1U97A

Solution structure of apo yeast cox17
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
69
structure length
69
Chain Sequence
MTETDKKQEQENHAECEDKPKPCCVCKPEKEERDTCILFNGQDSEKCKEFIEKYKECMKGYGFEVPSAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase copper chaperone
publication title Yeast cox17 solution structure and Copper(I) binding.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 12
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2004-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05051 COX17 Cytochrome C oxidase copper chaperone (COX17)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1130 Mainly Alpha Orthogonal Bundle Helix Hairpins CytochromE C oxidase copper chaperone 1u97A00
2LQTA 2RN9A 2HP8A 1Z2GA 1HP8A 2LGQA 1U97A 1U96A 2RNBA
chains in the Genus database with same CATH superfamily
5CA1B 1CP9A 1Q6UA 3E8BA 4LWSB 2DYRB 2EJRA 2X7RB 4R8CA 4JTDB 1I94O 4DV5B 1EN6A 4RWUA 3SYCA 5CBGA 1JCHA 3L75H 3SJBC 2WWWA 2GUZA 4O4IB 4WBNA 3DC5A 2A06H 3AK3A 5B66Z 4B3MB 2R72A 1XHXA 4ZOLA 3CMEV 2WPDG 1NTKH 1EFRG 4KHPB 3OUSA 2F95B 3ABLB 1R6NA 2LGWA 5LA6B 3HKEB 1QCEA 1M56B 3BRCA 2AHZA 5L3FA 2FMLA 5GONA 3SJAC 4PA4A 4MVQA 5JVDA 2QM4A 3BA8A 5LXTA 2Y4TA 3RW0A 4YY3O 1K5SA 4ZKIA 3ZMTA 4AI8A 2JGDB 1K7DA 2UXBO 1FFXA 5FPOA 2RMKB 3IGAC 3WFVA 3A0RA 3E8FA 4UFZA 4DR4B 3O9OA 3K5OA 4JYBA 1YHQV 3ZN0A 4U3FH 2ZR2A 2F23A 4FLWA 4L87A 4XDLA 2WLKA 4NXMB 4UCRA 1V54B 3P30A 3AG3C 3OD4A 1FJGB 4P9OA 3F5WC 5K1PA 3DXRB 1N36O 4LF6B 4WCEV 2VQFB 4OPHA 2QWRB 1D2DA 1YDXA 2D2CB 1N33B 1YEWA 5CA0A 5IYCO 1F23A 3JAWA 3GB7C 5IE9A 1NKDA 4DR6O 1AR1B 3RGBA 3JASA 2JVDA 3CRRA 2WSSG 1OCZB 2IJKA 4JI8B 3N27A 2YI8A 4JPRA 5LYJB 2CTQA 4LH6A 4ZI7A 4FZ0A 4UCTA 3L9DA 3JSLA 4QPKA 1Q90D 5CA1A 5FNVB 1KB9F 4X65O 3ABTA 1S76D 3H01A 2DW4A 4J9ZB 4O4IA 1K4CC 1KU9A 1Z2GA 2V1DA 3L73H 4JF3A 1DLBA 5KAIZ 2P90A 5JJEB 3PJSK 2X6AA 3B4SA 4PV1B 4JV5B 4LFAO 3ZJZA 2H94A 5LA6A 4PA3A 2Y48A 4AILC 1XMOB 3HKEA 2FTKA 3MD0A 1H2KA 1J5EO 2R9IA 4UVAA 1M90W 4NXNB 1JMKC 2YSUB 2F66C 2FB5A 3WU2Z 1AP5A 1DGSA 5IY5C 4CS4A 3K0GA 2AZ2A 3UQ8A 5KHGA 1AILA 2L6LA 4D7SA 2ZNIA 3KZIZ 4ZHQB 1NR1A 4LBEC 1T5EA 3C3SA 4DV4B 5B3SC 4X66B 2OTJV 1Q81W 3OGIB 2P6JA 2VRZA 2ZCEA 2JGDA 3X2QC 2OTLV 1AJPA 1D5NA 1QLEC 3FD9A 1JFFB 3AG7A 2OCCB 2G38A 3M7MX 3F5TA 3BVOA 3KKYA 1KKDA 4HYOA 3D3QA 3JATB 3ETQA 3TCUA 3CCSV 4I5SA 2UXNA 2QSAA 4PJ0Z 1ZX3A 5KX5A 2ZE8A 4TWKA 4LF4B 1L0LH 2K1EA 3Q4HB 5K1XA 1PM9A 3ZIAG 4OXSA 4WFEA 4J7ZA 4LF7O 3KCYA 1NJIW 4DR4O 3CHXA 3ZHVA 5IJ0A 1JA8A 1LUVA 2CGOA 1Q5OA 3H1LH 4TUYB 3BHPA 4H0LB 4NXMO 2GTAA 1VQKV 1NTMH 1H2GA 2Z3YA 5CMUA 5LHHA 2NLJC 5LYJA 2R70A 4LF6O 5L3GA 2GDSA 4GX2A 2IJIA 1E1RG 1WPXA 4XDKA 4H37A 5GTHZ 4X62B 1VQNV 5FNVA 1NTZH 1THZA 1BT8A 3QNEA 3N2GB 1UFIA 3THOA 5DM6V 2B5UA 4J7JA 4FIPC 4DR5O 2KSDA 2IJJA 3LUTB 4LF8B 2QTSA 4FLXA 4BR6A 4J41A 2A3QA 4FM2A 2PZSA 5ITZA 4HNAB 2HJFC 1YXBA 2UUBO 3AG4B 1IVSA 1WN7A 4G28B 1OCCC 1L8DA 1NR7A 4CBCA 2EIMB 2H3OA 4J11A 1YI2V 3G6BA 2PGGA 4JTCB 1KP3A 2QM7A 1AI5A 3ZCCA 5EC1C 4CS3A 1F4NA 2CTRA 1V55B 2BOCC 2Q68A 3K08A 2L35A 3T2MA 2QWNB 4DR1O 4JI0B 1YTFD 2WAMA 1ZSPA 3J80N 4B3TB 2ZIOA 1ORQC 2B9ZA 1IBMO 4HAMA 5CB4B 4PD4F 2DQ3A 4DR2B 4ZHQA 3S3XA 3SDLA 1JQ0A 4PDMA 3ZRWB 3OEHG 3CCEV 2XAGA 4H33A 2E75B 5KMGB 5B1BC 1XI1A 5D5PA 1URFA 1JFFA 4TT3G 1US6A 2B1IA 4I4TB 2VWKA 1XMQB 1BHAA 4X9QA 2ZXWC 4DV0O 3JATA 4OGQB 2P67A 3NR7A 1PNKA 1WA8B 4JI1O 3AK2A 4DRXB 4E4EA 1VF6C 5KUKA 4FLVA 2ADQB 4KXRA 2N04A 4X66O 4UUJC 4IYHA 3MAQA 2HG5C 1YSCA 4DV6B 1NVPD 1XDCA 4UV9A 3Q4HA 5LHGA 4LNUB 1UPGA 3CEIA 1IBKB 3A0HZ 2B1GA 2W0XA 1YJNV 3JD3A 1F4MA 5A2QN 4GX5A 5LMNB 1VQ8V 1WP7A 2ZR3A 1K5QA 4E2LA 4EEQA 2GUZB 4TUYA 4WFGA 2F4VB 2X0LA 4X64B 4DYLA 2QKCA 1M4UA 4GLXA 3E22B 2GV9A 5TISZ 2VQEB 1AJNA 1OHHG 4LF4O 4PDRA 2W6IG 2PYLA 5EK0A 4UVBA 