HP8 A;  1U96 A;  2RNB A;  1U97 A; 
#chains in the Genus database with same CATH topology
 1TVK A;  2EIL C;  1QVF U;  1WAZ A;  3JAW B;  2KB1 A;  5TIS Z;  1H8E G;  2UXX A;  3SJC C;  3N2G A;  2DN9 A;  4QGP A;  4JI2 O;  3HKD B;  3LDD A;  4FM0 A;  1S5J A;  3OE7 G;  3FX7 A;  3SYP A;  2PUS A;  4LF7 O;  4DV1 B;  2ITC C;  1TAE A;  2ZIO A;  2YIA A;  1QLE B;  1B04 A;  3CX5 F;  2ZXW C;  4MVS A;  1BZK A;  2QA4 V;  3RYH A;  3F5W C;  5J9P C;  5H9C A;  1Q6U A;  3CRA A;  3EFF K;  3BRC A;  2B1G A;  3KKY A;  1G1X B;  2ZQM A;  4X64 B;  4J10 A;  4K0K B;  3HKC B;  3ZJZ A;  3E8F A;  2A0L A;  2ZDI C;  4L87 A;  3FKS G;  1VQK V;  5JWP A;  4JZG A;  3UT5 A;  2BSK A;  4GX5 A;  2Q73 A;  2YXY A;  3LDC A;  4X65 B;  4FZ0 A;  4JAU A;  3CXC U;  3CCM V;  1I94 B;  1XMO B;  1Q3E A;  1ZX3 A;  4DRX A;  2LQT A;  1Y74 A;  4EKW A;  3CCV V;  1SQB H;  5FL7 G;  3ZX6 A;  4JTC B;  1RP3 B;  2ZIN A;  2ZXW B;  5LYJ B;  1IBL B;  2Q0O C;  1QU7 A;  1ZL8 B;  4RWU A;  1GK9 A;  1L1F A;  2Q0A A;  1SQG A;  1Y76 B;  1ZTE A;  1S0V A;  3ZRS A;  4A5U B;  4GKJ O;  4FLY A;  2UUA B;  1IVS A;  1N8R W;  2W0F C;  3K58 A;  2QKS A;  4BIU A;  3K08 A;  5C8Y B;  2CTP A;  5B66 Z;  2RMK B;  3W7S A;  2LGQ A;  4PA4 A;  4B7E A;  3G6E V;  1N36 O;  1IXM A;  3MAQ A;  4TT3 G;  5LOV B;  5KAF Z;  2A7W A;  4CS3 A;  2QWQ B;  3IJ4 A;  2E3C A;  3K9A A;  2Q7G A;  2R9R B;  1AJN A;  2UUC O;  2WLI B;  1M9N A;  1K73 W;  3AK2 A;  1GM7 A;  4XBF A;  2N04 A;  3ETD A;  1HNX B;  1XHZ A;  5KUM A;  1VF5 B;  1FFX A;  4W4K A;  3KCY A;  1N33 O;  1XL6 A;  1VQP V;  2VS0 A;  4PJ0 Z;  3ZMS A;  1AP5 A;  5LBQ A;  4KL1 A;  2LJ2 A;  5BXZ A;  1KC8 W;  3G80 A;  5L3C A;  1QLN A;  2ODM A;  4O4J A;  4DUY O;  2A06 H;  4LH7 A;  4JI0 O;  1QQC A;  2LGW A;  1WP8 A;  1B06 A;  1PNL A;  5J2U B;  1YCI A;  1P4R A;  4R50 A;  5F2V O;  4FMT A;  3UO2 A;  4LFB O;  3ZMT A;  2XND G;  3CCU V;  1YTF D;  1D2D A;  1YIJ V;  4YY3 O;  2XAH A;  4EFE A;  1IBM O;  3HPL C;  2QEX V;  1NKD A;  1R1B A;  2P4V A;  1AJP A;  4KXR A;  1E1Q G;  3K04 A;  1E1R G;  4LNU B;  1Q6I A;  1MOF A;  2EIM B;  4K8Z A;  3B8M A;  3ETG A;  2JIZ G;  1PKX A;  1NTZ H;  4NVP A;  2FML A;  4TV9 A;  2HHH B;  4JYY A;  2ZE7 A;  2JEU A;  4MVQ A;  3K0G A;  4OGQ B;  1BT8 A;  1N0N A;  1SQV H;  5IJ9 B;  2HJD A;  2WWW A;  4NYK A;  3FFQ A;  4PHZ A;  4GKK B;  2H94 A;  4JAS A;  4JI5 B;  4UCV A;  1I5Y A;  5KMG B;  1EZV H;  1HDJ A;  2YXL A;  2LP7 A;  3HKE A;  4LR3 A;  4MTG A;  1NR7 A;  1ARO P;  5GON B;  2WA4 A;  2Q68 A;  3RYI A;  4PV1 B;  4DR3 O;  5JH7 A;  1JOY A;  3OT7 A;  1YTF B;  1OV9 A;  4DV6 O;  3E22 B;  3ZHR A;  2LFS A;  4O2A A;  3Q4H A;  3GB7 C;  2QM8 A;  4H0L B;  5EIB D;  4LF9 B;  4O4H B;  4UUJ C;  5LMN O;  3ZN1 A;  1I08 A;  4NKG B;  3WB0 A;  2QM4 A;  2QWR B;  3BA9 A;  4H33 A;  4I7Z B;  1OCR C;  2R72 A;  3TJT A;  1BL8 A;  4EFB A;  3L70 H;  4X66 B;  3E2E A;  4XDL A;  5ITZ B;  3D36 C;  1JX9 A;  3P3N A;  4QIW F;  2ZE6 A;  5KUK A;  3JAK B;  5DM6 V;  2RNB A;  3PJS K;  1I5X A;  1JJO A;  1F4N A;  4UXN A;  1SC5 B;  4O2B B;  3U11 A;  4IYI A;  3I5D A;  4BWA A;  3CC4 V;  2ETN A;  3CJH A;  1GTO A;  3LDE A;  2KKW A;  4J7J A;  2HJF C;  1J5E B;  2ZE8 A;  3JCU Z;  1Q6H A;  1JCH A;  2UUB O;  1Q7Y W;  1PP9 H;  3OMA B;  1ZLZ A;  4LWS B;  2CH7 B;  1Q82 W;  3AEI A;  1VAR A;  1BGY H;  1FD9 A;  1PD3 A;  4I0X B;  4MVU A;  3ZIA G;  4TOI A;  4CZZ A;  2DOS A;  1H2G A;  1OCR B;  5IY5 C;  1WJZ A;  4JGS A;  4YJ3 A;  5JJE B;  2AW9 A;  1I0H A;  5IYD O;  1KU9 A;  1WP7 A;  4NXM B;  1K4D C;  5FLX N;  1WA8 A;  1HWY A;  1PNK A;  1XRE A;  5KHH A;  5KHG A;  4DW0 A;  1D5A A;  4KHP O;  2JGU A;  3APQ A;  1H38 A;  3CS5 A;  3CYO A;  3E8G A;  3LNM B;  1AI6 A;  3WB2 A;  2A9H A;  4LF6 B;  3K06 A;  3RVZ A;  1YJ9 V;  4HNA B;  5LMU O;  4DXW A;  4RQF A;  4DR5 O;  1AB3 A;  4E4E A;  2VWJ A;  3T1H O;  2H3O A;  2JJ2 G;  2VQF O;  5EBW C;  4RUF A;  3W7X A;  5IY5 B;  4BW5 A;  2QWO B;  2RN9 A;  4LF4 B;  1CEZ A;  1XBL A;  1H2L A;  2Z3Y A;  4ASU G;  1JFF A;  1KBH A;  2XHB A;  1TUB B;  4J80 A;  1ZAU A;  3SYO A;  5LGT A;  4WFB V;  2R70 A;  2KG7 B;  4X1I B;  4DV5 B;  4MW3 A;  3CHX A;  4LF5 O;  1M4U A;  1OCO C;  1BQZ A;  3ZHT A;  4X1Y A;  4WFG A;  3VQV A;  5E1A C;  1YIT V;  3RWR D;  1XNQ O;  4P30 A;  2LO1 A;  3L9D A;  3D3Q A;  4JZ2 A;  3H1I H;  4IL6 Z;  1NU1 H;  2X6C A;  3O65 A;  2XAS A;  2CTQ A;  3OUS A;  2M6Y A;  3K5N A;  3DSQ A;  4I50 B;  3UM7 A;  4LFA B;  2JK5 C;  