1UACL

Crystal structure of hyhel-10 fv mutant sfsf complexed with turkey white lysozyme
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
107
structure length
107
Chain Sequence
DIVLTQSPATLSVTPGNSVSLSCRASQSIGNNLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural consequences of target epitope-directed functional alteration of an antibody. The case of anti-hen lysozyme antibody, HyHEL-10
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hydrolase
molecule keywords lysozyme binding Ig kappa chain V23-J2 region
total genus 21
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2003-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1uacL00
4ODUA 3Q6GL 1IAOA 3U0TA 2GW5A 3VFGH 4L4JA 2B0SH 4I77H 3K8KA 1BD2E 1LEGA 3ULVL 4LSQH 2DLHA 3UYRL 3RRQA 1G7LB 5E9DA 1NCAH 3QWOB 4HWEL 3QXVA 3PL6C 2ESVA 2NX5D 3MOBL 5DLML 3BE1L 3ARRA 4CADB 3FQTB 4L3EA 5INDA 1IGYB 1HXMB 1Q1JH 5GGSA 1DBBL 3MRCB 1P6AB 4Z95H 5KSVB 4XPTH 4K8RL 1R24B 1MELA 2PW2A 4PV8A 1FDLL 3A6CL 2F53E 5DTFB 1KFAH 3LH2H 5I1LA 1LHZA 5J13C 2WIIA 3B83A 4LU5L 4O2EA 5GRVK 1FFRA 3IDJA 3MRRA 2WQ8A 5E5RB 5B4MC 4XAWL 4MNHB 1QPPA 2QTEA 3I2CL 3ZTJG 5J11B 3J7HA 4E5XB 4KUZL 1MWAB 3WBDA 4RA0C 3MRQB 3PQYE 1N2RB 1ZHNB 5DI8B 1YEIL 4N0UA 5E6YA 1SY6A 3O4OB 3H9SA 1DLHA 1I1AA 1ETZB 3FT2B 5EIIB 3CMOH 3X14A 1XH3B 3QNYB 2GHWB 1IGIL 3RVUC 4WDIA 3EYFA 5FO8B 2Y5TB 5KZCD 2FJGA 1NFIB 5DJAA 4OF0A 4PYGA 4ZTPL 1JGUL 2XZQH 2NTFA 4Q7DA 4XPTL 2VDLL 1QRND 3C8KA 1S7RB 5D2NA 3O6KL 3PHOA 3A0OA 3IRPX 3S36H 5D1XD 3GMMB 5EZLB 4XNUH 1HCVA 1H3PL 5J56B 4PJ5A 1RZ7H 3QO0B 1MCKA 5HVWA 5AD0A 3I85A 4GAYB 4R7NA 5D5ME 1YC7A 3VFWB 3GSUB 3LD8B 3GMOB 3VD5A 4HBCH 4Y4KA 1WICA 1KLGB 3WHXB 4AL8L 1NLBL 4EOWH 5IESH 1QFWL 4P3WA 1X7QB 5KVFL 1S78C 2R4RL 1DBAH 1T83A 5CD5D 1U8HB 4XWGL 4MDJA 4AEIH 3GI8H 4N0FB 3IF1B 4KUCF 2J8OA 5ESQA 5F7LB 2DQJH 1NSNL 3AUVA 3QUXD 2D4DA 5DZLA 3TN0A 1PYWA 4DAGL 5JHLL 4F7CB 4MA1B 5ITFA 5T1MB 1LE5A 1CDIA 2X5PA 4JHWL 5IW1A 1YNLH 2EDXA 1S9KC 4U1JA 2AK4B 4HUWA 4HDIA 1DBML 1D7FA 2EIEA 5LGJA 3PWLB 1E6OH 4JDZB 4DN3H 3IFLL 3BPCA 4AEHH 5HYQB 5EC1A 1I8IA 4CU7A 5I2IB 3O4OC 4FXKA 2DKMA 1T83C 4HXBH 1YUHA 2J1KA 4UT9H 5FV1L 2PR4H 3CFKA 4P9HH 4BZYA 1BVKA 1A6WH 4I13B 5GGUB 3L3GB 5B3NA 1NEZB 1DBJL 3INUL 4OZFG 1JGLL 1DTUA 1PSKH 1N6QH 4RMSA 3DGCR 2P43B 1IKNA 5JW4M 4PREA 5DDHB 12E8L 1KEMH 4BK5A 4XHJC 1U2CA 1U0QA 2QR0A 2GJZA 4I5BA 3MJ9L 4ONHA 2HT2D 4QXUL 1NBYA 3LD8C 4G5ZL 2OP4L 3MLRH 3UTPD 4TSBL 1A2YB 3HE6D 1VEOA 2NY5L 2WP3T 3OKNA 3K4DA 3LKSB 4UQ2B 5D1XC 5DK0B 1J05B 3QEHA 1NGZB 1Q8MA 3V4PH 2D03H 5L88H 3OMZA 2F53D 4RMTA 3QUMA 4S1DC 1M05B 3QDJB 2OP4H 4G5ZH 2DI7A 3RVUD 2XPGB 4JB9H 5B38G 3KYAA 4OZGF 5HYFA 2GK2A 2XG4A 1I7UB 4IBLT 1T89C 4NM8H 3QULA 2OTWA 3RPIA 3OHXA 4NQED 2WAHA 1N26A 4KJPC 5ISZE 4TULH 4LFHD 5C7XH 4JM2B 3RKDD 2BP3A 2EZ0D 4MDIA 2YD8A 5I1IH 1X9QA 4IRJC 4NNYA 4OCXL 3SEPA 4JGMA 3WEXA 5D6DA 3VXMA 3QQ9D 1QBAA 4XPGH 4LGRB 1AO7B 2X1QA 3O8XB 1PLGH 3O2DL 2G5BA 3VG0H 1YEHH 1KCRH 5IB3B 1J8HE 3NCJH 4KZDH 3PP4H 3HAEG 3MRHA 4N1HB 3OAUH 4HFWB 1E6JL 5TJWK 1EGJH 2AV7A 3JV0A 4N8VG 2XNAB 4LBEB 4S0TD 1X5ZA 4XC3L 5TE6H 4BJLA 4I18B 1YECH 3KPSD 2MKWA 5T1KB 1ZT7B 3OXRB 1WIUA 5H94A 3HE7A 1I3GH 3OQ3B 1JWMA 4V1DE 2L7UA 1EO8H 3CVHA 5DA0B 5DK2A 3GK8H 3T2PA 4MAYC 3U9UB 5IW1B 4M48L 1DUYB 4LEXH 1YY9D 2JJWA 1JGVL 1TJIL 4KI1A 4NC1E 1U3HC 