2PI5A 1S72V 4YJ3B 1Y66A 3CPWU 3B8NA 4FM1A 1NI8A 1VQMV 3STLC 1GRJA 5L3BA 3RYIB 4LFCB 3VOUA 3HKCB 1XNQB 3ZHSA 1HNZO 3RYHB 5LOVB 2ZE5A 5GONB 2ZM6B 1WAZA 1OZ0A 1VQOV 1FXKB 3D3IA 4HNAA 5JVDB 4CZZA 4KL1A 3TJTA 4JZGA 4K8XA 3NXSA 3SYAA 1BCCH 1BL8A 2QKSA 2HP8A 2QWPB 1K97A 1QVFU 4UV8A 3QVNA 1B6QA 1OCZC 2DYSB 2DWDC 1GN3A 2IM9A 1N0NA 3K9AA 2EBOA 3ABKB 1PL0A 1QQCA 1AROP 2XT9A 4LF8O 1ROPA 2EX3A 1K34A 2ZT9B 3RN4A 3K58A 3FFQA 1HNXB 1VIBA 1IBLO 4K0KB 1VQ9V 1R1BA 3RFRA 4GUNA 3TETA 3QTCA 3G6EV 2IH3C 5CB4A 1NQTA 2R9RB 4GKJB 4DXWA 1GTOA 3E86A 4DV2B 1GM8A 1SC5B 4YHHO 1BMFG 5EC2C 2Y69C 3RVZA 3ZRWA 2P5OA 1PNLA 2JK5C 1SQFA 1I08A 1NS1A 5KMGA 5LP6C 3L71H 3ZMZA 2UUCB 4FLYA 4CH5A 4OX9B 4EFEA 3SPJA 1RP3B 3QF7A 1SA0B 3EHBB 3OFNG 3JASB 3WB2A 2VS0A 4AHCA 4MTXA 4K8ZA 1FXHA 1WA8A 3AG2B 3F7VC 4WFHA 3U10A 4DRXA 4W4LA 1YIJV 4K3AA 4CC6A 1SQGA 3CCRV 3ZRSA 3D36A 4I50B 4X89A 4LNUA 2Q4PA 1TUBB 2NR5A 1TGOA 4TV9B 3JD4A 1W0KG 5L3CA 1FS0G 3M99B 4KFMA 1KYOF 2PY5A 1SESA 3ZMUA 2CH7B 1MSDA 2LW1A 1QVGU 4JYYA 4JYAO 1AJQA 2QDOA 4C7UA 2ZE6A 1B04A 4YJ2A 3CCVV 2YEVB 4DV7O 1LUWA 3E22A 2XASA 1XREA 3T1HB 3S3WA 1N32B 3JYCA 2ZQMA 4YJ3A 1Q6HA 4IL6Z 4EFBA 2ZKOA 3UM7A 2WLIB 4B3RO 2Q6AA 3RYIA 4JI4B 1SZXA 2JS5A 2JEXA 5B1OA 3HKCA 3CXHF 3RYHA 1Q3EA 5LOVA 2X6BA 3E8HA 2F4VO 4GYCB 5JCOC 1DF4A 1FXKA 2YIDA 3E2EA 2YDEA 2Y0IA 5LHIA 5CN0A 3CC2V 1Q8IA 1QR8A 1M1KW 4EB6B 3ABUA 2YIBD 2QEXV 5DN6G 4Z2WA 3B2EE 1FYJA 3DSQA 1S77D 5BR8B 2UUAB 4O4JB 5CBHA 4U3JB 2EIJB 2OIGA 1W59A 1EZJA 1XNQO 2HKOA 4F4LA 2MW2B 1OCOB 2JJ2G 2ZM6O 4FFKA 2HFEC 1QU7A 4IGGA 3JCZA 1L0NH 2NN4A 1MG1A 2HR3A 5KX5B 2OYQA 2UU9B 2YUAA 1AR4A 1BGYH 3IJ4A 4X1YB 2ZIMA 5EIBC 5BY1A 4J9YB 1TA8A 3L74H 1L1FA 4HZ3A 1EM1A 3K9SA 1YJWV 4X1KB 2FL4A 1IX9A 3MDSA 1HP8A 5IJ0B 3SPCA 2W6JG 1H2SB 1SA0A 1ZUQA 1N0JA 3B77A 3JAMN 1PV0A 1SZTA 4FM0A 1Q43A 4LFBO 3C3TA 2RN9A 1Y6XA 1EN4A 5IWAB 4MTGA 4CC5A 3RT3C 1S0VA 3SJQC 4I50A 3LNNA 3CMAV 2XOKG 1TUBA 3R66A 2BTOA 2Q73A 1GM9A 4TV9A 2UXCB 3OTOB 3ZEDA 1VQ4V 1HR0O 2CH7A 3WG7C 4QE9A 3QO8A 1M57B 3P32A 5ITZB 4DUZB 1Q86W 2YEVA 1KECA 2GHYA 4G2KA 4DR7O 1O9HA 4BIZA 1P7GA 1HNWB 3HB3B 2ITDC 1AI4A 3ML0A 1GH6A 1VEWA 2ZE7A 4O2AA 4OPAA 1WP8A 1YJ9V 3CSXA 1VQ7V 4X20B 2CDYA 3ZN1A 2WLIA 4TOIA 2PTMA 4DV5O 1K9MW 2EULA 1Y67A 2GSMB 1NT2B 3EFFK 5H5NA 3FB7C 1FD9A 3MHHC 4ZIBA 4TQFA 2HJDA 4JI2B 3OTFA 1XHZA 2XHBA 3K5MA 4D6TH 4EB6A 3CB2A 4B3MO 3ZRXA 4KHPO 4FMTA 1PP9H 1JPXA 4DR3B 2VWJA 3CS5A 3W7WA 4O4JA 1P84F 4U3JA 2O57A 1Z5WA 3ABMC 2E5LB 1QNMA 3CRAA 2YI9A 2LJ2A 4GX1A 3G71V 1BQZA 3L72H 1OJHA 3JD1A 1IXMA 4LH7A 4LC1A 4MTFA 4UCUA 4X1YA 1MA1A 4NYKA 2EILC 3B09A 3T1YB 1RM1C 1MNGA 3H1KH 3VQWA 1SETA 2AW9A 4X1KA 2RDCA 2X6CA 2E3CA 1WNSA 4H13B 3RYCA 2DYSC 5EIBD 3K3WA 3EXAA 4AQYB 3JARB 1NU1H 4D7TA 3FAVB 4LF9B 4B3SB 3ABKC 1IDSA 3T4DA 1FJGO 5LGUA 3CD6V 2CE4A 3WB1A 1AI6A 2VQFO 3HPLC 1NBMG 1N33O 1AB3A 2Q67A 4PDLA 2XAJA 2AZ0A 5C93A 4JI6B 2Y0PA 3ICXA 3IC9A 3OR7C 3SR2C 5GTIZ 1UJWB 3BPZA 2ZD9A 4JI5B 3ZHQA 2HVJC 3I56V 3W7XA 4FJCC 1MMMA 2PUSA 4JI8O 3CRQA 2CK3G 3QO5A 4B7EA 1CXZB 3FYIB 2UXDB 5EBWC 1VQ5V 3RBZA 2Q0OC 3ASOC 5C8YB 3AG3B 4DW1A 4X88A 1N34B 1N4CA 1Y4MA 5FL7G 4DW0A 4R50A 2D3OW 4R7CA 4X20A 1BQ0A 2LW7A 3K79A 4DV1B 2DMXA 1VARA 5H2FZ 4CS2A 2EINB 2QTOA 5DECA 2Q5ZA 4JYCA 4O2BB 5LMUB 2DYRC 1LNQA 1XBLA 2F93B 4WF9V 4BIUA 1FKAO 1JVMA 1HNWO 1M93A 4A5UB 2E74B 2JGUA 3H9VA 1TVKB 4DUYB 1JX9A 3FX7A 4JV5O 4LP8A 1HDJA 1XL4A 1YF2A 3CCLV 1XMOO 4N23A 3G80A 4NXNO 3ASNB 3CRMA 3OW2U 2A0LA 3ABLC 4O4HB 1RSOB 2IJHA 2QR4A 2FYUH 1SQQH 3T1CA 1B3QA 2WLLA 1R3KC 3D8CA 3UO3A 4JAUA 4DV4O 1S5LZ 1M56C 3W7TA 3J81N 2PYJA 2QGNA 2ODMA 5CA3A 1R6TA 1I94B 1I0HA 1SERA 2JRIA 3CJHB 1K92A 1FAFA 3CE2A 1YTFB 5FLXN 3CYOA 4GZRB 2YXLA 2YIAA 3OT7A 1X4TA 4FLTA 1COWG 3UT5B 1K3EA 3JARA 2M6YA 4YJ2B 3K5LA 4Q6GA 3FAVA 1R73A 3LNMB 4PI2A 1FPOA 