1U96A

Solution structure of yeast cox17 with copper bound
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
69
structure length
69
Chain Sequence
MTETDKKQEQENHAECEDKPKPCCVCKPEKEERDTCILFNGQDSEKCKEFIEKYKECMKGYGFEVPSAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Yeast cox17 solution structure and Copper(I) binding.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
molecule keywords Cytochrome c oxidase copper chaperone
total genus 10
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2004-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05051 COX17 Cytochrome C oxidase copper chaperone (COX17)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1130 Mainly Alpha Orthogonal Bundle Helix Hairpins CytochromE C oxidase copper chaperone 1u96A01
2RN9A 2RNBA 1U96A 2LGQA 1HP8A 2LQTA 2HP8A 1U97A 1Z2GA
chains in the Genus database with same CATH superfamily
2ZE7A 3IAYA 4PI0A 4Z1MG 2PF4E 3N2GA 4WFBV 1NTZH 2JEUA 5FL7G 2Q4PA 2UU9B 1TUEB 2Y69B 2JJ1G 2Q67A 1RPOA 1AP6A 4CC5A 4PHZA 3MAQA 1B3QA 1SESA 3OMNB 1I5YA 2JS5A 2NN4A 1GN2A 2WWWA 4GT1A 2W6JG 1EZVH 5CBHA 3F5WC 1K3EA 4JI0O 4QIWF 4UB8Z 5B1AC 1NH2D 1UFIA 1JOYA 4PELA 4DV1B 3M7MX 4YJ3B 3BABA 4DV1O 1XOUA 5KHJA 5LMNB 1H2MA 3J81N 1P84F 3W7XA 4GZRB 1Q7YW 2QWQB 2BSKA 4DUZB 2JGUA 2WLLA 4D7SA 2CK3G 1JFFB 1PKXA 1F7YA 3ETQA 2UUCO 1H38A 2GV9A 4GCZA 1WA8B 1W59A 3CCEV 2UUCB 3WFVA 2UXDO 4X64B 3DSQA 3I5DA 3QO8A 2XHBA 2K9PA 1FFXB 4DR5B 4NTYA 5GTIZ 1GN4A 1JVMA 4LF5O 5JQGA 1SQBH 4B08A 1SZXA 2P22C 3UO3A 3ASNB 3ML0A 2OT5A 4I9WA 4CS4A 3OEEG 2B1GA 1XEQA 2LGQA 3AG4C 1V54B 3DXRB 4G28B 2CTWA 2PI4A 2CGOA 4O4JB 1R6KA 5LL6Y 4BIUA 4AILC 2QR4A 5GW7A 3ABMC 4UV9A 4MVRA 4IT5A 4YHHB 1FYJA 5TISZ 1R73A 1DTOA 1AI5A 4ZI7B 4WBNA 4GLXA 3T4ZA 1NVPD 3FYEB 2IU0A 3CCLV 2IJKA 4K0KO 1XNQB 3UT5A 1TA8A 1RSOB 1NQTA 3ABLC 1G8MA 1S5HC 1FJGB 4B3SO 3FFQA 3ZRVA 4JI2B 3OTOB 4PA3A 1XL4A 2IH3C 3THOA 2FKXA 4O4LA 2ZXWC 5CBFA 3APQA 5B1AB 1YXBA 3JAKB 5IJ9A 1KKCA 2QM8A 3ZIAG 1QNMA 1SC5B 1BT8A 2X7RB 4K8ZA 5J2UA 3RYHB 2DYRB 3SYPA 5LXTB 4GKJB 1OV9A 3K0DA 3H1IH 3ZHRA 5L3BA 1P7GA 3VQXA 1QLEB 2UU9O 1AR5A 5CBGA 4DV4B 4RUFA 3BY6A 3CE2A 3EVKA 1PL4A 3SJCC 4GYCB 1N34O 4TOIA 1Q82W 1E1QG 2XAQA 5C8YB 2RNBA 2KSDA 4YY3O 1VMGA 2YXHA 2E76B 4JI0B 3RWRD 4JI8O 2NNUA 3CC4V 3ZBHA 4F4LA 1MSDA 1ENVA 2JK5C 3VBBA 1HNWO 2ITDC 3IC7A 3FX7A 1F4NA 3ABUA 3HKCB 1ZTEA 1QU7A 3G6EV 1R3JC 1V55B 3OM3B 3HKDB 1GKFA 5LGNA 5LP6A 5D5PA 1Q43A 3LDDA 4PDRA 1Y74B 2Y4TA 3H1HH 1YTFD 4J7JA 2OIGA 1KQSU 2ZKOA 3DXRA 2Y0PA 2V4DA 2A0LA 5EBMC 3F7YC 1N0JA 4P2ZA 1SRYA 3R66A 4UCUA 1JJ2U 1GTOA 4TQFA 1AR1B 4TV9A 2YI9A 1R6NA 4UCVA 1TAEA 1YZBA 5IYZB 1T5EA 2ZXWB 5D5QA 4X65B 2DYSC 2CTRA 2EINB 4R6ZA 3SYOA 3DC5A 1M56B 4FM1A 2UXBB 1OCCB 3QG5A 4WCEV 5E79Z 1IBKB 3M99B 1I94O 4KL1A 3CMAV 4IHJA 4JYAB 4O2AB 3E22A 1AILA 3HKEB 1KBHA 1QLEC 1OCZC 4AQYB 4DRXB 3K5NA 1GM7A 3ABKC 1BS3A 2ETNA 5J2UB 4JI5O 3CXCU 4BWAA 2LQTA 2NR5A 4LCUC 1H2GA 3L74H 1QVFU 1F23A 2BTQB 2EIJB 4LFAB 3CCUV 4E4EA 4X1KB 4MS2A 1G4YB 2M6YA 2VQEB 3CRQA 4DV0O 4DV7O 2B9ZA 2Y48A 2ZT9B 2V7QG 2N74A 5LOVA 3O9OA 1N33B 4TV8B 2N04A 2AZ0A 1BQ0A 1CEZA 3AEIA 4DR6B 2DMXA 4CH4A 1K73W 2ADQB 2XUMA 2ILMA 3E8BA 2IJHA 4EEQA 2CTPA 2H94A 3W7TA 2IU3A 4X62O 1FXVA 5LHIA 4IGGA 3AK1A 5JH7B 3OR7C 1KC8W 2GSMB 1SQVH 3NR7A 4P9OA 3DTUB 4JF3A 4PDVA 3LNNA 4J7KA 4W4LA 4J42A 4YJ2B 1YVWA 4O4HB 4JV5O 1IZ3A 2B1IA 4B3MO 2R9RB 5GONA 2EIMC 1GRJA 4JAAA 5EC1C 2QKSA 3OAAG 1HDJA 2ZE5A 1ZX3A 3H1JH 2X6BA 4CC6A 1M5IA 1F51A 3RYIB 4I4TA 2ZDIC 3A0HZ 5JVDB 2M7WA 2NLJC 2DQ0A 2YSUB 3JAMN 3SPIA 3ZN1A 3EHBB 2KG7B 1YDXA 4ICGA 1OCZB 2QKAA 3HKBA 2LO1A 1U96A 2F4VB 4YIPA 5B1BB 2JS3A 3W7WA 1KUQA 1M93A 2QWOB 4NR1A 2IM9A 5EIBD 2AHYA 4XDLA 3E83A 1PP9H 4GUNA 4GX1A 4DV2O 4BR6A 3F5TA 3EXAA 5EBLC 4NYKA 3K08A 4HNAA 2WLHA 2UUAO 5EYPA 3A2FA 