1U97A

Solution structure of apo yeast cox17
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
69
structure length
69
Chain Sequence
MTETDKKQEQENHAECEDKPKPCCVCKPEKEERDTCILFNGQDSEKCKEFIEKYKECMKGYGFEVPSAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Yeast cox17 solution structure and Copper(I) binding.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
molecule keywords Cytochrome c oxidase copper chaperone
total genus 12
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2004-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05051 COX17 Cytochrome C oxidase copper chaperone (COX17)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1130 Mainly Alpha Orthogonal Bundle Helix Hairpins CytochromE C oxidase copper chaperone 1u97A00
1U97A 2LQTA 1Z2GA 2RN9A 2LGQA 1U96A 2RNBA 1HP8A 2HP8A
chains in the Genus database with same CATH superfamily
2Q7HA 4GX2A 1R3JC 4LC1A 4UV9A 1SQQH 1AILA 3BFRA 4UV8A 2IJKA 1QLEC 2FB5A 3RVYA 3STZC 5JVDA 4HAMA 1GM9A 3JCZA 2HP8A 1SZXA 5EBLC 2CTPA 3G71V 2WLMA 2QWPB 4O4HB 5LXTA 5GONA 3AG2B 3WFVA 3TETA 3OAAG 5KA5A 2YDEA 3ABKC 1GN4A 4MW3A 2QTOA 3SYPA 5KHIA 2EIKB 4J42A 1XBLA 2LGQA 1MABG 2VQEB 5IJ9B 1SZTA 1EBOA 4YIOA 4LF8B 3B8MA 3T1YB 3UT5A 4QPKA 1VF5B 3CRQA 3SPHA 4LF5O 2ZE8A 1PNMA 5C8YA 3J80N 4R7CA 2IU0A 5ITZB 4A5UB 5L3CA 1BQZA 4ZOLB 4JYAO 5J2TA 4LF8O 4H13B 1H2KA 1VF6C 2V4DA 2Q9LA 1EN5A 4GKKO 5LHIA 1VQ6V 2QM4A 2EIJC 5JQGA 3CD6V 3BRCA 5LMNO 1I94O 1BCCH 1KECA 4WFHA 2BE3A 4BWAA 2UUAO 4N23A 2Q68A 1IBMB 2ITCC 2LW1A 2QWOB 1JVMA 4PA6A 3E22A 1OCRC 1U96A 3TK1A 1N32B 1WP8A 4U7OA 1R3IC 5L3BA 4W4KA 4YJ3A 1SF9A 4I0XB 2Q69A 4DV0B 1VQ8V 1SQPH 1ZSPA 4DO2A 2R70A 3B09A 5LOVB 4LWSA 3B2EE 3H1JH 1MA1A 1VQ9V 4K3AA 4JI6O 4FLVA 3RYHB 1XI1A 2P5OA 3EHBB 1HW7A 1Y74B 3AG4B 2ZNJA 1HNXB 1FXVA 3CCEV 2HJFC 1E1QG 5IYZA 5CBFA 3JALB 4PA9A 3RYCB 1HNZO 3OFNG 4O4IA 4CC5A 2LO1A 3ZRVA 4PELA 5LP6B 4JPRA 4PA4A 3JAWB 1GH6A 3AG3B 1GK9A 1S3JA 4X1IA 1SQFA 1AB3A 1XMQB 2R9AA 2F23A 4KP4A 5LYJB 1FD9A 2OCHA 2B5UA 2CAZC 1PNLA 3CJHB 4X1YA 3ZRWA 3IC9A 4FPPA 4KHPB 2KG7B 1CEZA 2PF4E 5LA6A 1Y74A 1I08A 4DUYO 4DR5B 2DE0X 5IYBO 1YEWA 1BHAA 5JCOC 2VQFB 4JI0O 3OD4A 4PI2A 4MVQA 5J2UA 2ZE6A 4B3MO 1CXZB 2WLHA 4GKJO 4JAVA 2F95B 4OX9B 1H8HG 4DR5O 4X8AA 4I9WA 3WG7C 4DW1A 4JI8B 3JYCA 4X88A 1VQ7V 1GN6A 2ZCEA 5KX5A 4EFEA 1RM1B 2A06H 1XNQO 3G6EV 5B1OA 4NYKA 3I5DA 4RUFA 2ZINA 4ZI7B 2E3CA 3I55V 4I50B 1QU7A 2VRZA 2Q8VA 5D5PA 4UB8Z 3BCCH 1RPOA 3GB7C 3CXCU 4CS4A 1M56C 2IH1C 2MK3A 3BVOA 1AR5A 1XQ8A 1G4YB 4QGPA 3F7VC 3K57A 2YEVB 4X20A 2P67A 3K79A 4I5SA 2PGGA 5LL6Y 4JI2O 3QTCA 1NH2D 4ABMA 2WLNA 1AJNA 2QGNA 4WF9V 1HDJA 1FYJA 2YEVA 4FLYA 1JA8A 1Q8IA 4CH5A 4LF6B 2XAFA 5H5NA 4FM0A 4X1KA 5EIBC 1S5LZ 2H8PC 1P49A 1QNMA 4IL6Z 4QJFB 3HKCB 5CA3A 5KUKA 1AI5A 5LXTB 3ZHTA 4ICGA 3CRAA 4MVZA 3E8BA 3FAVA 3ASOB 1AP5A 3BA9A 1JX9A 1P7BA 4J11A 4X66O 2Z0AA 2NNUA 2RCVA 1S5HC 4I4TA 1GTOA 5CA0A 3HKBB 4DV2O 2QE7G 1JFFA 3L9DA 2E5LB 4J80A 2C2AA 3R66A 1N0JA 1NJIW 2ITDC 1IDSA 4JYAB 4PI0A 3L72H 3RYIA 1VQKV 4JI3O 3F7YC 3KZIZ 1VP7A 3ZX6A 3BA8A 1M90W 2E5LO 4DR2B 2RDCA 2EILC 3ZBHA 3ETDA 1ENVA 3JCUZ 1LUWA 3ABMB 4R6ZA 2P6JA 4YJ3B 4DUZB 2WLIA 1Q7YW 1W59A 3HKBA 4FFBA 2FKXA 1VF7A 3ZCCA 1H2MA 2A9HA 4X62O 1OCOC 5K1XA 3FKSG 2CGNA 2ETNA 2YSUB 2FTKA 2ILMA 3ABLC 5BR8B 3AK2A 3GWOA 3T1HO 2YIBA 3VQYA 1UPGA 2JGDA 4P2ZA 3U10A 1BSMA 3AG4C 4JI4O 3CCMV 4PD4F 4OPHA 1HNWO 2DWDC 3D3IA 1YJWV 4NXNO 2IH3C 1FXKC 3U0ZA 2VWKA 4UCTA 2BSKB 2LP7A 3KCYA 2W6IG 4J9YB 4Z1VA 3F5WC 3CRCA 3ZRSA 4DR6O 1EN4A 3RT3C 2JS5A 4O4HA 1TUBB 4GZRB 4B08A 3ZHVA 3ZS8C 3OGIB 4AQYB 2Y0PA 1TUEB 4DRXB 3CWBH 2BTQA 1JFFB 1SQXH 3SJBC 3CS5A 1KKDA 2YUAA 4NTWA 1GN2A 1QVGU 1K5SA 1Q90D 1N32O 3OGCC 5IWAO 4XDJA 1WB8A 4W4LA 1Z5VA 2FYUH 2AZ0A 4CH6A 2YC0A 4NVPA 4MVOA 5KA6A 5KHKA 2D2CB 4FIPC 3CXHF 2VQFO 1NH2B 3HKDA 5BXZA 2JJ1G 1K97A 4BIZA 2QM8A 1K33A 2Z5UA 1LNQA 4B7EA 1AJQA 1ZTEA 3JARB 4JASA 2E74B 3LSQA 3UO2A 4GUNA 2AZ2A 2F66C 5E1AC 2NN4A 4PDMA 2EBOA 4HNAB 2R72A 1R6KA 2UXCB 1BQ0A 2EIKC 3IFXA 4O4JB 2H94A 5IY5C 2UUAB 3K0GA 3RYFA 2QKCA 1F4MA 3M8AA 1FFXA 3P32A 3AG2C 1NR7A 2WWWA 4UVCA 3KKYA 1JPXA 3A0HZ 2CTWA 1WP7A 2BOCC 2HFEC 2V1DA 4LH7A 2QJ1A 3BPZA 2UUBO 1QLEB 4MT8A 3JD2A 5BZBA 2A7WA 5KMGA 3SJAC 1SRYA 2Y48A 2HHHO 4UUJC 4IIJB 2GTAA 4P9OA 5JJEB 1COWG 1Q3EA 3BEHA 4C7UA 2KQXA 5F2VO 4JV5O 1S0VA 3N2KB 3APQA 1JJ2U 2KKWA 4TV9B 1UJWB 1G6UA 3RYHA 1NTMH 4UCUA 5J9PC 1VQOV 4FJCC 1YTFD 3J7AU 2ZXWB 5FPRA 1OHHG 4O2BA 3X2QC 4K8XA 3OW2U 3QF7A 4I55A 4JAUA 1PP9H 1Y76A 1WPXA 4PA7A 3OTOB 2EIMB 3RN4A 3ZHRA 3DXRA 3Q4HB 5FNVB 4G2KA 4DR4B 4DR7B 2QSAA 1YZBA 4EKWA 1N36O 1SKVA 4FMTA 4J10A 3N2GA 1T5EA 2BTOA 1WJZA 4DUYB 2HVKC 4X1IB 2LW7A 1YDXA 1RM1C 1XUQA 2EINC 1D5NA 1O9HA 3S3WA 3D8CA 5JCOA 2AW9A 1AI7A 1R1BA 3IJ4A 3SPGA 4EB6A 3L71H 2V7QG 5AG2A 1K8AW 2E76B 3CMEV 3SJQC 3DTUB 4ASUG 4L87A 1G8MA 1S72V 1SA0A 4DV6B 2W0XA 3ZMVA 5L3EA 3RWRD 5CA1B 2DMXA 3TJTA 5LMUO 2JGUA 2QWNB 1SS3A 4GCZA 1ZUQA 2YICA 1SQGA 2N04A 2EINB 3CEIA 3ZHQA 1URFA 3H9VA 4U3FH 5A9GA 5B3SB 2Y4TA 2GTSA 1JJOA 2K1EA 3SYOA 1AVMA 4JZ2A 1X59A 3VQVA 4FM1A 4X65B 4UCSA 1TAEA 2WAMA 1OCZC 3NXSA 2WLLB 1BGYH 3E8GA 4DR3O 2YI9A 2QEXV 2OT5A 2CTQA 4FLUA 4JYBA 5K1PA 2CTRA 3LUTB 3PJSK 4LF5B 4ZHQB 1UFIA 3LDEA 5CBGA 2Q73A 3HKEB 2AHZA 1D5AA 5EZYB 5FL7G 1KB9F 5FNVA 3WB0A 4AQYO 3TCUA 4XDLA 3RBZA 4ZHQA 2DW4A 3P3PA 2ZXWC 4LFAO 5BMVA 2CDYA 2X6CA 4YIPA 4Z2WA 3GVMA 3LNNA 5FPOA 3JAWA 5EYPA 5CA1A 2A79B 3FYEB 3B77A 1AI6A 4NTXA 1AP6A 1ROPA 2ZM6O 3VBBA 3A0BZ 1KC8W 2BSKA 1WN7A 4MVRA 3JALA 3AG7A 4WFAV 1KYOF 4MW8A 1ZAUA 4ZOLA 1OCCB 1RFYA 4LP8A 4LFBB 1Y76B 2ATKC 1R3LC 3VOUA 2IBZH 2R9RB 3TGUH 2IU3A 1PL0A 2DYSB 4CBCA 1JR9A 1O9GA 4I0XA 2E75B 2ZQMA 1QHTA 1NVPB 3WU2Z 1IZ3A 1PV0A 4LF4B 4X89A 1SA0B 5B1NA 5IY5B 3JAKB 1R6TA 2ZDIC 1S76D 3CCJV 1NTZH 5IYCO 2NLJC 2Q0OC 4OGQB 4JI1B 4O2AA 3OMIB 4J41A 1NBMG 4B3TB 5H2FZ 5KUMA 2EZOA 2YXLA 1EFRG 4BW5A 1FXKA 1M93A 3H01A 2ZR2A 2UUBB 3K59A 2LFRA 1IBKO 1GAXA 2XTAA 1ZX3A 4JI4B 5HFMA 2XHBA 2OWOA 3K06A 2EX3A 2HG5C 2NR5A 1Y4MA 2UXDO 1IBKB 3ABUA 4JI0B 5ITZA 3ZIAG 3G67A 4MVMA 3W7TA 3JD0A 1XL6A 1K3EA 5L3DA 1R6NA 1XL4A 1QLNA 4EFBA 3E86A 3RYIB 5H6RA 1XDCA 4X9QA 4JF3A 3SYCA 4DW0A 1V9PA 3JD4A 5DECA 1Z2GA 3ZJZA 4GX5A 5KHGA 4Q20A 1NVPD 5B5EZ 5IYZB 4TWKA 3G4SV 2DN9A 3E2EA 3ZMUA 3ETGA 2GUZB 1NZ6A 1XILA 2BCCH 3TXQA 2QM7A 1N34B 4JI7B 2QWQB 1E79G 1FXKB 2UXBB 1YTFB 1MG1A 1VMGA 3H1HH 3ABLB 1HP8A 3JAKA 3K5OA 4D7SA 4I7ZB 2ARHA 1IURA 2F43G 2CH7A 3CCLV 1EM1A 4LF9O 4LFCO 1OJHA 2JVDA 4XDKA 4TV8B 2VQEO 1BL8A 1SESA 1DF4A 1U97A 3K5LA 3JASB 4HNAA 5GW7A 3ABMC 1XNRB 3N27A 4DV3O 3T4DA 4LNUB 1I0HA 4LFCB 4LF9B 3E8FA 1W0KG 5B3SC 3C3SA 2EILB 4NR1A 4QE7A 4PDRA 3AEIA 1K73W 2RMKB 2QDOA 4GKKB 4P30A 2YIBD 5LMNB 1I94B 3CCQV 1N36B 1E1RG 3CJHA 4X1YB 2ZDIA 4PDVA 1M1KW 4ZKIA 4UCOA 4BIUA 3MHHC 1DGSA 1Y67A 1HR0O 1AJPA 3CCVV 2B1IA 1N33O 2LJ2A 5FLXN 2JK5C 3FD9A 1NU1H 1Z5WA 4KHPO 1V54C 3OMAB 5GTIZ 4WBNB 4JZGA 1MOFA 1Y66A 3AG1C 2Y4UA 2EJRA 1CP9A 2F4VB 3RYFB 5C8YB 2JS3A 4YY3O 1SETA 2IM9A 2Y0IA 2GBOA 1RPRA 2EIMC 4JI8O 2JJ2G 1XMOB 1N0NA 3LDCA 2EULA 3QO5A 4LF6O 5EC1C 2WA3A 4G28B 4QE9A 3FFQA 2FL4A 4QPJA 1FFXB 3OT7A 5EBWC 5EK0A 3DC6A 4NTYA 4MTOA 3HKEA 3W7SA 4O2BB 3ZN0A 4K0KB 2CGOA 3RVZA 3BY6A 3E22B 2RNBA 5HFLA 1XMQO 1IXBA 1K92A 1ZWIC 2LGWA 2GUZA 3SPIA 1V55B 4YHHB 4HBNA 4DK0A 1IBLO 3CC4V 2OTJV 3E83A 2PYJA 3K58A 4LCUC 4CC6A 4FZ1A 2XAJA 2ZE5A 3RFRA 3AG1B 1WA8A 4FVMA 3LNMB 4LNUA 4DV1B 3ASNB 4JI2B 2JIZG 5E79Z 3KCXA 2XNDG 3A2FA 2X7RB 4JI1O 3CHXA 1FFTB 3IAYA 1NKDA 1GO3F 1YF2A 1IXMA 5KHJA 5CN0A 4DR2O 1N4CA 2ZKOA 4IIJA 1XNQB 4WFFA 1BHBA 2OTLV 3UO3A 3HKDB 4FLTA 1L1FA 1K9MW 1W0JG 2M7WA 4LBEC 3IGAC 