1SA0 B;  4X62 B;  3L71 H;  5LXT B;  4GKJ B;  4YHH B;  3ASN C;  4JI8 B;  1YSC A;  1NS1 A;  4CH4 A;  1N4C A;  4EB6 B;  3CSX A;  2GHY A;  2OCC C;  4LF8 O;  1ZUQ A;  2WLN A;  3K57 A;  1FXV A;  4IIJ B;  1S72 V;  4N21 A;  1K8A W;  3OTO B;  1OCO B;  1R6N A;  1R73 A;  4FFK A;  4R8C A;  4U7N A;  5C93 A;  1HNZ O;  3DXR A;  5LYJ A;  1PL0 A;  3P3P A;  4QPK A;  3OR7 C;  4BW9 A;  4FM2 A;  2UUC B;  4X9Q A;  3AG2 B;  5LGU A;  1HP8 A;  2LFR A;  3FB5 C;  5GTI Z;  3I56 V;  1MMM A;  1FXK A;  4QE9 A;  3QO5 A;  3ASN B;  1CPY A;  2UU9 B;  1K4C C;  4W4L A;  2JVD A;  2L6L A;  5D5P A;  2OCC B;  4YXW G;  3OEH G;  2RQ6 A;  4JI7 O;  4WFH A;  1DF4 A;  3FAV B;  1N34 B;  3JD2 A;  4PA3 A;  2E5L B;  4UFZ A;  2AZ0 A;  4B3M B;  1EN4 A;  2UXN A;  3RT3 C;  3GWO A;  1JPX A;  1K3E A;  4J7K A;  5LA6 B;  4FLX A;  3CMA V;  3G71 V;  1QNM A;  3ZS8 C;  2ZIM A;  3W7T A;  5CBH A;  1GMG A;  2EZO A;  3SYC A;  4MS2 A;  2DJV A;  3QVN A;  1XOU A;  4WBN B;  3BAB A;  5KA5 A;  5KX5 A;  3CP1 A;  5JQG A;  4IHJ A;  2DYS C;  2JRI A;  3UKM A;  4B08 A;  2WA3 A;  3TET A;  4MVR A;  3BAA A;  3B8N A;  1J95 A;  3W7W A;  4Z2W A;  2UXB B;  2VQE B;  1K97 A;  2GUZ B;  2KQX A;  1U96 A;  3BA8 A;  4DR1 B;  4FFB B;  3S3X A;  5IJ0 B;  3IC9 A;  3QO7 A;  2W6I G;  2F1M A;  1RSO B;  3RFR A;  3C90 A;  1PV0 A;  4KP4 A;  2ATK C;  4TQD A;  4J9Z B;  5EYP A;  1XUQ A;  4BIO A;  1VQ9 V;  4LFC B;  1MZF A;  4FZ1 A;  3RYC A;  2Q7E A;  1H2K A;  3FB7 C;  3IC7 A;  3GWK C;  3P32 A;  2F95 B;  2DYS B;  1NH2 D;  3AG3 B;  4QNH B;  1VIB A;  4TV8 B;  2ZE5 A;  2PI4 A;  4YJ2 A;  4JI3 O;  2HR3 A;  4RUE A;  3LSS A;  4WF9 V;  3MD0 A;  3JAS B;  4FLT A;  2IJK A;  4JI1 O;  2DE0 X;  4DR7 O;  2QJ1 A;  3BY6 A;  5IWA O;  1O9H A;  1SS3 A;  2X6B A;  5JVD B;  3RYF B;  1SES A;  2NR5 A;  3ML0 A;  1XMQ O;  5E79 Z;  4F6R A;  1AIL A;  3IGA C;  4I5S A;  3JAL A;  4XDK A;  3B40 A;  3F7V C;  4NTX A;  4GX0 A;  4UCT A;  2XOK G;  1Y4M A;  2WPD G;  1JR9 A;  2GDS A;  4UV9 A;  4TUY A;  3T1Y B;  4U3J A;  5LMN B;  3AG4 C;  3ZHS A;  5FNV B;  1VQ5 V;  4X20 B;  2NLJ C;  4O4L B;  5BMV B;  1IUR A;  4ZOL B;  1QBZ A;  2OTJ V;  1H2M A;  2P90 A;  5EC1 C;  5CA1 A;  2FKX A;  1W2B U;  3HKB A;  1AP6 A;  2UXD O;  