1U97A

Solution structure of apo yeast cox17
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
69
structure length
69
Chain Sequence
b'MTETDKKQEQENHAECEDKPKPCCVCKPEKEERDTCILFNGQDSEKCKEFIEKYKECMKGYGFEVPSAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase copper chaperone
molecule tags Chaperone
source organism Saccharomyces cerevisiae
publication title Yeast cox17 solution structure and Copper(I) binding.
pubmed doi rcsb
total genus 12
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2004-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05051 COX17 Cytochrome C oxidase copper chaperone (COX17)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1130 Mainly Alpha Orthogonal Bundle Helix Hairpins CytochromE C oxidase copper chaperone 1u97A00
1HP8A 1U97A 2RN9A 2HP8A 2LQTA 2LGQA 1U96A 1Z2GA 2RNBA
chains in the Genus database with same CATH superfamily
3E8FA 5D5QA 2RCVA 4BW9A 2OWOA 4FK5C 4I5SA 2QWQB 1HNXB 4NVPA 4LH7A 3KZIZ 3ABMC 3JAWA 2YEVB 1R73A 3HKBB 5H5NA 4MVZA 5LA6A 1XNRB 5EC1C 3QTCA 2JS5A 3JAWB 1VEWA 2CH7B 2DE0X 4GX5A 2GV9A 4X20B 1JA8A 1LNQA 1TUBB 2LO1A 3T2MA 2K9PA 2YIAA 2EILB 4I50B 3BPZA 3CYOA 4W4KA 4U7OA 4B7KA 1R3LC 4OGQB 2XOKG 3CRMA 4AQYO 3WFVA 1IXMA 2JVDA 4DRXB 5LYJB 1SZTA 3CCVV 1NTMH 2QM8A 3SYPA 3JAKA 1N36B 1AR4A 3JARB 1BGYH 2Y69C 3P3NA 4J41A 1AJNA 2N05A 4X89A 3CCQV 1GAXA 1TVKA 2AGAA 2NLJC 2FKXA 1FPOA 4DUZB 3U11A 2BSKA 5JH7A 1OCOC 1YVWA 1HNWO 1F4NA 4ICGA 1URFA 1ZL8B 2P4KA 5LMNB 2N04A 2W6IG 3I56V 1K4DC 4OX9B 2ZKOA 2IU0A 4Z1VA 4J7KA 4JAUA 1SQPH 2HFEC 5KX5A 4LF6O 1I08A 3LSSA 2F1MA 3ASNB 2P4VA 4QE7A 3UQ8A 1EN4A 4KUMA 1FXKB 1W0JG 1LR1A 1IVSA 5JQGB 3FB7C 3OGCC 4K8XA 1I0HA 4O2AA 3KKYA 2EZOA 4J9ZB 2Q73A 1S72V 3ZN0A 3K9SA 2PYLA 3APOA 2PTMA 3N2GB 2QA4V 1MNGA 1FFXA 3B77A 4ZHQA 3ABLC 2Q6AA 5CB4B 4XBFA 3CE2A 4JI2B 4OPHA 2W0XA 1PL4A 3LDCA 5IYBO 4X62B 1AROP 3K9AA 4JYYA 4MSWC 3I55V 3SJCC 3ZMZA 4PA3A 4G2KA 1HNWB 3HKCA 1H2MA 1NI8A 2RDCA 2UUAO 2ZE7A 1AJPA 1G4YB 4UCUA 2PZSA 2EIJB 1GM8A 4NTXA 2P5OA 3ZMUA 2CK3G 3GWKC 4N23A 3OMAB 4XDKA 1VQ5V 5B1BC 5CBGA 1EN5A 3LSQA 4O4IA 2ZDIA 4KL1A 1Q8IA 2A9HA 1KP3A 1OCOB 3K5MA 4I7ZB 4WFAV 2NNUA 1TVKB 1YI2V 3SGIA 3G4SV 1Y76A 3G6EV 5JJEB 4PELA 3ASOC 2ITCC 2DOSA 1Q90D 4P9PA 1V9PA 3U10A 4X1IA 2JS3A 2QM7A 2QJ1A 3RYCA 2GSMB 1VMGA 5JJJB 4HBNA 2C2AA 1WA8B 4HNAA 3A8TA 3JASA 3FFQA 3K06A 1O9GA 2NR5A 2CTRA 4YHHO 1KYOF 2A0LA 5KA5A 1Q6IA 2OT5A 4X20A 2R9RB 1TUBA 4MT8A 5LHHA 5FPOA 1YJNV 1N0JA 1AR1B 4YJ3A 1PPJH 1FJGO 4JTDB 5EIBD 1N33B 1IBLO 5KAFZ 3H1IH 4FLYA 1EZJA 4KP4A 4CS3A 1YCIA 2JDIG 1WN7A 3ETDA 4TV9B 5B1OA 3BABA 4JPRA 4UCTA 1GTOA 1R6TA 5CA0B 4A5UB 5C93A 1AI6A 5LL6Y 3BFRA 2HP8A 4X1KA 2UXBO 2KG7A 1VF6C 1FKAO 1U97A 3LUTB 3WB1A 2ZXWB 1SQGA 4IYHA 1SQBH 4CZZA 4FLTA 2DYSC 4NXMB 3CS5A 4U3JA 4J9YB 1YJWV 1FAFA 2RNBA 4UVCA 2UUAB 4LFAO 2JEXA 3MHHC 4JYBA 2AXTZ 1NH2D 1G8MA 2ZD9A 1OZ0A 4DR4B 1H2GA 2CTWA 4QIWF 4FM2A 3L73H 4LWSA 3RFRA 3HB3B 3P3PA 4DUZO 3FAVB 2BTQA 3A0HZ 5HFLA 3X2QC 4RO2A 4D7TA 4WFGA 1CPYA 1QLEC 5H9CA 3FYIB 1Q6HA 4LP8A 3BEHA 4J7ZA 1YEWA 4NKGB 5HFMA 4I0XA 3L9DA 1VF6A 2ZNJA 1A32A 1WA8A 4HNAB 2DMXA 3WG7B 3CCUV 3RBZA 1MMMA 2A79B 3CCJV 2B1IA 2UUCB 3SJQC 4PI0A 2WLNA 2ARHA 5GONB 5CA1A 3G6BA 1Q81W 5IT9N 2OIGA 1IBMO 1Y74A 3X2QB 1IXBA 2R9IA 3OM3B 4RUFA 4JI2O 3STLC 1D2DA 2QKAA 1NVPD 1M57B 1P84F 2XAGA 3K08A 5IYZA 2ADPA 1JFFA 2A3QA 4WBNB 1Y67A 2ZXWC 2UXNA 4EFBA 3N2KB 3OE7G 3AK2A 3I5DA 5KUMA 5LGNA 2ZIOA 4LFBO 1NKDA 2P90A 4UCRA 2VS0A 3EVKA 2F43G 4MVQA 4B3MO 2WSSG 1OCZC 3JARA 4DR1B 1M9NA 4U3JB 1RSOA 3K5OA 5B1AC 2IJIA 2QKCA 3D36C 3B4SA 4PA9A 1OCCB 4ZBMA 2OYQA 2CGNA 4LNUB 5IYCO 1Q86W 2YSUB 5KMGA 3RYCB 4O4LA 2O57A 3CCRV 4JV5O 4LF7O 4MW3A 4I55B 4IGGA 4KHPB 1MZFA 2Q67A 4L87A 2EJRA 3T1YO 3NR7A 1XHZA 1PP9H 5BR8O 4DV0O 1QCEA 5E79Z 4KXRA 4FJCC 4YJ3B 2Q7EA 2GUZB 2ZE5A 1WP7A 1V55C 4BW5A 2DYSB 5CBHA 1EBOA 5EZYA 1SKVA 2WLKA 1YTFB 1ZWIC 1N0NA 1RM1B 1E79G 3ZMVA 4LF5B 3CMEV 4LBEC 5FNVA 4LF4O 4MTGA 5GW7A 1SQQH 1B04A 4JAAA 3CWBH 3K59A 1M57C 1GN4A 4OX9O 1VARA 2OCHA 1HP8A 5BY1A 1W2BU 3UCSC 1Y6XA 3MD0A 5JVDB 2BOBC 5A2QN 3OTFA 1HDJA 1JX9A 1YF2A 1BT8A 1TA8A 1KMIZ 4LFAB 4K0KB 4UCVA 5L3GA 4TQFA 5LOVB 4LF7B 2HHHB 4UV9A 5CN0A 1OCRB 3OTOO 5AG2A 1KBHA 3BCCH 1D5AA 3LNNA 3ZEDA 3JSLA 4WFBV 1YHQV 2HLDG 4FLUA 1PNLA 4X64O 4DR3O 2X6CA 1AP5A 2AW9A 1Q5OA 4GX0A 2JIZG 3E8BA 5IJ0A 3K79A 1SC5B 3CC4V 1G6UA 3JALA 1Q43A 2AHYA 4IIJA 2ZR2A 4G28B 2KB1A 4JI3O 3OGIB 1NQTA 1MOFA 1HW7A 4JI6O 2LQTA 1H2NA 3OR7C 3Q4HA 3CSXA 5KLVH 2DW4A 2ETNA 2YIDA 1SERA 1XL6A 2VQFO 2P22C 5JCOA 3QG5A 1Y74B 3HKBA 1JPXA 4BAYA 1P7BA 3ZHQA 3OTOB 2YICA 2Y48A 3BRCA 4H33A 2A7WA 2A06H 2B9ZA 4B3SO 2EINB 1L0LH 1V54B 2WA4A 5KHGA 1P7GA 4MVOA 4FFKA 5LMUB 2VWJA 2ODMA 2IU3A 3N2KA 3SYCA 2LFRA 3M99B 2VQEO 3AG1C 4O4IB 3J80N 1IBMB 1AP6A 2LP7A 4DR3B 1ZSPA 2DJVA 3BA8A 1LUWA 2QR4A 4PDLA 1ZL8A 3E8HA 5IY5C 2AZ0A 3SYOA 3VBBA 1Q3EA 4TV8B 4HAMA 4RAIA 5EYPB 2LGQA 5KX5B 4X65O 2IBZH 3W7WA 3HKEA 4YIOA 4GUNA 4PV1B 3CCEV 2JEUA 3RGBA 4NB5A 4DR7O 3EHBB 1GMGA 1P49A 2R70A 3VOUA 3GB7C 2GTAA 1KKDA 1RSOB 2VQEB 1MSWD 4B3MB 4X62O 1BHBA 1XOUA 2H3OA 1SETA 1NBMG 1FFXB 1VF7A 5IYZB 4IHJB 4Z2WA 3DC6A 2ZE6A 1YIJV 4MS2A 3LSUA 4U7NA 4DRXA 3C3SA 3J7AU 4JI0B 3K58A 4GKKB 3W7TA 1XDCA 3A0BZ 1CEZA 3FX7A 2Y4UA 3RN4A 3H1LH 4CC6A 4DR2B 3VQWA 4Z1MG 3ABTA 2EIJC 3ML0A 4H13B 5EC2C 4ZI7A 4KHPO 2QDOA 3SPIA 3QO7A 4NXMO 3UO3A 4JI6B 3E86A 2XASA 3TCUA 1E1RG 4X88A 3TETA 4X65B 1KUQA 4YY3O 2BCCH 2X7RB 2GBOA 3OEHG 1K4CC 4NXNB 1AJQA 1RM1C 3F5WC 3F5TA 5J2UB 2JJ2G 1VQ9V 1EZVH 3ZRSA 1B3QA 1ENVA 2E5LO 2LFSA 1WJZA 1N4CA 3WU2Z 2Y4TA 4AILC 4B3SB 5C8YB 4I9WA 4PJ0Z 1BCCH 1F4MA 3GVMA 4I50A 2HKOA 3ABKC 4GLXA 2D3OW 2ZT9B 2EJ7A 2UXDB 2E74B 2ATKC 4ABMA 1GN3A 4FMTA 4MVUA 5JQGA 4ZKIA 1H8HG 2VWKA 1BS3A 1FXHA 1N34B 5H6QA 3ZRVA 4AQYB 1L8DA 1VQMV 2CGOA 4EB6B 4Q6GA 4IL6Z 3AG2C 5JWPA 2B1GA 5IYDO 5BXZA 3K0GA 3L74H 3APQA 3TGUH 1XMOB 2XAJA 2Q68A 2LW7A 2M6YA 4DR4O 4LC1A 4J11A 3U0ZA 2P67A 2YI9A 2QTSA 2PF4E 2WLLA 1R1BA 5D5PA 2HVJC 3CRAA 3P32A 2IM9A 4FM0A 4LNUA 5GONA 3ABKB 3ZHSA 2G38A 3ZRWB 5CA1B 3IC7A 5KMGB 5KAIZ 5FL7G 1NT2B 1FXKC 2XTAA 3M7MX 4LF8O 3ASOB 4FZ0A 4DV6O 1OJHA 1FD9A 1CP9A 1NR7A 3D8CA 4FZ1A 4Q20A 2YXYA 2ZIMA 3HKDB 4HYOA 2UUBO 5B1BB 3H1JH 5F2VO 2ADQB 4K3AA 1K3EA 1QVFU 4LF6B 3ABUA 1BSMA 4I4TA 3H1HH 1VQOV 4UFZA 2YS8A 3ETEA 2X6AA 3W7XA 4QE9A 2Q7HA 1SQVH 4FPPA 1BQ0A 3UM7A 3TXSA 4K8ZA 3EXAA 4CH6A 1MZEA 2EIMC 2OIEA 1HR0B 4XDLA 5LA6B 2BTQB 1K92A 2UXCO 4QPKA 4RQFA 4O4LB 3RVZA 4LF8B 4WCEV 1L0NH 4TQDA 2WLJA 1SZXA 1AI4A 3OFNG 3KCYA 2WA3A 1H2SB 3CB2A 3RYIB 2F4VB 4LFCB 1B6QA 2F23A 3F7VC 4TUYA 2OCCB 4P30A 5LHGA 4AI8A 4X66B 3ZHRA 2YC0A 1XUQA 3UKMA 4C7UA 2X0LA 4DUYB 4DV7B 4LH6A 1AR5A 2RQ6A 3ASNC 3N2GA 3WB0A 1TUEB 1IBKB 1GH6A 1GM9A 1US6A 1S76D 4EKWA 2BOCC 4G27B 4B7EA 3D36A 5BZBA 2PYJA 1THZA 1BZKA 5FNVB 2WLLB 3PN1A 4O2BB 4XDJA 3RYFB 1NR1A 4UB6Z 4PA4A 3SYQA 5IWAB 3CCSV 3H01A 4B08A 3E83A 4MTFA 3EFFK 3QF7A 2YI8A 4DR6O 4JAVA 1MG1A 4LR3A 1XL4A 3RVYA 2ZR3A 4CC5A 1SS3A 3E8GA 4JTCB 4OXSA 1NTZH 1DTOA 4DR6B 2QM4A 1I5XA 1I7FA 1RFYA 1ZLZA 3OMNB 4DV2O 3G80A 4X1KB 3ZIAG 1OHHG 2WLIA 4PHZA 4BWAA 1SF9A 2PI5A 1YDXA 4O4HA 1ORQC 2VRZA 3JD0A 3K5LA 1XHXA 1ZTEA 2Q0OC 4TSFG 1JJ2U 2LGWA 3JCZA 3J81N 4IT5A 2UU9B 4DV4B 3UT5A 1LUVA 3SJBC 1DGSA 2WLHA 3HKEB 3ZRWA 2HJFC 3CMAV 2HVKC 2ZM6O 3AEIA 4RUEA 2EBOA 4NTYA 1K34A 2PI4A 5GTIZ 2BE3A 4HZ3A 4J42A 4DXWA 2RN9A 2GTSA 1QR9A 5TISZ 3RYHA 4JI8O 2B5UA 3BAAA 3OT7A 1R3JC 1Y4MA 4JI5B 2UXBB 4OPAA 1EN6A 4KFMA 1N8RW 2CAZC 4DV3O 5KUKA 1IURA 4CBCA 1QLNA 4FIPC 4CS2A 3OAAG 2ZINA 3CRQA 2N74A 2HJDA 3HKDA 1Z5VA 4GCZA 3JCUZ 1Z5WA 5CA0A 4X1IB 1UPGA 1M56B 4TWKA 3H9VA 4O4JA 