2QTSA 5EYPB 4U3JA 2VS0A 2H3OA 3CC2V 3T1HB 2PI4A 1H38A 1LUVA 4MS2A 4PHZA 4UB6Z 1AR4A 3OMNB 2RQ6A 2UU9O 1TVKA 3CC7V 1B3QA 3STLC 2F1MA 2BTQB 1H2NA 1Q81W 2RJZA 5GONB 3SGIA 4UCVA 3EVKA 3LDDA 2DOSA 4NB5A 3ZMTA 1RSOB 4JI3B 2XAGA 2OCCB 4UCRA 1NT2B 4WFBV 3E35A 1LR1A 3C3TA 1KKCA 1X4TA 3ETEA 3M99B 1G1XB 3FB6C 2L35A 4BIOA 2W6JG 1S5JA 1JCHA 4FFBB 1PKXA 1M5IA 1BMFG 3DXRB 3Q4HA 4GYCB 3W7XA 2UXBO 1MSDA 3CPWU 4JTAB 1P84F 3I56V 2PUSA 4YJ2B 3DSQA 4XBFA 2JGDB 2DQ0A 1KP2A 5IWAB 2AHYA 4I55B 1Q82W 3T2MA 1OCRB 1IBMO 3MD0A 3FAVB 4TQDA 1QQCA 2QR4A 5TISZ 3LSSA 4DV7B 3E8HA 2L6LA 2XAQA 1ZLZA 3C90A 2O57A 3UM7A 5CB4B 1JMKC 4JGSA 2X6BA 3JSNA 5C93A 2PI5A 1OCOB 2WLKA 3B4SA 4I50A 1QR8A 2GSMB 2ZIMA 3LSUA 4IHJA 2OYQA 4DR1B 5EIBD 2UUCO 1SQVH 4JI6B 2IJIA 2P90A 3QG5A 4TV9A 3IC7A 1GRJA 3B8NA 1PPJH 4O2AB 1HNZB 2YS8A 5J2TB 1R3KC 4NXMO 4DV5O 1J95A 2AXTZ 2HVJC 2LQTA 1M4UA 1SQBH 1NTKH 1VIBA 2YIAA 1I7FA 1K4CC 4DK1A 5DEDA 4Z1MG 1XNRO 2B1GA 4DV3B 2XAHA 2GHYA 4BR6A 5LP6A 4NKGB 2HHHB 4MTGA 3HPLC 4O4LB 3ASOC 5CBHA 3SPCA 1OCCC 4JYYA 4X64O 4B3MB 2Q7GA 3ZRWB 1TA8A 3T1CA 4DR6B 3CCSV 4DV4O 4DV6O 1RP3B 4GX1A 3K5NA 1JQ0A 2UXCO 2P22C 4I9QA 1TUBA 4B3RB 1N34O 2YXYA 1H2SB 1YJNV 1HNXO 3RGBA 4CS2A 5EBMC 4TT3G 1DF5A 1JOYA 3R65A 4ZBMA 4DR4O 1DLBA 5KMGB 2HR3A 1SERA 3OE7G 3AK3A 2XUMA 1NQTA 4K35A 4FLXA 2QKAA 3GWKC 3APOA 2VWJA 4LF7B 4HYOA 5CB4A 3K08A 1F4NA 4H44B 3SDLA 2WPDG 5B1BC 4DV0O 4TV8A 1TGOA 4UXNA 3CE2A 3ZEDA 2ZR3A 3W7UA 3RYCA 2OCCC 3E89A 2MW2B 4JTCB 4KUMA 1VQ5V 3L74H 2Y69C 3VQWA 5LGNA 4YJ2A 3SYQA 5J2UB 4WFEA 1D2DA 1Q86W 3G80A 5L3GA 3FYIB 4P9PA 4YXWG 5CA0B 4O4LA 2WSSG 2X0LA 4UVBA 2DYRB 4H33A 5JJNB 1EZJA 4IT5A 1YSCA 4DRXA 4TSFG 1YHQV 2DYRC 1H2LA 1GKFA 1FS0G 3CP1A 4GT1A 3OTFA 4E4EA 3UCSC 4TOIA 2XASA 3F5TA 3HR0A 4FZ0A 3H1LH 2P06A 1VQLV 3ICXA 5B1AB 4U3JB 3MAQA 2CE4A 2HLDG 3CRRA 5LP6C 3ZHUA 1KMIZ 4X20B 4OPAA 3SJCC 4MVUA 1L0NH 1KQSU 4BAYA 3K9AA 3VQXA 3JARA 1F51A 4RQFA 1A32A 4UVAA 1V55C 1YCIA 3X2QB 3SR2C 3FB8C 4LR3A 5KX5B 4QNHB 2ADQB 3K04A 1AI4A 5IT9N 5KHHA 2CH7B 1QVFU 4DR7O 4J9ZB 3NR7A 3H1IH 3K3WA 4EB6B 5LYJA 3L75H 2R9IA 1BT8A 1CPYA 1M56B 1F7YA 5IYDO 5LOVA 4MTFA 4FFKA 1RSOA 1B04A 4WCEV 5IJ9A 5DM6V 4U7NA 1GN3A 5JJJB 3HB3B 1J5EO 4CH4A 5B1AC 3JSLA 3K9SA 5JH7B 4OX9O 2EIJB 1XOUA 5KLVH 1V54B 5H9CA 2WLLA 2PTMA 4JI7O 4JI5B 3WG7B 1Q43A 4PA3A 1YIJV 2ZNIA 1KUQA 1QBZA 2Q7EA 4N21A 2N05A 2B9ZA 2P4KA 3M7MX 1TVKB 3G6BA 3DC5A 1NS1A 1WB7A 5DN6G 1QCEA 2QA4V 4K8ZA 1YXBA 3OM3B 5LA6B 3CMAV 1YJ9V 4JI5O 1VQPV 1VEWA 2UU9B 3BAAA 3K03A 4X62B 4CS3A 4J7ZA 2GV9A 4KXRA 5JH7A 5BMVB 2EJ7A 1GM7A 2BOBC 4QIWF 2JDIG 3ZHSA 4R8CA 2Y69B 3QVNA 2ODMA 3ABKB 3SPJA 1HNWB 1AR1B 4DV4B 3AG3C 3FX7A 4FK5C 2JEXA 3W7WA 1I5XA 1I5YA 3CB2A 3H1KH 4B3TO 5IDJA 5B1BB 4RWUA 3QO8A 4B7KA 1VF6A 4DV5B 2YI8A 2LFSA 3OEHG 2ZM6B 1WNSA 1K4DC 2Q5ZA 5BY1A 3QO7A 2HJDA 3EXAA 2Q67A 2YIDA 1M9NA 4KFMA 2P4VA 2PYLA 2PZSA 4DV7O 3JATB 3CCUV 1FJGO 1GM8A 4LF7O 4RAIA 2Q0AA 3MDSA 2WA4A 4R50A 1PL4A 3FB5C 1H2GA 5LHGA 2W0FC 1M57C 3L70H 1YITV 2EZPA 4MTXA 4D7TA 2A3QA 4RO2A 2F4VO 1FJGB 1ORQC 2K9PA 2YXHA 2OIGA 3ZMZA 4LWSB 4L8JA 5JVDB 3RW0A 4AI8A 5D5QA 1AROP 5GTHZ 4LF4O 2JEUA 1FKAO 1OV9A 4F6RA 3ABTA 1KD1W 3T1YO 5L3FA 1BZKA 3CYOA 1B06A 4IYIA 4ZI7A 2PY5A 1PNKA 1KU9A 4NXMB 1FAFA 4TUYB 1VQMV 1XREA 1P7GA 4DUZO 3PN1A 1NR1A 2ZE7A 2QKSA 5EC2C 1N33B 3BABA 3K0DA 1YVWA 1KBHA 4ZIBA 4PJ0Z 1IBLB 2IJHA 4FLWA 3UKMA 3DGEA 5H6QA 2DJVA 1L0LH 1EZVH 4F6EA 5BR8O 2UXNA 4B3SB 2ZIOA 2Q4PA 1BS3A 1OZ0A 1Q5OA 3FB7C 2IW5A 4X64B 2AGAA 3T4ZA 3J81N 4YY3B 1DTOA 1DK1A 1US6A 1HWYA 1MZEA 4H37A 1SC5B 3WB2A 4BW9A 4TQFA 3OUFA 5IE9A 1WLEA 4PDLA 3U11A 4B3RO 4B3SO 3HKCA 2KG7A 2F93B 2ZD9A 1XMOO 2DYSC 3D36A 4F6RB 3ZRXA 4E2LA 4MVSA 4GKJB 5KAIZ 2HKOA 3ASNC 3BHPA 4CH3A 3K5MA 4RUEA 2G38A 1XEQA 3JAMN 5LGTA 3OR7C 4O4JA 4HZ3A 4TUYA 1PD3A 1FXHA 1HR0B 2DQ3A 