2XT9 A;  1NR1 A;  1IDS A;  2YIB D;  3GVM A;  1VQO V;  3E83 A;  3CE2 A;  1NH2 B;  5GW7 A;  4JTA B;  2FL4 A;  1BS3 A;  4FPP A;  4ZHQ B;  4HZ3 A;  1SQF A;  5LP6 C;  2AZ2 A;  2UUB B;  3NR7 A;  1HR0 O;  1YEW A;  1Y66 A;  2E75 B;  3ZRW A;  5J2T A;  2BTO A;  5B1N A;  1W0K G;  2F43 G;  4YIO A;  4DV7 O;  3AG4 B;  3JAR A;  1VQN V;  3OGC C;  4JYB A;  1L0N H;  1SRY A;  1KUQ A;  3HR0 A;  2OIG A;  4ZI7 B;  2PY5 A;  2WLL B;  4JI4 O;  2IJI A;  3SJQ C;  1V54 C;  4FM1 A;  4ICG A;  4JI6 O;  4JV5 B;  5CB4 A;  4D7S A;  3PN1 A;  5BR8 B;  5CMU A;  3CXH F;  3OTF A;  4B3R O;  5L3G A;  2F4V B;  5DEC A;  5LP6 B;  5KLV H;  1VQM V;  1HNW O;  4KFM A;  1Y6X A;  3JSL A;  4DR5 B;  4DV3 O;  4TWK A;  1Q90 D;  4DR4 O;  3JAT A;  1XDC A;  3JCZ A;  1T5E A;  3A2F A;  2IU3 A;  4PA6 A;  3B2E E;  1JA8 A;  2D2C B;  2QWP B;  1R6K A;  4R6Z A;  2DW4 A;  3E8H A;  3M8A A;  1JQ0 A;  1L0L H;  4TQF A;  5IYZ A;  1V54 B;  3K5L A;  1IBK O;  2EIM C;  5BZB A;  2HVJ C;  3G67 A;  4UV8 A;  1GAX A;  3SR2 C;  3OGI B;  3N2K B;  3ZRV A;  4PDL A;  4PDM A;  3K59 A;  2BTQ B;  1R3J C;  4DK0 A;  5EZY B;  3E35 A;  1XIL A;  2IH3 C;  3ETE A;  1KEC A;  2P5O A;  5JCO A;  3SPH A;  5B3S C;  1N0J A;  1G4Y B;  1NQT A;  2ILM A;  3BFR A;  4WFA V;  2ZM6 B;  3U10 A;  2XAG A;  1SF9 A;  4JF3 A;  4UB8 Z;  4DV0 O;  1SET A;  4MVM A;  3CCL V;  4I55 A;  3ZHV A;  2AHZ A;  3ASO C;  1AJQ A;  2P06 A;  3EVK A;  2JGD B;  1TVK B;  1PM9 A;  4AHC A;  4JTD B;  3SPI A;  3ABM B;  5B1O A;  2JS3 A;  1R6T A;  2V4D A;  3FD9 A;  3N2G B;  5EC2 C;  1VQ8 V;  3CCR V;  4B3S B;  3K03 A;  3JD4 A;  4P9O A;  4BR6 A;  3E86 A;  1SKV A;  1ZWI C;  2RCV A;  2HP8 A;  5B3S B;  4KUM A;  5LXT A;  2CGO A;  4JYA O;  1CXZ B;  3ZRX A;  4DUZ O;  1EN6 A;  3HB3 B;  1NBM G;  3RYH B;  1NJI W;  5IT9 N;  3B77 A;  4GX2 A;  3ASO B;  2QKC A;  4I4T A;  2EJ7 A;  2QWN B;  2EIK C;  3RVY A;  2BOC C;  4G27 B;  3G4S V;  3QO8 A;  2V7Q G;  4QJF B;  3B4S A;  3ICX A;  2YEV A;  4MW8 A;  3SPG A;  1SQQ H;  1VEW A;  4X1K A;  1GO3 F;  3E8B A;  4X89 A;  3AG1 C;  4DV4 B;  2HVK C;  1XQ8 A;  1GKF A;  3CRQ A;  3UT5 B;  2BSK B;  4DV1 O;  1S76 D;  1N32 O;  1TGO A;  2K1E A;  3ABK B;  2Q4P A;  1XL4 A;  4CBC A;  2FTK A;  3SYQ A;  4DRX B;  2Q8V A;  1Y74 B;  5HFL A;  3CPW U;  1H2N A;  4F6E A;  2ARH A;  5JJN B;  4B3T B;  2X7R B;  1Z2G A;  4NXN B;  1IZ3 A;  3AK1 A;  1MSW D;  3CWB H;  2H8P C;  2GTS A;  5EIB C;  1XEQ A;  1WLE A;  2EIK B;  4DV2 B;  4X64 O;  3C3S A;  4DO2 A;  4K0K O;  4RO2 A;  2EJR A;  1YDX A;  1P84 F;  2Y4U A;  5KA6 A;  3EXA A;  3OD4 A;  4U7O A;  1XNR B;  1Z5V A;  4R7C A;  3AG1 B;  4X65 O;  3K0D A;  1I94 O;  3AK3 A;  1XMO O;  5CA0 A;  5H6Q A;  1B6Q A;  4PDV A;  1Q86 W;  2C2A A;  1BHB A;  1IBL O;  2HG5 C;  2CE4 A;  4DR6 O;  2F23 A;  4I9W A;  5HFM A;  1THZ A;  1XHX A;  3VOU A;  1GN2 A;  1JVM A;  4JI3 B;  2OYQ A;  1RM1 C;  2UUA O;  4O4I A;  4GYC B;  2A3Q A;  4H44 B;  1EZJ A;  4JI2 B;  4Z1M G;  4JI1 B;  4Z1V A;  4CS4 A;  1FFX B;  2P67 A;  3L73 H;  2WLK A;  2ZR2 A;  4ZKI A;  4LF7 B;  1M1K W;  2ZT9 B;  3OMI B;  3QNE A;  1VF6 A;  2PYL A;  2WLJ A;  3LUT B;  4IYH A;  2DWD C;  5DED A;  2ADP A;  4DR2 O;  3CME V;  2YDE A;  3E89 A;  3CC2 V;  4LP8 A;  3JAW A;  4FLV A;  4O4J B;  3EHB B;  5A2Q N;  3TK1 A;  3H01 A;  2YUA A;  2EIJ C;  1HNX O;  4C7U A;  3HKD A;  1RM1 B;  4J41 A;  1RPO A;  3T2M A;  2DYR C;  1K5Q A;  5KHJ A;  4H37 A;  1H2S B;  1NVP D;  3M7M X;  3TXQ A;  1K9M W;  1DF5 A;  1OJH A;  4HBN A;  5H5N A;  3AG2 C;  3J81 N;  3UCS C;  3ABL C;  1OCC C;  4NTW A;  2GTA A;  2NNU A;  2E76 B;  4DK1 A;  3HKC A;  2EX3 A;  4TV9 B;  5IE9 A;  3RN4 A;  2O57 A;  1PL4 A;  2EIJ B;  5LHG A;  2YI9 A;  3FYE B;  3FB6 C;  4ZBM A;  2ZKO A;  1EM1 A;  2DYR B;  2RJZ A;  5L3B A;  3P30 A;  4XDJ A;  2X6A A;  4CH3 A;  1N36 B;  3QG5 A;  3CRM A;  1MNG A;  2PGG A;  1KKD A;  1M57 C;  1BE3 H;  1ZL8 A;  3HKE B;  1YJW V;  3ABU A;  4N23 A;  2YS8 A;  2E74 B;  1HNW B;  3H9V A;  1Y76 A;  1NI8 A;  4J42 A;  3ABL B;  1OCC B;  1F4M A;  4DV3 B;  4GLX A;  3OEE G;  2PYJ A;  3A0B Z;  4QE7 A;  3RYI B;  5LHI A;  1A32 A;  5JH7 B;  4AIL C;  2HHH O;  1TA8 A;  2VWK A;  1M90 W;  5C8Y A;  3ZHQ A;  1Q43 A;  1N33 B;  2MW2 B;  2ZDI A;  4O2A B;  4GZR B;  3Q4H B;  3AG7 A;  2Q7H A;  2QSA A;  1UJW B;  2WLM A;  2LW7 A;  4J7Z A;  1K7D A;  4GKK O;  1BHA A;  1FS0 G;  5LOV A;  3VBB A;  4JI5 O;  3SJA C;  2FB5 A;  3APO A;  4FLZ A;  4DUY B;  2WLI A;  1M57 B;  