4FLWA 1RM1B 1B04A 1S5LZ 1WJZA 1BMFG 3Q4HB 2Z0AA 5E1AC 1MA1A 5EIBC 4DR4B 3CXHF 1YF2A 1WP7A 3SPHA 3IGAC 1FXKB 3OR6C 4D7TA 3C3SA 4IYHA 4FZ1A 4NB5A 4PV1B 3ZMUA 3FB5C 1GMGA 3F7VC 1PV0A 5BZBA 5IDJA 5CMUA 1CXZB 3JAWB 1FFTB 1IX9A 2QM7A 2QEXV 4DXWA 2CUGA 4MT8A 2XOKG 4LFAO 4H33A 1IXMA 4ZHQA 1KU9A 3CEIA 3CCMV 3J7AU 2EILB 3AG3C 4JAVA 3QNEA 1CPYA 3ASOC 1MZEA 4DR6O 2XAJA 1DF4A 1N36B 1Q90D 4D6TH 3JCZA 3CPWU 1IURA 3RYCA 3R65A 2ZE8A 2W0XA 5B1BC 3E2EA 3AG4B 5IYDO 5H2FZ 4G2KA 1V54C 3T1CA 4JI8B 4H37A 3OGIB 1I5XA 5A2QN 2QM4A 2YIAA 2ZQMA 1VIBA 1JMKC 1K8AW 3OTFA 3CC7V 1JA8A 4JAUA 2RQ6A 3B8NA 2VQFB 4W4KA 1M57B 3D8CA 1NTKH 1L8DA 3HKBB 2GUZA 2P06A 3K9SA 1J95A 4PA6A 4UCSA 5KX5B 2B5UA 3UM7A 2EIKC 4UCTA 1KP3A 1THZA 4DR3B 1XL6A 1FXKC 2QWRB 4O4JA 4FLXA 2PYLA 4K8XA 4U7OA 5EYPB 2F4VO 2ZM6B 5LA6B 4U7NA 2QWNB 3MDSA 2CAZC 4N23A 2ZNIA 2LFRA 5CA1B 4EKWA 2XNDG 1HW7A 2YXLA 1P7BA 1G6UA 4LF4O 3P32A 5H6RA 1Z5WA 2EJRA 1MMMA 2WPDG 1SETA 4QJFB 1SQXH 3FAVA 1XDCA 1DF5A 2ZCEA 1H8EG 4MVQA 3CC2V 2DJVA 3LSSA 4FPPA 2YDEA 3ZX6A 4JI3B 4LF7B 2PGGA 1N32O 3AG3B 3J80N 4PD4F 1VQ5V 3IC9A 5KUKA 1OCRB 2LW7A 4JYAO 2Y0IA 1LUVA 3ZRWB 4LFBB 1PNLA 1Q3EA 3SJBC 2Q73A 3LSQA 4LF6B 2YIDA 4FLYA 2YXYA 4LBEC 3ZCCA 2IJIA 4R50A 3WB2A 3CRAA 1TGOA 2D3OW 3KCXA 4B3RB 4LF8B 3ZRSA 2P4KA 4DW0A 1QQCA 2H8PC 1VF6A 5LP6C 1BSMA 1H2LA 4X20B 4UUJC 5LYJA 4JYCA 3L73H 3FB7C 4JI4B 2JIZG 1NTMH 5B1NA 1OCOB 1QR8A 2QTOA 3ZMZA 4LF9O 4DV0B 4DV7B 4MW8A 1YIJV 1K34A 4B7KA 5IE9A 2A06H 4OPHA 5EBWC 1Q6UA 3HR0A 3CS5A 1V9PA 2EZOA 1YJNV 4LWSA 2DWDC 4CH5A 3K5LA 4X8AA 1M90W 1SZTA 2CDYA 2VWJA 3MHSC 2ITCC 1N34B 1VF7A 3X2QC 3OEHG 1IBMO 4I0XA 2UXCO 4FMTA 1IBMB 3N2KA 5FNVB 4MTXA 3OMIB 5GTHZ 3LDEA 2F43G 2QJ1A 4EFEA 5JWPA 1PD3A 2R70A 4PDMA 4JV5B 1I7FA 4I5SA 1NZ6A 1XBLA 2Q7HA 4RUEA 4NXNB 5LGUA 1GN3A 1URFA 1TVKA 1R3IC 4U3JA 3E35A 3ETGA 3JD4A 5LA6A 2PUSA 3ZHTA 2JRIA 3ZJZA 3CWBH 3QVNA 1SA0A 2UUBO 5CA1A 1G1XB 4DK1A 2IH1C 3OFNG 2YS8A 1NR7A 2W0FC 1FPOA 4NKGB 4GX5A 1N4CA 4DR5O 3STLC 2IBZH 3E8FA 2P4VA 3ABKB 3H01A 1AI6A 1Z2GA 4AHCA 3K79A 1DGSA 1KYOF 1Y4MA 3SGIA 3RYFA 2HHHB 3JARA 5IY5B 4U3FH 4DV4O 4IHJB 1BCCH 5KHGA 1XNRO 2LW1A 1FXHA 3E22B 4E2LA 4Z1VA 3AG2B 2H3OA 1EN4A 3ZRWA 2UXXA 4DRXA 5EC2C 4QE9A 1Y74A 5CA3A 3OUSA 2ZR3A 1XHXA 2E3CA 1JCHA 5J2TB 5IYBO 5BY1A 3CJHB 2E5LO 3RBZA 1KMIZ 2Z5UA 2GTAA 5KAIZ 1K4DC 3ABLB 4B7EA 4YHHO 4TV9B 4DR1O 1YSCA 4JTDB 1I94B 5BMVA 3BFRA 4HZ3A 1K7DA 4LFBO 3WU2Z 3RN4A 4JYBA 2P6JA 4X89A 4UVAA 5LOVB 2EJ7A 3HB3B 4AQYO 1JX9A 5FLXN 2MW2B 2WAMA 4LF5B 3OTOO 3OE7G 3EFFK 1XREA 3TGUH 1H2NA 1QLNA 2Y4UA 4LP8A 4H44B 3ZHQA 4BW9A 3CYOA 3ETEA 3ZMVA 3OGCC 4WF9V 1ORQC 1QR9A 4RAIA 4J41A 4MVSA 1IBLB 2QKCA 5BR8O 4GKJO 2IW5A 3B8MA 5ITZB 4YJ2A 1SQGA 3OUFA 1KECA 2DW4A 1MNGA 4Z2WA 2AXTZ 5H6QA 1P49A 2GTSA 4KXRA 2RCVA 3L75H 2UXCB 2XASA 5LGTA 4YY3B 1OJHA 1Z5VA 2YC0A 4B3TB 5LBQA 2PI5A 3C3TA 3U10A 1Y76A 1NI8A 1S77D 2KG7A 1VF6C 5B3SB 1HNWB 4HBNA 1O9HA 2XT9A 1XMQB 1WAZA 4J9YB 3N2GB 3KZIZ 2FTKA 3JARB 4CH6A 3CCRV 1S0VA 4BW5A 4LH6A 3TCUA 3T1HO 4JASA 1I0HA 3CHXA 3D3IA 1H2SB 1NR1A 4YJ3A 3BA9A 5HFMA 3CCQV 1OHHG 1ZLZA 4X1YA 4QPKA 1M4UA 2BOCC 2WLLB 4Q20A 1BE3H 3JASA 3VQWA 4JI6B 4TUYB 5EZYB 3H1LH 5A9GA 2A79B 4WFHA 4X66B 2DOSA 3TJTA 1FFXA 3A0RA 2ZE6A 1B06A 2KB1A 3RYIA 1VQ7V 1NT2B 4X88A 1FD9A 1SKVA 2FL4A 2GHYA 5JQGB 5JVDA 4OXSA 1VARA 3JD0A 4LFCO 4KHPB 2UXBO 3JATB 1AB3A 2F1MA 4TQDA 4LFCB 4KHPO 2JDIG 3K58A 4LF7O 3AG7A 4PA4A 3SPJA 4ZOLA 3GVMA 3U11A 4DV3O 1GN6A 2MK3A 3GWKC 1COWG 1NKDA 2FYUH 4YIOA 2AW9A 1GAXA 2DWEC 1MSWD 5DEDA 1JR9A 1D5NA 3BPZA 2AZ2A 1GM8A 1A32A 3CRCA 1JJOA 4DW1A 1Q86W 3JD2A 3JD3A 2OCCB 2ZDIA 2WA3A 4WBNB 3SR2C 1L0LH 3K59A 3FB8C 2VS0A 3ICXA 4QNHB 5JJNB 1FXKA 4X9QA 2WLMA 3E86A 1ZAUA 3D3QA 3BA8A 3B77A 4UFZA 5FPOA 3CCVV 1XUQA 5JJJB 1JPXA 1CP9A 1LR1A 1HNZB 2Q7EA 2EX3A 2UXNA 3UT5B 2A7WA 3ZHUA 