2P7TC 2RN9A 2N74A 4GLXA 5A2QN 3AK1A 3N2GB 4WBNA 3THOA 4YHHO 4X65O 1EN6A 4FM2A 1GMGA 2ADPA 2CUGA 2IJJA 4DR3B 1NI8A 4DV1O 5KAFZ 1N8RW 3P30A 1F23A 4OXSA 2UXXA 4J7KA 1MZFA 3JD3A 3MHSC 2WLJA 4JV5B 3QNEA 1Q6HA 2DWEC 2HEPA 3O65A 1XHXA 3OUSA 4X1KB 4DXWA 1H8EG 1S77D 1Y6XA 4MSWC 1VQNV 1P4RA 5B66Z 1OCZB 1K34A 1MMMA 4K0KO 2ZT9B 5IJ0A 3CRMA 1Q6IA 3CSXA 5LBQA 2XT9A 3A0RA 3EFFK 4D6TH 4IYHA 1WA8B 3SYAA 2KSDA 1QR9A 1PM9A 3KG2A 4I4TB 1IVSA 3JATA 3ZN1A 4IGGA 4LFBO 1KP3A 4KL1A 2FMLA 1J5EB 3A8TA 5EZYA 2Z3YA 3OR6C 2M6YA 1K7DA 4LH6A 3P3NA 3CCRV 4X66B 2GDSA 3B40A 4DV2B 1FPOA 5IJ0B 2UUCB 4JAAA 3N2KA 1ZL8B 4AILC 3WB1A 4RQEA 4PV1B 4O4IB 2CK3G 4AHCA 2KB1A 3ETQA 4LFAB 5JWPA 5LMUB 1ZL8A 1WPBA 2A0LA 3D3QA 4F4LA 4WFGA 1VQ4V 5LHHA 4H0LB 1VARA 3ZMSA 4Q6GA 3CX5F 3JD1A 3O9OA 1YI2V 3D36C 5JQGB 3OTOO 1Q6UA 3L73H 4IHJB 3JASA 4EEQA 3OEEG 2JRIA 2XOKG 4J7JA 1MNGA 1L8DA 1IX9A 1R73A 4FLZA 3ML0A 1THZA 2WLIB 5LGUA 1K5QA 3UQ8A 2QWRB 4DYLA 1B6QA 1WAZA 4G27B 4JYCA 4CZZA 2UXDB 1M57B 3UT5B 2D3OW 3S3XA 2OIEA 1XHZA 2X6AA 2Q6AA 4DR1O 5CMUA 4JTDB 4UFZA 1W2BU 4NXNB 1MSWD 3TXSA 4GX0A 1BE3H
chains in the Genus database with same CATH topology
1U97A 2LQTA 1Z2GA 2RN9A 2LGQA 1U96A 2RNBA 1HP8A 2HP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U97 A;  2LQT A;  1Z2G A;  2RN9 A;  2LGQ A;  1U96 A;  2RNB A;  1HP8 A;  2HP8 A; 
#chains in the Genus database with same CATH topology
 2Q7H A;  4GX2 A;  1R3J C;  4LC1 A;  4UV9 A;  1SQQ H;  1AIL A;  3BFR A;  4UV8 A;  2IJK A;  1QLE C;  2FB5 A;  3RVY A;  3STZ C;  5JVD A;  4HAM A;  1GM9 A;  3JCZ A;  2HP8 A;  1SZX A;  5EBL C;  2CTP A;  3G71 V;  2WLM A;  2QWP B;  4O4H B;  5LXT A;  5GON A;  3AG2 B;  3WFV A;  3TET A;  3OAA G;  5KA5 A;  2YDE A;  3ABK C;  1GN4 A;  4MW3 A;  2QTO A;  3SYP A;  5KHI A;  2EIK B;  4J42 A;  1XBL A;  2LGQ A;  1MAB G;  2VQE B;  5IJ9 B;  1SZT A;  1EBO A;  4YIO A;  4LF8 B;  3B8M A;  3T1Y B;  3UT5 A;  4QPK A;  1VF5 B;  3CRQ A;  3SPH A;  4LF5 O;  2ZE8 A;  1PNM A;  5C8Y A;  3J80 N;  4R7C A;  2IU0 A;  5ITZ B;  4A5U B;  5L3C A;  1BQZ A;  4ZOL B;  4JYA O;  5J2T A;  4LF8 O;  4H13 B;  1H2K A;  1VF6 C;  2V4D A;  2Q9L A;  1EN5 A;  4GKK O;  5LHI A;  1VQ6 V;  2QM4 A;  2EIJ C;  5JQG A;  3CD6 V;  3BRC A;  5LMN O;  1I94 O;  1BCC H;  1KEC A;  4WFH A;  2BE3 A;  4BWA A;  2UUA O;  4N23 A;  2Q68 A;  1IBM B;  2ITC C;  2LW1 A;  2QWO B;  1JVM A;  4PA6 A;  3E22 A;  1OCR C;  1U96 A;  3TK1 A;  1N32 B;  1WP8 A;  4U7O A;  1R3I C;  5L3B A;  4W4K A;  4YJ3 A;  1SF9 A;  4I0X B;  2Q69 A;  4DV0 B;  1VQ8 V;  1SQP H;  1ZSP A;  4DO2 A;  2R70 A;  3B09 A;  5LOV B;  4LWS A;  3B2E E;  3H1J H;  1MA1 A;  1VQ9 V;  4K3A A;  4JI6 O;  4FLV A;  3RYH B;  1XI1 A;  2P5O A;  3EHB B;  1HW7 A;  1Y74 B;  3AG4 B;  2ZNJ A;  1HNX B;  1FXV A;  3CCE V;  2HJF C;  1E1Q G;  5IYZ A;  5CBF A;  3JAL B;  4PA9 A;  3RYC B;  1HNZ O;  3OFN G;  4O4I A;  4CC5 A;  2LO1 A;  3ZRV A;  4PEL A;  5LP6 B;  4JPR A;  4PA4 A;  3JAW B;  1GH6 A;  3AG3 B;  1GK9 A;  1S3J A;  4X1I A;  1SQF A;  1AB3 A;  1XMQ B;  2R9A A;  2F23 A;  4KP4 A;  5LYJ B;  1FD9 A;  2OCH A;  2B5U A;  2CAZ C;  1PNL A;  3CJH B;  4X1Y A;  3ZRW A;  3IC9 A;  4FPP A;  4KHP B;  2KG7 B;  1CEZ A;  2PF4 E;  5LA6 A;  1Y74 A;  1I08 A;  4DUY O;  4DR5 B;  2DE0 X;  5IYB O;  1YEW A;  1BHA A;  5JCO C;  2VQF B;  4JI0 O;  3OD4 A;  4PI2 A;  4MVQ A;  5J2U A;  2ZE6 A;  4B3M O;  1CXZ B;  2WLH A;  4GKJ O;  4JAV A;  2F95 B;  4OX9 B;  1H8H G;  4DR5 O;  4X8A A;  4I9W A;  3WG7 C;  4DW1 A;  4JI8 B;  3JYC A;  4X88 A;  1VQ7 V;  1GN6 A;  2ZCE A;  5KX5 A;  4EFE A;  1RM1 B;  2A06 H;  1XNQ O;  3G6E V;  5B1O A;  4NYK A;  3I5D A;  4RUF A;  2ZIN A;  4ZI7 B;  2E3C A;  3I55 V;  4I50 B;  1QU7 A;  2VRZ A;  2Q8V A;  5D5P A;  4UB8 Z;  3BCC H;  1RPO A;  3GB7 C;  3CXC U;  4CS4 A;  1M56 C;  2IH1 C;  2MK3 A;  3BVO