3HR0A 4DK1A 5IY5B 4MVUA 2XUMA 3K0DA 4MS2A 2BE3A 5JQGB 4K35A 5KAFZ 4DV3B 2WA3A 2UXXA 4MW8A 4PA9A 5B1AB 2CUGA 1GN6A 3LSQA 1V54C 2ZDIA 3ZBHA 4RO2A 5H6RA 1GN4A 4P9PA 4PHZA 1AP6A 4FLZA 2LP7A 2C2AA 3DTUB 3FKSG 1VMGA 2Q7EA 2UXBB 2EJ7A 2DWEC 1KUQA 1NVPB 5KHJA 3UKMA 1R3JC 3CCQV 1R3IC 3J7AU 3JD0A 1H2LA 5C8YA 3SJCC 3HKDA 3HKBA 3H1IH 4L8JA 1H8EG 4X62O 4RQEA 4MVRA 4XBFA 4NTYA 4JI6O 2P22C 1ENVA 3K5NA 3APOA 4P2ZA 3GWKC 1GKFA 1YVWA 4LF5B 2IU0A 4WFAV 3DGEA 3LDEA 4O2BA 1I5XA 3CXCU 2IU3A 5IJ9A 2Z5UA 3MHSC 2A79B 1NH2D 4FFBB 1G4YB 1VP7A 3ZHRA 1N34O 1F51A 1R6KA 1TVKA 1AVMA 1GO3F 4IIJB 2CTPA 4DR6B 2ADPA 3QO7A 4G27B 2XAQA 2CTWA 1KKCA 1WPBA 4DO2A 3E89A 2OIEA 2QA4V 2V7QG 5IYBO 4JI0O 4LCUC 5LMUO 5B1NA 4UXNA 3BFRA 4O4HA 4B3TO 1XUQA 1RSOA 2Q7GA 4I0XB 5J9PC 1S3JA 4DR2O 2KG7B 2N74A 3AG1B 4UB8Z 3B8MA 3ZMSA 1ZWIC 4X65B 1ZLZA 2IW5A 3SYQA 3GVMA 5EBMC 4I9WA 3CJHA 3RWRD 3K04A 4NR1A 1JR9A 1XMQO 1S5HC 1Q82W 1EN5A 1BS3A 4BW9A 2QM8A 5JWPA 3B40A 5FPRA 3E8GA 5LGTA 3UT5A 2OCCC 4KUMA 4TSFG 3SPHA 4LFAB 1IZ3A 5JQGA 3ZMVA 1X59A 2Q0AA 1MZFA 4DV6O 1CEZA 1J5EB 1Z5VA 2ZINA 4JGSA 5HFLA 4O2AB 1IBKO 1ZTEA 1XL6A 3SYOA 1XQ8A 2ARHA 5IYDO 2RNBA 2IH1C 3K59A 1VF5B 1RPRA 4HBNA 1AI7A 5B1BB 5LMNO 1PKXA 3LDDA 2P4VA 4X64O 2ZXWB 1E1QG 4LR3A 4JTAB 4DV3O 3LSUA 2VQEO 2IBZH 1K73W 5J2TB 3OM3B 3E83A 2AXTZ 3SYPA 4BAYA 1HW7A 4UVCA 4IHJB 3OUFA 2AHYA 3P3NA 4LFCO 4PA7A 1MOFA 4R6ZA 3G67A 4JZ2A 1PL4A 2ZDIC 1Q6IA 4TV8B 3CC7V 4P30A 5L3DA 3FB5C 3JALB 4X1IB 4LF7B 1V9PA 3TXSA 1XNRB 4BIOA 4FFBA 1SQXH 5IYZB 4QE7A 2XAHA 1OCRB 4RUEA 4MVOA 1DF5A 2LFRA 3OGCC 4IIJA 3CCJV 3GWOA 4W4KA 4Q20A 1B06A 1WB8A 5KA5A 2QWQB 3AG4C 5LL6Y 3G4SV 2YS8A 4LF5O 3RYCB 2EIMC 2H8PC 1HNXO 1BSMA 4K0KO 2QWOB 3OMAB 3ETEA 3PN1A 1A32A 1P7BA 2CAZC 4I0XA 3BCCH 1IURA 1U96A 1V55C 2EINC 2KG7A 4GKJO 3H1JH 2K9PA 4QPJA 3CWBH 4DV2O 3K06A 1PD3A 5BZBA 4UB6Z 4GX0A 2PI4A 4F6RB 4PDVA 5EYPB 4DR5B 1SKVA 2UUCO 4RQFA 3JAKB 1D5AA 2KKWA 4OX9O 4NTWA 4Z1VA 3JSNA 2UUBB 3UCSC 1P4RA 4QGPA 4UCSA 5BMVB 2A7WA 3TK1A 2RCVA 5GW7A 4MVZA 3VQVA 2LO1A 2M7WA 4LWSA 3ASNC 2FKXA 4PI0A 2Q7HA 1YCIA 3ZX6A 4PA6A 1MZEA 2EIKB 3I5DA 4J42A 4DR1B 4YIPA 1HWYA 2Y69B 2R9AA 1GN2A 2W0FC 1IBMB 3D36C 5LP6B 1RPOA 3CX5F 1H38A 5CBFA 5H6QA 3WB0A 4UCVA 3CCMV 2JJ1G 1G1XB 5JJJB 2WLJA 5KLVH 5J2TA 5J2UB 1VF6A 3RVYA 1VQLV 4QIWF 3T1HO 1N32O 2YC0A 4IHJA 4J80A 4BW5A 4DV0B 4N21A 4MT8A 3VBBA 1J95A 4YIOA 5IT9N 5B1AC 4MSWC 4JI1B 4JI4O 3KG2A 1MABG 2ZNJA 3OE7G 1JOYA 5D5QA 4TV8A 2LFSA 5AG2A 2WLLB 3JALA 4X1IA 2QJ1A 4CH6A 4I9QA 3ZHTA 5IYZA 1Q7YW 1SF9A 1E79G 1VQ6V 4ASUG 5DEDA 1FXKC 2DOSA 2HEPA 1I7FA 2JIZG 5BR8O 2UUAO 1XILA 3CCUV 4CH3A 4MVSA 1G6UA 4J10A 3VQXA 2YXHA 3OEEG 1EZVH 3A2FA 3DXRA 4JI3B 3DC6A 3E35A 1PPJH 1Y74B 2YIBA 3I55V 1AR5A 4WFBV 3RYFB 1XNRO 1TUEB 3SGIA 4I7ZB 2UU9O 5B5EZ 1NZ6A 1XEQA 5LBQA 4B08A 3ETDA 4RUFA 1WB7A 5JH7B 1BHBA 2HHHB 2ITCC 4F6RA 1CPYA 5EYPA 5LGNA 1HNZB 1OV9A 2QE7G 1K33A 2DJVA 1KD1W 4RAIA 3JAKA 2JDIG 2EZPA 4Z1MG 1I5YA 2ETNA 2Z0AA 4JI7B 3F7YC 4F6EA 4WFFA 5BMVA 2Q9LA 1K4DC 1SQBH 2XNDG 2E76B 5KUMA 5IWAO 4O4LB 4TQDA 3HKDB 3HKBB 1MSWD 3JCUZ 5E79Z 3QG5A 3UO2A 3AG2C 3JD2A 3AG1C 1IBLB 4U7OA 3M8AA 1FXVA 3ZS8C 2OCHA 5EBLC 4DK0A 2UXCO 1BZKA 3OTOO 4FK5C 1O9GA 3BAAA 5LP6A 2WLMA 1WJZA 4H44B 1SRYA 3SPIA 3L70H 4YHHB 4DUZO 1P49A 5IJ9B 2XTAA 3ZHUA 2LGQA 1FFTB 1R3LC 1K8AW 3OMIB 2P4KA 3BEHA 3LSSA 3OR6C 2P06A 4ZBMA 4FZ1A 2A9HA 5J2UA 2CGNA 1EBOA 2WA4A 2DN9A 3TXQA 5HFMA 3IFXA 2BCCH 4GKKB 4MW3A 3EVKA 5L3EA 4FLUA 4ABMA 3N2KB 3R65A 3A8TA 1GM7A 2BTQB 4UCOA 1KP2A 1BE3H 1W0JG 2F43G 2F1MA 3CP1A 3WG7B 4JASA 4JI2O 2NNUA 4NKGB 1VF7A 4U7NA 3K57A 1ZL8B 5E1AC 1ZAUA 3O65A 1TAEA 4JYAB 2DQ0A 2GBOA 5BXZA 4DR3O 1LR1A 3VQYA 4I55B 2HVKC 4XDJA 3FYEB 5EZYB 3W7SA 2E5LO 3H1HH 3BY6A 2BSKB 5KHKA 4DV7B 1F7YA 2HLDG 3BA9A 2ILMA 1H2MA 1GMGA 2JEUA 1M5IA 1Y76B 2LQTA 3IC7A 