4MVUA 4IL6Z 4FM2A 3FYIB 2YEVB 3JAKA 2F23A 2EBOA 1SQQH 4GKKO 4FK5C 1P4RA 2LFSA 3I56V 1W2BU 2L35A 2YIBA 3KCYA 3U0ZA 5IYCO 2HKOA 1BL8A 3JALA 2FB5A 3RT3C 4NTWA 5IJ9B 1O9GA 3I55V 1KD1W 2R9AA 4FFBB 1EM1A 4NXMB 5KHIA 1K5SA 3RW0A 2HEPA 2XTAA 4N21A 4EB6A 2WLKA 3ETDA 2F93B 4PA7A 4O2BA 3VQVA 5C8YA 2BOBC 2R9IA 4JTCB 4UVBA 1MOFA 5KA6A 1HWYA 1OCRC 3T1HB 4TUYA 5EZYA 1EBOA 1N33O 1SQPH 4QGPA 4CBCA 5K1PA 3K9AA 2P90A 1KP2A 2WLIB 3RVZA 1ZL8B 1X4TA 5K1XA 4CZZA 2W6IG 3ABMB 4PJ0Z 4I55B 2WLJA 4JI6O 4I50A 5LHHA 5BXZA 5LP6B 2RMKB 5KMGA 4BAYA 2OCHA 3K06A 1XI1A 1R3KC 5KX5A 1RFYA 4GX2A 3HKCA 4IIJB 1EN6A 3BVOA 3A0BZ 1W0JG 3HKDA 4JI7O 2X0LA 3VOUA 3APOA 1GH6A 3E8GA 2BCCH 3JSNA 1OZ0A 3ZS8C 4CS2A 3T1YB 2Q7GA 3L71H 3QO5A 4DUYB 4JI3O 1VQLV 2DN9A 4X20A 5LYJB 1UJWB 3AG1C 4YXWG 1I08A 2Q8VA 4JZ2A 1K97A 3UQ8A 4PDLA 4LF6O 4H13B 4K0KB 2UXDB 2E74B 5JCOA 2P7TC 2Q6AA 4PA9A 4LF8O 4JPRA 4NVPA 2FMLA 4LWSB 1LNQA 3FB6C 4JI2O 3LSUA 4UCRA 2EILC 2ZM6O 1WLEA 2LGWA 4EFBA 2PZSA 3JCUZ 2QGNA 5JJEB 3JSLA 1TUBA 4LF9B 2E75B 1N0NA 5H5NA 4DR7B 2HVJC 3N2KB 4OX9B 2HJDA 1GK9A 3JALB 4RQFA 3JD1A 4MW3A 1B6QA 4O4IA 3B09A 3SJQC 2DE0X 2ZR2A 4FFKA 3ASNC 4MSWC 4RO2A 1MG1A 2ZIOA 4KUMA 3UCSC 3G71V 4KFMA 2C2AA 4DR4O 5CB4B 1TVKB 1SQFA 2X6CA 4K35A 4XDJA 4U3JB 2QA4V 1PNKA 4EB6B 4DV6O 1Q5OA 4DV6B 3SPGA 4X1IA 4LNUB 1M1KW 4X1KA 1VEWA 4UCOA 4PI2A 1WPXA 3KG2A 2JVDA 4HYOA 1RM1C 1Q81W 1NH2B 4JTAB 1QBZA 4B3RO 3BAAA 4MVOA 1AROP 2Q68A 3LNMB 4NXNO 5IWAB 4TV8A 2WLIA 2OTLV 3S3WA 4DK0A 4DR2O 4F6RB 1YI2V 1Q6HA 3K04A 4JI1B 4R8CA 4I50B 5KMGB 2UUBB 3K5OA 2PY5A 2DYSB 1AJPA 1AJNA 2Q0OC 4IIJA 3AG1B 2VWKA 3B4SA 1N36O 4RWUA 2KQXA 2OTJV 2HVKC 1Y67A 4FIPC 1M56C 3G67A 3TXQA 1K5QA 3SYCA 5IJ0B 1D2DA 4CH3A 2P5OA 4BIOA 2IJJA 5CA0A 2DYRC 2JJ2G 4OPAA 5GONB 3W7UA 1N8RW 1K92A 4X66O 4P9PA 3VQYA 3G80A 1EN5A 3CCJV 2JEXA 1VQNV 3OW2U 4FJCC 3ABTA 5B5EZ 2G38A 3T1YO 2E5LB 2RDCA 4JZGA 4OGQB 1N32B 2EZPA 3SDLA 1BHAA 5LMNO 2EIJC 3A8TA 4DUZO 3NXSA 1HR0B 1NVPB 1XNQO 1TUBB 1VQ9V 3ZEDA 2OIEA 1M9NA 2L6LA 3K57A 1OCOC 5B66Z 3SPCA 1F4MA 3WB1A 1K9MW 2Y69C 1Q8IA 1AI4A 3FKSG 2HHHO 5B3SC 4UVCA 4G27B 4FLVA 3CSXA 3Q4HA 4WFEA 1XNRB 5L3FA 5CB4A 1JFFA 4LF4B 4K3AA 1HNXO 1AJQA 1HNXB 3JAWA 2LP7A 3X2QB 4I9QA 1R1BA 2HFEC 1KB9F 3FD9A 1XHZA 1H2KA 3DC6A 5L3CA 1NJIW 1MZFA 4BIZA 4O4LB 3SJAC 3P30A 1S72V 3CD6V 2EIMB 5C93A 5F2VO 4FLUA 3GWOA 1MABG 3M8AA 5LHGA 1VQ6V 5EK0A 1AVMA 1Q6IA 5DECA 2A3QA 4F6RA 2ADPA 2V1DA 1WB7A 3RYHA 3L9DA 2VRZA 3CMEV 1YCIA 2GDSA 3UKMA 1KKDA 3LUTB 4I7ZB 5LXTA 3W7SA 4QE7A 4NXMO 2PYJA 1D5AA 4X1YB 4J9ZB 4UB6Z 3PJSK 2X6AA 4ASUG 3S3XA 3CP1A 3JASB 2HP8A 1QVGU 1XMQO 1DK1A 4LH7A 3LDCA 1HP8A 5IJ0A 5KUMA 4ZI7A 2OWOA 1J5EB 4WFFA 2BTOA 1US6A 3E8HA 1BGYH 5CA0B 3ZMTA 3KKYA 3RYCB 1J5EO 4J11A 3GB7C 2YIBD 2YUAA 1PM9A 1K33A 5BR8B 3D36A 1Y76B 3AG2C 1WP8A 2JGDB 2ZD9A 1ZWIC 2QSAA 2N05A 1R6TA 1QCEA 2WLNA 1E79G 4WFGA 4TSFG 1XILA 1ROPA 1RPRA 3O65A 4ZBMA 4FLTA 2AGAA 3JYCA 2GUZB 3OMAB 3P3NA 4DV2B 3AK3A 2HG5C 1S3JA 1Y6XA 3D36C 4TWKA 1BQZA 4FVMA 5KLVH 2UUAB 4ABMA 1WNSA 4Q6GA 2OYQA 4C7UA 2F95B 4TT3G 4JYYA 4DR1B 4P30A 1QHTA 2ZNJA 1JQ0A 5IYZA 1EZJA 1H8HG 3G4SV 3FAVB 2Q9LA 3T2MA 4H0LB 4XBFA 2QE7G 3WG7B 3B2EE 2Q69A 2QTSA 5HFLA 4X64O 3IJ4A 1IDSA 4J7ZA 4FZ0A 3TETA 4JI5B 4DO2A 2YEVA 1IVSA 3JATA 2O57A 1NS1A 1WPBA 2P67A 1L1FA 4ZOLB 3CCSV 2ODMA 2Z3YA 3B40A 4R7CA 2HR3A 3OT7A 2VQEO 3MD0A 2WSSG 1K4CC 4OX9O 2ARHA 3H9VA 5L3EA 4FFBA 1NBMG 3STZC 4L8JA 4J10A 4MTOA 1X59A 2RJZA 3SYAA 5CN0A 1VQKV 2ATKC 2A9HA 4NTXA 3RFRA 3BCCH 3IFXA 3QTCA 3QO7A 4O2BB 1IBKO 3ZHSA 1V55C 1ZSPA 3HPLC 3G6BA 3PN1A 1YJ9V 1VQPV 2WA4A 5L3DA 4L87A 1YEWA 3CB2A 3WB0A 1FJGO 2HJFC 1ZL8A 3L72H 5KA5A 4GX0A 3T4DA 2CH7B 4B3MB 1AI7A 4I0XB 2JGDA 2VQFO 1L0NH 5FNVA 4IYIA 1PPJH 5JCOC 1ZUQA 4O2AA 4JI1O 2KKWA 3HKEA 2EINC 4MVMA 4MVZA 5KHKA 1IBLO 1HNZO 2ZINA 3OD4A 1OCCC 1BZKA 