1YITV 4R50A 3BY6A 1RPOA 4TV8A 3KCXA 3K0DA 3AG3B 2RJZA 4U3FH 4JI7B 4X64B 2FL4A 2YEVA 2EINC 4JZGA 5H6RA 2F93B 5B5EZ 3MAQA 1WLEA 1BMFG 1X4TA 2EIMB 3D3QA 1CXZB 2XAFA 4L8JA 1IZ3A 3JD1A 3DGEA 2EZPA 3IJ4A 3FB5C 1VP7A 4JI3B 2HEPA 4K0KO 4PDMA 4PI2A 5DEDA 1FXVA 1R6NA 4H0LB 4UXNA 5DECA 2Z5UA 3O9OA 1S3JA 2IJKA 2ITDC 2KSDA 2DQ3A 4J10A 4DW0A 1K5SA 1WAZA 3C3TA 3T4DA 4LF9B 2ZCEA 4YY3B 3ZHUA 5J2TB 2XHBA 1S77D 1SA0B 4WFFA 5B1AB 2WWWA 2F4VO 1HWYA 1GN6A 2Q4PA 4D7SA 2EX3A 1T5EA 4LF9O 3VQXA 4JYAB 1WB8A 1XNRO 1QLEB 2JGDA 3FYEB 1W0KG 1H38A 1QU7A 1JMKC 4PA7A 4O2AB 3TXQA 4I9QA 1S5HC 3VQVA 2E75B 1AI7A 2WAMA 4JI4B 4P2ZA 3AG4B 1H2KA 2UXDO 1ROPA 3L70H 2E3CA 4ZOLA 4WFHA 4YXWG 5LXTB 1TAEA 1DLBA 1X59A 1M56C 4GYCB 2UXXA 5KHIA 4FLVA 3T1HB 5H2FZ 3T1CA 3L72H 4E4EA 4UUJC 5EBLC 1AB3A 2Q9LA 1SQXH 4UCOA 1OV9A 1YSCA 3BHPA 4DO2A 1XQ8A 5LP6B 1F23A 4LCUC 2JJ1G 4PDRA 4JTAB 4MTXA 1D5NA 1QQCA 3UO2A 2V4DA 1BL8A 4X9QA 1DK1A 3ZJZA 4LFBB 1I94B 3W7UA 3RT3C 4LF5O 1E1QG 5LP6A 4MVMA 3SPHA 3OR6C 5EK0A 3AG7A 2EULA 1Q82W 1K73W 2Q69A 4YIPA 1KC8W 1XILA 1R3KC 1NVPB 5K1PA 2PGGA 3RYFA 1SQFA 3S3WA 1VQLV 1IDSA 4FFBB 1KECA 1R3IC 2R72A 4H37A 2CH7A 1O9HA 1JVMA 1WB7A 5JJNB 4R7CA 2PUSA 2V7QG 2DYRC 2CUGA 1N36O 3FKSG 2K1EA 1NS1A 1YTFD 3ZMTA 2H8PC 1PNMA 4BR6A 1N33O 1SESA 5J2TA 1PKXA 1UJWB 1PNKA 1FFTB 4DV1B 3JASB 5LGUA 1JJOA 2DWEC 3CJHA 5GTHZ 2DWDC 5CBFA 1K8AW 1VF5B 3L71H 1N34O 1XBLA 4FLWA 3OEEG 1XMQB 3CJHB 5E1AC 2QWNB 4PA6A 2YDEA 3CHXA 5FLXN 5L3DA 1ZUQA 1PD3A 2KKWA 1PL0A 3STZC 5BMVB 3H1KH 4X8AA 4QPJA 4DV1O 5IJ9A 3SPJA 2YIBA 4JI7O 3ETQA 2Q7GA 2Y0IA 3SPCA 4EEQA 3IC9A 1KB9F 3JD4A 3B8MA 2W6JG 1N32O 3JSNA 5J9PC 2JGUA 2CE4A 3DXRA 4CS4A 4CH3A 3CD6V 5EIBC 1G1XB 4YJ2A 1VIBA 2MW2B 3CRCA 1W59A 2YXLA 3ZHTA 2PY5A 5L3CA 4DR2O 5B3SB 1WPXA 5LYJA 4JI1B 1TGOA 1MABG 1GO3F 4DR7B 3AG4C 1M5IA 1VQ8V 4RQEA 2QE7G 2OTJV 2KQXA 2QKSA 5IWAO 2UUBB 3QO8A 4RWUA 5L3FA 1SA0A 1FS0G 3P30A 3FB8C 4DW1A 5C8YA 5KHHA 1OCZB 4X66O 4FLZA 2L35A 1IX9A 1AVMA 3IGAC 3KG2A 4GX2A 5LXTA 1HNXO 2XAHA 3E2EA 5BR8B 3MHSC 4DR5O 1V54C 4BIZA 1JFFB 4WBNA 3T1YB 5LMNO 4BIUA 2LW1A 4GKKO 4JZ2A 3E22A 2DQ0A 1P4RA 4DR5B 5LGTA 3W7SA 4TV9A 1HR0O 2F95B 4JGSA 4ZOLB 4JI0O 3FD9A 2QWOB 3K04A 4UVBA 1S5JA 2DN9A 5JCOC 1YJ9V 3LDEA 4B3TB 5LHIA 2P6JA 2KG7B 4FM1A 4O4HB 3CCMV 4JI4O 2XT9A 2Q5ZA 4DV4O 4UB8Z 1ZAUA 3QVNA 4NR1A 3B09A 1DF5A 5J2UA 1V55B 1QBZA 2Z3YA 3T1HO 3OUFA 3DTUB 2AZ2A 1L1FA 1EM1A 4R8CA 2Z0AA 3M8AA 5BMVA 4GKJO 3G71V 4D6TH 4DV7O 2FTKA 3DC5A 5LBQA 1I94O 2ZE8A 1J5EB 2EIKB 4IHJA 1S5LZ 4TT3G 1XI1A 3ZBHA 4AHCA 1ZX3A 1PM9A 3GWOA 2GUZA 1MSDA 3TK1A 2QWPB 1QVGU 4K35A 2XNDG 1F7YA 4NXNO 4DK0A 2FMLA 3HPLC 5EZYB 2IH3C 4B3RB 3OMIB 1J95A 4MVSA 3BVOA 4O2BA 2ZNIA 3AG2B 4B3RO 2P7TC 4F6RB 5A9GA 4I4TB 1FJGB 1BHAA 4JYCA 3CPWU 5K1XA 5ITZA 5JVDA 2VQFB 2NN4A 1K9MW 5KHJA 1QR8A 2EIKC 3RW0A 4GKJB 1Q7YW 1NZ6A 4CH5A 1BE3H 3N27A 1RPRA 4NYKA 1JR9A 5ITZB 4TOIA 2YIBD 3QNEA 5B66Z 3K57A 2CDYA 1NJIW 3A2FA 5IE9A 1M90W 2ILMA 2F66C 4I0XB 2ZM6B 2JK5C 3JAKB 4FVMA 4B3TO 3A0RA 3WG7C 2W0FC 4PD4F 1VQ6V 2DYRB 3NXSA 3LDDA 4E2LA 3OD4A 2V1DA 3B8NA 5CA3A 1VQ7V 2QEXV 4R6ZA 1AILA 2QWRB 4FLXA 4JI5O 1N32B 4UVAA 3ZS8C 1R6KA 4MTOA 4MW8A 4DV3B 1GRJA 3DSQA 3L75H 3ZCCA 1AI5A 2QSAA 4DV5B 1K5QA 2QGNA 1KP2A 1QNMA 4I55A 4DV5O 3T4ZA 2UU9O 1FYJA 2R9AA 5CMUA 1DF4A 3ICXA 2H94A 3THOA 4CH4A 1M4UA 2IW5A 5DM6V 3BA9A 3LNMB 1YZBA 5IJ9B 2HR3A 3C90A 3JD2A 5IJ0B 2OCCC 3CRRA 2HG5C 3PJSK 4DK1A 1BQZA 4DV6B 3F7YC 1HNZO 4WF9V 4GZRB 3FAVA 5DN6G 1I5YA 3S3XA 3OUSA 1NU1H 1IBKO 4DV2B 4JYAO 4DR1O 1HNZB 3CX5F 1XNQO 4J7JA 3ABMB 1KKCA 3JALB 1F51A 1VQPV 5EBMC 4JASA 3FB6C 5LMUO 5JH7B 5B3SC 4W4LA 4O4JB 3TJTA 1VQKV 1KD1W 1U96A 3Q4HB 3IFXA 4MVRA 2Q0AA 1WP8A 5L3BA 1Q6UA 1FXKA 4J80A 3JAMN 3JYCA 5LOVA 1EFRG 4F6EA 2HHHO 3SJAC 5LP6C 3QO5A 1JCHA 4DUYO 5EBWC 1NH2B 1IBLB 1OCCC 1GK9A 1COWG 2Y69B 