1U97A

Solution structure of apo yeast cox17
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
69
structure length
69
Chain Sequence
b'MTETDKKQEQENHAECEDKPKPCCVCKPEKEERDTCILFNGQDSEKCKEFIEKYKECMKGYGFEVPSAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase copper chaperone
publication title Yeast cox17 solution structure and Copper(I) binding.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 12
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2004-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05051 COX17 Cytochrome C oxidase copper chaperone (COX17)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1130 Mainly Alpha Orthogonal Bundle Helix Hairpins CytochromE C oxidase copper chaperone 1u97A00
1U96A 1Z2GA 2RNBA 1U97A 2LGQA 2RN9A 2LQTA 1HP8A 2HP8A
chains in the Genus database with same CATH superfamily
1FFXA 2A06H 4LWSB 5KX5A 1KC8W 4J9YB 4DV6O 1KD1W 3ZHVA 2F23A 1G8MA 1B3QA 5JJJB 5LA6B 4FM2A 3GB7C 2W0FC 4TQFA 2LFRA 1H2SB 3CS5A 1FJGB 5BR8B 4W4KA 1YSCA 4UVBA 3K58A 4WBNB 3D36A 5LMNO 1I7FA 3JATB 1LR1A 2QM4A 3P32A 4N23A 2Y69B 1HNWO 3AK1A 2WA3A 1JCHA 1AI5A 1VF7A 3K08A 2CE4A 1M57C 4JI5O 3TCUA 3MHSC 5L3GA 2QWPB 2E3CA 3CP1A 3ASOB 2PF4E 3CJHA 1DF4A 2NNUA 1XQ8A 5LP6B 1YJ9V 4FLWA 3AG3C 5IJ9A 3QO7A 3B4SA 4ZI7A 2L6LA 5H6RA 1PD3A 3CRAA 1AI6A 4LC1A 4I5SA 3SJQC 4LF6B 3QO5A 1FXKC 1RSOB 4K0KB 1KB9F 2F1MA 3UQ8A 1GTOA 1R6NA 1MMMA 4FZ0A 3LDDA 1Q3EA 3H1HH 1KKCA 1TA8A 4LF8B 4Q6GA 4UFZA 1ZL8B 1US6A 2F43G 2YS8A 1VQOV 2EIKC 3MAQA 4DV3B 2EIMC 5JQGB 3I56V 1H2MA 1JR9A 4BW5A 1K3EA 4KHPB 1F23A 1MNGA 2Q5ZA 2WLLA 4O4JB 4UUJC 1V54B 1S5HC 1S77D 4F6RB 5F2VO 3K59A 1N34O 4LNUA 5KLVH 2DYSB 4I9QA 3ASNB 2LGWA 1WN7A 5H9CA 3RBZA 3RGBA 2LQTA 1VQ8V 4DR1O 3ZHTA 1JX9A 4UCRA 1BQZA 1K4DC 5B3SC 1VF5B 1Q81W 2ADQB 3IJ4A 4B7KA 4JAAA 1BZKA 4CH6A 4D7SA 4GKKO 2OCCC 3HB3B 3ZCCA 3ABKB 5LHIA 4B3RB 1QNMA 4WBNA 2JEUA 4HYOA 4PDLA 2UUBO 2ZD9A 3APOA 2VQEB 3T1YO 3AK3A 1IDSA 4GT1A 3FFQA 2QKCA 4D7TA 4B3SB 1BMFG 4U7OA 4TUYA 1NVPB 2PUSA 4IYIA 1KKDA 5H2FZ 4J42A 5BMVB 4DUYO 2KG7B 5LP6A 4FLZA 4JGSA 5B1BB 1NU1H 4O2BA 3T1CA 4CC5A 1SZXA 2BE3A 1VQKV 1XOUA 5L3BA 5KHKA 2E76B 2R9AA 1AI7A 2PTMA 3WG7C 3SPIA 3U0ZA 2DQ0A 1RSOA 4R7CA 2IW5A 2LJ2A 4FLTA 3L73H 3AG1C 3L74H 3JD3A 2PI4A 4JASA 4WCEV 1ZL8A 1GRJA 4JTDB 1W0KG 2P6JA 3JD2A 1FPOA 3HKDB 2ZNIA 4DV4O 1SF9A 1WNSA 5B1NA 4JI1B 2YDEA 3OGIB 3AK2A 1SRYA 3N2KA 4DR6O 1M56B 2CGOA 3SPJA 2IU3A 1N32B 2ZR2A 2WAMA 4HNAB 4Z1MG 2IBZH 3C3SA 1FD9A 4YHHB 1VQ9V 1PNMA 1NI8A 4EFEA 2QM7A 1AB3A 2UUAO 2HR3A 4JI3B 1XNQO 3FB8C 2QEXV 3CRRA 5IYZB 3ZMTA 2YI9A 1R6KA 2XT9A 1JJOA 1F51A 1NVPD 3KCYA 2Q4PA 1Q5OA 2ZINA 3JD1A 3OTOB 4LFCO 5FL7G 3CCEV 5CB4B 3BEHA 3RYHB 1N33B 5FPOA 3BAAA 4LF5O 1IX9A 4FM0A 2YICA 4FJCC 1W0JG 3ABMB 4RUFA 4DR3O 1OJHA 3SPCA 2CTRA 1QLEC 4I55B 1MOFA 4PDMA 4IGGA 5BMVA 2CK3G 3W7UA 2KG7A 2IJIA 3G80A 4DV1B 2V1DA 1I0HA 4ZOLA 4L87A 1EBOA 2EINB 1JMKC 2Q68A 1PNKA 4UB6Z 2N04A 4AHCA 4C7UA 4PI0A 3BVOA 2WA4A 3JAWB 2JS5A 4OX9B 1WP7A 4MTXA 4JAVA 2UXDB 5IE9A 4X62O 2DYRB 1NQTA 4RWUA 3H1JH 3HKDA 2QWQB 1VF6C 2B1IA 1YEWA 1MG1A 1P49A 3ZMVA 4PA7A 4LF4B 1X4TA 1SQVH 3GWKC 5LGTA 2A7WA 1YVWA 5K1XA 1OCOC 4UCTA 5GTIZ 1SQBH 3P30A 1CEZA 3AG2C 2Y0IA 1N0JA 4JYAB 2BSKB 4JI2O 2QWRB 1GK9A 3OR6C 1NJIW 4DR7B 4MVMA 1K5SA 3HKCA 4MVZA 3BABA 3O65A 2KSDA 3X2QC 2XAFA 5B1AB 3OT7A 3I55V 1VARA 1Y6XA 3HKBB 3SDLA 3CX5F 1W59A 1MSDA 2DW4A 1H2KA 2A79B 1Q90D 4JTCB 1QCEA 4PA3A 3AG4B 4J10A 2UXBB 2YUAA 1P4RA 4WFEA 1HNZB 2GV9A 4TT3G 3ZHQA 4MTFA 3G4SV 2Z0AA 2YIBA 3TXSA 3RFRA 3SPGA 3CC4V 2ADPA 2YIDA 4YY3B 4LF7O 3VQYA 3F5TA 2X0LA 1SETA 3DTUB 4ASUG 4X88A 1SQFA 1RP3B 1BL8A 3G6EV 2YSUB 5IWAO 1PP9H 5LYJA 1G6UA 4RO2A 1V9PA 2R9IA 1HDJA 4UV8A 3F5WC 1AP6A 4CS4A 4PA4A 3OEEG 1AR1B 4MT8A 1O9GA 1H38A 3A0HZ 4BIOA 3RYFA 2UXNA 2ITDC 2CH7B 