2EIJC 1Y74A 1JJ2U 2Y4UA 4KP4A 3P3PA 3RYFA 4QJFB 4JAVA 5JCOA 1OCOC 5A9GA 4B3RB 3W7UA 1KBHA 3T4ZA 2XAFA 5JH7A 4PELA 3T1YO 1DTOA 4YXWG 5B3SB 3FB8C 4MTOA 4IT5A 3A0BZ 4J7KA 3U11A 3SPGA 3X2QB 1SQPH 1QBZA 1QLEB 1OCRC 4WBNB 1YITV 4YY3B 2Q8VA 4JI3O 1QR9A 1WLEA 3AK1A 2OWOA 4AQYO 3ABMB 4ZOLB 3TGUH 4LF9O 4B3SO 1KQSU 2JS3A 3BABA 4X8AA 5JJNB 2N05A 3N2GA 4O4LA 1YZBA 2MK3A 2HHHO 3APQA 3K03A 4JAAA 2YXYA 1DK1A 1VQPV 4B7KA 2EILB 2GTSA 5LXTB 5IDJA 1RM1B 1G8MA 2EZOA 4JI5O 4JI7O 1N36B 4EKWA 1FFXB 2RQ6A 1IXBA 3OAAG 4QNHB 1KC8W 2UXDO 4GCZA 1SQVH 1GK9A 2V4DA 2YICA 1M57C 4IYIA 5KA6A 2KQXA 1M9NA 2WLNA 4DV1O 3ETGA 3STZC 1XOUA 2BOBC 3ZRVA 5F2VO 3N2KA 2EIKC 4NB5A 4LFBB 4ICGA 1RFYA 1W2BU 5KHHA 2BTQA 3OMNB 4MVMA 2PF4E 1QHTA 1N8RW 4FPPA 5CA0B 1H8HG 1GAXA 3U0ZA 3JAWB 3AEIA 2QKAA 3CRCA 4FVMA 4BWAA 2RJZA 4DUYO 2AGAA 4I4TA 3FB6C 1ZL8A 4CH4A 2P7TC 1HR0B 5H9CA 1S5JA 3ASOB 3CC4V 1QLNA 2KB1A 1H2NA 4NVPA 1SS3A 3KCXA 1JJOA 1OCCB 2OT5A 3IAYA 4GKKO 1U97A 2ATKC 2WLHA 5KHIA 4I55A 2Q69A 4GT1A 2DE0X 5EZYA 4ZI7B 2BSKA 4DR7B 1NH2B 3LDCA 3C90A 1KMIZ 1PNMA 4NTXA 1Y76A
chains in the Genus database with same CATH topology
2LQTA 2RN9A 2HP8A 1Z2GA 1HP8A 2LGQA 1U97A 1U96A 2RNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LQT A;  2RN9 A;  2HP8 A;  1Z2G A;  1HP8 A;  2LGQ A;  1U97 A;  1U96 A;  2RNB A; 
#chains in the Genus database with same CATH topology
 5CA1 B;  1CP9 A;  1Q6U A;  3E8B A;  4LWS B;  2DYR B;  2EJR A;  2X7R B;  4R8C A;  4JTD B;  1I94 O;  4DV5 B;  1EN6 A;  4RWU A;  3SYC A;  5CBG A;  1JCH A;  3L75 H;  3SJB C;  2WWW A;  2GUZ A;  4O4I B;  4WBN A;  3DC5 A;  2A06 H;  3AK3 A;  5B66 Z;  4B3M B;  2R72 A;  1XHX A;  4ZOL A;  3CME V;  2WPD G;  1NTK H;  1EFR G;  4KHP B;  3OUS A;  2F95 B;  3ABL B;  1R6N A;  2LGW A;  5LA6 B;  3HKE B;  1QCE A;  1M56 B;  3BRC A;  2AHZ A;  5L3F A;  2FML A;  5GON A;  3SJA C;  4PA4 A;  4MVQ A;  5JVD A;  2QM4 A;  3BA8 A;  5LXT A;  2Y4T A;  3RW0 A;  4YY3 O;  1K5S A;  4ZKI A;  3ZMT A;  4AI8 A;  2JGD B;  1K7D A;  2UXB O;  1FFX A;  5FPO A;  2RMK B;  3IGA C;  3WFV A;  3A0R A;  3E8F A;  4UFZ A;  4DR4 B;  3O9O A;  3K5O A;  4JYB A;  1YHQ V;  3ZN0 A;  4U3F H;  2ZR2 A;  2F23 A;  4FLW A;  4L87 A;  4XDL A;  2WLK A;  4NXM B;  4UCR A;  1V54 B;  3P30 A;  3AG3 C;  3OD4 A;  1FJG B;  4P9O A;  3F5W C;  5K1P A;  3DXR B;  1N36 O;  4LF6 B;  4WCE V;  2VQF B;  4OPH A;  2QWR B;  1D2D A;  1YDX A;  2D2C B;  1N33 B;  1YEW A;  5CA0 A;  5IYC O;  1F23 A;  3JAW A;  3GB7 C;  5IE9 A;  1NKD A;  4DR6 O;  1AR1 B;  3RGB A;  3JAS A;  2JVD A;  3CRR A;  2WSS G;  1OCZ B;  2IJK A;  4JI8 B;  3N27 A;  2YI8 A;  4JPR A;  5LYJ B;  2CTQ A;  4LH6 A;  4ZI7 A;  4FZ0 A;  4UCT A;  3L9D A;  3JSL A;  4QPK A;  1Q90 D;  5CA1 A;  5FNV B;  1KB9 F;  4X65 O;  3ABT A;  1S76 D;  3H01 A;  2DW4 A;  4J9Z B;  4O4I A;  1K4C C;  1KU9 A;  1Z2G A;  2V1D A;  3L73 H;  4JF3 A;  1DLB A;  5KAI Z;  2P90 A;  5JJE B;  3PJS K;  2X6A A;  3B4S A;  4PV1 B;  4JV5 B;  4LFA O;  3ZJZ A;  2H94 A;  5LA6 A;  4PA3 A;  2Y48 A;  4AIL C;  1XMO B;  3HKE A;  2FTK A;  3MD0 A;  1H2K A;  1J5E O;  2R9I A;  4UVA A;  1M90 W;  4NXN B;  1JMK C;  2YSU B;  2F66 C;  2FB5 A;  3WU2 Z;  1AP5 A;  1DGS A;  5IY5 C;  4CS4 A;  3K0G A;  2AZ2 A;  3UQ8 A;  5KHG A;  1AIL A;  2L6L A;  4D7S A;  2ZNI A;  3KZI Z;  4ZHQ B;  1NR1 A;  4LBE C;  1T5E A;  3C3S A;  4DV4 B;  5B3S C;  4X66 B;  2OTJ V;  1Q81 W;  3OGI B;  2P6J A;  2VRZ A;  2ZCE A;  2JGD A;  3X2Q C;  2OTL V;  1AJP A;  1D5N A;  1QLE C;  3FD9 A;  1JFF B;  3AG7 A;  2OCC B;  2G38 A;  3M7M X;  3F5T A;  3BVO A;  3KKY A;  1KKD A;  4HYO A;  3D3Q A;  3JAT B;  3ETQ A;  3TCU A;  3CCS V;  4I5S A;  2UXN A;  2QSA A;  4PJ0 Z;  1ZX3 A;  5KX5 A;  2ZE8 A;  4TWK A;  4LF4 B;  1L0L H;  2K1E A;  3Q4H B;  5K1X A;  1PM9 A;  3ZIA G;  4OXS A;  4WFE A;  4J7Z A;  