4P9OA 2E76B 3E22B 4X1YB 3VQYA 4GX1A 2GDSA 1JQ0A 4F4LA 1Y76B 3OW2U 3ZHVA 3RYIA 4LFCO 2AHZA 3JD3A 4IYIA 4JF3A 1WPBA 1KU9A 1GN2A 2E5LB 5IY5B 1GKFA 4YJ2B 4F6RA 3ETGA 2Q8VA 4WFEA 2JGDB 3IAYA 1H8EG 4ZIBA 1SRYA 1J5EO 2XAQA 3CEIA 3G67A 2BTOA 3ZX6A 2WPDG 3ZRXA 3RWRD 2ZQMA 3AK1A 1VQ4V 5KHKA 2L6LA 1GM7A 4UV8A 3SR2C 4NTWA 1XEQA 3HKCB 1M93A 2UUCO 2RMKB 3R65A 3CP1A 1S0VA 4JI8B 1PV0A 3K5NA 1RP3B 4BIOA 3E35A 2M7WA 1K33A 2MK3A 3JATA 3SDLA 3AG1B 4GT1A 2GHYA 2ZDIC 3O65A 4QJFB 1NTKH 1YXBA 4ZHQB 3ABLB 4TUYB 5CB4A 4PDVA 2YXHA 3CCLV 4LF4B 1H2LA 3D3IA 3K03A 2X6BA 3JATB 3CXHF 2WLMA 4IIJB 4JV5B 3CC7V 2LJ2A 4QGPA 3DXRB 2XUMA 2FB5A 4JI1O 1UFIA 3E89A 4ZI7B 3CC2V 1K7DA 4DV0B 1XMOO 2WLIB 4DYLA 1VQNV 1MA1A 5EYPA 1Y66A 3AG3C 3AK3A 3UT5B 3ZMSA 4H44B 2BSKB 2CTPA 3CXCU 2OTLV 2UXCB 1K97A 3B40A 2QTOA 4LWSB 2IJJA 1Z2GA 3WB2A 1QHTA 5L3EA 3SPGA 1M1KW 2IJHA 5IDJA 4FFBA 2D2CB 1B06A 3R66A 3MDSA 2P06A 4EB6A 4QNHB 4X1YA 5KA6A 1KQSU 3SYAA 4YHHB 4N21A 2YUAA 5B1NA 2IH1C 2JRIA 3HR0A 2EILC 3K3WA 4ASUG 4UCSA 3RYHB 1WNSA 1XREA 1JOYA 1XMQO 2FYUH 3ZN1A 2CTQA 4EFEA 3B2EE 2Y0PA 5FPRA 1OCRC 1XNQB
chains in the Genus database with same CATH topology
1HP8A 1U97A 2RN9A 2HP8A 2LQTA 2LGQA 1U96A 1Z2GA 2RNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HP8 A;  1U97 A;  2RN9 A;  2HP8 A;  2LQT A;  2LGQ A;  1U96 A;  1Z2G A;  2RNB A; 
#chains in the Genus database with same CATH topology
 3E8F A;  5D5Q A;  2RCV A;  4BW9 A;  2OWO A;  4FK5 C;  4I5S A;  2QWQ B;  1HNX B;  4NVP A;  4LH7 A;  3KZI Z;  3ABM C;  3JAW A;  2YEV B;  1R73 A;  3HKB B;  5H5N A;  4MVZ A;  5LA6 A;  1XNR B;  5EC1 C;  3QTC A;  2JS5 A;  3JAW B;  1VEW A;  2CH7 B;  2DE0 X;  4GX5 A;  2GV9 A;  4X20 B;  1JA8 A;  1LNQ A;  1TUB B;  2LO1 A;  3T2M A;  2K9P A;  2YIA A;  2EIL B;  4I50 B;  3BPZ A;  3CYO A;  4W4K A;  4U7O A;  4B7K A;  1R3L C;  4OGQ B;  2XOK G;  3CRM A;  4AQY O;  3WFV A;  1IXM A;  2JVD A;  4DRX B;  5LYJ B;  1SZT A;  3CCV V;  1NTM H;  2QM8 A;  3SYP A;  3JAK A;  1N36 B;  1AR4 A;  3JAR B;  1BGY H;  2Y69 C;  3P3N A;  4J41 A;  1AJN A;  2N05 A;  4X89 A;  3CCQ V;  1GAX A;  1TVK A;  2AGA A;  2NLJ C;  2FKX A;  1FPO A;  4DUZ B;  3U11 A;  2BSK A;  5JH7 A;  1OCO C;  1YVW A;  1HNW O;  1F4N A;  4ICG A;  1URF A;  1ZL8 B;  2P4K A;  5LMN B;  2N04 A;  2W6I G;  3I56 V;  1K4D C;  4OX9 B;  2ZKO A;  2IU0 A;  4Z1V A;  4J7K A;  4JAU A;  1SQP H;  2HFE C;  5KX5 A;  4LF6 O;  1I08 A;  3LSS A;  2F1M A;  3ASN B;  2P4V A;  4QE7 A;  3UQ8 A;  1EN4 A;  4KUM A;  1FXK B;  1W0J G;  1LR1 A;  1IVS A;  5JQG B;  3FB7 C;  3OGC C;  4K8X A;  1I0H A;  4O2A A;  3KKY A;  2EZO A;  4J9Z B;  2Q73 A;  1S72 V;  3ZN0 A;  3K9S A;  2PYL A;  3APO A;  2PTM A;  3N2G B;  2QA4 V;  1MNG A;  1FFX A;  3B77 A;  4ZHQ A;  3ABL C;  2Q6A A;  5CB4 B;  4XBF A;  3CE2 A;  4JI2 B;  4OPH A;  2W0X A;  1PL4 A;  3LDC A;  5IYB O;  4X62 B;  1ARO P;  3K9A A;  4JYY A;  4MSW C;  3I55 V;  3SJC C;  3ZMZ A;  4PA3 A;  4G2K A;  1HNW B;  3HKC A;  1H2M A;  1NI8 A;  2RDC A;  2UUA O;  2ZE7 A;  1AJP A;  1G4Y B;  4UCU A;  2PZS A;  2EIJ B;  1GM8 A;  4NTX A;  2P5O A;  3ZMU A;  2CK3 G;  3GWK C;  4N23 A;  3OMA B;  4XDK A;  1VQ5 V;  5B1B C;  5CBG A;  1EN5 A;  3LSQ A;  4O4I A;  2ZDI A;  4KL1 A;  1Q8I A;  2A9H A;  1KP3 A;  1OCO B;  3K5M A;  4I7Z B;  4WFA V;  2NNU A;  1TVK B;  1YI2 V;  3SGI A;  3G4S V;  1Y76 A;  3G6E V;  5JJE B;  4PEL A;  3ASO C;  2ITC C;  2DOS A;  1Q90 D;  4P9P A;  1V9P A;  3U10 A;  4X1I A;  2JS3 A;  2QM7 A;  2QJ1 A;  3RYC A;  2GSM B;  1VMG A;  5JJJ B;  4HBN A;  2C2A A;  1WA8 B;  4HNA A;  3A8T A;  3JAS A;  3FFQ A;  3K06 A;  1O9G A;  2NR5 A;  2CTR A;  4YHH O;  1KYO F;  2A0L A;  5KA5 A;  1Q6I A;  2OT5 A;  4X20 A;  2R9R B;  1TUB A;  4MT8 A;  5LHH A;  5FPO A;  1YJN V;  1N0J A;  1AR1 B;  4YJ3 A;  1PPJ H;  1FJG O;  4JTD B;  5EIB