2CIIA 2ZNWA 3FFCE 1KCUL 2MFNA 4P2RE 4KTDL 4YXHL 2KL6A 3SJVB 4NQEB 5D9SA 4NNXA 3V0VA 5CP7A 3ZKND 3VXTA 1FNGA 1G9MH 2H3NA 3BSZL 3V7MA 4I9WD 4FXKB 1Z0MA 2BOCB 4JFFA 4JFZL 5EBWB 2VAAB 1YMHA 3MLTB 9CGTA 4QF1B 1P53A 3BEVB 1OAQH 3LN4A 4HK3J 4ZAKA 2WINA 4JRXE 1B0WA 5F9WC 4DFHA 3VG0L 2EE3A 2YMXH 4PRAA 2YA2A 3HZYA 2UVEA 4TNVK 2NY3B 3BN9C 3RWCA 2Z31D 4OD3L 4G9DA 2PYFB 4QHKI 2ADFH 3Q5TA 2VNCA 3FTGB 4GQ9L 1KENL 2Q8AH 2ILLA 4XPHL 5I1HL 4J4PC 3MRMB 1MCJA 1DVFA 1URLA 3D0LA 2XXCB 4TULL 4PJXF 5AUMB 4OGYH 1KLUA 1UM6L 3FAXA 4NN6C 5DHXB 4NM8L 4U1IA 6CGTA 3PP3H 1QLRB 2X2YA 1RMFL 1MCIA 2X4SA 4G80B 5FYJL 3RL1A 2GK0A 2OR7A 2C7UB 1MWAH 5J1AB 3X17A 1KTDB 1L7TL 4X7SL 3I75A 3FO0L 1S9WA 2A1WL 3ZDYE 1IAIH 2D31B 3FT4B 4PJ7A 5FF6A 3RKDC 4AG4H 1Z2KA 1NC4D 4N8VB 4APQC 2NY6D 3ZYJA 5DVOA 1KIRB 3RDTC 3RWIA 3MLVL 2GJ6D 5KSBE 2VDKL 3N85H 3RZCA 3MRDB 2HWZL 1U8KA 3WO4C 5F9OL 1FO0A 3SDAD 4KQ3L 3VFPB 4P5KA 2QLVB 1NL0L 1CR9L 5C70A 3M1BB 1NBVL 5C92A 5IKCB 2VL4A 2B20A 1G7MA 1NJ9B 3GI9H 4HS8H 2JKXA 1R3LA 2UUDH 32C2A 3OB8A 4YDLB 3BN9D 3DYOA 5JORB 1QFHA 1I75A 2R4SL 4GUPA 5HY9A 5SWSD 4DFIA 3UTQA 4PV9A 4YIQB 2A74A 1Q0XL 2XG5A 3WNKA 1ACYH 4L8BA 1NGYA 4H0HB 1TJHH 4HKBB 4PJ5B 1YMMB 2NW3A 1LO4H 1Z6JT 3D69A 1RURL 1UKTA 3QQNA 4RMWA 4MLIA 3U2SA 3Q6GH 4LLUB 3VFTA 2H9GA 2Z8SA 4P4KB 4YDVA 3QIBA 5EFIA 3U7YH 1U95A 4IMKC 5J6HB 1G6RA 4YHIA 5D6CB 3TBSB 4PP2B 3ALPA 1H3GA 4MAYD 3HE6C 4BSWB 4K23H 1ITBB 3BP5B 3H9HB 5JQ6H 4ODXA 1QLFA 1I8MB 2XWBA 4ZTOH 4M7ZC 1TNNA 1XGRB 5EU4A 2VXTH 5FA3B 5FKAB 4YHKL 1J5OL 4FQ2L 4PJBB 1VFMA 5T1KD 1MCOH 5KW9L 4FQIL 5CZVL 1I85A 1M7DA 1WFOA 1FV1A 4BQCA 2IH1B 2X4TB 4WTZG 4XNXH 1OM3L 2J3SA 1RVFL 5EORH 4OCYH 2G75B 2H26B 3QQ9C 4GBXC 4X6DF 2IEPA 3KPOA 3C2SA 3DXAE 2VITA 3JUZA 4RX4A 1MRFL 1D9KD 4CADA 3OSKA 3DMMA 4G8GA 4LIQL 1HCFX 3UZEA 3EOTL 1T2QL 4FRWA 3E2HB 3DIFA 3HNTH 2V2WB 5F7DB 4TUJB 5A16A 2D2OA 2DKSA 4LPYA 4X6DE 2H1PH 5CP3H 4UDUB 2BNQB 3FB5B 3V5DA 1T22A 1PG7H 4XP6H 5A2LH 3BZFB 2DB8A 1B4JH 1HH9B 2F58L 2F5AH 3AU1A 3DSFH 4ZYKA 5IVXA 5LWYL 1WBZA 1ZK9A 3T0VA 3K1DA 4UQ3B 4B50A 4FQLH 3V4UL 3E6HB 5DDHA 3H0TA 3UTSE 4M62H 4X5XA 2ZJSL 5MHSD 2GT9B 2CXGA 2VXUH 1DL7L 4X0KB 3LS4H 4M7JL 2APBA 3OKNB 4RAVB 2FLRT 3DSNA 3SDCC 4KRLB 1U92B 2DWEA 3GJFB 2VZ1A 4LCWA 3EYFB 1JGVH 1KYOJ 3MBXH 3HFML 1CE1H 3OKOB 3QIUA 4HKXA 4L9LB 1IEAB 5IBLC 5IUSA 3ARZA 4NQVB 4NPYA 3PHOB 2CJUH 2J2ZA 2OTUB 2V9TA 2B2XL 1V3MA 2IQ9H 2ZSWB 5CD3B 4MA8H 3B2UC 5FGSA 3TBVA 2VR9A 4K3DH 3O9WD 2GFBB 4DVRH 2J8UB 3NMEA 1MUJA 2VLRA 2R9HC 1F02I 2X4QA 2Z4QB 3D39A 1C1EH 1T21A 1B3JA 3TJHC 4KPHH 3OAUL 1BGXH 2ID5A 3ABZA 1PFCA 3VFSB 1UH4A 4KRPB 3P30H 3DJ9A 4TTDC 1A0QL 2QV2A 3MUHL 5C2BH 1XF2B 4W70A 1UEYA 2Y36L 5F7EH 4Y5VC 1RZJC 1IM9D 3ZSSA 3HCVA 4JPWL 5BV7L 4NSKB 4OCXH 1Z5LB 3OR6A 1MRCH 5FK9B 1FCGA 1GCFA 1F11B 4Z7VB 5D5MF 5AYUH 2JJTA 4QRPA 2X89D 3PWPE 1RZFL 4H20L 4MYWB 5ESQB 4XNYL 1GGTA 3CFCH 1W0YT 5I16A 3MRPB 4M9OA 4R7DB 5HYJA 4ZS7L 1NUNB 3IDNB 2IAMA 1A3RH 4XMKL 3IJSA 4JB9L 2Q20A 3K0WA 2CKBA 1BZ9A 3PGDB 2BK8A 5GRVL 2WBJA 4PJAA 2IALA 3OX8B 4U33A 1OT1A 1CD1B 1S7TA 1DUYA 3HRPA 1FN4B 1JN6B 5HVFB 3K2UH 1N5YL 1JUFA 5CIPH 2NY3C 4KROC 1IQDA 4UB0L 4RA3A 4NC0B 1T6VN 5HDBE 1WIOA 3D0VB 3LEVL 1QSFD 2N4IA 1E4WH 1GHFL 3BGMB 4BSVA 2H3NB 3DXAD 5GIRB 1S7VA 1JHTB 4KKAD 3NA9L 4MCZA 3CH8A 3SGDH 2AAVA 1T6WA 3CFJA 3LDBB 4HT1H 2VXSL 4LAJH 4CJ1A 5I0DA 