A;  1AR5 A;  1XQ8 A;  1G4Y B;  4QGP A;  3F7V C;  3K57 A;  2YEV B;  4X20 A;  2P67 A;  3K79 A;  4I5S A;  2PGG A;  5LL6 Y;  4JI2 O;  3QTC A;  1NH2 D;  4ABM A;  2WLN A;  1AJN A;  2QGN A;  4WF9 V;  1HDJ A;  1FYJ A;  2YEV A;  4FLY A;  1JA8 A;  1Q8I A;  4CH5 A;  4LF6 B;  2XAF A;  5H5N A;  4FM0 A;  4X1K A;  5EIB C;  1S5L Z;  2H8P C;  1P49 A;  1QNM A;  4IL6 Z;  4QJF B;  3HKC B;  5CA3 A;  5KUK A;  1AI5 A;  5LXT B;  3ZHT A;  4ICG A;  3CRA A;  4MVZ A;  3E8B A;  3FAV A;  3ASO B;  1AP5 A;  3BA9 A;  1JX9 A;  1P7B A;  4J11 A;  4X66 O;  2Z0A A;  2NNU A;  2RCV A;  1S5H C;  4I4T A;  1GTO A;  5CA0 A;  3HKB B;  4DV2 O;  2QE7 G;  1JFF A;  3L9D A;  2E5L B;  4J80 A;  2C2A A;  3R66 A;  1N0J A;  1NJI W;  2ITD C;  1IDS A;  4JYA B;  4PI0 A;  3L72 H;  3RYI A;  1VQK V;  4JI3 O;  3F7Y C;  3KZI Z;  1VP7 A;  3ZX6 A;  3BA8 A;  1M90 W;  2E5L O;  4DR2 B;  2RDC A;  2EIL C;  3ZBH A;  3ETD A;  1ENV A;  3JCU Z;  1LUW A;  3ABM B;  4R6Z A;  2P6J A;  4YJ3 B;  4DUZ B;  2WLI A;  1Q7Y W;  1W59 A;  3HKB A;  4FFB A;  2FKX A;  1VF7 A;  3ZCC A;  1H2M A;  2A9H A;  4X62 O;  1OCO C;  5K1X A;  3FKS G;  2CGN A;  2ETN A;  2YSU B;  2FTK A;  2ILM A;  3ABL C;  5BR8 B;  3AK2 A;  3GWO A;  3T1H O;  2YIB A;  3VQY A;  1UPG A;  2JGD A;  4P2Z A;  3U10 A;  1BSM A;  3AG4 C;  4JI4 O;  3CCM V;  4PD4 F;  4OPH A;  1HNW O;  2DWD C;  3D3I A;  1YJW V;  4NXN O;  2IH3 C;  1FXK C;  3U0Z A;  2VWK A;  4UCT A;  2BSK B;  2LP7 A;  3KCY A;  2W6I G;  4J9Y B;  4Z1V A;  3F5W C;  3CRC A;  3ZRS A;  4DR6 O;  1EN4 A;  3RT3 C;  2JS5 A;  4O4H A;  1TUB B;  4GZR B;  4B08 A;  3ZHV A;  3ZS8 C;  3OGI B;  4AQY B;  2Y0P A;  1TUE B;  4DRX B;  3CWB H;  2BTQ A;  1JFF B;  1SQX H;  3SJB C;  3CS5 A;  1KKD A;  2YUA A;  4NTW A;  1GN2 A;  1QVG U;  1K5S A;  1Q90 D;  1N32 O;  3OGC C;  5IWA O;  4XDJ A;  1WB8 A;  4W4L A;  1Z5V A;  2FYU H;  2AZ0 A;  4CH6 A;  2YC0 A;  4NVP A;  4MVO A;  5KA6 A;  5KHK A;  2D2C B;  4FIP C;  3CXH F;  2VQF O;  1NH2 B;  3HKD A;  5BXZ A;  2JJ1 G;  1K97 A;  4BIZ A;  2QM8 A;  1K33 A;  2Z5U A;  1LNQ A;  4B7E A;  1AJQ A;  1ZTE A;  3JAR B;  4JAS A;  2E74 B;  3LSQ A;  3UO2 A;  4GUN A;  2AZ2 A;  2F66 C;  5E1A C;  2NN4 A;  4PDM A;  2EBO A;  4HNA B;  2R72 A;  1R6K A;  2UXC B;  1BQ0 A;  2EIK C;  3IFX A;  4O4J B;  2H94 A;  5IY5 C;  2UUA B;  3K0G A;  3RYF A;  2QKC A;  1F4M A;  3M8A A;  1FFX A;  3P32 A;  3AG2 C;  1NR7 A;  2WWW A;  4UVC A;  3KKY A;  1JPX A;  3A0H Z;  2CTW A;  1WP7 A;  2BOC C;  2HFE C;  2V1D A;  4LH7 A;  2QJ1 A;  3BPZ A;  2UUB O;  1QLE B;  4MT8 A;  3JD2 A;  5BZB A;  2A7W A;  5KMG A;  3SJA C;  1SRY A;  2Y48 A;  2HHH O;  4UUJ C;  4IIJ B;  2GTA A;  4P9O A;  5JJE B;  1COW G;  1Q3E A;  3BEH A;  4C7U A;  2KQX A;  5F2V O;  4JV5 O;  1S0V A;  3N2K B;  3APQ A;  1JJ2 U;  2KKW A;  4TV9 B;  1UJW B;  1G6U A;  3RYH A;  1NTM H;  4UCU A;  5J9P C;  1VQO V;  4FJC C;  1YTF D;  3J7A U;  2ZXW B;  5FPR A;  1OHH G;  4O2B A;  3X2Q C;  4K8X A;  3OW2 U;  3QF7 A;  4I55 A;  4JAU A;  1PP9 H;  1Y76 A;  1WPX A;  4PA7 A;  3OTO B;  2EIM B;  3RN4 A;  3ZHR A;  3DXR A;  3Q4H B;  5FNV B;  4G2K A;  4DR4 B;  4DR7 B;  2QSA A;  1YZB A;  4EKW A;  1N36 O;  1SKV A;  4FMT A;  4J10 A;  3N2G A;  1T5E A;  2BTO A;  1WJZ A;  4DUY B;  2HVK C;  4X1I B;  2LW7 A;  1YDX A;  1RM1 C;  1XUQ A;  2EIN C;  1D5N A;  1O9H A;  3S3W A;  3D8C A;  5JCO A;  2AW9 A;  1AI7 A;  1R1B A;  3IJ4 A;  3SPG A;  4EB6 A;  3L71 H;  2V7Q G;  5AG2 A;  1K8A W;  2E76 B;  3CME V;  3SJQ C;  3DTU B;  4ASU G;  4L87 A;  1G8M A;  1S72 V;  1SA0 A;  4DV6 B;  2W0X A;  3ZMV A;  5L3E A;  3RWR D;  5CA1 B;  2DMX A;  3TJT A;  5LMU O;  2JGU A;  2QWN B;  1SS3 A;  4GCZ A;  1ZUQ A;  2YIC A;  1SQG A;  2N04 A;  2EIN B;  3CEI A;  3ZHQ A;  1URF A;  3H9V A;  4U3F H;  5A9G A;  5B3S B;  2Y4T A;  2GTS A;  1JJO A;  2K1E A;  3SYO A;  1AVM A;  