D;  1N33 B;  1IBL O;  5KAF Z;  3H1I H;  4FLY A;  1EZJ A;  4KP4 A;  4CS3 A;  1YCI A;  2JDI G;  1WN7 A;  3ETD A;  4TV9 B;  5B1O A;  3BAB A;  4JPR A;  4UCT A;  1GTO A;  1R6T A;  5CA0 B;  4A5U B;  5C93 A;  1AI6 A;  5LL6 Y;  3BFR A;  2HP8 A;  4X1K A;  2UXB O;  2KG7 A;  1VF6 C;  1FKA O;  1U97 A;  3LUT B;  3WB1 A;  2ZXW B;  1SQG A;  4IYH A;  1SQB H;  4CZZ A;  4FLT A;  2DYS C;  4NXM B;  3CS5 A;  4U3J A;  4J9Y B;  1YJW V;  1FAF A;  2RNB A;  4UVC A;  2UUA B;  4LFA O;  2JEX A;  3MHH C;  4JYB A;  2AXT Z;  1NH2 D;  1G8M A;  2ZD9 A;  1OZ0 A;  4DR4 B;  1H2G A;  2CTW A;  4QIW F;  4FM2 A;  3L73 H;  4LWS A;  3RFR A;  3HB3 B;  3P3P A;  4DUZ O;  3FAV B;  2BTQ A;  3A0H Z;  5HFL A;  3X2Q C;  4RO2 A;  4D7T A;  4WFG A;  1CPY A;  1QLE C;  5H9C A;  3FYI B;  1Q6H A;  4LP8 A;  3BEH A;  4J7Z A;  1YEW A;  4NKG B;  5HFM A;  4I0X A;  3L9D A;  1VF6 A;  2ZNJ A;  1A32 A;  1WA8 A;  4HNA B;  2DMX A;  3WG7 B;  3CCU V;  3RBZ A;  1MMM A;  2A79 B;  3CCJ V;  2B1I A;  2UUC B;  3SJQ C;  4PI0 A;  2WLN A;  2ARH A;  5GON B;  5CA1 A;  3G6B A;  1Q81 W;  5IT9 N;  2OIG A;  1IBM O;  1Y74 A;  3X2Q B;  1IXB A;  2R9I A;  3OM3 B;  4RUF A;  4JI2 O;  3STL C;  1D2D A;  2QKA A;  1NVP D;  1M57 B;  1P84 F;  2XAG A;  3K08 A;  5IYZ A;  2ADP A;  1JFF A;  2A3Q A;  4WBN B;  1Y67 A;  2ZXW C;  2UXN A;  4EFB A;  3N2K B;  3OE7 G;  3AK2 A;  3I5D A;  5KUM A;  5LGN A;  2ZIO A;  4LFB O;  1NKD A;  2P90 A;  4UCR A;  2VS0 A;  3EVK A;  2F43 G;  4MVQ A;  4B3M O;  2WSS G;  1OCZ C;  3JAR A;  4DR1 B;  1M9N A;  4U3J B;  1RSO A;  3K5O A;  5B1A C;  2IJI A;  2QKC A;  3D36 C;  3B4S A;  4PA9 A;  1OCC B;  4ZBM A;  2OYQ A;  2CGN A;  4LNU B;  5IYC O;  1Q86 W;  2YSU B;  5KMG A;  3RYC B;  4O4L A;  2O57 A;  3CCR V;  4JV5 O;  4LF7 O;  4MW3 A;  4I55 B;  4IGG A;  4KHP B;  1MZF A;  2Q67 A;  4L87 A;  2EJR A;  3T1Y O;  3NR7 A;  1XHZ A;  1PP9 H;  5BR8 O;  4DV0 O;  1QCE A;  5E79 Z;  4KXR A;  4FJC C;  4YJ3 B;  2Q7E A;  2GUZ B;  2ZE5 A;  1WP7 A;  1V55 C;  4BW5 A;  2DYS B;  5CBH A;  1EBO A;  5EZY A;  1SKV A;  2WLK A;  1YTF B;  1ZWI C;  1N0N A;  1RM1 B;  1E79 G;  3ZMV A;  4LF5 B;  3CME V;  4LBE C;  5FNV A;  4LF4 O;  4MTG A;  5GW7 A;  1SQQ H;  1B04 A;  4JAA A;  3CWB H;  3K59 A;  1M57 C;  1GN4 A;  4OX9 O;  1VAR A;  2OCH A;  1HP8 A;  5BY1 A;  1W2B U;  3UCS C;  1Y6X A;  3MD0 A;  5JVD B;  2BOB C;  5A2Q N;  3OTF A;  1HDJ A;  1JX9 A;  1YF2 A;  1BT8 A;  1TA8 A;  1KMI Z;  4LFA B;  4K0K B;  4UCV A;  5L3G A;  4TQF A;  5LOV B;  4LF7 B;  2HHH B;  4UV9 A;  5CN0 A;  1OCR B;  3OTO O;  5AG2 A;  1KBH A;  3BCC H;  1D5A A;  3LNN A;  3ZED A;  3JSL A;  4WFB V;  1YHQ V;  2HLD G;  4FLU A;  1PNL A;  4X64 O;  4DR3 O;  2X6C A;  1AP5 A;  2AW9 A;  1Q5O A;  4GX0 A;  2JIZ G;  3E8B A;  5IJ0 A;  3K79 A;  1SC5 B;  3CC4 V;  1G6U A;  3JAL A;  1Q43 A;  2AHY A;  4IIJ A;  2ZR2 A;  4G28 B;  2KB1 A;  4JI3 O;  3OGI B;  1NQT A;  1MOF A;  1HW7 A;  4JI6 O;  2LQT A;  1H2N A;  3OR7 C;  3Q4H A;  3CSX A;  5KLV H;  2DW4 A;  2ETN A;  2YID A;  1SER A;  1XL6 A;  2VQF O;  2P22 C;  5JCO A;  3QG5 A;  1Y74 B;  3HKB A;  1JPX A;  4BAY A;  1P7B A;  3ZHQ A;  3OTO B;  2YIC A;  2Y48 A;  3BRC A;  4H33 A;  2A7W A;  2A06 H;  2B9Z A;  4B3S O;  2EIN B;  1L0L H;  1V54 B;  2WA4 A;  5KHG A;  1P7G A;  4MVO A;  4FFK A;  5LMU B;  2VWJ A;  2ODM A;  2IU3 A;  3N2K A;  3SYC A;  2LFR A;  3M99 B;  2VQE O;  3AG1 C;  4O4I B;  3J80 N;  1IBM B;  1AP6 A;  2LP7 A;  4DR3 B;  1ZSP A;  2DJV A;  3BA8 A;  1LUW A;  2QR4 A;  4PDL A;  1ZL8 A;  3E8H A;  5IY5 C;  2AZ0 A;  3SYO A;  3VBB A;  1Q3E A;  4TV8 B;  4HAM A;  4RAI A;  5EYP B;  2LGQ A;  5KX5 B;  4X65 O;  2IBZ H;  3W7W A;  3HKE A;  4YIO A;  4GUN A;  4PV1 B;  3CCE V;  2JEU A;  3RGB A;  4NB5 A;  4DR7 O;  3EHB B;  1GMG A;  1P49 A;  2R70 A;  3VOU A;  3GB7 C;  2GTA A;  1KKD A;  1RSO B;  2VQE B;  1MSW