2EH7H 3SDAA 1FLRL 2EXWD 5CBAB 5I18L 3EHBC 3EOAA 5D7IB 4D0DA 1KXQE 4QOKA 3S5LB 4BZ2H 3ZKQD 4JO3L 2BY3A 3NCEB 2VDRL 4X9IA 1XIWC 4X9HA 1H15B 2H2PD 5IVXB 3RDTB 3MRGA 5CAYB 3VW3H 5IHUH 1NFDB 1MCBA 1RK1A 4TOYH 1XMWA 1NUFA 5JDSB 1G0DA 1N6VA 1AGFA 3TO4B 2IFGA 5KSBA 3JV6B 1HQRB 1MJ8L 1AIFB 2F5BL 4N0UE 3CNKA 3HN3A 2V6HA 4YEFA 3EFFA 3Q5OA 4GH7B 5DRXA 1MFBH 3PWVB 2XQBL 1PZ5A 1TNMA 4JKWA 3TJEH 2BX5A 3KJ4C 5GGVY 5F7YC 1MVUA 2M8XA 4S1SL 5C0AD 5DS8A 1EIBA 5TFSL 3CLEH 5JHLH 3MV9D 3UAJC 4QTHB 2ESVD 3B6SA 2R1YB 3VH8A 4PS4H 3IGAB 3KXFB 4MJIE 2WWMD 1R3JB 3NIGF 1A9EB 1FVDA 1YEKL 5D2LA 3RVWC 4I8DA 5DEGA 4M43H 3GB7B 3LN9A 1FZJB 3SPVA 1KUMA 3TO2A 4PJHE 4YBHA 5HI5C 1REIA 4RZCB 2AV1A 4R90H 1XGPB 2ORBH 4HJJL 2RR3A 1NGWB 1BM3H 2VL5B 4FQXC 4JPIA 5DMIL 4NBXB 2Z92A 2ENSA 3S7GA 2XRAH 2EYSB 3WUWG 3TO4D 3HZKA 5LXGH 3BEWB 3I9GH 4MJ5A 3THMH 4CNIA 5C3TA 3IDXH 3T1FB 4PRID 2P45B 1GGCH 4QY8B 1IGMH 3VXRB 2LV4A 4OCRL 5F93C 4NJ9L 2EDFA 2H32B 2DJ4A 3UTTA 5IHBA 5HHOE 1UZ8B 4DKEL 2YUXA 3FQXB 4OCNC 2DQHL 1PG7W 1CT8B 1IGCH 3VI3E 3P4NB 4JZJB 4WGWB 5C0AB 4GRLA 1N5AB 4LLMB 4HWUA 3QQ3A 3BUTA 2DD8H 2VLRE 4KFZC 3PJSA 1T7XA 2FL5B 4GBXB 1S9VA 1YEIH 3SJVD 3Q0HA 1YY8A 4FP8H 1ERNA 3P4OA 4OF8A 1OAXH 2DQGH 1XZ0B 5HPMA 4U2YA 3IU4H 2EDOA 4JG1H 3V0WH 1EERB 5D71L 3EO9H 2MKLC 3GBLA 4B5EA 3STLB 3OKKB 4I3RL 4GRMB 4K94H 3UBXB 4XVTL 2YC1A 2I9TB 4WW1A 2HTLC 5F1IA 4X4ZA 5FM8A 1INQB 5IEHB 2LABA 4XGZB 3TBTA 1RK0B 4FFVD 4F15B 2HJKB 1HOCA 3DYMA 3ORJA 5DJDA 2BHZA 5DMGD 2BSRA 4K3EL 4QRSB 3FN9A 3G6AB 5F6IB 1B0RA 3PWNA 1P1ZB 4X80H 2QSTA 3QISA 4RFNB 3MJ8A 2VLKB 1W72L 3P4MA 2LU4A 5KG9B 1FRGL 1K8DA 4MNGA 2ZUQB 2FJHB 1RZKH 3ZHDA 1OQXA 4XPBL 3S88H 3NPSC 3H3PL 5C0DB 4NO2A 1IGML 2Q1EA 2JB6B 1CLYH 2GAZB 2FD6H 1MOEA 5LBSL 3BW9A 3FB8B 2BNRA 2Q6WA 2IG2H 1LK3H 3LRHA 4K9EL 4WI4A 5H2BB 5L9DH 3CDYA 1BBJB 1NGQH 3G5ZB 4HIXL 1CWVA 4UI2A 2FSEA 1G7MB 4C59B 4JN2B 4OD1H 4M1CC 5HHOA 3DX7B 4BQ9A 3RWJA 4UAOC 4KDTA 3MRNA 4X6CE 4DQOH 43C9B 4XNXL 1BFOB 3S35L 3BQUC 2YKLL 4P2OA 4LRNL 1P7KA 4NKIL 2VTFA 4YBLC 4Z7UF 1INEL 3MRJB 1MHCB 1ZA6B 4M7LH 1A7OH 5CJOL 1A6AA 4FS0A 5F89B 3EYSL 5BVJA 4JFDB 1MFDL 3HS0A 5F9JB 1HWHB 4D0BB 1T21B 3PHSA 4M7KH 3RZCC 4PRHD 4Z8FH 1EFXA 3QI9D 3RTQD 3K1KC 3P73A 5GRJH 2AK4D 3TN0C 5I19L 1ZTXH 2QEJA 2D9CA 3P4NA 1QR1A 5T5FL 3S88L 4UBDD 4XCCL 4UINL 3IDMB 4BSWA 3O4LA 1CDJA 2EEAA 5GGSY 1BPVA 3KWWB 4PLOB 4F7EA 1SBSH 1GH7A 3HRZB 4QCIA 3U0WH 1UACH 1T1YB 4PJEB 4ZUVB 3V6FB 5KVDL 4NKMB 5LGKA 2OJZH 2ZCHL 5EIQA 3BOVA 1UA6H 2O5ZH 1N64H 1A1MB 2ZUQC 1WEJL 4JHZA 1AGBA 1QHPA 2WBKA 5J06A 1IAOB 5EU6D 1BIIB 1OF2A 4I48B 2HTKD 3U0TB 7CGTA 1X5XA 4L8SA 4LCWD 3ARDC 1NBQA 4ZNCD 1PQZB 3CIQA 1J10A 2EEDA 3RX7A 3QIWD 2DL9A 5GS2D 4G9FA 2DTML 3MV8B 2BJML 4Y5YB 1QSFE 4R2GB 4OZ4B 5ABDE 3FAWA 1GHFH 1G7QB 3TIDA 5E2UH 3HE6B 3REVB 3VGBA 1XFPA 2CDGA 4TUJA 2XTLA 3CMGA 2CUIA 2FZ3B 1A1OB 3GGWA 1XF4A 1MCHA 4KJYA 3HA0A 3K2UL 3OR7B 5H37G 4FZEH 5JOFA 5I1LB 3DO3A 1P4IL 1D5IL 2RFXB 4QHKJ 1DE4A 4LSTH 1L7TH 4XBGB 3BP6B 1JCKA 2J88H 1OSPH 4U0QB 1QNZL 4OM1L 1U36A 1UENA 5FYLD 1QQDA 4KZEL 3ZKSD 4DZ8B 4HS6A 5E00A 5F1OB 3GHBH 4LLYB 4OIIL 3VA2C 4GQ9H 1J12A 4EVNA 1AGCA 3DMMC 4PB0H 2CRIA 4FQHB 1KPRB 3CSPA 3ARED 1JV5A 4N1CA 4O51B 5IR1B 4HKXB 5LXGL 4I3RH 4Y2DD 5CJXC 5D6DC 2V5YA 3TCLB 4LSTL 2OJEB 4LKCA 2YBRB 1I9JL 4FQXA 5HGAA 2NNAA 4PLJD 5EC2A 3O6FD 3VXME 4AJ0A 