3UO2A 3A0RA 2JGDB 5LMUB 4GKJO 3FD9A 4YJ3B 3CCUV 4H33A 5E1AC 2AHYA 3BPZA 2PI5A 4AILC 2DMXA 1XUQA 2HVKC 1SZTA 4BWAA 2MW2B 4I0XB 1GM7A 4I7ZB 4NTXA 3Q4HB 3L72H 1U97A 4AQYO 4X20B 2F95B 1Y66A 2JJ2G 4DV7B 3K04A 3VQWA 2Q7GA 1H2NA 2HJFC 2Q67A 3AG2B 4UXNA 3OE7G 3OD4A 2Y69C 2JIZG 1QQCA 3RN4A 3I5DA 1JOYA 4FLVA 4NB5A 1XMOB 1IZ3A 3OR7C 1GM8A 2OIGA 5CBFA 1HWYA 1Q86W 4DV0B 2F4VO 4GYCB 2JGUA 3ASOC 4E2LA 1FXVA 5HFLA 2R72A 1XBLA 5FNVB 2WLKA 1YHQV 5H5NA 3S3XA 1NTMH 1UFIA 4DR5B 1SA0B 3QNEA 1XHZA 5JJEB 4PHZA 2OT5A 3CMAV 1VP7A 1BT8A 2DWDC 3B09A 4EKWA 1TVKA 4YIOA 3CCRV 2QKAA 1GMGA 1S5JA 2EIJB 2LGQA 4JI8B 2G38A 2OYQA 2E5LO 2CAZC 2A0LA 1AROP 1Y67A 1KBHA 1QR8A 2WLMA 2WLNA 4X64O 1VQ6V 4K8XA 1N0NA 1XILA 2VQFB 4X65O 3L75H 1WJZA 3D3QA 1YXBA 3CRCA 3K3WA 2WLIA 4TV9B 5ITZA 3WU2Z 4O4LB 4DRXB 2JGDA 1V54C 1GN2A 1ENVA 3LSQA 4ZHQB 3LDCA 3DXRB 2E75B 4U3JA 3SYPA 4PJ0Z 1RPOA 2DYSC 2FB5A 5KUMA 3ASNC 3ZHSA 3FYIB 1EN4A 1XI1A 4I0XA 4PDRA 3RVZA 3LNMB 3TJTA 3K5OA 1VF6A 4TV8A 4K3AA 2GUZA 1I5YA 4B3TO 4O4HB 4DV3O 4NKGB 2KQXA 3G67A 3K0DA 1B6QA 4B08A 3ABKC 2CTQA 4DV5B 4JV5O 2EULA 3RVYA 2YI8A 5LL6Y 2UUCB 1S0VA 3K06A 1VIBA 1DLBA 1WA8A 4FFKA 3UKMA 1B04A 4NTWA 3M99B 5C93A 4LP8A 2ZE6A 2ZE8A 4X66O 3DSQA 3ZHUA 3W7XA 1F4NA 1W2BU 1M93A 3SGIA 3B8NA 1OCRB 3K5LA 1Y76B 1ZSPA 3SPHA 5FNVA 1EZVH 2UXCO 5B1BC 1NBMG 2P7TC 1JFFB 3K03A 1TUEB 3JASB 4DR4B 2E74B 3OMAB 1WLEA 4B3MB 2HEPA 2QWNB 4UCOA 4H13B 4X8AA 5C8YB 4X1KB 4UV9A 1R6TA 3JYCA 3FYEB 2LW1A 3E89A 1Q82W 2GTAA 5J9PC 2PGGA 2IJKA 4OPAA 1P7BA 4DK1A 5TISZ 3CCQV 1M56C 4O4LA 5LXTA 1VQ4V 3CC7V 2Q73A 1X59A 5EYPB 1YZBA 4WFFA 5D5PA 3TETA 1S72V 3HKEB 4U7NA 5D5QA 2XOKG 4FFBB 2W6IG 2B5UA 3J7AU 3ZIAG 3STLC 4X89A 2JDIG 1NKDA 1QR9A 3W7SA 4WFHA 3T1HO 4I9WA 5KMGA 4DV6B 4LWSA 2WSSG 3DGEA 5EZYB 1SC5B 4QIWF 1MZFA 1NS1A 4ZBMA 4JI1O 4H37A 5LA6A 4QNHB 1Q7YW 1OCCB 4BW9A 3LSSA 3W7WA 4DK0A 5LMNB 3N2GB 3RYIB 1I94O 3RW0A 1HNWB 2WPDG 3JATA 2ZM6O 2Y0PA 1PM9A 2N74A 4JI5B 3ABMC 4NYKA 3SYCA 3UM7A 4B7EA 2QSAA 1RM1B 4IIJB 1IBMO 4UVAA 2XAGA 2ITCC 3JAKB 3NR7A 2A3QA 1F4MA 2P4KA 4Z2WA 4NTYA 5LHHA 2ZR3A 2EINC 2PYLA 4FLXA 1K7DA 1JVMA 3KZIZ 4QJFB 4LF9O 5L3EA 3QO8A 1D5AA 4WFBV 3H9VA 2R70A 1AJPA 1R3IC 4J7KA 2HHHO 1YITV 1XEQA 5BZBA 3E8GA 1RFYA 2JS3A 5CMUA 1VQ7V 2DYRC 4NXNO 2IH1C 5LOVB 1P7GA 4I4TB 4MVRA 1LUWA 4DUZO 2ZXWB 3ABUA 1N36O 4JYBA 2QDOA 4D6TH 5JH7B 1AVMA 3CSXA 1Q6UA 4JI7O 4LCUC 1IURA 5JQGA 5EYPA 2NR5A 1N8RW 3E8BA 1Y74B 2F66C 2QWOB 3DC5A 4G2KA 2ETNA 4FFBA 4IL6Z 3ABTA 4O4JA 1E79G 3U10A 4JI4B 4F6RA 4P30A 1VMGA 4O2AB 1R3JC 4XDJA 4J11A 1H2LA 2QR4A 3ETQA 1S5LZ 5B1AC 5FPRA 4DR1B 3L9DA 4UCUA 1SS3A 1WPBA 1KMIZ 3E35A 2BOCC 4GKKB 3AG4C 4G27B 2Q8VA 3RYCB 3WB0A 4NXMO 4LFAB 2UUBB 3N2GA 3LDEA 1E1QG 2Q7EA 3ZN0A 3T1YB 1THZA 3CE2A 2P5OA 1EN5A 4JYAO 4XBFA 2MK3A 1KU9A 2FTKA 3E22B 4UCSA 4P2ZA 3CPWU 2H8PC 4FPPA 3K5MA 5FLXN 4H44B 1D2DA 2KB1A 5CA1B 3SJAC 3ZBHA 1AR5A 1HW7A 1L8DA 3ZRSA 3OMIB 4CBCA 1J5EO 3MD0A 3OUFA 3D8CA 3FB7C 3S3WA 2XTAA 2B1GA 4QGPA 2GHYA 5BY1A 3CMEV 4QPKA 4R6ZA 5EBMC 5KHIA 3TK1A 3UT5B 2CGNA 3QG5A 1VQNV 2WLHA 2ZIOA 2UU9O 1KP2A 4U3FH 5J2TB 1QBZA 4H0LB 4PA9A 5L3CA 4KUMA 4DV4B 1FAFA 4J9ZB 2Z5UA 4RUEA 1GN3A 3SYQA 3OGCC 3PJSK 1H8EG 1A32A 3ETEA 5GTHZ 4DR6B 4YJ2B 4OXSA 3N27A 1FXHA 2K1EA 5LGNA 2ZIMA 3LUTB 2ZNJA 3DC6A 1ORQC 3EVKA 4JI6O 3FB6C 4PV1B 4JF3A 3F7VC 4HNAA 5IYDO 2UUAB 4X1IB 5JVDB 3STZC 4FIPC 1XNQB 2XAQA 5EIBD 2QGNA 5IY5B 1XL4A 2L35A 3CYOA 2ATKC 3F7YC 2BOBC 4DW0A 2XHBA 2ZE5A 1XNRO 2H3OA 4LR3A 1HNXO 4IHJB 2D3OW 1KQSU 2ZDIC 3H1LH 4LH7A 5IYZA 2Q69A 2DJVA 4DXWA 4DV2O 1XDCA 2OIEA 3AEIA 3JALB 1IBKO 3OMNB 1HR0O 4DR2O 1SKVA 5CB4A 4LF5B 1MZEA 5IJ0B 3RYHA 3E22A 5EC1C 3D3IA 3ZRVA 3ZEDA 2EIJC 1AR4A 2W6JG 4TSFG 3CCVV 3E8FA 1IBLO 4I55A 2X7RB 5AG2A 5E79Z 4TQDA 5CA3A 2CDYA 1YCIA 3EHBB 1NR7A 2NN4A 3E83A 1WB8A 4BIZA 2XAHA 1TAEA 