3TXS A;  4JI0 B;  4WFF A;  2BCC H;  3S3W A;  3KZI Z;  1AR4 A;  3CJH B;  2MK3 A;  1WB7 A;  4LFB B;  3FYI B;  2PTM A;  1FJG O;  2PF4 E;  3AG3 C;  3G6B A;  3CEI A;  4LF9 O;  4OPA A;  4JPR A;  1KB9 F;  4GT1 A;  1Q8I A;  4YY3 B;  1TUE B;  1IBM B;  2JS5 A;  4B7K A;  3CCE V;  4MT8 A;  1G8M A;  2A79 B;  4X66 O;  5FPR A;  1MAB G;  1YF2 A;  4YJ3 B;  1JJ2 U;  3F7Y C;  3R65 A;  1YVW A;  3DTU B;  1WA8 B;  5J2U A;  1S5H C;  4F4L A;  4J9Y B;  3K79 A;  1SQX H;  1J5E O;  4JYC A;  4HYO A;  1YHQ V;  3SYA A;  5GTH Z;  4DW1 A;  1GM8 A;  3WG7 C;  1M93 A;  3BEH A;  5DN6 G;  3STZ C;  2IW5 A;  3ZHU A;  1D5N A;  4X8A A;  4AI8 A;  4YIP A;  3FB8 C;  4LNU A;  2JGD A;  1X59 A;  1WB8 A;  2R9I A;  4GX1 A;  2Q6A A;  1V55 C;  1YXB A;  4UCS A;  3T4Z A;  2AXT Z;  2GBO A;  1R3L C;  2V1D A;  1QCE A;  1R3K C;  4NXM O;  1MG1 A;  2JDI G;  3OFN G;  1URF A;  3OAA G;  1JMK C;  2R9A A;  4DR3 B;  1S3J A;  4AQY O;  2HFE C;  1JFF B;  2P22 C;  1MA1 A;  4DV6 B;  2LW1 A;  1S77 D;  2ITD C;  2WAM A;  4HAM A;  3DC5 A;  5IJ9 A;  4LF6 O;  1FYJ A;  3SGI A;  5D5Q A;  1NZ6 A;  1N32 B;  4X1Y B;  2IJH A;  4E2L A;  1FXH A;  1KYO F;  4Q20 A;  3LSQ A;  5KMG A;  1IXB A;  2G38 A;  2CTR A;  3WG7 B;  4FLW A;  1LR1 A;  2YXH A;  3THO A;  2CDY A;  1NTK H;  5EBM C;  4GUN A;  4PA9 A;  2P7T C;  3CD6 V;  5GON A;  4CS2 A;  1V55 B;  2EIL B;  1FXK C;  4ZIB A;  4LF4 O;  4FIP C;  2Q9L A;  5LHH A;  3L75 H;  2P4K A;  3E22 A;  2ZD9 A;  2B5U A;  1COW G;  2DMX A;  4DV5 O;  2AHY A;  1FPO A;  4O4H A;  2ADQ B;  3A0H Z;  1K5S A;  1VQ4 V;  2Y4T A;  3X2Q C;  3T1C A;  5K1P A;  1W0J G;  4WCE V;  1LNQ A;  2F66 C;  1AI5 A;  3DXR B;  1F23 A;  3DC6 A;  5ITZ A;  4DR6 B;  5IYC O;  1US6 A;  3JAK A;  2IBZ H;  3CCJ V;  3B09 A;  4X88 A;  2QR4 A;  3WU2 Z;  2Y0P A;  2Z0A A;  4LFA O;  4X62 O;  4O2B A;  4KHP B;  4YHH O;  3UQ8 A;  3A8T A;  4JI8 O;  1FXK B;  4G2K A;  1HW7 A;  4LCU C;  4JAV A;  3OR6 C;  1K92 A;  3A0R A;  2L35 A;  1SER A;  4LWS A;  2CH7 A;  4FVM A;  5LMU B;  3OTO O;  1NTM H;  2WLH A;  2WSS G;  2HKO A;  1FKA O;  1IX9 A;  4I0X A;  2JEX A;  2RDC A;  3T1H B;  4DR2 B;  3X2Q B;  2VQF B;  2Y69 C;  4P9P A;  3RGB A;  4RAI A;  1DLB A;  3D36 A;  4ABM A;  1KD1 W;  2OIE