4JZ2 A;  1X59 A;  3VQV A;  4FM1 A;  4X65 B;  4UCS A;  1TAE A;  2WAM A;  1OCZ C;  3NXS A;  2WLL B;  1BGY H;  3E8G A;  4DR3 O;  2YI9 A;  2QEX V;  2OT5 A;  2CTQ A;  4FLU A;  4JYB A;  5K1P A;  2CTR A;  3LUT B;  3PJS K;  4LF5 B;  4ZHQ B;  1UFI A;  3LDE A;  5CBG A;  2Q73 A;  3HKE B;  2AHZ A;  1D5A A;  5EZY B;  5FL7 G;  1KB9 F;  5FNV A;  3WB0 A;  4AQY O;  3TCU A;  4XDL A;  3RBZ A;  4ZHQ A;  2DW4 A;  3P3P A;  2ZXW C;  4LFA O;  5BMV A;  2CDY A;  2X6C A;  4YIP A;  4Z2W A;  3GVM A;  3LNN A;  5FPO A;  3JAW A;  5EYP A;  5CA1 A;  2A79 B;  3FYE B;  3B77 A;  1AI6 A;  4NTX A;  1AP6 A;  1ROP A;  2ZM6 O;  3VBB A;  3A0B Z;  1KC8 W;  2BSK A;  1WN7 A;  4MVR A;  3JAL A;  3AG7 A;  4WFA V;  1KYO F;  4MW8 A;  1ZAU A;  4ZOL A;  1OCC B;  1RFY A;  4LP8 A;  4LFB B;  1Y76 B;  2ATK C;  1R3L C;  3VOU A;  2IBZ H;  2R9R B;  3TGU H;  2IU3 A;  1PL0 A;  2DYS B;  4CBC A;  1JR9 A;  1O9G A;  4I0X A;  2E75 B;  2ZQM A;  1QHT A;  1NVP B;  3WU2 Z;  1IZ3 A;  1PV0 A;  4LF4 B;  4X89 A;  1SA0 B;  5B1N A;  5IY5 B;  3JAK B;  1R6T A;  2ZDI C;  1S76 D;  3CCJ V;  1NTZ H;  5IYC O;  2NLJ C;  2Q0O C;  4OGQ B;  4JI1 B;  4O2A A;  3OMI B;  4J41 A;  1NBM G;  4B3T B;  5H2F Z;  5KUM A;  2EZO A;  2YXL A;  1EFR G;  4BW5 A;  1FXK A;  1M93 A;  3H01 A;  2ZR2 A;  2UUB B;  3K59 A;  2LFR A;  1IBK O;  1GAX A;  2XTA A;  1ZX3 A;  4JI4 B;  5HFM A;  2XHB A;  2OWO A;  3K06 A;  2EX3 A;  2HG5 C;  2NR5 A;  1Y4M A;  2UXD O;  1IBK B;  3ABU A;  4JI0 B;  5ITZ A;  3ZIA G;  3G67 A;  4MVM A;  3W7T A;  3JD0 A;  1XL6 A;  1K3E A;  5L3D A;  1R6N A;  1XL4 A;  1QLN A;  4EFB A;  3E86 A;  3RYI B;  5H6R A;  1XDC A;  4X9Q A;  4JF3 A;  3SYC A;  4DW0 A;  1V9P A;  3JD4 A;  5DEC A;  1Z2G A;  3ZJZ A;  4GX5 A;  5KHG A;  4Q20 A;  1NVP D;  5B5E Z;  5IYZ B;  4TWK A;  3G4S V;  2DN9 A;  3E2E A;  3ZMU A;  3ETG A;  2GUZ B;  1NZ6 A;  1XIL A;  2BCC H;  3TXQ A;  2QM7 A;  1N34 B;  4JI7 B;  2QWQ B;  1E79 G;  1FXK B;  2UXB B;  1YTF B;  1MG1 A;  1VMG A;  3H1H H;  3ABL B;  1HP8 A;  3JAK A;  3K5O A;  4D7S A;  4I7Z B;  2ARH A;  1IUR A;  2F43 G;  2CH7 A;  3CCL V;  1EM1 A;  4LF9 O;  4LFC O;  1OJH A;  2JVD A;  4XDK A;  4TV8 B;  2VQE O;  1BL8 A;  1SES A;  1DF4 A;  1U97 A;  3K5L A;  3JAS B;  4HNA A;  5GW7 A;  3ABM C;  1XNR B;  3N27 A;  4DV3 O;  3T4D A;  4LNU B;  1I0H A;  4LFC B;  4LF9 B;  3E8F A;  1W0K G;  5B3S C;  3C3S A;  2EIL B;  4NR1 A;  4QE7 A;  4PDR A;  3AEI A;  1K73 W;  2RMK B;  2QDO A;  4GKK B;  4P30 A;  2YIB D;  5LMN B;  1I94 B;  3CCQ V;  1N36 B;  1E1R G;  3CJH A;  4X1Y B;  2ZDI A;  4PDV A;  1M1K W;  4ZKI A;  4UCO A;  4BIU A;  3MHH C;  1DGS A;  1Y67 A;  1HR0 O;  1AJP A;  3CCV V;  2B1I A;  1N33 O;  2LJ2 A;  5FLX N;  2JK5 C;  3FD9 A;  1NU1 H;  1Z5W A;  4KHP O;  1V54 C;  3OMA B;  5GTI Z;  4WBN B;  4JZG A;  1MOF A;  1Y66 A;  3AG1 C;  2Y4U A;  2EJR A;  1CP9 A;  2F4V B;  3RYF B;  5C8Y B;  2JS3 A;  4YY3 O;  1SET A;  2IM9 A;  2Y0I A;  2GBO A;  1RPR A;  2EIM C;  4JI8 O;  2JJ2 G;  1XMO B;  1N0N A;  3LDC A;  2EUL A;  3QO5 A;  4LF6 O;  5EC1 C;  2WA3 A;  4G28 B;  4QE9 A;  3FFQ A;  2FL4 A;  4QPJ A;  1FFX B;  3OT7 A;  5EBW C;  5EK0 A;  3DC6 A;  4NTY A;  4MTO A;  3HKE A;  3W7S A;  4O2B B;  3ZN0 A;  4K0K B;  2CGO A;  3RVZ A;  3BY6 A;  3E22 B;  2RNB A;  5HFL A;  1XMQ O;  1IXB A;  1K92 A;  1ZWI C;  2LGW A;  2GUZ A;  3SPI A;  1V55 B;  4YHH B;  4HBN A;  4DK0 A;  1IBL O;  3CC4 V;  2OTJ V;  3E83 A;  2PYJ A;  3K58 A;  4LCU C;  4CC6 A;  4FZ1 A;  2XAJ A;  2ZE5 A;  3RFR A;  3AG1 B;  1WA8 A;  4FVM A;  3LNM B;  4LNU A;  4DV1 B;  3ASN B;  4JI2 B;  2JIZ G;  5E79 Z;  3KCX A;  2XND G;  3A2F A;  2X7R B;  4JI1 O;  3CHX A;  1FFT B;  3IAY A;  1NKD A;  1GO3 F;  1YF2 A;  1IXM A;  5KHJ A;  5CN0 A;  4DR2 O;  1N4C A;  2ZKO A;  4IIJ A;  1XNQ B;  4WFF A;  1BHB A;  2OTL V;  3UO3 A;  3HKD B;  4FLT A;  1L1F