1R1BA 1TUBB 2WWWA 5K1PA 2H94A 4X62B 1H8HG 2GTSA 3JAWA 2HJDA 3G71V 2OCHA 4LFBO 1T5EA 2ZE7A 4TWKA 4G28B 1EM1A 2P22C 5KAIZ 1IXMA 2OTJV 5CA0B 2VQFO 5JJNB 2AW9A 1P84F 4N21A 3BA8A 4GUNA 2HG5C 2B9ZA 4JI0O 4YXWG 3U11A 2EZOA 3CCLV 4CH5A 2BSKA 4X1IA 5JVDA 3RT3C 4X1YB 1GM9A 3IGAC 4ZIBA 4R50A 1DGSA 4QE7A 5KX5B 1V55B 1Q6IA 3HKBA 1CXZB 1VEWA 2YC0A 1OCRC 3WFVA 1MABG 3OW2U 1M9NA 1XREA 1SQGA 5J2UB 4P9PA 3JALA 1ZUQA 4FLUA 4DV5O 4FM1A 5LHGA 2N05A 2YEVB 4MW3A 5LBQA 1FJGO 4GX2A 5BR8O 4W4LA 3B2EE 5IJ0A 1ROPA 2EILB 1OV9A 3ZN1A 4A5UB 4LF7B 1AI4A 1NZ6A 4CH4A 3IFXA 3ZMZA 2ZQMA 2HP8A 5EC2C 1URFA 4O4IB 4PELA 1Q8IA 1ZX3A 5IWAB 3E86A 3SYAA 2RDCA 1S3JA 2HLDG 3CCSV 3T4ZA 3BFRA 2EJRA 1BGYH 3FB5C 2RN9A 3OEHG 1Q43A 4JZ2A 5IJ9B 2Q0AA 4ZI7B 4I50B 4NVPA 4GKJB 2ARHA 2CH7A 4F4LA 4J7JA 4YJ3A 2QTSA 4OPHA 3ZJZA 4LF6O 2DWEC 4K0KO 3WB2A 3HR0A 3VQXA 3K5NA 3G6BA 5CA0A 1GO3F 2ZKOA 2RMKB 4AQYB 1R3KC 4LF8O 2DOSA 1XMQB 4Z1VA 3Q4HA 1GH6A 4X20A 3A8TA 1QVFU 2X6BA 5JCOC 2D2CB 4MS2A 2C2AA 4EFBA 1YJNV 3ICXA 3H01A 3IC9A 1OCCC 4KHPO 5HFMA 3H1IH 2IM9A 4KP4A 4DO2A 2EZPA 3CXHF 3VQVA 3ZMUA 5EK0A 5GONB 1ZLZA 2RJZA 4LNUB 1M1KW 1K5QA 4HZ3A 1BS3A 2HVJC 5A9GA 1RM1C 2WLJA 2JRIA 3L70H 2YXLA 2F4VB 1S76D 3IC7A 5J2UA 4NR1A 2ZDIA 3EXAA 2XNDG 3QF7A 3VOUA 2RCVA 3PN1A 2YEVA 5B1OA 1JA8A 3JSLA 5KHGA 1K33A 3ABLB 1ZAUA 4B3RO 1SA0A 4J41A 1WAZA 5JWPA 1IXBA 5IDJA 2PZSA 2VQEO 1JQ0A 4JTAB 2E5LB 3ETGA 4O4IA 1O9HA 4B3SO 4X64B 4TUYB 3T4DA 2ZXWC 4X65B 5CBHA 4TOIA 1TGOA 3TGUH 2NLJC 5B66Z 1NT2B 1R73A 4UVCA 1UJWB 4O2BB 3HPLC 3KG2A 3P3PA 2GBOA 4XDKA 4TV9A 4MTOA 4DYLA 4I50A 1QHTA 4DRXA 2P67A 4F6EA 3JD4A 4ZHQA 3CCMV 1RPRA 3DXRA 2ZT9B 4J7ZA 1EN6A 1PL4A 4MW8A 1OCZB 4CC6A 4B3TB 3SR2C 1PV0A 2VWKA 4XDLA 4O4HA 5KHHA 2OTLV 4JV5B 3N2KB 4RAIA 1WP8A 1NH2B 4K8ZA 2P4VA 1JJ2U 4FLYA 1EZJA 5EIBC 5GONA 3GWOA 4JI4O 3GVMA 3MHHC 3UO3A 1N32O 4J80A 5L3FA 5DECA 1BSMA 2JJ1G 3NXSA 3CRMA 4X66B 4GZRB 4YHHO 1Z5VA 2W0XA 1HP8A 4FZ1A 4JI3O 4HBNA 4CS3A 2UXCB 1Y76A 4PA6A 1K34A 2JK5C 4LFAO 1KP3A 2KKWA 1JFFA 1PPJH 3BHPA 1BHAA 3KCXA 5EBLC 1F7YA 3JASA 4JYYA 3OTOO 1VQPV 3JARB 1N33O 5C8YA 3JD0A 2EJ7A 4GLXA 1IVSA 3JCUZ 2EBOA 3LSUA 3T2MA 4X1KA 1AP5A 1M57B 4EEQA 3BCCH 3ML0A 2X6CA 4EB6B 5IYCO 5L3DA 4WFGA 1VQMV 1DF5A 2Q7HA 4ZOLB 4LBEC 1K4CC 1LUVA 4DV1O 4UCVA 1L1FA 1M5IA 1DTOA 3AG3B 5EBWC 1YI2V 2QE7G 1MA1A 3M7MX 3FAVB 3HKEA 1GN6A 2P06A 1AILA 1NH2D 1N34B 3T1HB 1FXKB 4GX0A 4OX9O 3CB2A 1GN4A 2V4DA 4E4EA 2UXDO 2K9PA 5DEDA 5IY5C 2HFEC 4KFMA 1I5XA 5B5EZ 1K92A 2DE0X 2QTOA 2EIKB 5EZYA 5GW7A 1GKFA 4ABMA 2EIMB 3CHXA 3CWBH 5JCOA 3ZHRA 3ETDA 4LF4O 2AGAA 5KHJA 1I94B 1PKXA 5BXZA 3RYIA 2ZM6B 2QA4V 1FYJA 1NTZH 3IAYA 1OZ0A 3HKCB 1K73W 1FKAO 4DR7O 1IBMB 3CEIA 3K9SA 1Z2GA 4IIJA 2P90A 2JVDA 5B3SB 3JAKA 5CBGA 3BA9A 3JCZA 4ZKIA 4DUYB 4Q20A 2OCCB 2VRZA 4LF9B 2UXBO 3SJBC 1K8AW 1E1RG 1HNZO 4ICGA 3MDSA 3QTCA 3SYOA 3JARA 2HHHB 5A2QN 1KECA 2AZ0A 5KAFZ 4NXNB 5KA6A 1D5NA 1SQXH 4EB6A 4YY3O 4DUZB 5LOVA 1N36B 1Z5WA 4I4TA 3APQA 3AG7A 3FKSG 3CD6V 4JI7B 4JZGA 3P3NA 1XL6A 4FVMA 5LYJB 5JH7A 2LW7A 1COWG 2LP7A 2RNBA 2YIAA 3BRCA 2Y48A 1QU7A 1Y74A 4L8JA 5LGUA 3FAVA 1BHBA 3K79A 1EFRG 3RYFB 3WG7B 2UXXA 1FXKA 3WB1A 5H6QA 1CP9A 4O2AA 1WPXA 1L0NH 3AG1B 5LMUO 2Z3YA 4JAUA 3W7TA 2PYJA 1YIJV 2LO1A 1V55C 2JEXA 3M8AA 2OWOA 1UPGA 3B77A 4NXMB 2VS0A 3C3TA 2XAJA 4IT5A 1WB7A 3RYCA 2CTPA 2CUGA 2LFSA 3KKYA 2BTOA 4BAYA 4LFCB 3R65A 4DV7O 3D36C 4HAMA 3JAMN 2EX3A 2EILC 3OTFA 3ZX6A 4GX1A 3VBBA 1K9MW 1SESA 1PL0A 1YTFB 2ILMA 4YIPA 2QKSA 2YIBD 4DR3B 4DW1A 4WF9V 2RQ6A 2YXYA 4BIUA 5KUKA 3CXCU 4PDVA 1XMOO 2VWJA 5CA1A 1J5EB 3CC2V 1AJNA 4QE9A 1FS0G 4DV0O 2QM8A 1SQPH 2AXTZ 3R66A 2FKXA 2CTWA 4DR5O 2FMLA 2F93B 2Y4TA 4MTGA 3UCSC 2M6YA 1TVKB 3H1KH 3UT5A 2UU9B 3SJCC 4P9OA 5DN6G 5IT9N 2FL4A 1VQ5V 1NTKH 5J2TA 4GX5A 4RQFA 4JI8O 1QLEB 2PY5A 2R9RB 3C90A 3TXQA 3RWRD 