4LF7 O;  3KCY A;  1NJI W;  4DR4 O;  3CHX A;  3ZHV A;  5IJ0 A;  1JA8 A;  1LUV A;  2CGO A;  1Q5O A;  3H1L H;  4TUY B;  3BHP A;  4H0L B;  4NXM O;  2GTA A;  1VQK V;  1NTM H;  1H2G A;  2Z3Y A;  5CMU A;  5LHH A;  2NLJ C;  5LYJ A;  2R70 A;  4LF6 O;  5L3G A;  2GDS A;  4GX2 A;  2IJI A;  1E1R G;  1WPX A;  4XDK A;  4H37 A;  5GTH Z;  4X62 B;  1VQN V;  5FNV A;  1NTZ H;  1THZ A;  1BT8 A;  3QNE A;  3N2G B;  1UFI A;  3THO A;  5DM6 V;  2B5U A;  4J7J A;  4FIP C;  4DR5 O;  2KSD A;  2IJJ A;  3LUT B;  4LF8 B;  2QTS A;  4FLX A;  4BR6 A;  4J41 A;  2A3Q A;  4FM2 A;  2PZS A;  5ITZ A;  4HNA B;  2HJF C;  1YXB A;  2UUB O;  3AG4 B;  1IVS A;  1WN7 A;  4G28 B;  1OCC C;  1L8D A;  1NR7 A;  4CBC A;  2EIM B;  2H3O A;  4J11 A;  1YI2 V;  3G6B A;  2PGG A;  4JTC B;  1KP3 A;  2QM7 A;  1AI5 A;  3ZCC A;  5EC1 C;  4CS3 A;  1F4N A;  2CTR A;  1V55 B;  2BOC C;  2Q68 A;  3K08 A;  2L35 A;  3T2M A;  2QWN B;  4DR1 O;  4JI0 B;  1YTF D;  2WAM A;  1ZSP A;  3J80 N;  4B3T B;  2ZIO A;  1ORQ C;  2B9Z A;  1IBM O;  4HAM A;  5CB4 B;  4PD4 F;  2DQ3 A;  4DR2 B;  4ZHQ A;  3S3X A;  3SDL A;  1JQ0 A;  4PDM A;  3ZRW B;  3OEH G;  3CCE V;  2XAG A;  4H33 A;  2E75 B;  5KMG B;  5B1B C;  1XI1 A;  5D5P A;  1URF A;  1JFF A;  4TT3 G;  1US6 A;  2B1I A;  4I4T B;  2VWK A;  1XMQ B;  1BHA A;  4X9Q A;  2ZXW C;  4DV0 O;  3JAT A;  4OGQ B;  2P67 A;  3NR7 A;  1PNK A;  1WA8 B;  4JI1 O;  3AK2 A;  4DRX B;  4E4E A;  1VF6 C;  5KUK A;  4FLV A;  2ADQ B;  4KXR A;  2N04 A;  4X66 O;  4UUJ C;  4IYH A;  3MAQ A;  2HG5 C;  1YSC A;  4DV6 B;  1NVP D;  1XDC A;  4UV9 A;  3Q4H A;  5LHG A;  4LNU B;  1UPG A;  3CEI A;  1IBK B;  3A0H Z;  2B1G A;  2W0X A;  1YJN V;  3JD3 A;  1F4M A;  5A2Q N;  4GX5 A;  5LMN B;  1VQ8 V;  1WP7 A;  2ZR3 A;  1K5Q A;  4E2L A;  4EEQ A;  2GUZ B;  4TUY A;  4WFG A;  2F4V B;  2X0L A;  4X64 B;  4DYL A;  2QKC A;  1M4U A;  4GLX A;  3E22 B;  2GV9 A;  5TIS Z;  2VQE B;  1AJN A;  1OHH G;  4LF4 O;  4PDR A;  2W6I G;  2PYL A;  5EK0 A;  4UVB A;  2PI5 A;  1S72 V;  4YJ3 B;  1Y66 A;  3CPW U;  3B8N A;  4FM1 A;  1NI8 A;  1VQM V;  3STL C;  1GRJ A;  5L3B A;  3RYI B;  4LFC B;  3VOU A;  3HKC B;  1XNQ B;  3ZHS A;  1HNZ O;  3RYH B;  5LOV B;  2ZE5 A;  5GON B;  2ZM6 B;  1WAZ A;  1OZ0 A;  1VQO V;  1FXK B;  3D3I A;  4HNA A;  5JVD B;  4CZZ A;  4KL1 A;  3TJT A;  4JZG A;  4K8X A;  3NXS A;  3SYA A;  1BCC H;  1BL8 A;  2QKS A;  2HP8 A;  2QWP B;  1K97 A;  1QVF U;  4UV8 A;  3QVN A;  1B6Q A;  1OCZ C;  2DYS B;  2DWD C;  1GN3 A;  2IM9 A;  1N0N A;  3K9A A;  2EBO A;  3ABK B;  1PL0 A;  1QQC A;  1ARO P;  2XT9 A;  4LF8 O;  1ROP A;  2EX3 A;  1K34 A;  2ZT9 B;  3RN4 A;  3K58 A;  3FFQ A;  1HNX B;  1VIB A;  1IBL O;  4K0K B;  1VQ9 V;  1R1B A;  3RFR A;  4GUN A;  3TET A;  3QTC A;  3G6E V;  2IH3 C;  5CB4 A;  1NQT A;  2R9R B;  4GKJ B;  4DXW A;  1GTO A;  3E86 A;  4DV2 B;  1GM8 A;  1SC5 B;  4YHH O;  1BMF G;  5EC2 C;  2Y69 C;  3RVZ A;  3ZRW A;  2P5O A;  1PNL A;  2JK5 C;  1SQF A;  1I08 A;  1NS1 A;  5KMG A;  5LP6 C;  3L71 H;  3ZMZ A;  2UUC B;  4FLY A;  4CH5 A;  4OX9 B;  4EFE A;  3SPJ A;  1RP3 B;  3QF7 A;  1SA0 B;  3EHB B;  3OFN G;  3JAS B;  3WB2 A;  2VS0 A;  4AHC A;  4MTX A;  4K8Z A;  1FXH A;  1WA8 A;  3AG2 B;  3F7V C;  4WFH A;  3U10 A;  4DRX A;  4W4L A;  1YIJ V;  4K3A A;  4CC6 A;  1SQG A;  3CCR V;  3ZRS A;  3D36 A;  4I50 B;  4X89 A;  4LNU A;  2Q4P A;  1TUB B;  2NR5 A;  1TGO A;  4TV9 B;  3JD4 A;  1W0K G;  5L3C A;  1FS0 G;  3M99 B;  4KFM A;  1KYO F;  2PY5 A;  1SES A;  3ZMU A;  2CH7 B;  1MSD A;  2LW1 A;  1QVG U;  4JYY A;  4JYA O;  1AJQ A;  2QDO A;  4C7U A;  2ZE6 A;  1B04 A;  4YJ2 A;  3CCV V;  2YEV B;  4DV7 O;  1LUW A;  3E22 A;  2XAS A;  1XRE A;  3T1H B;  3S3W A;  1N32 B;  3JYC A;  2ZQM A;  4YJ3 A;  1Q6H A;  4IL6 Z;  4EFB A;  2ZKO A;  3UM7 A;  2WLI B;  4B3R O;  2Q6A A;  3RYI A;  4JI4 B;  