2GBOA 2F66C 2XAFA 2XAHA 4AI8A 4O4HA 4LR3A 3WG7C 4WFAV 4KP4A 3K3WA 2BTQA 5IT9N 1AR4A 5L3GA 1SA0B 3QF7A 1R3LC 2PTMA 2YI8A 5DN6G 3TXSA 4J80A 1FS0G 3ASOB 4X62B 2Q5ZA 1FKAO 1DLBA 4B3TO 4JI7B 5FPRA 3ZRXA 4I4TB 1WB8A 4MTGA 4JGSA 3RGBA 4LC1A 2QDOA 3AK2A 3CRMA 1RP3B 1S76D 1XQ8A 2QWPB 4A5UB 2LJ2A 4I55A 3ZN0A 1GM9A 4DUYO 4DV3B 3H1KH 4HAMA 3RYFB 2OCCC 1YITV 3N27A 3BEHA 5DM6V 1HR0O 1EFRG 1S5JA 3ZHVA 1IXBA 1E1RG 2EULA 1AP5A 2XAGA 5JH7A 3CJHA 4HNAB 3BRCA 2D2CB 1VQMV 1PNMA 4UXNA 5H9CA 5KAFZ 1M57C 1VF5B 1PL0A 1U97A 4MTFA 2BSKB 4QPJA 5BMVB 5J2TA 1XMOB 4DV5B 2EIKB 1XMOO 1WA8A 2CTQA 2ZIMA 4DV5O 2RN9A 4UV8A 4X1IB 4LNUA 4DR7O 1SS3A 2Q0AA 4X65O 3K03A 1VQOV 3RVYA 3CRRA 2HLDG 3TK1A 4ZKIA 1LUWA 3L70H 1SERA 3MHHC 2DQ3A 3SYQA 4GKKB 1UPGA 3DGEA 1GO3F 2CH7A 1SF9A 4XDKA 3UO2A 3K5MA 3K0GA 4ZHQB 2CGNA 1YHQV 1WN7A 4DYLA 4F6EA 3C90A 1YJWV 4O4IB 2R72A 2K1EA 2CE4A 5AG2A 4B3SB 4ZIBA 1NU1H 5IWAO 3ZMSA 4FM0A 3P3PA 4RQEA 5ITZA 2YICA 3E89A 1FAFA 5IY5C 5LMUO 4JI4O 4DR2B 2AHZA 1YTFB 5LMUB 1VQ8V 3CX5F 1RSOA 2BE3A 1Y66A 4FLZA 1BHBA 3BHPA 1VQ4V 5B1OA 1VP7A 1W0KG 4DR3O 5KHHA 4CS3A 5J9PC
chains in the Genus database with same CATH topology
2RN9A 2RNBA 1U96A 2LGQA 1HP8A 2LQTA 2HP8A 1U97A 1Z2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RN9 A;  2RNB A;  1U96 A;  2LGQ A;  1HP8 A;  2LQT A;  2HP8 A;  1U97 A;  1Z2G A; 
#chains in the Genus database with same CATH topology
 2ZE7 A;  3IAY A;  4PI0 A;  4Z1M G;  2PF4 E;  3N2G A;  4WFB V;  1NTZ H;  2JEU A;  5FL7 G;  2Q4P A;  2UU9 B;  1TUE B;  2Y69 B;  2JJ1 G;  2Q67 A;  1RPO A;  1AP6 A;  4CC5 A;  4PHZ A;  3MAQ A;  1B3Q A;  1SES A;  3OMN B;  1I5Y A;  2JS5 A;  2NN4 A;  1GN2 A;  2WWW A;  4GT1 A;  2W6J G;  1EZV H;  5CBH A;  3F5W C;  1K3E A;  4JI0 O;  4QIW F;  4UB8 Z;  5B1A C;  1NH2 D;  1UFI A;  1JOY A;  4PEL A;  4DV1 B;  3M7M X;  4YJ3 B;  3BAB A;  4DV1 O;  1XOU A;  5KHJ A;  5LMN B;  1H2M A;  3J81 N;  1P84 F;  3W7X A;  4GZR B;  1Q7Y W;  2QWQ B;  2BSK A;  4DUZ B;  2JGU A;  2WLL A;  4D7S A;  2CK3 G;  1JFF B;  1PKX A;  1F7Y A;  3ETQ A;  2UUC O;  1H38 A;  2GV9 A;  4GCZ A;  1WA8 B;  1W59 A;  3CCE V;  2UUC B;  3WFV A;  2UXD O;  4X64 B;  3DSQ A;  3I5D A;  3QO8 A;  2XHB A;  2K9P A;  1FFX B;  4DR5 B;  4NTY A;  5GTI Z;  1GN4 A;  1JVM A;  4LF5 O;  5JQG A;  1SQB H;  4B08 A;  1SZX A;  2P22 C;  3UO3 A;  3ASN B;  3ML0 A;  2OT5 A;  4I9W A;  4CS4 A;  3OEE G;  2B1G A;  1XEQ A;  2LGQ A;  3AG4 C;  1V54 B;  3DXR B;  4G28 B;  2CTW A;  2PI4 A;  2CGO A;  4O4J B;  1R6K A;  5LL6 Y;  4BIU A;  4AIL C;  2QR4 A;  5GW7 A;  3ABM C;  4UV9 A;  4MVR A;  4IT5 A;  4YHH B;  1FYJ A;  5TIS Z;  1R73 A;  1DTO A;  1AI5 A;  4ZI7 B;  4WBN A;  4GLX A;  3T4Z A;  1NVP D;  3FYE B;  2IU0 A;  3CCL V;  2IJK A;  4K0K O;  1XNQ B;  3UT5 A;  1TA8 A;  1RSO B;  1NQT A;  3ABL C;  1G8M A;  1S5H C;  1FJG B;  4B3S O;  3FFQ A;  3ZRV A;  4JI2 B;  3OTO B;  4PA3 A;  1XL4 A;  2IH3 C;  3THO A;  2FKX A;  4O4L A;  2ZXW C;  5CBF A;  3APQ A;  5B1A B;  1YXB A;  3JAK B;  5IJ9 A;  1KKC A;  2QM8 A;  3ZIA G;  1QNM A;  1SC5 B;  1BT8 A;  2X7R B;  4K8Z A;  5J2U A;  3RYH B;  2DYR B;  3SYP A;  5LXT B;  4GKJ B;  1OV9 A;  3K0D A;  3H1I H;  3ZHR A;  5L3B A;  1P7G A;  3VQX A;  1QLE B;  2UU9 O;  1AR5 A;  5CBG A;  4DV4 B;  4RUF A;  3BY6 A;  3CE2 A;  3EVK A;  1PL4 A;  3SJC C;  4GYC B;  1N34 O;  4TOI A;  1Q82 W;  1E1Q G;  2XAQ A;  5C8Y B;  2RNB A;  2KSD A;  4YY3 O;  1VMG A;  2YXH A;  2E76 B;  4JI0 B;  3RWR D;  4JI8 O;  2NNU A;  3CC4 V;  3ZBH A;  4F4L A;  1MSD A;  1ENV A;  2JK5 C;  3VBB A;  1HNW O;  2ITD C;  3IC7 A;  3FX7 A;  1F4N A;  3ABU A;  3HKC B;  1ZTE A;  1QU7 A;  3G6E V;  1R3J C;  1V55 B;  3OM3 B;  3HKD B;  1GKF A;  5LGN A;  5LP6 A;  5D5P A;  1Q43 A;  3LDD A;  4PDR A;  1Y74 B;  2Y4T A;  3H1H H;  1YTF D;  4J7J A;  2OIG A;  1KQS U;  2ZKO