2XY2A 1U9KA 4HPYL 4NQUA 5CEYA 1AKJA 4DVRL 2Y5EA 1CGVA 4LSSL 5F89A 5D1QD 3UBXI 4J3UA 3SDXE 5AEAA 1JNNL 1JI1A 5HDLA 2R15A 3ZMRA 1YPZE 3BHBA 4GSDH 5HGHB 2X4UA 3CZJA 4KMTH 3X3GH 1ZGLA 4V1DD 1JZ6A 2BJMH 3MGTB 1K4CB 5DD6B 4HUVB 1WQVT 3SDCA 4XCYA 5GISL 4L4VD 2A83A 2VABA 3LKPA 4NO3B 4GKSA 5JOPD 5CJXA 4JFQB 3ARQA 4XP1H 3OL2A 3WYRA 2R2BB 1WC7B 4A6YB 3QEQA 1H3TA 1IT9L 4RNRB 4XC3H 4BZ1H 1A6PA 4NZRL 2RBLA 3WS6A 1NGXA 1CDCA 4MD4B 4A2LA 3GJFK 4ZFGH 4KI5C 4YQXH 4TOYL 1G1YA 1JF6A 4GLRH 1UQSB 4PRHB 4QXGL 3RL2A 5IEKB 4M6AA 2F8XC 3ARFA 4U1JB 3P9MA 5KANG 1ZLUK 3T3MF 5D7JA 4FZEL 4OT1L 4JVPA 4I4WB 5FM5M 1XT5A 4F58H 1FNEB 1UJ3C 2P5ED 3B2VL 3LB6C 3WFEL 3QCUH 4U1GC 4M43L 4UOW0 4M5ZH 1KPVB 1KCVL 5ADPL 5EO0B 2UVFA 1AY1H 1IBGL 1MJJB 5TE7L 3BJLA 4LP4A 1F3DH 3BISA 4E42A 2XTJC 2FO4B 2D7NA 3DXAB 4G7YL 4PJHA 5KSVA 2DQCL 4N5UA 3BKML 4LHUD 1UB5B 4QRRB 3SGJA 4HX1A 1BJMA 4PJ8A 4PGDB 4QOKB 3S5LA 4MQXC 2W07A 3TJEL 5F1NA 4JQXC 4UUJA 4OV5A 3Q6FA 3BQUD 3GSNA 4YHKH 1J5OH 5GGTH 4PJDA 3G5XA 5I71B 4KKCD 2DQIL 2VN4A 2JF1A 4BUHA 4P99A 3BD4A 1TTFA 3FQWB 3I3BA 4JN1H 1K6QH 4OD1L 4P48A 3GBMH 5DQ9B 3E3QC 5TH2B 5ICYA 1INDL 3CCHA 3ULSA 4PRIA 4XXDB 4E41B 2FECL 1MFAH 1NLDH 4JY6B 1YN6B 1F5WA 3FCTB 4P0DA 5D4QA 5DJ0A 1N6QL 4WIQA 1WIPA 3RKPA 3C2AL 1AQDB 2QJDA 4UAOB 3FOLA 3VRJA 4RGNB 2A9NH 1NPUA 4OZIB 3HUJA 2X09A 1F3RB 1RZKL 2L0DA 3SKUD 2V7NA 5L2KD 1O7VA 3X12B 1EHLH 1T5XA 2IGFL 4XZUB 1W72H 3UTOA 4Z8FL 2BNRD 1X6NA 2QQQA 4F57L 1UFUA 4HGWA 1TJHL 2GJ6A 3HZMB 8FABA 5MEND 5DMGC 5GZNC 1AKJB 3PV7A 4XCNA 3KLAA 5IK3A 1OOAA 1UXSB 3MCG1 4AH2B 1TETH 1YDPA 2WUCL 3H9ZA 3EJYC 1IL1B 1QBBA 4PRDB 1WZ1H 1CFSA 2YPLE 1G6RL 5GJTL 4LSSH 3RWDB 3L5WA 2P49B 5C0CD 2VUOA 4MA8L 3JWDH 5J9PA 4OF6A 3IFOB 4R96B 1XGQA 1CFVL 1L7IH 2ATKA 3W0WD 3AREB 2QADD 4JREC 1LK2A 4L4VE 1ZA6A 4Z7UB 2DICA 2FHFA 2GKIA 5K59E 2X4SB 2VLJB 3NCCB 1P4BH 3PIQA 5SWZE 2HLFC 3BVNA 1SMAA 1FGVL 43CAA 4AZ8A 3S34L 5F44A 4P5MA 3QDMA 1DQLH 4C55A 3N06B 4K3JH 3BH9A 2QHLA 3T0WA 1RZGB 4GAJH 2PW1A 4TUOA 4JZJA 4PGJA 1NFDE 1G9NL 4XNZB 2XN9D 4YE4H 4P57A 4F7TA 1SVZA 4YHPA 4U6XA 1ZHBA 4QHNA 4ZFFB 3N1QC 3IXTA 3PJSB 3QAZC 2BVTA 1GRWA 1SEQH 2X9XA 2ZUTA 2AJSH 1U3JA 5TPWH 1YNTB 4RIRB 3IDGA 3A6OA 4JM2F 4XHJD 2WWKO 4NKMA 3UP1A 3VFVA 2GCYB 1BQLH 5ID0A 3RTQC 3TWCH 2EKJA 3AMLA 1FYTD 4Z7VE 4XVUC 2PYEB 1FHGA 5FYJE 4TPRL 3IU3B 5IB2A 1LP9F 2AGJH 5CLWA 3BRFA 4N0YL 3LKNA 5ILTH 4EI5C 3HAEB 1ORQA 4L8DB 5EU5B 3MPCA 1WBXA 2AXGA 3MLPA 4QRTB 1BQUA 5HHNB 1U58B 1KCSH 3OJVC 5C9JB 3FOMB 3G5VB 3ZDXE 4H0GA 3JTSB 4JANA 2AERT 2C1OA 1S5IL 1DP0A 1P1ZA 2QHRH 3F5WA 4PB9H 3KPPA 3LQZB 4U1MB 3LPFA 5IFAL 4GOSA 2MTPA 4NCC2 2CR3A 3P77B 3RIFK 2LU7A 1HSBB 7FABH 3VFMA 5D7IE 4QLRA 3LVEA 5LKNA 5HI4D 1GC1L 3F65A 4J2XA 4S1RH 2NX5B 5B38B 4XI5D 3RNQA 1ND0A 5T5NG 1XF5B 5I19H 5MHSE 2H45A 1T3FB 3DWTA 4OI8A 1EO7A 3G5YB 3MJ7B 2AEQL 4OM0H 4X7CC 1J86A 1FGNL 1UGNA 3TVMA 3ZKXC 1KJ2L 4RMQA 4H1LH 3BKCL 5GGRA 4BUGA 1MIEL 1F3JB 5I17A 4D3CH 1NBZA 2A77L 5JPMB 4NHUB 3MXWL 2NR6D 3MRJA 3TJHD 1F00I 4BZ2L 4QT5B 4PJ9D 3E1F1 5JOPE 1LVEA 4DW2H 5ESAA 2QKIA 3PNWA 1K9TA 1EXUA 5FIEA 3OTTA 1YMMA 1F58H 2HFEA 2FHBA 4CN6A 3S5LG 1CFTB 1S8DA 5F7KC 3NA9H 3C5ZC 3FZUD 1NUGA 5TFSH 1GAFH 3DTXA 5DJ6B 1JRHL 4Z76A 3T3PE 4C56A 1P7QB 2IAMC 5DUML 4EDXB 2AI0L 4ODHH 1QRNB 2YD7A 1J7VR 2GUOA 4KVNL 3EYUL 4KDTC 1KB9K 4JFED 2C4XA 4GW1A 5IOPB 2CQVA 3KPRB 