D;  4B3M B;  4X62 O;  1BHB A;  1XOU A;  2H3O A;  1SET A;  1NBM G;  1FFX B;  1VF7 A;  5IYZ B;  4IHJ B;  4Z2W A;  3DC6 A;  2ZE6 A;  1YIJ V;  4MS2 A;  3LSU A;  4U7N A;  4DRX A;  3C3S A;  3J7A U;  4JI0 B;  3K58 A;  4GKK B;  3W7T A;  1XDC A;  3A0B Z;  1CEZ A;  3FX7 A;  2Y4U A;  3RN4 A;  3H1L H;  4CC6 A;  4DR2 B;  3VQW A;  4Z1M G;  3ABT A;  2EIJ C;  3ML0 A;  4H13 B;  5EC2 C;  4ZI7 A;  4KHP O;  2QDO A;  3SPI A;  3QO7 A;  4NXM O;  3UO3 A;  4JI6 B;  3E86 A;  2XAS A;  3TCU A;  1E1R G;  4X88 A;  3TET A;  4X65 B;  1KUQ A;  4YY3 O;  2BCC H;  2X7R B;  2GBO A;  3OEH G;  1K4C C;  4NXN B;  1AJQ A;  1RM1 C;  3F5W C;  3F5T A;  5J2U B;  2JJ2 G;  1VQ9 V;  1EZV H;  3ZRS A;  1B3Q A;  1ENV A;  2E5L O;  2LFS A;  1WJZ A;  1N4C A;  3WU2 Z;  2Y4T A;  4AIL C;  4B3S B;  5C8Y B;  4I9W A;  4PJ0 Z;  1BCC H;  1F4M A;  3GVM A;  4I50 A;  2HKO A;  3ABK C;  4GLX A;  2D3O W;  2ZT9 B;  2EJ7 A;  2UXD B;  2E74 B;  2ATK C;  4ABM A;  1GN3 A;  4FMT A;  4MVU A;  5JQG A;  4ZKI A;  1H8H G;  2VWK A;  1BS3 A;  1FXH A;  1N34 B;  5H6Q A;  3ZRV A;  4AQY B;  1L8D A;  1VQM V;  2CGO A;  4EB6 B;  4Q6G A;  4IL6 Z;  3AG2 C;  5JWP A;  2B1G A;  5IYD O;  5BXZ A;  3K0G A;  3L74 H;  3APQ A;  3TGU H;  1XMO B;  2XAJ A;  2Q68 A;  2LW7 A;  2M6Y A;  4DR4 O;  4LC1 A;  4J11 A;  3U0Z A;  2P67 A;  2YI9 A;  2QTS A;  2PF4 E;  2WLL A;  1R1B A;  5D5P A;  2HVJ C;  3CRA A;  3P32 A;  2IM9 A;  4FM0 A;  4LNU A;  5GON A;  3ABK B;  3ZHS A;  2G38 A;  3ZRW B;  5CA1 B;  3IC7 A;  5KMG B;  5KAI Z;  5FL7 G;  1NT2 B;  1FXK C;  2XTA A;  3M7M X;  4LF8 O;  3ASO B;  4FZ0 A;  4DV6 O;  1OJH A;  1FD9 A;  1CP9 A;  1NR7 A;  3D8C A;  4FZ1 A;  4Q20 A;  2YXY A;  2ZIM A;  3HKD B;  4HYO A;  2UUB O;  5B1B B;  3H1J H;  5F2V O;  2ADQ B;  4K3A A;  1K3E A;  1QVF U;  4LF6 B;  3ABU A;  1BSM A;  4I4T A;  3H1H H;  1VQO V;  4UFZ A;  2YS8 A;  3ETE A;  2X6A A;  3W7X A;  4QE9 A;  2Q7H A;  1SQV H;  4FPP A;  1BQ0 A;  3UM7 A;  3TXS A;  4K8Z A;  3EXA A;  4CH6 A;  1MZE A;  2EIM C;  2OIE A;  1HR0 B;  4XDL A;  5LA6 B;  2BTQ B;  1K92 A;  2UXC O;  4QPK A;  4RQF A;  4O4L B;  3RVZ A;  4LF8 B;  4WCE V;  1L0N H;  4TQD A;  2WLJ A;  1SZX A;  1AI4 A;  3OFN G;  3KCY A;  2WA3 A;  1H2S B;  3CB2 A;  3RYI B;  2F4V B;  4LFC B;  1B6Q A;  2F23 A;  3F7V C;  4TUY A;  2OCC B;  4P30 A;  5LHG A;  4AI8 A;  4X66 B;  3ZHR A;  2YC0 A;  1XUQ A;  3UKM A;  4C7U A;  2X0L A;  4DUY B;  4DV7 B;  4LH6 A;  1AR5 A;  2RQ6 A;  3ASN C;  3N2G A;  3WB0 A;  1TUE B;  1IBK B;  1GH6 A;  1GM9 A;  1US6 A;  1S76 D;  4EKW A;  2BOC C;  4G27 B;  4B7E A;  3D36 A;  5BZB A;  2PYJ A;  1THZ A;  1BZK A;  5FNV B;  2WLL B;  3PN1 A;  4O2B B;  4XDJ A;  3RYF B;  1NR1 A;  4UB6 Z;  4PA4 A;  3SYQ A;  5IWA B;  3CCS V;  3H01 A;  4B08 A;  3E83 A;  4MTF A;  3EFF K;  3QF7 A;  2YI8 A;  4DR6 O;  4JAV A;  1MG1 A;  4LR3 A;  1XL4 A;  3RVY A;  2ZR3 A;  4CC5 A;  1SS3 A;  3E8G A;  4JTC B;  4OXS A;  1NTZ H;  1DTO A;  4DR6 B;  2QM4 A;  1I5X A;  1I7F A;  1RFY A;  1ZLZ A;  3OMN B;  4DV2 O;  3G80 A;  4X1K B;  3ZIA G;  1OHH G;  2WLI A;  4PHZ A;  4BWA A;  1SF9 A;  2PI5 A;  1YDX A;  4O4H A;  1ORQ C;  2VRZ A;  3JD0 A;  3K5L A;  1XHX A;  1ZTE A;  2Q0O C;  4TSF G;  1JJ2 U;  2LGW A;  3JCZ A;  3J81 N;  4IT5 A;  2UU9 B;  4DV4 B;  3UT5 A;  1LUV A;  3SJB C;  1DGS A;  2WLH A;  3HKE B;  3ZRW A;  2HJF C;  3CMA V;  2HVK C;  2ZM6 O;  3AEI A;  4RUE A;  2EBO A;  4NTY A;  1K34 A;  2PI4 A;  5GTI Z;  2BE3 A;  4HZ3 A;  4J42 A;  4DXW A;  2RN9 A;  2GTS A;  1QR9 A;  5TIS Z;  3RYH A;  4JI8 O;  2B5U A;  3BAA A;  3OT7 A;  1R3J C;  1Y4M A;  4JI5 B;  2UXB B;  4OPA A;  1EN6 A;  4KFM A;  1N8R W;  2CAZ C;  4DV3 O;  5KUK A;  1IUR A;  4CBC A;  1QLN A;  4FIP C;  4CS2 A;  3OAA G;  2ZIN A;  3CRQ A;  2N74 A;  2HJD A;  3HKD A;  1Z5V A;  4GCZ A;  3JCU Z;  1Z5W A;  5CA0 A;  4X1I B;  1UPG A;  