3ZMSA 2BTQB 1U96A 1G1XB 1ZWIC 4MVUA 1XHXA 1BQ0A 4YJ2A 4PI2A 2HKOA 2WLIB 5ITZB 4JI6B 2Q6AA 2Y4UA 1Q6HA 4BR6A 4RQEA 3CCJV 1G4YB 1L0LH 2ZCEA 2O57A 3ZRWB 1J95A 4U3JB 2DQ3A 2BCCH 4JI2B 4PD4F 2FYUH 1YF2A 1I08A 2XUMA 1XNRB 4TV8B 3O9OA 1HNXB 4OGQB 2AHZA 4K35A 2GUZB 4X9QA 1FFTB 4MVSA 1XMQO 2M7WA 4IHJA 1FFXB 4DV2B 1YTFD 3E8HA 1R3LC 1QLNA 2IJHA 1IBKB 1OCOB 4IYHA 1HR0B 4DR2B 3OUSA 2XASA 3ABLC 5CN0A 1LNQA 3J80N 3A2FA 3FX7A 3J81N 1WA8B 1M90W 4JPRA 2UUCO 2YXHA 4KXRA 1BE3H 2IJJA 1MSWD 3THOA 3X2QB 3ZS8C 3OM3B 4R8CA 4CS2A 3ZRXA 1IBLB 1AJQA 2GSMB 3K9AA 1N4CA 2V7QG 4GCZA 4WFAV 3LNNA 2QJ1A 5LP6C 4FK5C 3B8MA 4UB8Z 1VQLV 3CJHB 1DK1A 3OAAG 3OFNG 2IU0A 1PNLA 4JYCA 3E2EA 3JSNA 5KA5A 4CH3A 3QVNA 1TUBA 1CPYA 1QVGU 4QPJA 2ODMA 2Q9LA 4DR4O 2AZ2A 1ZTEA 3CRQA 4LFBB 4B3MO 4AI8A 2DN9A 3A0BZ 1SERA 2X6AA 1NR1A 1OCZC 3B40A 2GDSA 2BTQA 3L71H 4CZZA 3BY6A 2IH3C 1JPXA 4FMTA 1K97A 4JI0B 4MVOA 1KUQA 1OHHG 1YJWV 1M4UA 1YDXA 3K0GA 5LXTB 2A9HA 4LH6A 1Y4MA 2Q0OC 1B06A 3ZRWA 4MVQA 5IYBO 1SQQH 1KYOF 2WLLB 3K57A 1BCCH 1H2GA 4X1YA 4MSWC 1GAXA 3EFFK 4KL1A 5KMGB 5DM6V
chains in the Genus database with same CATH topology
1U96A 1Z2GA 2RNBA 1U97A 2LGQA 2RN9A 2LQTA 1HP8A 2HP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U96 A;  1Z2G A;  2RNB A;  1U97 A;  2LGQ A;  2RN9 A;  2LQT A;  1HP8 A;  2HP8 A; 
#chains in the Genus database with same CATH topology
 1FFX A;  2A06 H;  4LWS B;  5KX5 A;  1KC8 W;  4J9Y B;  4DV6 O;  1KD1 W;  3ZHV A;  2F23 A;  1G8M A;  1B3Q A;  5JJJ B;  5LA6 B;  4FM2 A;  3GB7 C;  2W0F C;  4TQF A;  2LFR A;  1H2S B;  3CS5 A;  1FJG B;  5BR8 B;  4W4K A;  1YSC A;  4UVB A;  3K58 A;  4WBN B;  3D36 A;  5LMN O;  1I7F A;  3JAT B;  1LR1 A;  2QM4 A;  3P32 A;  4N23 A;  2Y69 B;  1HNW O;  3AK1 A;  2WA3 A;  1JCH A;  1AI5 A;  1VF7 A;  3K08 A;  2CE4 A;  1M57 C;  4JI5 O;  3TCU A;  3MHS C;  5L3G A;  2QWP B;  2E3C A;  3CP1 A;  3ASO B;  2PF4 E;  3CJH A;  1DF4 A;  2NNU A;  1XQ8 A;  5LP6 B;  1YJ9 V;  4FLW A;  3AG3 C;  5IJ9 A;  3QO7 A;  3B4S A;  4ZI7 A;  2L6L A;  5H6R A;  1PD3 A;  3CRA A;  1AI6 A;  4LC1 A;  4I5S A;  3SJQ C;  4LF6 B;  3QO5 A;  1FXK C;  1RSO B;  4K0K B;  1KB9 F;  2F1M A;  3UQ8 A;  1GTO A;  1R6N A;  1MMM A;  4FZ0 A;  3LDD A;  1Q3E A;  3H1H H;  1KKC A;  1TA8 A;  4LF8 B;  4Q6G A;  4UFZ A;  1ZL8 B;  1US6 A;  2F43 G;  2YS8 A;  1VQO V;  2EIK C;  3MAQ A;  4DV3 B;  2EIM C;  5JQG B;  3I56 V;  1H2M A;  1JR9 A;  4BW5 A;  1K3E A;  4KHP B;  1F23 A;  1MNG A;  2Q5Z A;  2WLL A;  4O4J B;  4UUJ C;  1V54 B;  1S5H C;  1S77 D;  4F6R B;  5F2V O;  3K59 A;  1N34 O;  4LNU A;  5KLV H;  2DYS B;  4I9Q A;  3ASN B;  2LGW A;  1WN7 A;  5H9C A;  3RBZ A;  3RGB A;  2LQT A;  1VQ8 V;  4DR1 O;  3ZHT A;  1JX9 A;  4UCR A;  1BQZ A;  1K4D C;  5B3S C;  1VF5 B;  1Q81 W;  2ADQ B;  3IJ4 A;  4B7K A;  4JAA A;  1BZK A;  4CH6 A;  4D7S A;  4GKK O;  2OCC C;  3HB3 B;  3ZCC A;  3ABK B;  5LHI A;  4B3R B;  1QNM A;  4WBN A;  2JEU A;  4HYO A;  4PDL A;  2UUB O;  2ZD9 A;  3APO A;  2VQE B;  3T1Y O;  3AK3 A;  1IDS A;  4GT1 A;  3FFQ A;  2QKC A;  4D7T A;  4B3S B;  1BMF G;  4U7O A;  4TUY A;  1NVP B;  2PUS A;  4IYI A;  1KKD A;  5H2F Z;  4J42 A;  5BMV B;  4DUY O;  2KG7 B;  5LP6 A;  4FLZ A;  4JGS A;  5B1B B;  1NU1 H;  4O2B A;  3T1C A;  4CC5 A;  1SZX A;  2BE3 A;  1VQK V;  1XOU A;  5L3B A;  5KHK A;  2E76 B;  2R9A A;  1AI7 A;  2PTM A;  3WG7 C;  3SPI A;  3U0Z A;  2DQ0 A;  1RSO A;  4R7C A;  2IW5 A;  2LJ2 A;  4FLT A;  3L73 H;  3AG1 C;  3L74 H;  3JD3 A;  2PI4 A;  4JAS A;  4WCE V;  1ZL8 A;  1GRJ A;  4JTD B;  1W0K G;  2P6J A;  3JD2 A;  1FPO A;  3HKD B;  2ZNI A;  4DV4 O;  1SF9 A;  1WNS A;  5B1N A;  4JI1 B;  2YDE A;  3OGI B;  3AK2 A;  1SRY A;  3N2K A;  4DR6 O;  1M56 B;  2CGO A;  3SPJ A;  2IU3 A;  1N32 B;  2ZR2 A;  2WAM A;  4HNA B;  4Z1M G;  2IBZ H;  3C3S A;  1FD9 A;  