4LARL 1X5IA 3GSWA 1U93B 4PJBE 1RZ8A 1IAIM 2E7LC 1CLOH 5I1CL 2EXWC 4M3JA 3H9SB 1FVEA 3ROOB 2V9RA 3V52H 4AIZB 4NN7C 2QQLH 1ULVA 2X70A 3NOIA 1NFIA 1M1SA 4XP9H 4BFIA 3LKRB 3VU2A 3SQOH 2GTWB 2IH1A 5I1HH 5D7JB 3R06B 5C0BB 5EU6B 5IT2H 1T0NB 2BNUB 1JZ5A 4JPWH 3KPNB 1FNEA 1AJ7H 5JIIA 3IFNH 3LZFH 4XVTH 1A0QH 4ZXBC 1N7ML 4RSVA 4KMTL 3MJ9A 1DUZB 4OKVA 5HYEA 1YMMD 1QLRA 5JXEC 4KPHL 2BCKA 4KU1A 1KG0A 3BWAA 4H5SA 5BW7C 1JNNH 3O3EB 4WHTA 3LRSB 1E6OL 5C8JA 5DA4A 1AC6A 4YBQC 1J8HA 3DI3B 3G9AB 3WIHL 4K94C 5DUBA 2J8HA 2CRMA 1CGXA 3MREA 3WFHA 2XWTB 2IQ9L 3DVGB 1ZGLP 4YXHH 2BSTB 3T8XB 5JIPA 1GVIA 1OAKL 1CF8H 5FV2A 3TYGH 5E8PB 3MA9H 1TJIH 3GHEL 3P9LA 3MO1A 1MWAL 3SKMA 4X6FA 2DQJL 5K9OB 3W0WA 3ZYOA 2A6KB 2BNRE 3C5JA 4AYFA 4QHLA 1GL4B 2A9ML 2F54B 2NY7L 4A2MA 1KPUB 2AABL 1RIUL 3JV4B 4Z7OE 4JY6A 5IBTH 4MVBC 4OZFA 1U8PA 3W82A 5E8NA 4PJ7E 2YPLD 2H6PB 1CG9A 5E2JA 4ZNEE 5C07E 4FQLL 3UJTH 3V0AC 5BS0D 5J13B 1EAPA 5T3ZL 3A67H 1YQ2A 4Q9RL 3RVXC 4Z7OF 3E8UL 5D5MB 1YPZB 1ZLUH 4J1UA 5C09D 4YXKL 4ISVA 2FX7H 1WWAX 2AJ3A 4K7PL 2GITB 4ODTH 3MRKB 2AP2A 2VQUA 3MCKA 5GSVA 1I1FB 4O9HH 1MRFH 3VMPA 3M8OH 1HILB 1HXMA 1VFBB 4G3YL 4MS8C 3VDBA 2G9HA 2P48B 4TSCL 5SV4A 1JZ7A 5E56A 4R0LA 4YHIB 4JAMB 5A3IC 4X8JB 1NFDA 4GG6B 2I25N 1DFBL 4L1HA 2EDLA 3E6FA 2DM3A 4JY5L 4F15C 1AGFB 3TO4A 3ZHKA 4F3FA 3UPCA 4EQ3A 4Z7VA 4NQDB 2R29H 4YAQB 1OWRM 1KIQB 4BH7B 1I8MA 1HYSC 4POUB 1A2YA 5D1XB 4NZDA 3SBWC 1A6ZA 3LPGA 3KYOA 4UT7H 1IC4L 3CX2A 5IG7A 5F96H 1UM5H 1OD7A 4OCMC 4P23B 5EOQL 3TVMD 4HFUH 4HAGA 3PABB 1JNHB 1B4JL 1N7MH 2F58H 3DSFL 4EN3D 1GPOH 5EWIH 1CXEA 3DO7A 3T0EE 4HW6A 5EO9A 3EOYG 4MXWL 4HG4K 5BRZB 3IGAA 3HZVB 4XNMB 4BKLA 5JW5A 5HI3D 1XIWB 4JFXA 5D70L 4JO2H 1Q72H 2F54E 3IKKA 1DBJH 1DANU 4AEEA 4HKJA 4LVNB 4M6NH 5GS0C 5HVHC 2YD2A 1XCTA 1K4DA 4ESKA 4G8FA 1NCAL 3VXNB 1X4XA 3VXUB 1I3UA 2DQUH 3TF7C 4ELKB 1MQKH 1RU9H 5KSAA 3NABL 3RWGB 4YBLB 4PRBB 2R39A 3KHOA 3CSGA 1EZVX 3BP7B 5EN2A 1QKZL 1GJIA 1TFHA 1MCOL 5L88L 4JFEB 3V4PL 1YPZF 1TLKA 5E8EB 4Z7NE 1NAKL 5DQDH 3TBWB 3PGCB 2CKNA 3PL6A 3CXDL 1J0YA 5JHDE 5BVPL 2DJUA 3FKUS 3SDDD 4OLYH 1VACB 3DBXA 4ZD3L 4E41D 3WUWA 1DLFL 5C0GB 3LIZL 4B7LA 2D3VA 2A0LD 4HH9A 3L1OL 1HSBA 4JO4H 4NN5B 4NCDA 4UIKH 4FQ1L 5H35B 1G9EA 2IBGA 2APVA 4OSUL 3AAZA 5IESL 1WFUA 4ALAH 4GKZA 5B38A 5HHXH 4X7SH 4PJEF 2UY7A 1LO4L 3QP3A 5DYOB 1KC5L 1I85C 3QO0A 1CYGA 1HINL 5FYJH 3DRQB 1ZT1A 4O4YL 4QXWA 1GZPB 5F3BA 4CRPA 1T7ZA 1A4JA 1DQDL 4PRAB 1IQWH 4Z77B 4L4TE 4J3SA 4N9GA 3OF6A 3GMOA 3W11C 4DKDC 2GSGA 1NUDA 4HJ0C 2OL3B 2FATH 3TA3B 5DJZA 3T08A 4AT6A 3L3DB 1XGTA 3MFGB 4LVNC 2ICWI 2AEPL 4R0LB 3L3JA 1QBLH 5L2JA 1OARL 4MQXD 3GMNB 4XB8A 5BS0B 4JRYE 4ZUWB 3VWJD 5B8CB 4HGKC 5LVEA 4UV7H 3LB6D 5C09B 4U1NA 1BOYA 1A7QH 1OAXL 1MREH 1U8LA 3RUGF 3LS4L 4MAUH 3IVKA 5E9DE 1CZ8H 4KVCL 4NKOB 5I8EB 4U3HA 1A4KA 4DZBB 4NOFA 1JNHA 3PABA 3BH8B 1OCWL 3DROA 4PJAE 4ZFFA 3SGKC 2VO5A 4MXVE 1R5VB 4XAKE 2ITCA 4OLVL 1T0MA 3ARDA 5FAAA 3N50A 3VGFA 5IMLB 4OGZA 1RJLA 3IAPA 3M8OL 5E24E 1FDLH 1RZ7L 4U1SA 2JIXA 2VR5A 1H3PH 3FHAA 4OFKA 4Y16A 3HB3D 2ED9A 1X5HA 1A7PL 1IEBB 1OAUL 4XPHH 3SQBA 3V8OA 5DD0H 1AO7A 2EKSB 4WNQA 4I0KA 4JJ5A 3QQ4A 1RUAH 1VFOA 3EJZC 3VXRE 1FYTB 3CFBA 4XCEA 1VEMA 5B3JE 3I9GL 4IMLB 5F8QC 1Z9OA 2HJLB 1T7VA 5GS0H 3RDTA 1MSPA 2MHAA 4Y19D 3HLAA 3VWJA 1OW0C 4QGTA 4G9FD 1CK0L 1AIFA 3FRUB 1HHKA 1DQQB 4U1KB 5DRNB 