A;  3DXR A;  2Y0P A;  2V4D A;  2A0L A;  5EBM C;  3F7Y C;  1N0J A;  4P2Z A;  1SRY A;  3R66 A;  4UCU A;  1JJ2 U;  1GTO A;  4TQF A;  1AR1 B;  4TV9 A;  2YI9 A;  1R6N A;  4UCV A;  1TAE A;  1YZB A;  5IYZ B;  1T5E A;  2ZXW B;  5D5Q A;  4X65 B;  2DYS C;  2CTR A;  2EIN B;  4R6Z A;  3SYO A;  3DC5 A;  1M56 B;  4FM1 A;  2UXB B;  1OCC B;  3QG5 A;  4WCE V;  5E79 Z;  1IBK B;  3M99 B;  1I94 O;  4KL1 A;  3CMA V;  4IHJ A;  4JYA B;  4O2A B;  3E22 A;  1AIL A;  3HKE B;  1KBH A;  1QLE C;  1OCZ C;  4AQY B;  4DRX B;  3K5N A;  1GM7 A;  3ABK C;  1BS3 A;  2ETN A;  5J2U B;  4JI5 O;  3CXC U;  4BWA A;  2LQT A;  2NR5 A;  4LCU C;  1H2G A;  3L74 H;  1QVF U;  1F23 A;  2BTQ B;  2EIJ B;  4LFA B;  3CCU V;  4E4E A;  4X1K B;  4MS2 A;  1G4Y B;  2M6Y A;  2VQE B;  3CRQ A;  4DV0 O;  4DV7 O;  2B9Z A;  2Y48 A;  2ZT9 B;  2V7Q G;  2N74 A;  5LOV A;  3O9O A;  1N33 B;  4TV8 B;  2N04 A;  2AZ0 A;  1BQ0 A;  1CEZ A;  3AEI A;  4DR6 B;  2DMX A;  4CH4 A;  1K73 W;  2ADQ B;  2XUM A;  2ILM A;  3E8B A;  2IJH A;  4EEQ A;  2CTP A;  2H94 A;  3W7T A;  2IU3 A;  4X62 O;  1FXV A;  5LHI A;  4IGG A;  3AK1 A;  5JH7 B;  3OR7 C;  1KC8 W;  2GSM B;  1SQV H;  3NR7 A;  4P9O A;  3DTU B;  4JF3 A;  4PDV A;  3LNN A;  4J7K A;  4W4L A;  4J42 A;  4YJ2 B;  1YVW A;  4O4H B;  4JV5 O;  1IZ3 A;  2B1I A;  4B3M O;  2R9R B;  5GON A;  2EIM C;  1GRJ A;  4JAA A;  5EC1 C;  2QKS A;  3OAA G;  1HDJ A;  2ZE5 A;  1ZX3 A;  3H1J H;  2X6B A;  4CC6 A;  1M5I A;  1F51 A;  3RYI B;  4I4T A;  2ZDI C;  3A0H Z;  5JVD B;  2M7W A;  2NLJ C;  2DQ0 A;  2YSU B;  3JAM N;  3SPI A;  3ZN1 A;  3EHB B;  2KG7 B;  1YDX A;  4ICG A;  1OCZ B;  2QKA A;  3HKB A;  2LO1 A;  1U96 A;  2F4V B;  4YIP A;  5B1B B;  2JS3 A;  3W7W A;  1KUQ A;  1M93 A;  2QWO B;  4NR1 A;  2IM9 A;  5EIB D;  2AHY A;  4XDL A;  3E83 A;  1PP9 H;  4GUN A;  4GX1 A;  4DV2 O;  4BR6 A;  3F5T A;  3EXA A;  5EBL C;  4NYK A;  3K08 A;  4HNA A;  2WLH A;  2UUA O;  5EYP A;  3A2F A;  4FLW A;  1RM1 B;  1B04 A;  1S5L Z;  1WJZ A;  1BMF G;  3Q4H B;  2Z0A A;  5E1A C;  1MA1 A;  5EIB C;  4DR4 B;  3CXH F;  1YF2 A;  1WP7 A;  3SPH A;  3IGA C;  1FXK B;  3OR6 C;  4D7T A;  3C3S A;  4IYH A;  4FZ1 A;  4NB5 A;  4PV1 B;  3ZMU A;  3FB5 C;  1GMG A;  3F7V C;  1PV0 A;  5BZB A;  5IDJ A;  5CMU A;  1CXZ B;  3JAW B;  1FFT B;  1IX9 A;  2QM7 A;  2QEX V;  4DXW A;  2CUG A;  4MT8 A;  2XOK G;  4LFA O;  4H33 A;  1IXM A;  4ZHQ A;  1KU9 A;  3CEI A;  3CCM V;  3J7A U;  2EIL B;  3AG3 C;  4JAV A;  3QNE A;  1CPY A;  3ASO C;  1MZE A;  4DR6 O;  2XAJ A;  1DF4 A;  1N36 B;  1Q90 D;  4D6T H;  3JCZ A;  3CPW U;  1IUR A;  3RYC A;  3R65 A;  2ZE8 A;  2W0X A;  5B1B C;  3E2E A;  3AG4 B;  5IYD O;  5H2F Z;  4G2K A;  1V54 C;  3T1C A;  4JI8 B;  4H37 A;  3OGI B;  1I5X A;  5A2Q N;  2QM4 A;  2YIA A;  2ZQM A;  1VIB A;  1JMK C;  1K8A W;  3OTF A;  3CC7 V;  1JA8 A;  4JAU A;  2RQ6 A;  3B8N A;  2VQF B;  4W4K A;  1M57 B;  3D8C A;  1NTK H;  1L8D A;  3HKB B;  2GUZ A;  2P06 A;  3K9S A;  1J95 A;  4PA6 A;  4UCS A;  5KX5 B;  2B5U A;  3UM7 A;  2EIK C;  4UCT A;  1KP3 A;  1THZ A;  4DR3 B;  1XL6 A;  1FXK C;  2QWR B;  4O4J A;  4FLX A;  2PYL A;  4K8X A;  4U7O A;  5EYP B;  2F4V O;  2ZM6 B;  5LA6 B;  4U7N A;  2QWN B;  3MDS A;  2CAZ C;  4N23 A;  2ZNI A;  2LFR A;  5CA1 B;  4EKW A;  2XND G;  1HW7 A;  2YXL A;  1P7B A;  1G6U A;  4LF4 O;  3P32 A;  5H6R A;  1Z5W A;  2EJR A;  1MMM A;  2WPD G;  1SET A;  4QJF B;  1SQX H;  3FAV A;  1XDC A;  1DF5 A;  2ZCE A;  1H8E G;  4MVQ A;  3CC2 V;  2DJV A;  3LSS A;  4FPP A;  2YDE A;  3ZX6 A;  4JI3 B;  4LF7 B;  2PGG A;  1N32 O;  3AG3 B;  3J80 N;  4PD4 F;  1VQ5 V;  3IC9 A;  5KUK A;  1OCR B;  2LW7 A;  4JYA O;  2Y0I A;  1LUV A;  3ZRW B;  4LFB B;  1PNL A;  1Q3E A;  3SJB C;  2Q73 A;  3LSQ A;  4LF6 B;  2YID A;  4FLY A;  2YXY A;  4LBE C;  3ZCC A;  2IJI A;  4R50 A;  3WB2 A;  3CRA A;  1TGO