1M56 B;  4TWK A;  3H9V A;  4O4J A;  1YIT V;  4R50 A;  3BY6 A;  1RPO A;  4TV8 A;  3KCX A;  3K0D A;  3AG3 B;  2RJZ A;  4U3F H;  4JI7 B;  4X64 B;  2FL4 A;  2YEV A;  2EIN C;  4JZG A;  5H6R A;  2F93 B;  5B5E Z;  3MAQ A;  1WLE A;  1BMF G;  1X4T A;  2EIM B;  3D3Q A;  1CXZ B;  2XAF A;  4L8J A;  1IZ3 A;  3JD1 A;  3DGE A;  2EZP A;  3IJ4 A;  3FB5 C;  1VP7 A;  4JI3 B;  2HEP A;  4K0K O;  4PDM A;  4PI2 A;  5DED A;  1FXV A;  1R6N A;  4H0L B;  4UXN A;  5DEC A;  2Z5U A;  3O9O A;  1S3J A;  2IJK A;  2ITD C;  2KSD A;  2DQ3 A;  4J10 A;  4DW0 A;  1K5S A;  1WAZ A;  3C3T A;  3T4D A;  4LF9 B;  2ZCE A;  4YY3 B;  3ZHU A;  5J2T B;  2XHB A;  1S77 D;  1SA0 B;  4WFF A;  5B1A B;  2WWW A;  2F4V O;  1HWY A;  1GN6 A;  2Q4P A;  4D7S A;  2EX3 A;  1T5E A;  4LF9 O;  3VQX A;  4JYA B;  1WB8 A;  1XNR O;  1QLE B;  2JGD A;  3FYE B;  1W0K G;  1H38 A;  1QU7 A;  1JMK C;  4PA7 A;  4O2A B;  3TXQ A;  4I9Q A;  1S5H C;  3VQV A;  2E75 B;  1AI7 A;  2WAM A;  4JI4 B;  4P2Z A;  3AG4 B;  1H2K A;  2UXD O;  1ROP A;  3L70 H;  2E3C A;  4ZOL A;  4WFH A;  4YXW G;  5LXT B;  1TAE A;  1DLB A;  1X59 A;  1M56 C;  4GYC B;  2UXX A;  5KHI A;  4FLV A;  3T1H B;  5H2F Z;  3T1C A;  3L72 H;  4E4E A;  4UUJ C;  5EBL C;  1AB3 A;  2Q9L A;  1SQX H;  4UCO A;  1OV9 A;  1YSC A;  3BHP A;  4DO2 A;  1XQ8 A;  5LP6 B;  1F23 A;  4LCU C;  2JJ1 G;  4PDR A;  4JTA B;  4MTX A;  1D5N A;  1QQC A;  3UO2 A;  2V4D A;  1BL8 A;  4X9Q A;  1DK1 A;  3ZJZ A;  4LFB B;  1I94 B;  3W7U A;  3RT3 C;  4LF5 O;  1E1Q G;  5LP6 A;  4MVM A;  3SPH A;  3OR6 C;  5EK0 A;  3AG7 A;  2EUL A;  1Q82 W;  1K73 W;  2Q69 A;  4YIP A;  1KC8 W;  1XIL A;  1R3K C;  1NVP B;  5K1P A;  2PGG A;  3RYF A;  1SQF A;  3S3W A;  1VQL V;  1IDS A;  4FFB B;  1KEC A;  1R3I C;  2R72 A;  4H37 A;  2CH7 A;  1O9H A;  1JVM A;  1WB7 A;  5JJN B;  4R7C A;  2PUS A;  2V7Q G;  2DYR C;  2CUG A;  1N36 O;  3FKS G;  2K1E A;  1NS1 A;  1YTF D;  3ZMT A;  2H8P C;  1PNM A;  4BR6 A;  1N33 O;  1SES A;  5J2T A;  1PKX A;  1UJW B;  1PNK A;  1FFT B;  4DV1 B;  3JAS B;  5LGU A;  1JJO A;  2DWE C;  3CJH A;  5GTH Z;  2DWD C;  5CBF A;  1K8A W;  1VF5 B;  3L71 H;  1N34 O;  1XBL A;  4FLW A;  3OEE G;  1XMQ B;  3CJH B;  5E1A C;  2QWN B;  4PA6 A;  2YDE A;  3CHX A;  5FLX N;  5L3D A;  1ZUQ A;  1PD3 A;  2KKW A;  1PL0 A;  3STZ C;  5BMV B;  3H1K H;  4X8A A;  4QPJ A;  4DV1 O;  5IJ9 A;  3SPJ A;  2YIB A;  4JI7 O;  3ETQ A;  2Q7G A;  2Y0I A;  3SPC A;  4EEQ A;  3IC9 A;  1KB9 F;  3JD4 A;  3B8M A;  2W6J G;  1N32 O;  3JSN A;  5J9P C;  2JGU A;  2CE4 A;  3DXR A;  4CS4 A;  4CH3 A;  3CD6 V;  5EIB C;  1G1X B;  4YJ2 A;  1VIB A;  2MW2 B;  3CRC A;  1W59 A;  2YXL A;  3ZHT A;  2PY5 A;  5L3C A;  4DR2 O;  5B3S B;  1WPX A;  5LYJ A;  4JI1 B;  1TGO A;  1MAB G;  1GO3 F;  4DR7 B;  3AG4 C;  1M5I A;  1VQ8 V;  4RQE A;  2QE7 G;  2OTJ V;  2KQX A;  2QKS A;  5IWA O;  2UUB B;  3QO8 A;  4RWU A;  5L3F A;  1SA0 A;  1FS0 G;  3P30 A;  3FB8 C;  4DW1 A;  5C8Y A;  5KHH A;  1OCZ B;  4X66 O;  4FLZ A;  2L35 A;  1IX9 A;  1AVM A;  3IGA C;  3KG2 A;  4GX2 A;  5LXT A;  1HNX O;  2XAH A;  3E2E A;  5BR8 B;  3MHS C;  4DR5 O;  1V54 C;  4BIZ A;  1JFF B;  4WBN A;  3T1Y B;  5LMN O;  4BIU A;  2LW1 A;  4GKK O;  4JZ2 A;  3E22 A;  2DQ0 A;  1P4R A;  4DR5 B;  5LGT A;  3W7S A;  4TV9 A;  1HR0 O;  2F95 B;  4JGS A;  4ZOL B;  4JI0 O;  3FD9 A;  2QWO B;  3K04 A;  4UVB A;  1S5J A;  2DN9 A;  5JCO C;  1YJ9 V;  3LDE A;  4B3T B;  5LHI A;  2P6J A;  2KG7 B;  4FM1 A;  4O4H B;  3CCM V;  4JI4 O;  2XT9 A;  2Q5Z A;  4DV4 O;  4UB8 Z;  1ZAU A;  3QVN A;  4NR1 A;  3B09 A;  1DF5 A;  5J2U A;  1V55 B;  1QBZ A;  2Z3Y A;  3T1H O;  3OUF A;  3DTU B;  2AZ2 A;  1L1F A;  1EM1 A;  4R8C A;  2Z0A A;  3M8A A;  5BMV A;  4GKJ O;  3G71 V;  4D6T H;  4DV7 O;  2FTK A;  3DC5 A;  5LBQ A;  1I94 O;  2ZE8 A;  1J5E B;  2EIK B;  4IHJ A;  1S5L Z;  4TT3 G;  