2FWOA 3LSOB 1UC6A 1WF5A 4Z18A 1U95B 1DLFH 3SDAC 2OK0L 5E95B 4Z7UE 3RTQA 4ONGL 3TBSA 2BVQB 1EAJA 3DURA 1FORH 1M05A 1WZLA 5FUZL 1MI5A 2W9DH 5DK2B 1L7IL 1Q94A 3OKMA 4OF3A 5CP7B 1RJYB 2X44D 2HJFB 3LMJH 2EDRA 3MQIA 2VSDA 3MO1B 3SKMB 1FNSL 2VZ3A 2HAZA 4KI5F 4XTRC 3AB0C 5D2LB 5HDQL 2J8UF 2FEEL 1OP5K 1ROWA 4FTVA 3VCLA 1S78D 4OLWL 1I7RB 1I8KA 3QDJE 3L95B 4IMKA 1UH2A 3ILPB 3KDMB 1XH3A 1C16B 1IC5L 1M7IA 4OI9A 5EUKA 2VDRH 2WV3A 2VLLA 1Q9OA 3GSVA 2A6IB 4WVRA 4XP9L 5T3ZE 2CLZA 1Y0LB 3SKOB 2ZOKA 3U1SL 2VC2H 4HS8L 3QXDB 3G9VA 3OKEB 3ZE0E 4WFGE 1LO0L 1W0WA 1GPOL 2EEBA 3D6GA 1P9MA 4DUXA 3DNKA 1Z9LA 3HC4H 4OLWH 3F12B 1E4WL 2E6PA 1KIRA 4ELMF 5T5NF 1ZLSH 4PLKC 2XZCL 4XVSH 2D7QA 5E5MA 5A2KH 4CMMB 5FUCE 2UV3A 3BPLB 1T1ZB 3O9WB 2WQRA 3RI5K 1FL5A 3TZVC 3FRPA 4OLZL 1E0OB 3U6RB 1ZS8A 4BA8A 4FFVC 1FE8L 4EEEA 1DCLA 4HK3N 1T20A 1AC0A 3ULUE 4G7YH 1L0QA 4TNVF 5F8RC 2BFVH 2G5RA 1F6FB 1W0VB 4JO1L 1C5BL 1U41A 2YZ8A 4YFEA 5TE7H 3MTRA 3NAAH 3UJJL 4OGYL 4IOIB 3V6OC 3ARGC 5KSAC 4BYHA 4DOHB 4F7PB 5DVNA 3ZDXF 3ZE0F 2R1XB 4BH8A 4EOWL 4C4KT 1BECA 3AB0B 4OT1H 2R2HA 5EBMB 4RX4D 3MOAL 1G7HA 4LSUH 4KRMB 3PDOA 3V4VL 4ZUSB 5HVGB 3V6BR 2R0LL 1YN7B 5T3ZH 4IIQC 5DFVC 1Q38A 3BHBB 1YEJL 4QRSA 3E0GA 5EU7E 5MP6H 1U6AH 5I1KL 2N7BA 2W0PA 3B5TA 1ZEAL 3CH1B 4MB5A 2P8PB 4JFZH 3VXRD 2V2TB 4CDGC 1M71B 1CL7I 2A83B 4NO5A 1CBVL 4KGJA 2DYPB 2WW8A 2NR6C 2XT1B 4JR9H 2CK2A 2NY4D 1F11A 1TQBC 2LU3A 1NCUA 4NUJA 3IFPA 4JY5H 5FGCE 1KCUH 1XR9B 1WVZA 5I8CB 4R4NC 1MJUL 2VQ1A 3SDXF 4GG6F 3B5GA 4YXLL 3LKOA 3QEGL 4XMPH 3UC0L 5KSUA 4MSWA 3TH2T 1JP5A 1YEDA 4UOW1 5C08E 4YXLH 2QSQA 1MFCL 2NY1D 3B3IA 4TNWK 4IM8A 1M7DB 5TDPA 4KK8C 3RL2B 5IEKA 4JR9L 1LDSA 1BMGA 4O2CA 3K80A 1R5WA 1JTTA 1DDHA 1DSFL 3VXMB 4GXVL 5I66B 5KVGL 3QHFH 1QFWH 3O11B 1F3DJ 5E94A 5HI5D 3BUYB 4QRQB 5HHVL 4YZFF 4XWOC 3H3BC 5ILTL 4XAWH 4EUPH 1FNAA 3RVWD 4ODSH 1BZ7B 1KCRL 1YNKL 1M7IB 3MV9A 3GIVB 3IS0X 3FO2A 2IANA 3WHE0 5CEZH 2DIAA 5J3HC 2NMSA 2HVKB 1CQKA 1U8JA 5GJSL 4Z95L 5T3ZD 4XNUL 5IV2B 3B9KA 3D87B 3EOAB 1BQLL 3ROLA 2DMCA 4XH2B 3MFFA 3CVHB 4P2RA 2I9LB 2VDOL 5LQBL 3I3EA 4DVBB 4ZPTB 1A9BB 3REWB 1HHHA 1TTGA 4G6JH 2IBBA 3TIEB 4PGCA 2A38A 2ZCKH 4EIGB 1GGBH 3QZWG 2HFGH 2O5YL 1OAKH 3PXHA 4CKVX 4JFYA 3L7FA 1G9NH 3BZFA 1FO0L 5C6WH 4J23A 5DI8A 1D5MA 2C5DC 4LARH 4U7MA 1D5BB 5C0FA 4X7TA 4WU7A 3DHMA 5I75C 2AI0H 4ODHL 1IKFH 3UTTD 1HWGB 1I7TB 1ZLSL 1QSEE 4LDLB 3I2CH 3QH3B 1W0VA 5HHOD 2XFXB 4O58L 3BIAX 3HE7B 1HIML 4Y2DB 4LU5H 4LLAA 1TDQA 3GMRB 4X99A 4X4ME 4HS3A 1HHJA 3SO3C 4JPVL 5KTEL 4U6HA 3VD7A 3R0MA 4LQ1A 4XX1G 2CLVB 3QXAA 1NAMA 1RSFA 4LKXB 2VIRB 3BP4A 2IMNA 2A77H 4G9FE 2EYRB 2IQAA 4NGHL 3TT3H 3QJHB 4WUUE 3ZO0A 1K3ZA 2P7TA 4KAQH 3RGVC 3FT3A 3D3VE 1IGJB 3GMQA 2VQTA 4NQCB 3MRFA 2HKHH 4HX1B 3BESR 3KG5A 4OD2B 5JMOC 2FBJL 3KPMB 1IFHL 2XWJA 2FR4A 4NO0D 5EZIL 5D7LD 1ZSDB 3DETD 3O6ML 4UV4L 1BZQK 5BXFB 1BD2A 2MCPL 1EX0A 4U0RC 3G08A 3EDFA 1RIHL 5TE4H 3DUSB 4UIKL 2C9AA 4GKNB 2B7DT 4Q97A 1U42A 4G9DB 1I3RA 4Q9BA 4G8IB 4XPAL 5FEBA 1DBKL 1QSFB 1GC1H 3VG9C 1IGFL 2NZIA 2VDML 3SOBH 4JPVH 3MRMA 5DJ8B 4WI3A 4LLDB 3QYCA 4M02A 5C9KA 5FOBB 1NL0H 3CAFA 1UVQB 5JUEH 2BVOA 3C6LA 2FYYB 2BNQE 3EYSH 4WV1C 1MHHB 4POZD 3MRPA 3FOLB 3N1MC 3TT1L 2X4OA 1M6OB 5GSRB 1NMBH 5F6HI 2HKFL 1LDPH 3B2UD 4GUPB 1X5YA 1ED3B 3D2UA 4F80A 4GMTH 4HLJA 2DWDB 1VCAA 5IFJA 3VXQB 1JN6A 2EIZB 3F62A 