A;  2D3O W;  3KCX A;  4B3R B;  4LF8 B;  3ZRS A;  2P4K A;  4DW0 A;  1QQC A;  2H8P C;  1VF6 A;  5LP6 C;  1BSM A;  1H2L A;  4X20 B;  4UUJ C;  5LYJ A;  4JYC A;  3L73 H;  3FB7 C;  4JI4 B;  2JIZ G;  1NTM H;  5B1N A;  1OCO B;  1QR8 A;  2QTO A;  3ZMZ A;  4LF9 O;  4DV0 B;  4DV7 B;  4MW8 A;  1YIJ V;  1K34 A;  4B7K A;  5IE9 A;  2A06 H;  4OPH A;  5EBW C;  1Q6U A;  3HR0 A;  3CS5 A;  1V9P A;  2EZO A;  1YJN V;  4LWS A;  2DWD C;  4CH5 A;  3K5L A;  4X8A A;  1M90 W;  1SZT A;  2CDY A;  2VWJ A;  3MHS C;  2ITC C;  1N34 B;  1VF7 A;  3X2Q C;  3OEH G;  1IBM O;  4I0X A;  2UXC O;  4FMT A;  1IBM B;  3N2K A;  5FNV B;  4MTX A;  3OMI B;  5GTH Z;  3LDE A;  2F43 G;  2QJ1 A;  4EFE A;  5JWP A;  1PD3 A;  2R70 A;  4PDM A;  4JV5 B;  1I7F A;  4I5S A;  1NZ6 A;  1XBL A;  2Q7H A;  4RUE A;  4NXN B;  5LGU A;  1GN3 A;  1URF A;  1TVK A;  1R3I C;  4U3J A;  3E35 A;  3ETG A;  3JD4 A;  5LA6 A;  2PUS A;  3ZHT A;  2JRI A;  3ZJZ A;  3CWB H;  3QVN A;  1SA0 A;  2UUB O;  5CA1 A;  1G1X B;  4DK1 A;  2IH1 C;  3OFN G;  2YS8 A;  1NR7 A;  2W0F C;  1FPO A;  4NKG B;  4GX5 A;  1N4C A;  4DR5 O;  3STL C;  2IBZ H;  3E8F A;  2P4V A;  3ABK B;  3H01 A;  1AI6 A;  1Z2G A;  4AHC A;  3K79 A;  1DGS A;  1KYO F;  1Y4M A;  3SGI A;  3RYF A;  2HHH B;  3JAR A;  5IY5 B;  4U3F H;  4DV4 O;  4IHJ B;  1BCC H;  5KHG A;  1XNR O;  2LW1 A;  1FXH A;  3E22 B;  4E2L A;  4Z1V A;  3AG2 B;  2H3O A;  1EN4 A;  3ZRW A;  2UXX A;  4DRX A;  5EC2 C;  4QE9 A;  1Y74 A;  5CA3 A;  3OUS A;  2ZR3 A;  1XHX A;  2E3C A;  1JCH A;  5J2T B;  5IYB O;  5BY1 A;  3CJH B;  2E5L O;  3RBZ A;  1KMI Z;  2Z5U A;  2GTA A;  5KAI Z;  1K4D C;  3ABL B;  4B7E A;  4YHH O;  4TV9 B;  4DR1 O;  1YSC A;  4JTD B;  1I94 B;  5BMV A;  3BFR A;  4HZ3 A;  1K7D A;  4LFB O;  3WU2 Z;  3RN4 A;  4JYB A;  2P6J A;  4X89 A;  4UVA A;  5LOV B;  2EJ7 A;  3HB3 B;  4AQY O;  1JX9 A;  5FLX N;  2MW2 B;  2WAM A;  4LF5 B;  3OTO O;  3OE7 G;  3EFF K;  1XRE A;  3TGU H;  1H2N A;  1QLN A;  2Y4U A;  4LP8 A;  4H44 B;  3ZHQ A;  4BW9 A;  3CYO A;  3ETE A;  3ZMV A;  3OGC C;  4WF9 V;  1ORQ C;  1QR9 A;  4RAI A;  4J41 A;  4MVS A;  1IBL B;  2QKC A;  5BR8 O;  4GKJ O;  2IW5 A;  3B8M A;  5ITZ B;  4YJ2 A;  1SQG A;  3OUF A;  1KEC A;  2DW4 A;  1MNG A;  4Z2W A;  2AXT Z;  5H6Q A;  1P49 A;  2GTS A;  4KXR A;  2RCV A;  3L75 H;  2UXC B;  2XAS A;  5LGT A;  4YY3 B;  1OJH A;  1Z5V A;  2YC0 A;  4B3T B;  5LBQ A;  2PI5 A;  3C3T A;  3U10 A;  1Y76 A;  1NI8 A;  1S77 D;  2KG7 A;  1VF6 C;  5B3S B;  1HNW B;  4HBN A;  1O9H A;  2XT9 A;  1XMQ B;  1WAZ A;  4J9Y B;  3N2G B;  3KZI Z;  2FTK A;  3JAR B;  4CH6 A;  3CCR V;  1S0V A;  4BW5 A;  4LH6 A;  3TCU A;  3T1H O;  4JAS A;  1I0H A;  3CHX A;  3D3I A;  1H2S B;  1NR1 A;  4YJ3 A;  3BA9 A;  5HFM A;  3CCQ V;  1OHH G;  1ZLZ A;  4X1Y A;  4QPK A;  1M4U A;  2BOC C;  2WLL B;  4Q20 A;  1BE3 H;  3JAS A;  3VQW A;  4JI6 B;  4TUY B;  5EZY B;  3H1L H;  5A9G A;  2A79 B;  4WFH A;  4X66 B;  2DOS A;  3TJT A;  1FFX A;  3A0R A;  2ZE6 A;  1B06 A;  2KB1 A;  3RYI A;  1VQ7 V;  1NT2 B;  4X88 A;  1FD9 A;  1SKV A;  2FL4 A;  2GHY A;  5JQG B;  5JVD A;  4OXS A;  1VAR A;  3JD0 A;  4LFC O;  4KHP B;  2UXB O;  3JAT B;  1AB3 A;  2F1M A;  4TQD A;  4LFC B;  4KHP O;  2JDI G;  3K58 A;  4LF7 O;  3AG7 A;  4PA4 A;  3SPJ A;  4ZOL A;  3GVM A;  3U11 A;  4DV3 O;  1GN6 A;  2MK3 A;  3GWK C;  1COW G;  1NKD A;  2FYU H;  4YIO A;  2AW9 A;  1GAX A;  2DWE C;  1MSW D;  5DED A;  1JR9 A;  1D5N A;  3BPZ A;  2AZ2 A;  1GM8 A;  1A32 A;  3CRC A;  1JJO A;  4DW1 A;  1Q86 W;  3JD2 A;  3JD3 A;  2OCC B;  2ZDI A;  2WA3 A;  4WBN B;  3SR2 C;  1L0L H;  3K59 A;  3FB8 C;  2VS0 A;  3ICX A;  4QNH B;  5JJN B;  1FXK A;  4X9Q A;  2WLM A;  3E86 A;  1ZAU A;  3D3Q A;  3BA8 A;  3B77 A;  4UFZ A;  5FPO A;  3CCV V;  1XUQ A;  5JJJ B;  1JPX A;  1CP9 A;  1LR1 A;  1HNZ B;  2Q7E A;  2EX3 A;  