1SZX A;  2JS5 A;  2JEX A;  5B1O A;  3HKC A;  3CXH F;  3RYH A;  1Q3E A;  5LOV A;  2X6B A;  3E8H A;  2F4V O;  4GYC B;  5JCO C;  1DF4 A;  1FXK A;  2YID A;  3E2E A;  2YDE A;  2Y0I A;  5LHI A;  5CN0 A;  3CC2 V;  1Q8I A;  1QR8 A;  1M1K W;  4EB6 B;  3ABU A;  2YIB D;  2QEX V;  5DN6 G;  4Z2W A;  3B2E E;  1FYJ A;  3DSQ A;  1S77 D;  5BR8 B;  2UUA B;  4O4J B;  5CBH A;  4U3J B;  2EIJ B;  2OIG A;  1W59 A;  1EZJ A;  1XNQ O;  2HKO A;  4F4L A;  2MW2 B;  1OCO B;  2JJ2 G;  2ZM6 O;  4FFK A;  2HFE C;  1QU7 A;  4IGG A;  3JCZ A;  1L0N H;  2NN4 A;  1MG1 A;  2HR3 A;  5KX5 B;  2OYQ A;  2UU9 B;  2YUA A;  1AR4 A;  1BGY H;  3IJ4 A;  4X1Y B;  2ZIM A;  5EIB C;  5BY1 A;  4J9Y B;  1TA8 A;  3L74 H;  1L1F A;  4HZ3 A;  1EM1 A;  3K9S A;  1YJW V;  4X1K B;  2FL4 A;  1IX9 A;  3MDS A;  1HP8 A;  5IJ0 B;  3SPC A;  2W6J G;  1H2S B;  1SA0 A;  1ZUQ A;  1N0J A;  3B77 A;  3JAM N;  1PV0 A;  1SZT A;  4FM0 A;  1Q43 A;  4LFB O;  3C3T A;  2RN9 A;  1Y6X A;  1EN4 A;  5IWA B;  4MTG A;  4CC5 A;  3RT3 C;  1S0V A;  3SJQ C;  4I50 A;  3LNN A;  3CMA V;  2XOK G;  1TUB A;  3R66 A;  2BTO A;  2Q73 A;  1GM9 A;  4TV9 A;  2UXC B;  3OTO B;  3ZED A;  1VQ4 V;  1HR0 O;  2CH7 A;  3WG7 C;  4QE9 A;  3QO8 A;  1M57 B;  3P32 A;  5ITZ B;  4DUZ B;  1Q86 W;  2YEV A;  1KEC A;  2GHY A;  4G2K A;  4DR7 O;  1O9H A;  4BIZ A;  1P7G A;  1HNW B;  3HB3 B;  2ITD C;  1AI4 A;  3ML0 A;  1GH6 A;  1VEW A;  2ZE7 A;  4O2A A;  4OPA A;  1WP8 A;  1YJ9 V;  3CSX A;  1VQ7 V;  4X20 B;  2CDY A;  3ZN1 A;  2WLI A;  4TOI A;  2PTM A;  4DV5 O;  1K9M W;  2EUL A;  1Y67 A;  2GSM B;  1NT2 B;  3EFF K;  5H5N A;  3FB7 C;  1FD9 A;  3MHH C;  4ZIB A;  4TQF A;  2HJD A;  4JI2 B;  3OTF A;  1XHZ A;  2XHB A;  3K5M A;  4D6T H;  4EB6 A;  3CB2 A;  4B3M O;  3ZRX A;  4KHP O;  4FMT A;  1PP9 H;  1JPX A;  4DR3 B;  2VWJ A;  3CS5 A;  3W7W A;  4O4J A;  1P84 F;  4U3J A;  2O57 A;  1Z5W A;  3ABM C;  2E5L B;  1QNM A;  3CRA A;  2YI9 A;  2LJ2 A;  4GX1 A;  3G71 V;  1BQZ A;  3L72 H;  1OJH A;  3JD1 A;  1IXM A;  4LH7 A;  4LC1 A;  4MTF A;  4UCU A;  4X1Y A;  1MA1 A;  4NYK A;  2EIL C;  3B09 A;  3T1Y B;  1RM1 C;  1MNG A;  3H1K H;  3VQW A;  1SET A;  2AW9 A;  4X1K A;  2RDC A;  2X6C A;  2E3C A;  1WNS A;  4H13 B;  3RYC A;  2DYS C;  5EIB D;  3K3W A;  3EXA A;  4AQY B;  3JAR B;  1NU1 H;  4D7T A;  3FAV B;  4LF9 B;  4B3S B;  3ABK C;  1IDS A;  3T4D A;  1FJG O;  5LGU A;  3CD6 V;  2CE4 A;  3WB1 A;  1AI6 A;  2VQF O;  3HPL C;  1NBM G;  1N33 O;  1AB3 A;  2Q67 A;  4PDL A;  2XAJ A;  2AZ0 A;  5C93 A;  4JI6 B;  2Y0P A;  3ICX A;  3IC9 A;  3OR7 C;  3SR2 C;  5GTI Z;  1UJW B;  3BPZ A;  2ZD9 A;  4JI5 B;  3ZHQ A;  2HVJ C;  3I56 V;  3W7X A;  4FJC C;  1MMM A;  2PUS A;  4JI8 O;  3CRQ A;  2CK3 G;  3QO5 A;  4B7E A;  1CXZ B;  3FYI B;  2UXD B;  5EBW C;  1VQ5 V;  3RBZ A;  2Q0O C;  3ASO C;  5C8Y B;  3AG3 B;  4DW1 A;  4X88 A;  1N34 B;  1N4C A;  1Y4M A;  5FL7 G;  4DW0 A;  4R50 A;  2D3O W;  4R7C A;  4X20 A;  1BQ0 A;  2LW7 A;  3K79 A;  4DV1 B;  2DMX A;  1VAR A;  5H2F Z;  4CS2 A;  2EIN B;  2QTO A;  5DEC A;  2Q5Z A;  4JYC A;  4O2B B;  5LMU B;  2DYR C;  1LNQ A;  1XBL A;  2F93 B;  4WF9 V;  4BIU A;  1FKA O;  1JVM A;  1HNW O;  1M93 A;  4A5U B;  2E74 B;  2JGU A;  3H9V A;  1TVK B;  4DUY B;  1JX9 A;  3FX7 A;  4JV5 O;  4LP8 A;  1HDJ A;  1XL4 A;  1YF2 A;  3CCL V;  1XMO O;  4N23 A;  3G80 A;  4NXN O;  3ASN B;  3CRM A;  3OW2 U;  2A0L A;  3ABL C;  4O4H B;  1RSO B;  2IJH A;  2QR4 A;  2FYU H;  1SQQ H;  3T1C A;  1B3Q A;  2WLL A;  1R3K C;  3D8C A;  3UO3 A;  4JAU A;  4DV4 O;  1S5L Z;  1M56 C;  3W7T A;  3J81 N;  2PYJ A;  2QGN A;  2ODM A;  5CA3 A;  1R6T A;  1I94 B;  1I0H A;  1SER A;  2JRI A;  3CJH B;  1K92 A;  1FAF A;  3CE2 A;  1YTF B;  5FLX N;  3CYO A;  4GZR B;  2YXL A;  2YIA A;  3OT7 A;  1X4T A;  4FLT A;  1COW G;  3UT5 B;  1K3E A;  3JAR A;  2M6Y A;  4YJ2 