A;  2YID A;  3H1J H;  3K9S A;  1EFR G;  4MTX A;  3RW0 A;  5B1A C;  1GN3 A;  5KX5 B;  4LF5 B;  5JQG B;  2UU9 O;  4IHJ B;  4J11 A;  3JD3 A;  3L72 H;  4CC6 A;  1AVM A;  3ZED A;  4OX9 O;  4HNA A;  4IT5 A;  2ZR3 A;  3ABM C;  5A9G A;  1N34 O;  2E5L O;  1XNQ B;  2D3O W;  4B3M O;  3ZBH A;  4PD4 F;  4UVB A;  2PZS A;  1BSM A;  4PDR A;  1V9P A;  1MZE A;  2YI8 A;  3MHS C;  4H13 B;  5EBL C;  4PI2 A;  2F93 B;  2Y69 B;  4U3F H;  3OMN B;  2GV9 A;  3H1L H;  5EYP B;  3ZMV A;  3ZMZ A;  4MSW C;  3RYC B;  1TUB A;  2KG7 A;  4X1I A;  1K34 A;  4LF8 B;  5B1A B;  1AI7 A;  3I55 V;  1QR8 A;  1MSD A;  2UXB O;  2VQE O;  4YJ2 B;  2YSU B;  4CC5 A;  1HNZ B;  2K9P A;  2YIC A;  2UXC O;  4DR1 O;  4D7T A;  1DGS A;  3H1K H;  1AR1 B;  2IJJ A;  1W59 A;  4I50 A;  1Q81 W;  3ABK C;  1SA0 A;  3J7A U;  3LSU A;  5LL6 Y;  2BOB C;  2ZNJ A;  3KG2 A;  3H1H H;  2OCH A;  4EB6 A;  4LFC O;  2QTS A;  2QTO A;  4F6R B;  1UPG A;  1AR5 A;  3JAL B;  3BVO A;  1VQ6 V;  1BCC H;  4IIJ A;  1KP2 A;  2Q67 A;  3CC7 V;  4TUY B;  4U3J B;  3OW2 U;  4MVZ A;  4JI7 B;  4TSF G;  4Q6G A;  5B1B C;  3DGE A;  2NN4 A;  5CA1 B;  3SDL A;  3HKB B;  1F51 A;  5L3F A;  1ROP A;  4K8X A;  3K5O A;  1O9G A;  1GN6 A;  1K33 A;  4WFE A;  2B1I A;  2CGN A;  1VP7 A;  4UCU A;  1VQ7 V;  4QPJ A;  1M56 C;  2IU0 A;  5K1X A;  4EEQ A;  3D8C A;  3WB1 A;  4PEL A;  2N05 A;  3VQY A;  1FJG B;  4LC1 A;  2W6J G;  1VMG A;  2CK3 G;  3KCX A;  3STL C;  4P2Z A;  1UFI A;  3OM3 B;  3T1Y O;  1CP9 A;  3FAV A;  3TCU A;  3ZRW B;  5J2T B;  3ETQ A;  4GCZ A;  3JAR B;  1LUW A;  1AI4 A;  1WNS A;  1YJN V;  4LBE C;  5LA6 A;  2QKA A;  2FYU H;  2XAQ A;  5B1B B;  1PPJ H;  4FLU A;  2IM9 A;  1XI1 A;  5H2F Z;  2VRZ A;  3CRC A;  1F7Y A;  3N27 A;  4WBN A;  1E79 G;  5CB4 B;  1M56 B;  3L74 H;  4MVO A;  2XTA A;  2ZCE A;  1YZB A;  1P7B A;  2DQ0 A;  1EN5 A;  3VQX A;  1KQS U;  1WPX A;  1P7G A;  1ZSP A;  2GUZ A;  1H8H G;  2QDO A;  3JAT B;  1BQ0 A;  4FFB A;  5JCO C;  4L8J A;  1KP3 A;  5IJ0 A;  3O9O A;  4DR7 B;  5KHI A;  5IWA B;  1S5L Z;  2CAZ C;  1RSO A;  3D3I A;  3K5M A;  4FJC C;  5CN0 A;  1EBO A;  2EZP A;  1XMQ B;  3BCC H;  3NXS A;  5IYZ B;  4UCR A;  3ZCC A;  4AQY B;  4JV5 O;  5BR8 O;  2OTL V;  3WFV A;  