2UXN A;  3UT5 B;  2A7W A;  3ZHU A;  4MVU A;  4IL6 Z;  4FM2 A;  3FYI B;  2YEV B;  3JAK A;  2F23 A;  2EBO A;  1SQQ H;  4GKK O;  4FK5 C;  1P4R A;  2LFS A;  3I56 V;  1W2B U;  2L35 A;  2YIB A;  3KCY A;  3U0Z A;  5IYC O;  2HKO A;  1BL8 A;  3JAL A;  2FB5 A;  3RT3 C;  4NTW A;  5IJ9 B;  1O9G A;  3I55 V;  1KD1 W;  2R9A A;  4FFB B;  1EM1 A;  4NXM B;  5KHI A;  1K5S A;  3RW0 A;  2HEP A;  2XTA A;  4N21 A;  4EB6 A;  2WLK A;  3ETD A;  2F93 B;  4PA7 A;  4O2B A;  3VQV A;  5C8Y A;  2BOB C;  2R9I A;  4JTC B;  4UVB A;  1MOF A;  5KA6 A;  1HWY A;  1OCR C;  3T1H B;  4TUY A;  5EZY A;  1EBO A;  1N33 O;  1SQP H;  4QGP A;  4CBC A;  5K1P A;  3K9A A;  2P90 A;  1KP2 A;  2WLI B;  3RVZ A;  1ZL8 B;  1X4T A;  5K1X A;  4CZZ A;  2W6I G;  3ABM B;  4PJ0 Z;  4I55 B;  2WLJ A;  4JI6 O;  4I50 A;  5LHH A;  5BXZ A;  5LP6 B;  2RMK B;  5KMG A;  4BAY A;  2OCH A;  3K06 A;  1XI1 A;  1R3K C;  5KX5 A;  1RFY A;  4GX2 A;  3HKC A;  4IIJ B;  1EN6 A;  3BVO A;  3A0B Z;  1W0J G;  3HKD A;  4JI7 O;  2X0L A;  3VOU A;  3APO A;  1GH6 A;  3E8G A;  2BCC H;  3JSN A;  1OZ0 A;  3ZS8 C;  4CS2 A;  3T1Y B;  2Q7G A;  3L71 H;  3QO5 A;  4DUY B;  4JI3 O;  1VQL V;  2DN9 A;  4X20 A;  5LYJ B;  1UJW B;  3AG1 C;  4YXW G;  1I08 A;  2Q8V A;  4JZ2 A;  1K97 A;  3UQ8 A;  4PDL A;  4LF6 O;  4H13 B;  4K0K B;  2UXD B;  2E74 B;  5JCO A;  2P7T C;  2Q6A A;  4PA9 A;  4LF8 O;  4JPR A;  4NVP A;  2FML A;  4LWS B;  1LNQ A;  3FB6 C;  4JI2 O;  3LSU A;  4UCR A;  2EIL C;  2ZM6 O;  1WLE A;  2LGW A;  4EFB A;  2PZS A;  3JCU Z;  2QGN A;  5JJE B;  3JSL A;  1TUB A;  4LF9 B;  2E75 B;  1N0N A;  5H5N A;  4DR7 B;  2HVJ C;  3N2K B;  4OX9 B;  2HJD A;  1GK9 A;  3JAL B;  4RQF A;  3JD1 A;  4MW3 A;  1B6Q A;  4O4I A;  3B09 A;  3SJQ C;  2DE0 X;  2ZR2 A;  4FFK A;  3ASN C;  4MSW C;  4RO2 A;  1MG1 A;  2ZIO A;  4KUM A;  3UCS C;  3G71 V;  4KFM A;  2C2A A;  4DR4 O;  5CB4 B;  1TVK B;  1SQF A;  2X6C A;  4K35 A;  4XDJ A;  4U3J B;  2QA4 V;  1PNK A;  4EB6 B;  4DV6 O;  1Q5O A;  4DV6 B;  3SPG A;  4X1I A;  4LNU B;  1M1K W;  4X1K A;  1VEW A;  4UCO A;  4PI2 A;  1WPX A;  3KG2 A;  2JVD A;  4HYO A;  1RM1 C;  1Q81 W;  1NH2 B;  4JTA B;  1QBZ A;  4B3R O;  3BAA A;  4MVO A;  1ARO P;  2Q68 A;  3LNM B;  4NXN O;  5IWA B;  4TV8 A;  2WLI A;  2OTL V;  3S3W A;  4DK0 A;  4DR2 O;  4F6R B;  1YI2 V;  1Q6H A;  3K04 A;  4JI1 B;  4R8C A;  4I50 B;  5KMG B;  2UUB B;  3K5O A;  2PY5 A;  2DYS B;  1AJP A;  1AJN A;  2Q0O C;  4IIJ A;  3AG1 B;  2VWK A;  3B4S A;  1N36 O;  4RWU A;  2KQX A;  2OTJ V;  2HVK C;  1Y67 A;  4FIP C;  1M56 C;  3G67 A;  3TXQ A;  1K5Q A;  3SYC A;  5IJ0 B;  1D2D A;  4CH3 A;  2P5O A;  4BIO A;  2IJJ A;  5CA0 A;  2DYR C;  2JJ2 G;  4OPA A;  5GON B;  3W7U A;  1N8R W;  1K92 A;  4X66 O;  4P9P A;  3VQY A;  3G80 A;  1EN5 A;  3CCJ V;  2JEX A;  1VQN V;  3OW2 U;  4FJC C;  3ABT A;  5B5E Z;  2G38 A;  3T1Y O;  2E5L B;  2RDC A;  4JZG A;  4OGQ B;  1N32 B;  2EZP A;  3SDL A;  1BHA A;  5LMN O;  2EIJ C;  3A8T A;  4DUZ O;  3NXS A;  1HR0 B;  1NVP B;  1XNQ O;  1TUB B;  1VQ9 V;  3ZED A;  2OIE A;  1M9N A;  2L6L A;  3K57 A;  1OCO C;  5B66 Z;  3SPC A;  1F4M A;  3WB1 A;  1K9M W;  2Y69 C;  1Q8I A;  1AI4 A;  3FKS G;  2HHH O;  5B3S C;  4UVC A;  4G27 B;  4FLV A;  3CSX A;  3Q4H A;  4WFE A;  1XNR B;  5L3F A;  5CB4 A;  1JFF A;  4LF4 B;  4K3A A;  1HNX O;  1AJQ A;  1HNX B;  3JAW A;  2LP7 A;  3X2Q B;  4I9Q A;  1R1B A;  2HFE C;  1KB9 F;  3FD9 A;  1XHZ A;  1H2K A;  3DC6 A;  5L3C A;  1NJI W;  1MZF A;  4BIZ A;  4O4L B;  3SJA C;  3P30 A;  1S72 V;  3CD6 V;  2EIM B;  5C93 A;  5F2V O;  4FLU A;  3GWO A;  1MAB G;  3M8A A;  5LHG A;  1VQ6 V;  5EK0 A;  1AVM A;  1Q6I A;  5DEC A;  2A3Q A;  4F6R A;  2ADP A;  2V1D A;  1WB7 A;  3RYH A;  3L9D A;  2VRZ A;  3CME V;  1YCI A;  2GDS A;  3UKM A;  1KKD A;  3LUT B;  4I7Z B;  5LXT A;  3W7S A;  4QE7 A;  4NXM O;  