B;  3K5L A;  4Q6G A;  3FAV A;  1R73 A;  3LNM B;  4PI2 A;  1FPO A;  3HR0 A;  4DK1 A;  5IY5 B;  4MVU A;  2XUM A;  3K0D A;  4MS2 A;  2BE3 A;  5JQG B;  4K35 A;  5KAF Z;  4DV3 B;  2WA3 A;  2UXX A;  4MW8 A;  4PA9 A;  5B1A B;  2CUG A;  1GN6 A;  3LSQ A;  1V54 C;  2ZDI A;  3ZBH A;  4RO2 A;  5H6R A;  1GN4 A;  4P9P A;  4PHZ A;  1AP6 A;  4FLZ A;  2LP7 A;  2C2A A;  3DTU B;  3FKS G;  1VMG A;  2Q7E A;  2UXB B;  2EJ7 A;  2DWE C;  1KUQ A;  1NVP B;  5KHJ A;  3UKM A;  1R3J C;  3CCQ V;  1R3I C;  3J7A U;  3JD0 A;  1H2L A;  5C8Y A;  3SJC C;  3HKD A;  3HKB A;  3H1I H;  4L8J A;  1H8E G;  4X62 O;  4RQE A;  4MVR A;  4XBF A;  4NTY A;  4JI6 O;  2P22 C;  1ENV A;  3K5N A;  3APO A;  4P2Z A;  3GWK C;  1GKF A;  1YVW A;  4LF5 B;  2IU0 A;  4WFA V;  3DGE A;  3LDE A;  4O2B A;  1I5X A;  3CXC U;  2IU3 A;  5IJ9 A;  2Z5U A;  3MHS C;  2A79 B;  1NH2 D;  4FFB B;  1G4Y B;  1VP7 A;  3ZHR A;  1N34 O;  1F51 A;  1R6K A;  1TVK A;  1AVM A;  1GO3 F;  4IIJ B;  2CTP A;  4DR6 B;  2ADP A;  3QO7 A;  4G27 B;  2XAQ A;  2CTW A;  1KKC A;  1WPB A;  4DO2 A;  3E89 A;  2OIE A;  2QA4 V;  2V7Q G;  5IYB O;  4JI0 O;  4LCU C;  5LMU O;  5B1N A;  4UXN A;  3BFR A;  4O4H A;  4B3T O;  1XUQ A;  1RSO A;  2Q7G A;  4I0X B;  5J9P C;  1S3J A;  4DR2 O;  2KG7 B;  2N74 A;  3AG1 B;  4UB8 Z;  3B8M A;  3ZMS A;  1ZWI C;  4X65 B;  1ZLZ A;  2IW5 A;  3SYQ A;  3GVM A;  5EBM C;  4I9W A;  3CJH A;  3RWR D;  3K04 A;  4NR1 A;  1JR9 A;  1XMQ O;  1S5H C;  1Q82 W;  1EN5 A;  1BS3 A;  4BW9 A;  2QM8 A;  5JWP A;  3B40 A;  5FPR A;  3E8G A;  5LGT A;  3UT5 A;  2OCC C;  4KUM A;  4TSF G;  3SPH A;  4LFA B;  1IZ3 A;  5JQG A;  3ZMV A;  1X59 A;  2Q0A A;  1MZF A;  4DV6 O;  1CEZ A;  1J5E B;  1Z5V A;  2ZIN A;  4JGS A;  5HFL A;  4O2A B;  1IBK O;  1ZTE A;  1XL6 A;  3SYO A;  1XQ8 A;  2ARH A;  5IYD O;  2RNB A;  2IH1 C;  3K59 A;  1VF5 B;  1RPR A;  4HBN A;  1AI7 A;  5B1B B;  5LMN O;  1PKX A;  3LDD A;  2P4V A;  4X64 O;  2ZXW B;  1E1Q G;  4LR3 A;  4JTA B;  4DV3 O;  3LSU A;  2VQE O;  2IBZ H;  1K73 W;  5J2T B;  3OM3 B;  3E83 A;  2AXT Z;  3SYP A;  4BAY A;  1HW7 A;  4UVC A;  4IHJ B;  3OUF A;  2AHY A;  3P3N A;  4LFC O;  4PA7 A;  1MOF A;  4R6Z A;  3G67 A;  4JZ2 A;  1PL4 A;  2ZDI C;  1Q6I A;  4TV8 B;  3CC7 V;  4P30 A;  5L3D A;  3FB5 C;  3JAL B;  4X1I B;  4LF7 B;  1V9P A;  3TXS A;  1XNR B;  4BIO A;  4FFB A;  1SQX H;  5IYZ B;  4QE7 A;  2XAH A;  1OCR B;  4RUE A;  4MVO A;  1DF5 A;  2LFR A;  3OGC C;  4IIJ A;  3CCJ V;  3GWO A;  4W4K A;  4Q20 A;  1B06 A;  1WB8 A;  5KA5 A;  2QWQ B;  3AG4 C;  5LL6 Y;  3G4S V;  2YS8 A;  4LF5 O;  3RYC B;  2EIM C;  2H8P C;  1HNX O;  1BSM A;  4K0K O;  2QWO B;  3OMA B;  3ETE A;  3PN1 A;  1A32 A;  1P7B A;  2CAZ C;  4I0X A;  3BCC H;  1IUR A;  1U96 A;  1V55 C;  2EIN C;  2KG7 A;  4GKJ O;  3H1J H;  2K9P A;  4QPJ A;  3CWB H;  4DV2 O;  3K06 A;  1PD3 A;  5BZB A;  4UB6 Z;  4GX0 A;  2PI4 A;  4F6R B;  4PDV A;  5EYP B;  4DR5 B;  1SKV A;  2UUC O;  4RQF A;  3JAK B;  1D5A A;  2KKW A;  4OX9 O;  4NTW A;  4Z1V A;  3JSN A;  2UUB B;  3UCS C;  1P4R A;  4QGP A;  4UCS A;  5BMV B;  2A7W A;  3TK1 A;  2RCV A;  5GW7 A;  4MVZ A;  3VQV A;  2LO1 A;  2M7W A;  4LWS A;  3ASN C;  2FKX A;  4PI0 A;  2Q7H A;  1YCI A;  3ZX6 A;  4PA6 A;  1MZE A;  2EIK B;  3I5D A;  4J42 A;  4DR1 B;  4YIP A;  1HWY A;  2Y69 B;  2R9A A;  1GN2 A;  2W0F C;  1IBM B;  3D36 C;  5LP6 B;  1RPO A;  3CX5 F;  1H38 A;  5CBF A;  5H6Q A;  3WB0 A;  4UCV A;  3CCM V;  2JJ1 G;  1G1X B;  5JJJ B;  2WLJ A;  5KLV H;  5J2T A;  5J2U B;  1VF6 A;  3RVY A;  1VQL V;  4QIW F;  3T1H O;  1N32 O;  2YC0 A;  4IHJ A;  4J80 A;  4BW5 A;  4DV0 B;  4N21 A;  4MT8 A;  3VBB A;  1J95 A;  4YIO A;  5IT9 N;  5B1A C;  4MSW C;  4JI1 B;  4JI4 O;  3KG2 A;  1MAB G;  2ZNJ A;  3OE7 G;  1JOY A;  5D5Q A;  4TV8 A;  2LFS A;  5AG2 A;  2WLL B;  3JAL A;  4X1I A;  2QJ1 