4YHH B;  1VQ9 V;  1PNM A;  1NI8 A;  4EFE A;  2QM7 A;  1AB3 A;  2UUA O;  2HR3 A;  4JI3 B;  1XNQ O;  3FB8 C;  2QEX V;  3CRR A;  5IYZ B;  3ZMT A;  2YI9 A;  1R6K A;  2XT9 A;  1JJO A;  1F51 A;  1NVP D;  3KCY A;  2Q4P A;  1Q5O A;  2ZIN A;  3JD1 A;  3OTO B;  4LFC O;  5FL7 G;  3CCE V;  5CB4 B;  3BEH A;  3RYH B;  1N33 B;  5FPO A;  3BAA A;  4LF5 O;  1IX9 A;  4FM0 A;  2YIC A;  4FJC C;  1W0J G;  3ABM B;  4RUF A;  4DR3 O;  1OJH A;  3SPC A;  2CTR A;  1QLE C;  4I55 B;  1MOF A;  4PDM A;  4IGG A;  5BMV A;  2CK3 G;  3W7U A;  2KG7 A;  2IJI A;  3G80 A;  4DV1 B;  2V1D A;  1I0H A;  4ZOL A;  4L87 A;  1EBO A;  2EIN B;  1JMK C;  2Q68 A;  1PNK A;  4UB6 Z;  2N04 A;  4AHC A;  4C7U A;  4PI0 A;  3BVO A;  2WA4 A;  3JAW B;  2JS5 A;  4OX9 B;  1WP7 A;  4MTX A;  4JAV A;  2UXD B;  5IE9 A;  4X62 O;  2DYR B;  1NQT A;  4RWU A;  3H1J H;  3HKD A;  2QWQ B;  1VF6 C;  2B1I A;  1YEW A;  1MG1 A;  1P49 A;  3ZMV A;  4PA7 A;  4LF4 B;  1X4T A;  1SQV H;  3GWK C;  5LGT A;  2A7W A;  1YVW A;  5K1X A;  1OCO C;  4UCT A;  5GTI Z;  1SQB H;  3P30 A;  1CEZ A;  3AG2 C;  2Y0I A;  1N0J A;  4JYA B;  2BSK B;  4JI2 O;  2QWR B;  1GK9 A;  3OR6 C;  1NJI W;  4DR7 B;  4MVM A;  1K5S A;  3HKC A;  4MVZ A;  3BAB A;  3O65 A;  2KSD A;  3X2Q C;  2XAF A;  5B1A B;  3OT7 A;  3I55 V;  1VAR A;  1Y6X A;  3HKB B;  3SDL A;  3CX5 F;  1W59 A;  1MSD A;  2DW4 A;  1H2K A;  2A79 B;  1Q90 D;  4JTC B;  1QCE A;  4PA3 A;  3AG4 B;  4J10 A;  2UXB B;  2YUA A;  1P4R A;  4WFE A;  1HNZ B;  2GV9 A;  4TT3 G;  3ZHQ A;  4MTF A;  3G4S V;  2Z0A A;  2YIB A;  3TXS A;  3RFR A;  3SPG A;  3CC4 V;  2ADP A;  2YID A;  4YY3 B;  4LF7 O;  3VQY A;  3F5T A;  2X0L A;  1SET A;  3DTU B;  4ASU G;  4X88 A;  1SQF A;  1RP3 B;  1BL8 A;  3G6E V;  2YSU B;  5IWA O;  1PP9 H;  5LYJ A;  1G6U A;  4RO2 A;  1V9P A;  2R9I A;  1HDJ A;  4UV8 A;  3F5W C;  1AP6 A;  4CS4 A;  4PA4 A;  3OEE G;  1AR1 B;  4MT8 A;  1O9G A;  1H38 A;  3A0H Z;  4BIO A;  3RYF A;  2UXN A;  2ITD C;  2CH7 B;  3UO2 A;  3A0R A;  2JGD B;  5LMU B;  4GKJ O;  3FD9 A;  4YJ3 B;  3CCU V;  4H33 A;  5E1A C;  2AHY A;  3BPZ A;  2PI5 A;  4AIL C;  2DMX A;  1XUQ A;  2HVK C;  1SZT A;  4BWA A;  2MW2 B;  4I0X B;  1GM7 A;  4I7Z B;  4NTX A;  3Q4H B;  3L72 H;  1U97 A;  4AQY O;  4X20 B;  2F95 B;  1Y66 A;  2JJ2 G;  4DV7 B;  3K04 A;  3VQW A;  2Q7G A;  1H2N A;  2HJF C;  2Q67 A;  3AG2 B;  4UXN A;  3OE7 G;  3OD4 A;  2Y69 C;  2JIZ G;  1QQC A;  3RN4 A;  3I5D A;  1JOY A;  4FLV A;  4NB5 A;  1XMO B;  1IZ3 A;  3OR7 C;  1GM8 A;  2OIG A;  5CBF A;  1HWY A;  1Q86 W;  4DV0 B;  2F4V O;  4GYC B;  2JGU A;  3ASO C;  4E2L A;  1FXV A;  5HFL A;  2R72 A;  1XBL A;  5FNV B;  2WLK A;  1YHQ V;  5H5N A;  3S3X A;  1NTM H;  1UFI A;  4DR5 B;  1SA0 B;  3QNE A;  1XHZ A;  5JJE B;  4PHZ A;  2OT5 A;  3CMA V;  1VP7 A;  1BT8 A;  2DWD C;  3B09 A;  4EKW A;  1TVK A;  4YIO A;  3CCR V;  2QKA A;  1GMG A;  1S5J A;  2EIJ B;  2LGQ A;  4JI8 B;  2G38 A;  2OYQ A;  2E5L O;  2CAZ C;  2A0L A;  1ARO P;  1Y67 A;  1KBH A;  1QR8 A;  2WLM A;  2WLN A;  4X64 O;  1VQ6 V;  4K8X A;  1N0N A;  1XIL A;  2VQF B;  4X65 O;  3L75 H;  1WJZ A;  3D3Q A;  1YXB A;  3CRC A;  3K3W A;  2WLI A;  4TV9 B;  5ITZ A;  3WU2 Z;  4O4L B;  4DRX B;  2JGD A;  1V54 C;  1GN2 A;  1ENV A;  3LSQ A;  4ZHQ B;  3LDC A;  3DXR B;  2E75 B;  4U3J A;  3SYP A;  4PJ0 Z;  1RPO A;  2DYS C;  2FB5 A;  5KUM A;  3ASN C;  3ZHS A;  3FYI B;  1EN4 A;  1XI1 A;  4I0X A;  4PDR A;  3RVZ A;  3LNM B;  3TJT A;  3K5O A;  1VF6 A;  4TV8 A;  4K3A A;  2GUZ A;  1I5Y A;  4B3T O;  4O4H B;  4DV3 O;  4NKG B;  2KQX A;  3G67 A;  3K0D A;  1B6Q A;  4B08 A;  3ABK C;  2CTQ A;  4DV5 B;  4JV5 O;  2EUL A;  3RVY A;  2YI8 A;  5LL6 Y;  2UUC B;  1S0V A;  3K06 A;  1VIB A;  1DLB A;  1WA8 A;  4FFK A;  3UKM A;  1B04 A;  4NTW A;  3M99 B;  5C93 A;  4LP8 A;  2ZE6 A;  2ZE8 A;  4X66 O;  