A;  1K9M W;  1W0J G;  2M7W A;  4LBE C;  3IGA C;  2QTS A;  5EYP B;  4U3J A;  2VS0 A;  2H3O A;  3CC2 V;  3T1H B;  2PI4 A;  1H38 A;  1LUV A;  4MS2 A;  4PHZ A;  4UB6 Z;  1AR4 A;  3OMN B;  2RQ6 A;  2UU9 O;  1TVK A;  3CC7 V;  1B3Q A;  3STL C;  2F1M A;  2BTQ B;  1H2N A;  1Q81 W;  2RJZ A;  5GON B;  3SGI A;  4UCV A;  3EVK A;  3LDD A;  2DOS A;  4NB5 A;  3ZMT A;  1RSO B;  4JI3 B;  2XAG A;  2OCC B;  4UCR A;  1NT2 B;  4WFB V;  3E35 A;  1LR1 A;  3C3T A;  1KKC A;  1X4T A;  3ETE A;  3M99 B;  1G1X B;  3FB6 C;  2L35 A;  4BIO A;  2W6J G;  1S5J A;  1JCH A;  4FFB B;  1PKX A;  1M5I A;  1BMF G;  3DXR B;  3Q4H A;  4GYC B;  3W7X A;  2UXB O;  1MSD A;  3CPW U;  4JTA B;  1P84 F;  3I56 V;  2PUS A;  4YJ2 B;  3DSQ A;  4XBF A;  2JGD B;  2DQ0 A;  1KP2 A;  5IWA B;  2AHY A;  4I55 B;  1Q82 W;  3T2M A;  1OCR B;  1IBM O;  3MD0 A;  3FAV B;  4TQD A;  1QQC A;  2QR4 A;  5TIS Z;  3LSS A;  4DV7 B;  3E8H A;  2L6L A;  2XAQ A;  1ZLZ A;  3C90 A;  2O57 A;  3UM7 A;  5CB4 B;  1JMK C;  4JGS A;  2X6B A;  3JSN A;  5C93 A;  2PI5 A;  1OCO B;  2WLK A;  3B4S A;  4I50 A;  1QR8 A;  2GSM B;  2ZIM A;  3LSU A;  4IHJ A;  2OYQ A;  4DR1 B;  5EIB D;  2UUC O;  1SQV H;  4JI6 B;  2IJI A;  2P90 A;  3QG5 A;  4TV9 A;  3IC7 A;  1GRJ A;  3B8N A;  1PPJ H;  4O2A B;  1HNZ B;  2YS8 A;  5J2T B;  1R3K C;  4NXM O;  4DV5 O;  1J95 A;  2AXT Z;  2HVJ C;  2LQT A;  1M4U A;  1SQB H;  1NTK H;  1VIB A;  2YIA A;  1I7F A;  1K4C C;  4DK1 A;  5DED A;  4Z1M G;  1XNR O;  2B1G A;  4DV3 B;  2XAH A;  2GHY A;  4BR6 A;  5LP6 A;  4NKG B;  2HHH B;  4MTG A;  3HPL C;  4O4L B;  3ASO C;  5CBH A;  3SPC A;  1OCC C;  4JYY A;  4X64 O;  4B3M B;  2Q7G A;  3ZRW B;  1TA8 A;  3T1C A;  4DR6 B;  3CCS V;  4DV4 O;  4DV6 O;  1RP3 B;  4GX1 A;  3K5N A;  1JQ0 A;  2UXC O;  2P22 C;  4I9Q A;  1TUB A;  4B3R B;  1N34 O;  2YXY A;  1H2S B;  1YJN V;  1HNX O;  3RGB A;  4CS2 A;  5EBM C;  4TT3 G;  1DF5 A;  1JOY A;  3R65 A;  4ZBM A;  4DR4 O;  1DLB A;  5KMG B;  2HR3 A;  1SER A;  3OE7 G;  3AK3 A;  2XUM A;  1NQT A;  4K35 A;  4FLX A;  2QKA A;  3GWK C;  3APO A;  2VWJ A;  4LF7 B;  4HYO A;  5CB4 A;  3K08 A;  1F4N A;  4H44 B;  3SDL A;  2WPD G;  5B1B C;  4DV0 O;  4TV8 A;  1TGO A;  4UXN A;  3CE2 A;  3ZED A;  2ZR3 A;  3W7U A;  3RYC A;  2OCC C;  3E89 A;  2MW2 B;  4JTC B;  4KUM A;  1VQ5 V;  3L74 H;  2Y69 C;  3VQW A;  5LGN A;  4YJ2 A;  3SYQ A;  5J2U B;  4WFE A;  1D2D A;  1Q86 W;  3G80 A;  5L3G A;  3FYI B;  4P9P A;  4YXW G;  5CA0 B;  4O4L A;  2WSS G;  2X0L A;  4UVB A;  2DYR B;  4H33 A;  5JJN B;  1EZJ A;  4IT5 A;  1YSC A;  4DRX A;  4TSF G;  1YHQ V;  2DYR C;  1H2L A;  1GKF A;  1FS0 G;  3CP1 A;  4GT1 A;  3OTF A;  4E4E A;  3UCS C;  4TOI A;  2XAS A;  3F5T A;  3HR0 A;  4FZ0 A;  3H1L H;  2P06 A;  1VQL V;  3ICX A;  5B1A B;  4U3J B;  3MAQ A;  2CE4 A;  2HLD G;  3CRR A;  5LP6 C;  3ZHU A;  1KMI Z;  4X20 B;  4OPA A;  3SJC C;  4MVU A;  1L0N H;  1KQS U;  4BAY A;  3K9A A;  3VQX A;  3JAR A;  1F51 A;  4RQF A;  1A32 A;  4UVA A;  1V55 C;  1YCI A;  3X2Q B;  3SR2 C;  3FB8 C;  4LR3 A;  5KX5 B;  4QNH B;  2ADQ B;  3K04 A;  1AI4 A;  5IT9 N;  5KHH A;  2CH7 B;  1QVF U;  4DR7 O;  4J9Z B;  3NR7 A;  3H1I H;  3K3W A;  4EB6 B;  5LYJ A;  3L75 H;  2R9I A;  1BT8 A;  1CPY A;  1M56 B;  1F7Y A;  5IYD O;  5LOV A;  4MTF A;  4FFK A;  1RSO A;  1B04 A;  4WCE V;  5IJ9 A;  5DM6 V;  4U7N A;  1GN3 A;  5JJJ B;  3HB3 B;  1J5E O;  4CH4 A;  5B1A C;  3JSL A;  3K9S A;  5JH7 B;  4OX9 O;  2EIJ B;  1XOU A;  5KLV H;  1V54 B;  5H9C A;  2WLL A;  2PTM A;  4JI7 O;  4JI5 B;  3WG7 B;  1Q43 A;  4PA3 A;  1YIJ V;  2ZNI A;  1KUQ A;  1QBZ A;  2Q7E A;  4N21 A;  2N05 A;  2B9Z A;  2P4K A;  3M7M X;  1TVK B;  3G6B A;  3DC5 A;  1NS1 A;  1WB7 A;  5DN6 G;  1QCE A;  2QA4 V;  4K8Z A;  1YXB A;  3OM3 B;  5LA6 B;  3CMA V;  1YJ9 V;  4JI5 O;  1VQP V;  1VEW A;  2UU9 B;  3BAA A;  