A;  4CH6 A;  4I9Q A;  3ZHT A;  5IYZ A;  1Q7Y W;  1SF9 A;  1E79 G;  1VQ6 V;  4ASU G;  5DED A;  1FXK C;  2DOS A;  2HEP A;  1I7F A;  2JIZ G;  5BR8 O;  2UUA O;  1XIL A;  3CCU V;  4CH3 A;  4MVS A;  1G6U A;  4J10 A;  3VQX A;  2YXH A;  3OEE G;  1EZV H;  3A2F A;  3DXR A;  4JI3 B;  3DC6 A;  3E35 A;  1PPJ H;  1Y74 B;  2YIB A;  3I55 V;  1AR5 A;  4WFB V;  3RYF B;  1XNR O;  1TUE B;  3SGI A;  4I7Z B;  2UU9 O;  5B5E Z;  1NZ6 A;  1XEQ A;  5LBQ A;  4B08 A;  3ETD A;  4RUF A;  1WB7 A;  5JH7 B;  1BHB A;  2HHH B;  2ITC C;  4F6R A;  1CPY A;  5EYP A;  5LGN A;  1HNZ B;  1OV9 A;  2QE7 G;  1K33 A;  2DJV A;  1KD1 W;  4RAI A;  3JAK A;  2JDI G;  2EZP A;  4Z1M G;  1I5Y A;  2ETN A;  2Z0A A;  4JI7 B;  3F7Y C;  4F6E A;  4WFF A;  5BMV A;  2Q9L A;  1K4D C;  1SQB H;  2XND G;  2E76 B;  5KUM A;  5IWA O;  4O4L B;  4TQD A;  3HKD B;  3HKB B;  1MSW D;  3JCU Z;  5E79 Z;  3QG5 A;  3UO2 A;  3AG2 C;  3JD2 A;  3AG1 C;  1IBL B;  4U7O A;  3M8A A;  1FXV A;  3ZS8 C;  2OCH A;  5EBL C;  4DK0 A;  2UXC O;  1BZK A;  3OTO O;  4FK5 C;  1O9G A;  3BAA A;  5LP6 A;  2WLM A;  1WJZ A;  4H44 B;  1SRY A;  3SPI A;  3L70 H;  4YHH B;  4DUZ O;  1P49 A;  5IJ9 B;  2XTA A;  3ZHU A;  2LGQ A;  1FFT B;  1R3L C;  1K8A W;  3OMI B;  2P4K A;  3BEH A;  3LSS A;  3OR6 C;  2P06 A;  4ZBM A;  4FZ1 A;  2A9H A;  5J2U A;  2CGN A;  1EBO A;  2WA4 A;  2DN9 A;  3TXQ A;  5HFM A;  3IFX A;  2BCC H;  4GKK B;  4MW3 A;  3EVK A;  5L3E A;  4FLU A;  4ABM A;  3N2K B;  3R65 A;  3A8T A;  1GM7 A;  2BTQ B;  4UCO A;  1KP2 A;  1BE3 H;  1W0J G;  2F43 G;  2F1M A;  3CP1 A;  3WG7 B;  4JAS A;  4JI2 O;  2NNU A;  4NKG B;  1VF7 A;  4U7N A;  3K57 A;  1ZL8 B;  5E1A C;  1ZAU A;  3O65 A;  1TAE A;  4JYA B;  2DQ0 A;  2GBO A;  5BXZ A;  4DR3 O;  1LR1 A;  3VQY A;  4I55 B;  2HVK C;  4XDJ A;  3FYE B;  5EZY B;  3W7S A;  2E5L O;  3H1H H;  3BY6 A;  2BSK B;  5KHK A;  4DV7 B;  1F7Y A;  2HLD G;  3BA9 A;  2ILM A;  1H2M A;  1GMG A;  2JEU A;  1M5I A;  1Y76 B;  2LQT A;  3IC7 A;  2EIJ C;  1Y74 A;  1JJ2 U;  2Y4U A;  4KP4 A;  3P3P A;  3RYF A;  4QJF B;  4JAV A;  5JCO A;  1OCO C;  5A9G A;  4B3R B;  3W7U A;  1KBH A;  3T4Z A;  2XAF A;  5JH7 A;  4PEL A;  3T1Y O;  1DTO A;  4YXW G;  5B3S B;  3FB8 C;  4MTO A;  4IT5 A;  3A0B Z;  4J7K A;  3U11 A;  3SPG A;  3X2Q B;  1SQP H;  1QBZ A;  1QLE B;  1OCR C;  4WBN B;  1YIT V;  4YY3 B;  2Q8V A;  4JI3 O;  1QR9 A;  1WLE A;  3AK1 A;  2OWO A;  4AQY O;  3ABM B;  4ZOL B;  3TGU H;  4LF9 O;  4B3S O;  1KQS U;  2JS3 A;  3BAB A;  4X8A A;  5JJN B;  2N05 A;  3N2G A;  4O4L A;  1YZB A;  2MK3 A;  2HHH O;  3APQ A;  3K03 A;  4JAA A;  2YXY A;  1DK1 A;  1VQP V;  4B7K A;  2EIL B;  2GTS A;  5LXT B;  5IDJ A;  1RM1 B;  1G8M A;  2EZO A;  4JI5 O;  4JI7 O;  1N36 B;  4EKW A;  1FFX B;  2RQ6 A;  1IXB A;  3OAA G;  4QNH B;  1KC8 W;  2UXD O;  4GCZ A;  1SQV H;  1GK9 A;  2V4D A;  2YIC A;  1M57 C;  4IYI A;  5KA6 A;  2KQX A;  1M9N A;  2WLN A;  4DV1 O;  3ETG A;  3STZ C;  1XOU A;  2BOB C;  3ZRV A;  5F2V O;  3N2K A;  2EIK C;  4NB5 A;  4LFB B;  4ICG A;  1RFY A;  1W2B U;  5KHH A;  2BTQ A;  3OMN B;  4MVM A;  2PF4 E;  1QHT A;  1N8R W;  4FPP A;  5CA0 B;  1H8H G;  1GAX A;  3U0Z A;  3JAW B;  3AEI A;  2QKA A;  3CRC A;  4FVM A;  4BWA A;  2RJZ A;  4DUY O;  2AGA A;  4I4T A;  3FB6 C;  1ZL8 A;  4CH4 A;  2P7T C;  1HR0 B;  5H9C A;  1S5J A;  3ASO B;  3CC4 V;  1QLN A;  2KB1 A;  1H2N A;  4NVP A;  1SS3 A;  3KCX A;  1JJO A;  1OCC B;  2OT5 A;  3IAY A;  4GKK O;  1U97 A;  2ATK C;  2WLH A;  5KHI A;  4I55 A;  2Q69 A;  4GT1 A;  2DE0 X;  5EZY A;  4ZI7 B;  2BSK A;  4DR7 B;  1NH2 B;  3LDC A;  3C90 A;  1KMI Z;  1PNM A;  4NTX A;  1Y76 A; 
#chains in the Genus database with same CATH homology
 2LQT A;  2RN9 A;  2HP8 A;  1Z2G A;  1HP8 A;  2LGQ A;  1U97 A;  1U96 A;  2RNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...