3ZMU A;  1QHT A;  2HLD G;  2F4V O;  4TV8 A;  2DQ3 A;  2DWE C;  2CTW A;  5L3E A;  2M7W A;  1SZT A;  5AG2 A;  1B3Q A;  2UXD B;  2N74 A;  3JAS A;  4DYL A;  1WPB A;  4UB6 Z;  3M99 B;  2EUL A;  2QE7 G;  5JVD A;  3RYF A;  3SPJ A;  2W0X A;  4IGG A;  4OXS A;  4NB5 A;  2QGN A;  4I55 B;  2XAF A;  3F5T A;  1HR0 B;  5LGN A;  2OWO A;  3W7U A;  5H6R A;  1FAF A;  2BE3 A;  1SZX A;  1X4T A;  5FNV A;  3CCS V;  1I7F A;  4X20 A;  4O4L A;  5CA3 A;  2OT5 A;  5BMV A;  4DV7 B;  4ZOL A;  5JJJ B;  5BY1 A;  1FFT B;  2Q69 A;  3BPZ A;  4CH6 A;  1G6U A;  2ZNI A;  4CH5 A;  3CCQ V;  4JI4 B;  3JYC A;  5L3D A;  2ZM6 O;  1RPR A;  2B9Z A;  1RFY A;  2EBO A;  4JI6 B;  4D6T H;  3MDS A;  1WN7 A;  1Z5W A;  4ZHQ A;  2Y0I A;  1OHH G;  5CBF A;  1BMF G;  1ENV A;  4B3R B;  3IFX A;  4I4T B;  2XAJ A;  4BIZ A;  1Q5O A;  2IH1 C;  2Z5U A;  1GN4 A;  1M5I A;  3SJB C;  2YC0 A;  4DR4 B;  2QM7 A;  1GM9 A;  2YEV B;  3U0Z A;  3IAY A;  5CBG A;  3K3W A;  4X1K B;  4ZI7 A;  2KSD A;  1ORQ C;  3R66 A;  1NVP B;  4B3S O;  3JD0 A;  2WLL A;  1L8D A;  4PA7 A;  1OCZ C;  3SPC A;  4LH6 A;  1YI2 V;  1Y67 A;  1IBK B;  5IYB O;  1PNM A;  3J80 N;  1VQL V;  3RBZ A;  4MTF A;  3VQW A;  4UCO A;  5LP6 A;  4OX9 B;  2GSM B;  4NR1 A;  5KAI Z;  1GRJ A;  1VF7 A;  2EIN C;  4G28 B;  3CRR A;  3BHP A;  2YIB A;  4RQE A;  3C3T A;  3JAM N;  1QR9 A;  2X0L A;  3LNN A;  2CUG A;  2P6J A;  1OZ0 A;  3JSN A;  4DV4 O;  2JJ1 G;  1SQP H;  1DK1 A;  4K35 A;  1VF6 C;  1KKC A;  1OCZ B;  4DV0 B;  3ABT A;  5CA0 B;  3QTC A;  4UVA A;  3QF7 A;  1LUV A;  2Q5Z A;  3T4D A;  3JD1 A;  3ZN0 A;  4B3T O;  2Y48 A;  4OPH A;  3N2K A;  5IDJ A;  4NXN O;  4UVC A;  1GH6 A;  2BTQ A;  2HEP A;  1U97 A;  5EZY A;  5KHK A;  1NT2 B;  4DV2 O;  2EIN B;  3CB2 A;  1R3I C;  4PI0 A;  3OUF A;  4O4I B;  5EK0 A;  3TGU H;  1QVG U;  4JAA A;  2UXC B;  2XUM A;  3MHH C;  1XNR O;  4MTO A;  4BAY A;  2PI5 A;  2AGA A;  5B5E Z;  1QLE C;  4JYA B;  1KMI Z;  1DTO A;  4DUZ B;  3UO3 A;  4FK5 C;  4I9Q A;  1P49 A;  4NTY A;  5FPO A;  4K3A A; 
#chains in the Genus database with same CATH homology
 2LGQ A;  2RN9 A;  1Z2G A;  2LQT A;  2HP8 A;  1HP8 A;  1U96 A;  2RNB A;  1U97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...