2PYJ A;  1D5A A;  4X1Y B;  4J9Z B;  4UB6 Z;  3PJS K;  2X6A A;  4ASU G;  3S3X A;  3CP1 A;  3JAS B;  2HP8 A;  1QVG U;  1XMQ O;  1DK1 A;  4LH7 A;  3LDC A;  1HP8 A;  5IJ0 A;  5KUM A;  4ZI7 A;  2OWO A;  1J5E B;  4WFF A;  2BTO A;  1US6 A;  3E8H A;  1BGY H;  5CA0 B;  3ZMT A;  3KKY A;  3RYC B;  1J5E O;  4J11 A;  3GB7 C;  2YIB D;  2YUA A;  1PM9 A;  1K33 A;  5BR8 B;  3D36 A;  1Y76 B;  3AG2 C;  1WP8 A;  2JGD B;  2ZD9 A;  1ZWI C;  2QSA A;  2N05 A;  1R6T A;  1QCE A;  2WLN A;  1E79 G;  4WFG A;  4TSF G;  1XIL A;  1ROP A;  1RPR A;  3O65 A;  4ZBM A;  4FLT A;  2AGA A;  3JYC A;  2GUZ B;  3OMA B;  3P3N A;  4DV2 B;  3AK3 A;  2HG5 C;  1S3J A;  1Y6X A;  3D36 C;  4TWK A;  1BQZ A;  4FVM A;  5KLV H;  2UUA B;  4ABM A;  1WNS A;  4Q6G A;  2OYQ A;  4C7U A;  2F95 B;  4TT3 G;  4JYY A;  4DR1 B;  4P30 A;  1QHT A;  2ZNJ A;  1JQ0 A;  5IYZ A;  1EZJ A;  1H8H G;  3G4S V;  3FAV B;  2Q9L A;  3T2M A;  4H0L B;  4XBF A;  2QE7 G;  3WG7 B;  3B2E E;  2Q69 A;  2QTS A;  5HFL A;  4X64 O;  3IJ4 A;  1IDS A;  4J7Z A;  4FZ0 A;  3TET A;  4JI5 B;  4DO2 A;  2YEV A;  1IVS A;  3JAT A;  2O57 A;  1NS1 A;  1WPB A;  2P67 A;  1L1F A;  4ZOL B;  3CCS V;  2ODM A;  2Z3Y A;  3B40 A;  4R7C A;  2HR3 A;  3OT7 A;  2VQE O;  3MD0 A;  2WSS G;  1K4C C;  4OX9 O;  2ARH A;  3H9V A;  5L3E A;  4FFB A;  1NBM G;  3STZ C;  4L8J A;  4J10 A;  4MTO A;  1X59 A;  2RJZ A;  3SYA A;  5CN0 A;  1VQK V;  2ATK C;  2A9H A;  4NTX A;  3RFR A;  3BCC H;  3IFX A;  3QTC A;  3QO7 A;  4O2B B;  1IBK O;  3ZHS A;  1V55 C;  1ZSP A;  3HPL C;  3G6B A;  3PN1 A;  1YJ9 V;  1VQP V;  2WA4 A;  5L3D A;  4L87 A;  1YEW A;  3CB2 A;  3WB0 A;  1FJG O;  2HJF C;  1ZL8 A;  3L72 H;  5KA5 A;  4GX0 A;  3T4D A;  2CH7 B;  4B3M B;  1AI7 A;  4I0X B;  2JGD A;  2VQF O;  1L0N H;  5FNV A;  4IYI A;  1PPJ H;  5JCO C;  1ZUQ A;  4O2A A;  4JI1 O;  2KKW A;  3HKE A;  2EIN C;  4MVM A;  4MVZ A;  5KHK A;  1IBL O;  1HNZ O;  2ZIN A;  3OD4 A;  1OCC C;  1BZK A;  2GBO A;  2F66 C;  2XAF A;  2XAH A;  4AI8 A;  4O4H A;  4LR3 A;  3WG7 C;  4WFA V;  4KP4 A;  3K3W A;  2BTQ A;  5IT9 N;  1AR4 A;  5L3G A;  1SA0 B;  3QF7 A;  1R3L C;  2PTM A;  2YI8 A;  5DN6 G;  3TXS A;  4J80 A;  1FS0 G;  3ASO B;  4X62 B;  2Q5Z A;  1FKA O;  1DLB A;  4B3T O;  4JI7 B;  5FPR A;  3ZRX A;  4I4T B;  1WB8 A;  4MTG A;  4JGS A;  3RGB A;  4LC1 A;  2QDO A;  3AK2 A;  3CRM A;  1RP3 B;  1S76 D;  1XQ8 A;  2QWP B;  4A5U B;  2LJ2 A;  4I55 A;  3ZN0 A;  1GM9 A;  4DUY O;  4DV3 B;  3H1K H;  4HAM A;  3RYF B;  2OCC C;  1YIT V;  3N27 A;  3BEH A;  5DM6 V;  1HR0 O;  1EFR G;  1S5J A;  3ZHV A;  1IXB A;  1E1R G;  2EUL A;  1AP5 A;  2XAG A;  5JH7 A;  3CJH A;  4HNA B;  3BRC A;  2D2C B;  1VQM V;  1PNM A;  4UXN A;  5H9C A;  5KAF Z;  1M57 C;  1VF5 B;  1PL0 A;  1U97 A;  4MTF A;  2BSK B;  4QPJ A;  5BMV B;  5J2T A;  1XMO B;  4DV5 B;  2EIK B;  1XMO O;  1WA8 A;  2CTQ A;  2ZIM A;  4DV5 O;  2RN9 A;  4UV8 A;  4X1I B;  4LNU A;  4DR7 O;  1SS3 A;  2Q0A A;  4X65 O;  3K03 A;  1VQO V;  3RVY A;  3CRR A;  2HLD G;  3TK1 A;  4ZKI A;  1LUW A;  3L70 H;  1SER A;  3MHH C;  2DQ3 A;  3SYQ A;  4GKK B;  1UPG A;  3DGE A;  1GO3 F;  2CH7 A;  1SF9 A;  4XDK A;  3UO2 A;  3K5M A;  3K0G A;  4ZHQ B;  2CGN A;  1YHQ V;  1WN7 A;  4DYL A;  4F6E A;  3C90 A;  1YJW V;  4O4I B;  2R72 A;  2K1E A;  2CE4 A;  5AG2 A;  4B3S B;  4ZIB A;  1NU1 H;  5IWA O;  3ZMS A;  4FM0 A;  3P3P A;  4RQE A;  5ITZ A;  2YIC A;  3E89 A;  1FAF A;  5IY5 C;  5LMU O;  4JI4 O;  4DR2 B;  2AHZ A;  1YTF B;  5LMU B;  1VQ8 V;  3CX5 F;  1RSO A;  2BE3 A;  1Y66 A;  4FLZ A;  1BHB A;  3BHP A;  1VQ4 V;  5B1O A;  1VP7 A;  1W0K G;  4DR3 O;  5KHH A;  4CS3 A;  5J9P C; 
#chains in the Genus database with same CATH homology
 2RN9 A;  2RNB A;  1U96 A;  2LGQ A;  1HP8 A;  2LQT A;  2HP8 A;  1U97 A;  1Z2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...