3K03 A;  4X62 B;  4CS3 A;  4J7Z A;  2GV9 A;  4KXR A;  5JH7 A;  5BMV B;  2EJ7 A;  1GM7 A;  2BOB C;  4QIW F;  2JDI G;  3ZHS A;  4R8C A;  2Y69 B;  3QVN A;  2ODM A;  3ABK B;  3SPJ A;  1HNW B;  1AR1 B;  4DV4 B;  3AG3 C;  3FX7 A;  4FK5 C;  2JEX A;  3W7W A;  1I5X A;  1I5Y A;  3CB2 A;  3H1K H;  4B3T O;  5IDJ A;  5B1B B;  4RWU A;  3QO8 A;  4B7K A;  1VF6 A;  4DV5 B;  2YI8 A;  2LFS A;  3OEH G;  2ZM6 B;  1WNS A;  1K4D C;  2Q5Z A;  5BY1 A;  3QO7 A;  2HJD A;  3EXA A;  2Q67 A;  2YID A;  1M9N A;  4KFM A;  2P4V A;  2PYL A;  2PZS A;  4DV7 O;  3JAT B;  3CCU V;  1FJG O;  1GM8 A;  4LF7 O;  4RAI A;  2Q0A A;  3MDS A;  2WA4 A;  4R50 A;  1PL4 A;  3FB5 C;  1H2G A;  5LHG A;  2W0F C;  1M57 C;  3L70 H;  1YIT V;  2EZP A;  4MTX A;  4D7T A;  2A3Q A;  4RO2 A;  2F4V O;  1FJG B;  1ORQ C;  2K9P A;  2YXH A;  2OIG A;  3ZMZ A;  4LWS B;  4L8J A;  5JVD B;  3RW0 A;  4AI8 A;  5D5Q A;  1ARO P;  5GTH Z;  4LF4 O;  2JEU A;  1FKA O;  1OV9 A;  4F6R A;  3ABT A;  1KD1 W;  3T1Y O;  5L3F A;  1BZK A;  3CYO A;  1B06 A;  4IYI A;  4ZI7 A;  2PY5 A;  1PNK A;  1KU9 A;  4NXM B;  1FAF A;  4TUY B;  1VQM V;  1XRE A;  1P7G A;  4DUZ O;  3PN1 A;  1NR1 A;  2ZE7 A;  2QKS A;  5EC2 C;  1N33 B;  3BAB A;  3K0D A;  1YVW A;  1KBH A;  4ZIB A;  4PJ0 Z;  1IBL B;  2IJH A;  4FLW A;  3UKM A;  3DGE A;  5H6Q A;  2DJV A;  1L0L H;  1EZV H;  4F6E A;  5BR8 O;  2UXN A;  4B3S B;  2ZIO A;  2Q4P A;  1BS3 A;  1OZ0 A;  1Q5O A;  3FB7 C;  2IW5 A;  4X64 B;  2AGA A;  3T4Z A;  3J81 N;  4YY3 B;  1DTO A;  1DK1 A;  1US6 A;  1HWY A;  1MZE A;  4H37 A;  1SC5 B;  3WB2 A;  4BW9 A;  4TQF A;  3OUF A;  5IE9 A;  1WLE A;  4PDL A;  3U11 A;  4B3R O;  4B3S O;  3HKC A;  2KG7 A;  2F93 B;  2ZD9 A;  1XMO O;  2DYS C;  3D36 A;  4F6R B;  3ZRX A;  4E2L A;  4MVS A;  4GKJ B;  5KAI Z;  2HKO A;  3ASN C;  3BHP A;  4CH3 A;  3K5M A;  4RUE A;  2G38 A;  1XEQ A;  3JAM N;  5LGT A;  3OR7 C;  4O4J A;  4HZ3 A;  4TUY A;  1PD3 A;  1FXH A;  1HR0 B;  2DQ3 A;  2P7T C;  2RN9 A;  2N74 A;  4GLX A;  5A2Q N;  3AK1 A;  3N2G B;  4WBN A;  3THO A;  4YHH O;  4X65 O;  1EN6 A;  4FM2 A;  1GMG A;  2ADP A;  2CUG A;  2IJJ A;  4DR3 B;  1NI8 A;  4DV1 O;  5KAF Z;  1N8R W;  3P30 A;  1F23 A;  4OXS A;  2UXX A;  4J7K A;  1MZF A;  3JD3 A;  3MHS C;  2WLJ A;  4JV5 B;  3QNE A;  1Q6H A;  2DWE C;  2HEP A;  3O65 A;  1XHX A;  3OUS A;  4X1K B;  4DXW A;  1H8E G;  1S77 D;  1Y6X A;  4MSW C;  1VQN V;  1P4R A;  5B66 Z;  1OCZ B;  1K34 A;  1MMM A;  4K0K O;  2ZT9 B;  5IJ0 A;  3CRM A;  1Q6I A;  3CSX A;  5LBQ A;  2XT9 A;  3A0R A;  3EFF K;  4D6T H;  4IYH A;  1WA8 B;  3SYA A;  2KSD A;  1QR9 A;  1PM9 A;  3KG2 A;  4I4T B;  1IVS A;  3JAT A;  3ZN1 A;  4IGG A;  4LFB O;  1KP3 A;  4KL1 A;  2FML A;  1J5E B;  3A8T A;  5EZY A;  2Z3Y A;  3OR6 C;  2M6Y A;  1K7D A;  4LH6 A;  3P3N A;  3CCR V;  4X66 B;  2GDS A;  3B40 A;  4DV2 B;  1FPO A;  5IJ0 B;  2UUC B;  4JAA A;  3N2K A;  1ZL8 B;  4AIL C;  3WB1 A;  4RQE A;  4PV1 B;  4O4I B;  2CK3 G;  4AHC A;  2KB1 A;  3ETQ A;  4LFA B;  5JWP A;  5LMU B;  1ZL8 A;  1WPB A;  2A0L A;  3D3Q A;  4F4L A;  4WFG A;  1VQ4 V;  5LHH A;  4H0L B;  1VAR A;  3ZMS A;  4Q6G A;  3CX5 F;  3JD1 A;  3O9O A;  1YI2 V;  3D36 C;  5JQG B;  3OTO O;  1Q6U A;  3L73 H;  4IHJ B;  3JAS A;  4EEQ A;  3OEE G;  2JRI A;  2XOK G;  4J7J A;  1MNG A;  1L8D A;  1IX9 A;  1R73 A;  4FLZ A;  3ML0 A;  1THZ A;  2WLI B;  5LGU A;  1K5Q A;  3UQ8 A;  2QWR B;  4DYL A;  1B6Q A;  1WAZ A;  4G27 B;  4JYC A;  4CZZ A;  2UXD B;  1M57 B;  3UT5 B;  2D3O W;  3S3X A;  2OIE A;  1XHZ A;  2X6A A;  2Q6A A;  4DR1 O;  5CMU A;  4JTD B;  4UFZ A;  1W2B U;  4NXN B;  1MSW D;  3TXS A;  4GX0 A;  1BE3 H; 
#chains in the Genus database with same CATH homology
 1U97 A;  2LQT A;  1Z2G A;  2RN9 A;  2LGQ A;  1U96 A;  2RNB A;  1HP8 A;  2HP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...