3OGCA 5C08D 3QIWB 4TQEH 4HUNB 3V7AG 1DFBH 1NCBL 3DRQA 1HH6A 3D25A 4PD4K 2OSLB 1FGNH 2Z0BA 4JFHD 3ZHLA 4PLJC 1TCRB 3GKWL 3GNMH 5SX5K 1KSRA 5GGUA 4TPRH 5BQ7B 1O0VA 2W1NA 2G60H 1AY1L 1BWMA 4WW1B 5F1IB 5DJCB 3PDGA 1JHKH 2CD0A 2E9BA 4PJFB 3UROR 2EICA 4LPUA 4R3SB 4TSAH 3STBA 3QAZB 1WFNA 5EWIL 5AAMA 5JW4N 2OQJA 3OPZL 5JR1H 5CCKL 2ICCA 2X4NB 2MPAL 4RFNC 5F88B 3QNYA 1W0WB 3MRQA 1T7YA 2B4CH 1OCWH 5I76A 4PJBA 3MRLA 1JPSH 4PJIB 3O81A 4UT7L 3VFMB 1SEBB 3H9SE 3NFPA 4LNRB 3H7LA 4W81A 4PRHA 3ARUA 1GOFA 3ZL4H 3EKCA 5DD1H 5A1AA 3D9AL 1YYMH 4RGND 3I6GA 1RIUH 2R29L 1LNUA 4G8GD 3ZLQC 4YEEA 2W0FB 4Y2DA 4GW5B 3B4NA 4Z7WE 3L5IA 3GMMA 3TZVB 5IMOB 1P4BL 1CFBA 4XXCA 4IRJA 4MA3B 2JIXD 3SE4C 3RPIB 2AQ2A 4LCYA 1I9RH 2NTFB 4Y1AA 4J4PA 2JJTC 3BKYH 3TPUB 4JG1L 1I3GL 4GBXD 1S5HA 1VSCA 1HI6A 1E4KC 4DGIL 5I1GH 1DEEA 1FBIH 2NY2B 4RISH 4MNQA 5FKPB 3D85A 4OLUL 2B1AL 4MA1C 1OQOA 1PKQE 3VXSB 1RZIB 1SEQL 3NN8A 2DLEA 4UMGA 4S2SA 3A67L 1JIBA 4NJAH 4F57H 4XMLH 1CGSH 4L4VB 3CU1A 3DUSA 2F54D 3HPJB 1IGCL 3OXRA 1U8NA 5IB3A 4CN1A 5TH2A 5T3XD 5J0BA 3SCMC 1HQ4A 3QPXH 3B9EA 2HT4C 1B0GB 2A9NL 1OAYL 2R0ZH 5FA4A 5D72H 3IDXL 4G8GB 4U1MA 5IVNA 3RAJL 5T1KA 2UZYB 1XCQA 5A16B 5LCVH 3FFCB 3PP3K 5C6PB 4ZO9A 1A21A 1RUPL 5KN5B 2EYTA 4UDUA 4DJMA 3HG1B 5E2TL 2ADGA 3IXAB 2QBWA 4NQEE 2PXYB 3R1GH 4JFOB 4F7MA 5BJTA 5FECB 2RB8A 4IDLA 1JZ2A 1CCZA 4WWID 1WLHA 1GIGH 5ALCH 3WIHH 2P5EB 2ZP0T 3C9NA 5I73B 1R3JA 1NDMB 3KLAB 3BPCB 2A6JB 4PR5A 5BO1H 1I8IB 4PJGB 4Y4FC 2OXHA 1N8ZB 1UWXK 4WTXA 5C0BA 5CWSA 1WAAF 4FQJH 4LRIC 3CFKB 4E41E 1EEUA 3RJQB 4KRPD 4RMUA 4X7EC 1F58L 4PJFA 3P9WB 5HVHB 3GSXA 3HAEH 4LCUB 2C3HA 3ZT6A 3V5KB 3MCLH 4GAGH 2XQBH 5MEOA 3DECA 2EYSA 3GKZA 2Z93A 1EEZB 2ICEB 4X4XB 5T1LA 2VRAA 5C09E 5IVXE 5J7CC 3DV6B 1A7NH 4PJIF 1Q72L 3BD3A 3BPNB 1BREA 1TZHA 4JO2L 5IJVB 1WV7T 2PYEE 2NXYD 3MNVB 1A6UH 2RCSL 3HG1E 1HZHL 3KNBA 4OV6F 5IIEB 2OBGA 4W6YB 1MUJB 4R26H 4LQFH 2YUVA 1LEIB 1DN2A 1SY6H 3FFCD 4XBPA 3MZGB 3QWRD 5EU7C 1CFQB 5IVXF 1CLOL 1DN0B 1I1AD 3ARGD 1GZQA 3P9LB 2C4FT 3CSYB 3K74B 4PGCB 2W0FA 4ZOBA 4M9PA 4UILL 1I9IL 5D7LA 2E7MA 5KS9E 4Z7WB 3WFCL 4P5KB 3G5ZA 5E2VH 2D7MA 2O5XH 1A1NA 5AYQA 1FORL 4M7KL 3CZFA 5MENB 4N90D 2VZVA 5IB5B 5EO1B 5EOCJ 5ESVA 3NA4A 1I7ZA 3MLUL 2BHYA 5CJOH 5CILL 2X4PB 3BDYL 3D48R 2W60A 4GRMA 4YC2C 3QHZL 4AQ1B 5EU6A 4X6DB 4NKIH 2WANA 3V95A 3KPNA 3C08H 2H8PB 4HPYH 4ONFH 1VB9A 2JE8A 3FO9B 5DJ2B 3BRDA 5H8DA 1PEZA 1TJGL 2NXYB 1D6EB 2DLTA 3FB6B 1MAML 5C1MB 2HJKA 3U0PA 3BZEB 4P4KA 4XP4H 2R2EA 1R3KB 4W6XB 3TYFB 2WLYA 3WIFB 1K2DA 5HGDB 4PRPA 2VE6A 5FCUH 4PLNC 1LWRA 1ZANH 1OAYH 2R0ZL 1SYVA 2MOVA 4YHMH 1IE5A 1VGEH 4M61A 5KANI 2FEEI 5BV7H 4QHMB 4OZHA 1ND0B 4G43B 3WSQL 4UT6L 3VGAB 1NGPH 4J3XA 1YMHB 3MLTA 4Y5YC 5DC4B 2DOCA 4YHOL 4RQQB 3LEXA 4KWUA 2YD4A 3OHXB 1BGXL 4LSDA 3D5OF 4QRRD 1D5IH 3VGDA 2R2CA 3RUGB 3AROA 1UCTA 1LO3L 5I1EH 3A6BL 4GRLC 3TNNA 2YD1A 3WMSA 3G6DH 1J1OH 2WMPA 1XEDA 3AM8A 1E4XH 4FZ8L 1CS6A 3SKNB 3RWFB 3VXSD 5CJBA 3N1GC 4HC1L 5B21A 4HWBH 5FO8A 3NZHL 4OQTA 1CICC 1AXTL 4L3CB 5IQ7L 3T1WA 1NKRA 3KYMA 5MEOB 3V6ZB 4CMHB 1QR4A 2W0LA 4XRCA 3QA3A 3DV6A 3O6FA 2VDPH 3QNZA 4Z78B 2JK5A 2BXZA 4MQ7B 1E4XL 3JWDL 3I75B 1L4IA 3L3KA 3RY5A 3GHBL 1AD9B 4JGUA 3HMXH 4ENEC 1EJOL 3PHQA 3V9FA 3UTZB 1BQHB 5DLMH 4Z5RB 3P0GB 5C2UB 1FZOA 3O0RH 3QDJD 4EDWL 3ARVA 2MPAH 5EUOB 4ODVL 4BK4A 1OT2A 2J88L 1U8QB 