1XI1 A;  3ZBH A;  4AHC A;  1ZX3 A;  1PM9 A;  3GWO A;  2GUZ A;  1MSD A;  3TK1 A;  2QWP B;  1QVG U;  4K35 A;  2XND G;  1F7Y A;  4NXN O;  4DK0 A;  2FML A;  3HPL C;  5EZY B;  2IH3 C;  4B3R B;  3OMI B;  1J95 A;  4MVS A;  3BVO A;  4O2B A;  2ZNI A;  3AG2 B;  4B3R O;  2P7T C;  4F6R B;  5A9G A;  4I4T B;  1FJG B;  1BHA A;  4JYC A;  3CPW U;  5K1X A;  5ITZ A;  5JVD A;  2VQF B;  2NN4 A;  1K9M W;  5KHJ A;  1QR8 A;  2EIK C;  3RW0 A;  4GKJ B;  1Q7Y W;  1NZ6 A;  4CH5 A;  1BE3 H;  3N27 A;  1RPR A;  4NYK A;  1JR9 A;  5ITZ B;  4TOI A;  2YIB D;  3QNE A;  5B66 Z;  3K57 A;  2CDY A;  1NJI W;  3A2F A;  5IE9 A;  1M90 W;  2ILM A;  2F66 C;  4I0X B;  2ZM6 B;  2JK5 C;  3JAK B;  4FVM A;  4B3T O;  3A0R A;  3WG7 C;  2W0F C;  4PD4 F;  1VQ6 V;  2DYR B;  3NXS A;  3LDD A;  4E2L A;  3OD4 A;  2V1D A;  3B8N A;  5CA3 A;  1VQ7 V;  2QEX V;  4R6Z A;  1AIL A;  2QWR B;  4FLX A;  4JI5 O;  1N32 B;  4UVA A;  3ZS8 C;  1R6K A;  4MTO A;  4MW8 A;  4DV3 B;  1GRJ A;  3DSQ A;  3L75 H;  3ZCC A;  1AI5 A;  2QSA A;  4DV5 B;  1K5Q A;  2QGN A;  1KP2 A;  1QNM A;  4I55 A;  4DV5 O;  3T4Z A;  2UU9 O;  1FYJ A;  2R9A A;  5CMU A;  1DF4 A;  3ICX A;  2H94 A;  3THO A;  4CH4 A;  1M4U A;  2IW5 A;  5DM6 V;  3BA9 A;  3LNM B;  1YZB A;  5IJ9 B;  2HR3 A;  3C90 A;  3JD2 A;  5IJ0 B;  2OCC C;  3CRR A;  2HG5 C;  3PJS K;  4DK1 A;  1BQZ A;  4DV6 B;  3F7Y C;  1HNZ O;  4WF9 V;  4GZR B;  3FAV A;  5DN6 G;  1I5Y A;  3S3X A;  3OUS A;  1NU1 H;  1IBK O;  4DV2 B;  4JYA O;  4DR1 O;  1HNZ B;  3CX5 F;  1XNQ O;  4J7J A;  3ABM B;  1KKC A;  3JAL B;  1F51 A;  1VQP V;  5EBM C;  4JAS A;  3FB6 C;  5LMU O;  5JH7 B;  5B3S C;  4W4L A;  4O4J B;  3TJT A;  1VQK V;  1KD1 W;  1U96 A;  3Q4H B;  3IFX A;  4MVR A;  2Q0A A;  1WP8 A;  5L3B A;  1Q6U A;  1FXK A;  4J80 A;  3JAM N;  3JYC A;  5LOV A;  1EFR G;  4F6E A;  2HHH O;  3SJA C;  5LP6 C;  3QO5 A;  1JCH A;  4DUY O;  5EBW C;  1NH2 B;  1IBL B;  1OCC C;  1GK9 A;  1COW G;  2Y69 B;  4P9O A;  2E76 B;  3E22 B;  4X1Y B;  3VQY A;  4GX1 A;  2GDS A;  1JQ0 A;  4F4L A;  1Y76 B;  3OW2 U;  3ZHV A;  3RYI A;  4LFC O;  2AHZ A;  3JD3 A;  4IYI A;  4JF3 A;  1WPB A;  1KU9 A;  1GN2 A;  2E5L B;  5IY5 B;  1GKF A;  4YJ2 B;  4F6R A;  3ETG A;  2Q8V A;  4WFE A;  2JGD B;  3IAY A;  1H8E G;  4ZIB A;  1SRY A;  1J5E O;  2XAQ A;  3CEI A;  3G67 A;  2BTO A;  3ZX6 A;  2WPD G;  3ZRX A;  3RWR D;  2ZQM A;  3AK1 A;  1VQ4 V;  5KHK A;  2L6L A;  1GM7 A;  4UV8 A;  3SR2 C;  4NTW A;  1XEQ A;  3HKC B;  1M93 A;  2UUC O;  2RMK B;  3R65 A;  3CP1 A;  1S0V A;  4JI8 B;  1PV0 A;  3K5N A;  1RP3 B;  4BIO A;  3E35 A;  2M7W A;  1K33 A;  2MK3 A;  3JAT A;  3SDL A;  3AG1 B;  4GT1 A;  2GHY A;  2ZDI C;  3O65 A;  4QJF B;  1NTK H;  1YXB A;  4ZHQ B;  3ABL B;  4TUY B;  5CB4 A;  4PDV A;  2YXH A;  3CCL V;  4LF4 B;  1H2L A;  3D3I A;  3K03 A;  2X6B A;  3JAT B;  3CXH F;  2WLM A;  4IIJ B;  4JV5 B;  3CC7 V;  2LJ2 A;  4QGP A;  3DXR B;  2XUM A;  2FB5 A;  4JI1 O;  1UFI A;  3E89 A;  4ZI7 B;  3CC2 V;  1K7D A;  4DV0 B;  1XMO O;  2WLI B;  4DYL A;  1VQN V;  1MA1 A;  5EYP A;  1Y66 A;  3AG3 C;  3AK3 A;  3UT5 B;  3ZMS A;  4H44 B;  2BSK B;  2CTP A;  3CXC U;  2OTL V;  2UXC B;  1K97 A;  3B40 A;  2QTO A;  4LWS B;  2IJJ A;  1Z2G A;  3WB2 A;  1QHT A;  5L3E A;  3SPG A;  1M1K W;  2IJH A;  5IDJ A;  4FFB A;  2D2C B;  1B06 A;  3R66 A;  3MDS A;  2P06 A;  4EB6 A;  4QNH B;  4X1Y A;  5KA6 A;  1KQS U;  3SYA A;  4YHH B;  4N21 A;  2YUA A;  5B1N A;  2IH1 C;  2JRI A;  3HR0 A;  2EIL C;  3K3W A;  4ASU G;  4UCS A;  3RYH B;  1WNS A;  1XRE A;  1JOY A;  1XMQ O;  2FYU H;  3ZN1 A;  2CTQ A;  4EFE A;  3B2E E;  2Y0P A;  5FPR A;  1OCR C;  1XNQ B; 
#chains in the Genus database with same CATH homology
 1HP8 A;  1U97 A;  2RN9 A;  2HP8 A;  2LQT A;  2LGQ A;  1U96 A;  1Z2G A;  2RNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...