3DSQ A;  3ZHU A;  3W7X A;  1F4N A;  1W2B U;  1M93 A;  3SGI A;  3B8N A;  1OCR B;  3K5L A;  1Y76 B;  1ZSP A;  3SPH A;  5FNV A;  1EZV H;  2UXC O;  5B1B C;  1NBM G;  2P7T C;  1JFF B;  3K03 A;  1TUE B;  3JAS B;  4DR4 B;  2E74 B;  3OMA B;  1WLE A;  4B3M B;  2HEP A;  2QWN B;  4UCO A;  4H13 B;  4X8A A;  5C8Y B;  4X1K B;  4UV9 A;  1R6T A;  3JYC A;  3FYE B;  2LW1 A;  3E89 A;  1Q82 W;  2GTA A;  5J9P C;  2PGG A;  2IJK A;  4OPA A;  1P7B A;  4DK1 A;  5TIS Z;  3CCQ V;  1M56 C;  4O4L A;  5LXT A;  1VQ4 V;  3CC7 V;  2Q73 A;  1X59 A;  5EYP B;  1YZB A;  4WFF A;  5D5P A;  3TET A;  1S72 V;  3HKE B;  4U7N A;  5D5Q A;  2XOK G;  4FFB B;  2W6I G;  2B5U A;  3J7A U;  3ZIA G;  3STL C;  4X89 A;  2JDI G;  1NKD A;  1QR9 A;  3W7S A;  4WFH A;  3T1H O;  4I9W A;  5KMG A;  4DV6 B;  4LWS A;  2WSS G;  3DGE A;  5EZY B;  1SC5 B;  4QIW F;  1MZF A;  1NS1 A;  4ZBM A;  4JI1 O;  4H37 A;  5LA6 A;  4QNH B;  1Q7Y W;  1OCC B;  4BW9 A;  3LSS A;  3W7W A;  4DK0 A;  5LMN B;  3N2G B;  3RYI B;  1I94 O;  3RW0 A;  1HNW B;  2WPD G;  3JAT A;  2ZM6 O;  2Y0P A;  1PM9 A;  2N74 A;  4JI5 B;  3ABM C;  4NYK A;  3SYC A;  3UM7 A;  4B7E A;  2QSA A;  1RM1 B;  4IIJ B;  1IBM O;  4UVA A;  2XAG A;  2ITC C;  3JAK B;  3NR7 A;  2A3Q A;  1F4M A;  2P4K A;  4Z2W A;  4NTY A;  5LHH A;  2ZR3 A;  2EIN C;  2PYL A;  4FLX A;  1K7D A;  1JVM A;  3KZI Z;  4QJF B;  4LF9 O;  5L3E A;  3QO8 A;  1D5A A;  4WFB V;  3H9V A;  2R70 A;  1AJP A;  1R3I C;  4J7K A;  2HHH O;  1YIT V;  1XEQ A;  5BZB A;  3E8G A;  1RFY A;  2JS3 A;  5CMU A;  1VQ7 V;  2DYR C;  4NXN O;  2IH1 C;  5LOV B;  1P7G A;  4I4T B;  4MVR A;  1LUW A;  4DUZ O;  2ZXW B;  3ABU A;  1N36 O;  4JYB A;  2QDO A;  4D6T H;  5JH7 B;  1AVM A;  3CSX A;  1Q6U A;  4JI7 O;  4LCU C;  1IUR A;  5JQG A;  5EYP A;  2NR5 A;  1N8R W;  3E8B A;  1Y74 B;  2F66 C;  2QWO B;  3DC5 A;  4G2K A;  2ETN A;  4FFB A;  4IL6 Z;  3ABT A;  4O4J A;  1E79 G;  3U10 A;  4JI4 B;  4F6R A;  4P30 A;  1VMG A;  4O2A B;  1R3J C;  4XDJ A;  4J11 A;  1H2L A;  2QR4 A;  3ETQ A;  1S5L Z;  5B1A C;  5FPR A;  4DR1 B;  3L9D A;  4UCU A;  1SS3 A;  1WPB A;  1KMI Z;  3E35 A;  2BOC C;  4GKK B;  3AG4 C;  4G27 B;  2Q8V A;  3RYC B;  3WB0 A;  4NXM O;  4LFA B;  2UUB B;  3N2G A;  3LDE A;  1E1Q G;  2Q7E A;  3ZN0 A;  3T1Y B;  1THZ A;  3CE2 A;  2P5O A;  1EN5 A;  4JYA O;  4XBF A;  2MK3 A;  1KU9 A;  2FTK A;  3E22 B;  4UCS A;  4P2Z A;  3CPW U;  2H8P C;  4FPP A;  3K5M A;  5FLX N;  4H44 B;  1D2D A;  2KB1 A;  5CA1 B;  3SJA C;  3ZBH A;  1AR5 A;  1HW7 A;  1L8D A;  3ZRS A;  3OMI B;  4CBC A;  1J5E O;  3MD0 A;  3OUF A;  3D8C A;  3FB7 C;  3S3W A;  2XTA A;  2B1G A;  4QGP A;  2GHY A;  5BY1 A;  3CME V;  4QPK A;  4R6Z A;  5EBM C;  5KHI A;  3TK1 A;  3UT5 B;  2CGN A;  3QG5 A;  1VQN V;  2WLH A;  2ZIO A;  2UU9 O;  1KP2 A;  4U3F H;  5J2T B;  1QBZ A;  4H0L B;  4PA9 A;  5L3C A;  4KUM A;  4DV4 B;  1FAF A;  4J9Z B;  2Z5U A;  4RUE A;  1GN3 A;  3SYQ A;  3OGC C;  3PJS K;  1H8E G;  1A32 A;  3ETE A;  5GTH Z;  4DR6 B;  4YJ2 B;  4OXS A;  3N27 A;  1FXH A;  2K1E A;  5LGN A;  2ZIM A;  3LUT B;  2ZNJ A;  3DC6 A;  1ORQ C;  3EVK A;  4JI6 O;  3FB6 C;  4PV1 B;  4JF3 A;  3F7V C;  4HNA A;  5IYD O;  2UUA B;  4X1I B;  5JVD B;  3STZ C;  4FIP C;  1XNQ B;  2XAQ A;  5EIB D;  2QGN A;  5IY5 B;  1XL4 A;  2L35 A;  3CYO A;  2ATK C;  3F7Y C;  2BOB C;  4DW0 A;  2XHB A;  2ZE5 A;  1XNR O;  2H3O A;  4LR3 A;  1HNX O;  4IHJ B;  2D3O W;  1KQS U;  2ZDI C;  3H1L H;  4LH7 A;  5IYZ A;  2Q69 A;  2DJV A;  4DXW A;  4DV2 O;  1XDC A;  2OIE A;  3AEI A;  3JAL B;  1IBK O;  3OMN B;  1HR0 O;  4DR2 O;  1SKV A;  5CB4 A;  4LF5 B;  1MZE A;  5IJ0 B;  3RYH A;  3E22 A;  5EC1 C;  3D3I A;  3ZRV A;  3ZED A;  2EIJ C;  1AR4 A;  2W6J G;  4TSF G;  3CCV V;  3E8F A;  1IBL O;  4I55 A;  2X7R B;  5AG2 A;  5E79 Z;  4TQD A;  5CA3 A;  2CDY A;  1YCI A;  3EHB B;  1NR7 A;  2NN4 A;  3E83 A;  1WB8 A;  4BIZ A;  2XAH A;  1TAE A;  1R1B A;  1TUB B;  2WWW A;  5K1P A;  2H94 A;  4X62 B;  1H8H G;  2GTS A;  3JAW A;  2HJD A;  3G71 V;  2OCH A;  4LFB O;  1T5E A;  2ZE7 A;  4TWK A;  4G28 B;  1EM1 A;  2P22 C;  5KAI Z;  1IXM A;  2OTJ V;  5CA0 B;  2VQF O;  5JJN B;  2AW9 A;  1P84 F;  4N21 A;  3BA8 A;  4GUN A;  2HG5 C;  2B9Z A;  4JI0 O;  4YXW G;  3U11 A;  2EZO A;  3CCL V;  4CH5 A;  2BSK A;  4X1I A;  5JVD A;  3RT3 C;  4X1Y B;  1GM9 A;  3IGA C;  4ZIB A;  4R50 A;  1DGS A;  4QE7 A;  5KX5 B;  1V55 B;  1Q6I A;  3HKB A;  1CXZ B;  1VEW A;  2YC0 A;  1OCR C;  3WFV A;  1MAB G;  3OW2 U;  1M9N A;  1XRE A;  1SQG A;  5J2U B;  4P9P A;  3JAL A;  1ZUQ A;  4FLU A;  4DV5 O;  4FM1 A;  5LHG A;  2N05 A;  2YEV B;  4MW3 A;  5LBQ A;  1FJG O;  4GX2 A;  5BR8 O;  4W4L A;  3B2E E;  5IJ0 A;  1ROP A;  2EIL B;  1OV9 A;  3ZN1 A;  4A5U B;  4LF7 B;  1AI4 A;  1NZ6 A;  4CH4 A;  3IFX A;  3ZMZ A;  2ZQM A;  2HP8 A;  5EC2 C;  1URF A;  4O4I B;  4PEL A;  1Q8I A;  1ZX3 A;  5IWA B;  3E86 A;  3SYA A;  2RDC A;  1S3J A;  2HLD G;  3CCS V;  3T4Z A;  3BFR A;  2EJR A;  1BGY H;  3FB5 C;  2RN9 A;  3OEH G;  1Q43 A;  4JZ2 A;  5IJ9 B;  2Q0A A;  4ZI7 B;  4I50 B;  4NVP A;  4GKJ B;  2ARH A;  2CH7 A;  4F4L A;  4J7J A;  4YJ3 A;  2QTS A;  4OPH A;  3ZJZ A;  4LF6 O;  2DWE C;  4K0K O;  3WB2 A;  3HR0 A;  3VQX A;  3K5N A;  3G6B A;  5CA0 A;  1GO3 F;  2ZKO A;  2RMK B;  4AQY B;  1R3K C;  4LF8 O;  2DOS A;  1XMQ B;  4Z1V A;  3Q4H A;  1GH6 A;  4X20 A;  3A8T A;  1QVF U;  2X6B A;  5JCO C;  2D2C B;  4MS2 A;  2C2A A;  4EFB A;  1YJN V;  3ICX A;  3H01 A;  3IC9 A;  1OCC C;  4KHP O;  5HFM A;  3H1I H;  2IM9 A;  4KP4 A;  4DO2 A;  2EZP A;  3CXH F;  3VQV A;  3ZMU A;  5EK0 A;  5GON B;  1ZLZ A;  2RJZ A;  4LNU B;  1M1K W;  1K5Q A;  4HZ3 A;  1BS3 A;  2HVJ C;  5A9G A;  1RM1 C;  2WLJ A;  2JRI A;  3L70 H;  2YXL A;  2F4V B;  1S76 D;  3IC7 A;  5J2U A;  4NR1 A;  2ZDI A;  3EXA A;  2XND G;  3QF7 A;  3VOU A;  2RCV A;  3PN1 A;  2YEV A;  5B1O A;  1JA8 A;  3JSL A;  5KHG A;  1K33 A;  3ABL B;  1ZAU A;  4B3R O;  1SA0 A;  4J41 A;  1WAZ A;  5JWP A;  1IXB A;  5IDJ A;  2PZS A;  2VQE O;  1JQ0 A;  4JTA B;  2E5L B;  3ETG A;  4O4I A;  1O9H A;  4B3S O;  4X64 B;  4TUY B;  3T4D A;  2ZXW C;  4X65 B;  5CBH A;  4TOI A;  1TGO A;  3TGU H;  2NLJ C;  5B66 Z;  1NT2 B;  1R73 A;  4UVC A;  1UJW B;  4O2B B;  3HPL C;  3KG2 A;  3P3P A;  2GBO A;  4XDK A;  4TV9 A;  4MTO A;  4DYL A;  4I50 A;  1QHT A;  4DRX A;  2P67 A;  4F6E A;  3JD4 A;  4ZHQ A;  3CCM V;  1RPR A;  3DXR A;  2ZT9 B;  4J7Z A;  1EN6 A;  1PL4 A;  4MW8 A;  1OCZ B;  4CC6 A;  4B3T B;  3SR2 C;  1PV0 A;  2VWK A;  4XDL A;  4O4H A;  5KHH A;  2OTL V;  4JV5 B;  3N2K B;  4RAI A;  1WP8 A;  1NH2 B;  4K8Z A;  2P4V A;  1JJ2 U;  4FLY A;  1EZJ A;  5EIB C;  5GON A;  3GWO A;  4JI4 O;  3GVM A;  3MHH C;  3UO3 A;  1N32 O;  4J80 A;  5L3F A;  5DEC A;  1BSM A;  2JJ1 G;  3NXS A;  3CRM A;  4X66 B;  4GZR B;  4YHH O;  1Z5V A;  2W0X A;  1HP8 A;  4FZ1 A;  4JI3 O;  4HBN A;  4CS3 A;  2UXC B;  1Y76 A;  4PA6 A;  1K34 A;  2JK5 C;  4LFA O;  1KP3 A;  2KKW A;  1JFF A;  1PPJ H;  3BHP A;  1BHA A;  3KCX A;  5EBL C;  1F7Y A;  3JAS A;  4JYY A;  3OTO O;  1VQP V;  3JAR B;  1N33 O;  5C8Y A;  3JD0 A;  2EJ7 A;  4GLX A;  1IVS A;  3JCU Z;  2EBO A;  3LSU A;  3T2M A;  4X1K A;  1AP5 A;  1M57 B;  4EEQ A;  3BCC H;  3ML0 A;  2X6C A;  4EB6 B;  5IYC O;  5L3D A;  4WFG A;  1VQM V;  1DF5 A;  2Q7H A;  4ZOL B;  4LBE C;  1K4C C;  1LUV A;  4DV1 O;  4UCV A;  1L1F A;  1M5I A;  1DTO A;  3AG3 B;  5EBW C;  1YI2 V;  2QE7 G;  1MA1 A;  3M7M X;  3FAV B;  3HKE A;  1GN6 A;  2P06 A;  1AIL A;  1NH2 D;  1N34 B;  3T1H B;  1FXK B;  4GX0 A;  4OX9 O;  3CB2 A;  1GN4 A;  2V4D A;  4E4E A;  2UXD O;  2K9P A;  5DED A;  5IY5 C;  2HFE C;  4KFM A;  1I5X A;  5B5E Z;  1K92 A;  2DE0 X;  2QTO A;  2EIK B;  5EZY A;  5GW7 A;  1GKF A;  4ABM A;  2EIM B;  3CHX A;  3CWB H;  5JCO A;  3ZHR A;  3ETD A;  4LF4 O;  2AGA A;  5KHJ A;  1I94 B;  1PKX A;  5BXZ A;  3RYI A;  2ZM6 B;  2QA4 V;  1FYJ A;  1NTZ H;  3IAY A;  1OZ0 A;  3HKC B;  1K73 W;  1FKA O;  4DR7 O;  1IBM B;  3CEI A;  3K9S A;  1Z2G A;  4IIJ A;  2P90 A;  2JVD A;  5B3S B;  3JAK A;  5CBG A;  3BA9 A;  3JCZ A;  4ZKI A;  4DUY B;  4Q20 A;  2OCC B;  2VRZ A;  4LF9 B;  2UXB O;  3SJB C;  1K8A W;  1E1R G;  1HNZ O;  4ICG A;  3MDS A;  3QTC A;  3SYO A;  3JAR A;  2HHH B;  5A2Q N;  1KEC A;  2AZ0 A;  5KAF Z;  4NXN B;  5KA6 A;  1D5N A;  1SQX H;  4EB6 A;  4YY3 O;  4DUZ B;  5LOV A;  1N36 B;  1Z5W A;  4I4T A;  3APQ A;  3AG7 A;  3FKS G;  3CD6 V;  4JI7 B;  4JZG A;  3P3N A;  1XL6 A;  4FVM A;  5LYJ B;  5JH7 A;  2LW7 A;  1COW G;  2LP7 A;  2RNB A;  2YIA A;  3BRC A;  2Y48 A;  1QU7 A;  1Y74 A;  4L8J A;  5LGU A;  3FAV A;  1BHB A;  3K79 A;  1EFR G;  3RYF B;  3WG7 B;  2UXX A;  1FXK A;  3WB1 A;  5H6Q A;  1CP9 A;  4O2A A;  1WPX A;  1L0N H;  3AG1 B;  5LMU O;  2Z3Y A;  4JAU A;  3W7T A;  2PYJ A;  1YIJ V;  2LO1 A;  1V55 C;  2JEX A;  3M8A A;  2OWO A;  1UPG A;  3B77 A;  4NXM B;  2VS0 A;  3C3T A;  2XAJ A;  4IT5 A;  1WB7 A;  3RYC A;  2CTP A;  2CUG A;  2LFS A;  3KKY A;  2BTO A;  4BAY A;  4LFC B;  3R65 A;  4DV7 O;  3D36 C;  4HAM A;  3JAM N;  2EX3 A;  2EIL C;  3OTF A;  3ZX6 A;  4GX1 A;  3VBB A;  1K9M W;  1SES A;  1PL0 A;  1YTF B;  2ILM A;  4YIP A;  2QKS A;  2YIB D;  4DR3 B;  4DW1 A;  4WF9 V;  2RQ6 A;  2YXY A;  4BIU A;  5KUK A;  3CXC U;  4PDV A;  1XMO O;  2VWJ A;  5CA1 A;  1J5E B;  3CC2 V;  1AJN A;  4QE9 A;  1FS0 G;  4DV0 O;  2QM8 A;  1SQP H;  2AXT Z;  3R66 A;  2FKX A;  2CTW A;  4DR5 O;  2FML A;  2F93 B;  2Y4T A;  4MTG A;  3UCS C;  2M6Y A;  1TVK B;  3H1K H;  3UT5 A;  2UU9 B;  3SJC C;  4P9O A;  5DN6 G;  5IT9 N;  2FL4 A;  1VQ5 V;  1NTK H;  5J2T A;  4GX5 A;  4RQF A;  4JI8 O;  1QLE B;  2PY5 A;  2R9R B;  3C90 A;  3TXQ A;  3RWR D;  3ZMS A;  2BTQ B;  1U96 A;  1G1X B;  1ZWI C;  4MVU A;  1XHX A;  1BQ0 A;  4YJ2 A;  4PI2 A;  2HKO A;  2WLI B;  5ITZ B;  4JI6 B;  2Q6A A;  2Y4U A;  1Q6H A;  4BR6 A;  4RQE A;  3CCJ V;  1G4Y B;  1L0L H;  2ZCE A;  2O57 A;  3ZRW B;  1J95 A;  4U3J B;  2DQ3 A;  2BCC H;  4JI2 B;  4PD4 F;  2FYU H;  1YF2 A;  1I08 A;  2XUM A;  1XNR B;  4TV8 B;  3O9O A;  1HNX B;  4OGQ B;  2AHZ A;  4K35 A;  2GUZ B;  4X9Q A;  1FFT B;  4MVS A;  1XMQ O;  2M7W A;  4IHJ A;  1FFX B;  4DV2 B;  1YTF D;  3E8H A;  1R3L C;  1QLN A;  2IJH A;  1IBK B;  1OCO B;  4IYH A;  1HR0 B;  4DR2 B;  3OUS A;  2XAS A;  3ABL C;  5CN0 A;  1LNQ A;  3J80 N;  3A2F A;  3FX7 A;  3J81 N;  1WA8 B;  1M90 W;  4JPR A;  2UUC O;  2YXH A;  4KXR A;  1BE3 H;  2IJJ A;  1MSW D;  3THO A;  3X2Q B;  3ZS8 C;  3OM3 B;  4R8C A;  4CS2 A;  3ZRX A;  1IBL B;  1AJQ A;  2GSM B;  3K9A A;  1N4C A;  2V7Q G;  4GCZ A;  4WFA V;  3LNN A;  2QJ1 A;  5LP6 C;  4FK5 C;  3B8M A;  4UB8 Z;  1VQL V;  3CJH B;  1DK1 A;  3OAA G;  3OFN G;  2IU0 A;  1PNL A;  4JYC A;  3E2E A;  3JSN A;  5KA5 A;  4CH3 A;  3QVN A;  1TUB A;  1CPY A;  1QVG U;  4QPJ A;  2ODM A;  2Q9L A;  4DR4 O;  2AZ2 A;  1ZTE A;  3CRQ A;  4LFB B;  4B3M O;  4AI8 A;  2DN9 A;  3A0B Z;  1SER A;  2X6A A;  1NR1 A;  1OCZ C;  3B40 A;  2GDS A;  2BTQ A;  3L71 H;  4CZZ A;  3BY6 A;  2IH3 C;  1JPX A;  4FMT A;  1K97 A;  4JI0 B;  4MVO A;  1KUQ A;  1OHH G;  1YJW V;  1M4U A;  1YDX A;  3K0G A;  5LXT B;  2A9H A;  4LH6 A;  1Y4M A;  2Q0O C;  1B06 A;  3ZRW A;  4MVQ A;  5IYB O;  1SQQ H;  1KYO F;  2WLL B;  3K57 A;  1BCC H;  1H2G A;  4X1Y A;  4MSW C;  1GAX A;  3EFF K;  4KL1 A;  5KMG B;  5DM6 V; 
#chains in the Genus database with same CATH homology
 1U96 A;  1Z2G A;  2RNB A;  1U97 A;  2LGQ A;  2RN9 A;  2LQT A;  1HP8 A;  2HP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...