3TBWA 3I02A 5JOFB 5DD5L 4EXPX 2F5AL 1F4XL 2DIJA 4Z0BH 1BVLA 1RHHB 1AE6L 2YN3A 1BWWA 4NRZA 3CX5J 3HB3C 4YAQA 4YDJA 4JFFE 3QUZA 1T80A 3FB7B 2HLAB 4DGYH 4FQ1H 4Y4HA 1L0YA 3EYUH 1JZ3A 1ZXQA 4FQHA 4LBEA 2CO6B 5H37H 1HKFA 4YBQD 1EK3A 3LIZH 3QUXC 3VXOA 1ZHKB 1MFAL 1NLDL 4HS6B 4JKKA 1P4LA 2AJYL 2OR8A 4NPYB 5CUSL 3LV3B 2HFFA 3PQYB 3BMWA 3U4BH 5E1AB 3WNLA 3BZ4A 4G9FB 5FB8B 3ARYA 4U31A 1TZIB 4YHYB 2I27N 3K4AA 3WE6A 2ZKHH 1YDPB 1HOCB 4ONOA 3VFTB 4PJ9B 1LDPL 4DCQB 2BRRH 1AQKL 1S7QB 1YEKH 3ET9F 4UZGA 4D3CL 4LDOB 4WFED 1K4CA 1RAMA 1OWWA 4P2OC 3MBEA 2YEZB 1KNOB 5DMJB 4PP2A 5JQ6L 4C56D 4ELMB 5ECJE 4JREB 4DGVH 1KLFA 2AEQH 3L3OB 5JXAH 5T1DH 3OKKA 1DBKH 1TITA 4QOKD 1LO5B 1F4WH 1UJ3B 1HHIB 4JZOB 1HDMA 5DMKB 1IMHC 5EBLA 1ZTXL 3VFOA 4CVZA 3RIAF 3WDHA 4P2QE 4S1RL 4OF7A 3RZWA 1U8IB 4PG2C 4TVPH 4EUPA 4DTGH 3ULVD 5IP4A 3FQUA 5L8KB 1MHEB 4GG8B 1RZGA 3SKJH 5JPNA 1VADB 3X13A 1YEFL 2ZUVA 4AQOA 4HCRH 3MRIB 4IOSD 1BLNA 1MFDH 2UWEE 1C7TA 3QEUA 1PAMA 4KMQA 1V3KA 4NZRH 2FIKB 4K3EH 3TA3C 3VI4F 1KCSL 4JDVB 2NXZB 4S1DD 1F90L 1HEZB 3ARXA 5B4MD 4LRNH 3FQRA 5ERWA 4DQOL 4YGVA 1FLRH 3QJFB 2NW3B 3AFLA 2JK5B 1QSEB 2E3VA 2R23A 3DYPA 2EC9U 3RX8A 4J6RL 4KQ3H 3DX9B 1ZVSB 3QI9B 2OL3L 3AGVA 1VESA 3F6IA 5INDB 3HI5L 5D96B 4DOHE 3C09C 1KLGA 4X6BB 2OXGA 3MRNB 4JG0H 3C60C 1MCDA 4CW1B 1W72B 1GIGL 5ALCL 2VWEC 1CQYA 1N59A 1AFVH 2GSIB 4U3CA 1U8OB 4OCWL 5HD8C 1IC7H 3ULSB 4A6YA 4QXGH 2X1PA 3IDIB 2C1OB 4ZS7H 2DI9A 3VFUB 4L8CA 5DJ0B 3P0VL 3O45B 4D8PA 2YPKA 3VI4E 3BFOA 2WUBL 3L5JA 4TVPE 1GXEA 1X5AA 4YPGA 3DRTA 5JXED 2X42A 3QPQC 3F58H 4DKEH 4YJZL 4GW4A 1S7SA 5FGCB 5EO9B 2K7PA 3C8KB 4K7FA 1IGTB 4RGOH 5JDJA 4HUUB 5HYIA 1FGVH 1OTUD 4LCWB 2E27L 4OD3H 5L6YL 1T04A 2XKNB 2DM7A 2Y5TA 5K9KB 3S4SA 3WCYA 3F6LA 5JZ7D 5E70A 5EB9A 3OJDA 5JW3H 5DMIH 4GSDL 4WRLA 1L9NA 5TQ0L 5KOMC 3IJYB 5I6XC 4KC3B 1D3CA 1KGCE 3L6FB 2J8UA 4HD9A 5GGRB 3WJLA 1J1OL 3S37L 3HTLX 4FMKA 4M5YH 2WUCH 2K7QA 5IGXH 3KPRD 3JWOL 3ARFC 3WKMH 4Y19A 2VLJA 3MLUH 1U8HA 3QRGH 4PG9B 2WK2A 4P46C 3O4LD 1O7SA 3VWJB 4HHAB 4LSRL 1HDMB 1NMAH 5DMKA 3DVFA 3HI1A 2H26A 1PYWB 1T2JA 2ZUSA 3PGFL 1FFNA 4JM2C 4X0KA 4GO6B 5MEPA 5F7UA 4FHBD 3B5HA 3VA6A 4MDJB 1F90H 4P4RA 5FGRA 3C2AH 5IB4A 2CLRB 4GRLB 2FZ3A 5FYJU 3EOBA 4E9LA 1E4KA 4M3KB 1UADC 3THML 5KN5A 4EBQH 3QUMB 3MLSH 4KKNA 1I8LA 3EDDA 4QO1A 1IEAA 5D7LE 3LQMA 3CGTA 5E03A 1Y6MR 2XPGA 1XF3A 3DX8B 3VD9A 1LEGB 4P5TD 1JPGA 1EHXA 2DQIH 2FEDC 4MLSA 1YZZA 1JZ8A 2BVEA 3CD4A 2PTTA 3WV0A 3D0VA 3KGRA 1B9ZA 4MXVF 5D7JC 4KK5C 5TDOA 3UJJH 1KT2B 4JDTL 4M93C 3SCMB 1A5FH 5TDNA 2BNQD 1A8JH 2BFVL 4NKDB 3BIKB 2VXSH 1FFPB 3L3JB 4DKFH 4PY8I 5BZWB 4V1DB 4P2OD 4AMKL 5BS0E 4Q2ZA 1KPRA 1NC4A 1BVKB 4JKLA 2Z93B 4X4XA 3MV7D 3WS3A 4TYUA 2XICA 5I6XB 1INEH 1JJUA 3V6ZA 3Q1SH 1D6VL 2ENYA 2BDNH 2BRRL 2VH5H 3OWEA 2AV7B 4H5SB 1CDBA 3VDCA 2YHGA 3L7EA 3EYQC 1NMBL 4HJGB 3CPLB 1I3VA 1CVRA 1H8OA 3F7RA 2GEEA 4L8BB 1MIEH 4AM0A 1LO2H 5DGQA 3WIIH 3UDWA 1VKXA 3MGOB 4NQSA 2W59A 1TTUA 2CKBB 5KS9F 3GMLA 1J18A 3QUXB 1Q9KB 4H26B 4OJFH 1QSED 5TF1L 1SMOA 3QCTL 5D1ZA 3VW3L 3T04D 4OZHE 3ARGB 4I0PA 4OAWB 1G6VK 5HHPB 3KR3H 1X3DA 1CXFA 3QR2A 1MRCL 3DHJA 3QXUA 4HV8B 3VI3F 3HMXA 5B3JF 3BQUA 3BPOC 2B4CC 4Y4HB 3MLYH 1IEBA 1AE6H 2DI8A 4LP5A 1CG9B 1S7XA 4UT9L 3LN5B 2HKHL 5JOEA 4ODVH 1F8TL 2P8MA 2R1WB 3H9SD 4Q9QL 4KI5E 4P2OB 3RGVA 1A7RL 3KPLB 5B39A 3QIBD 4KAQL 2ZZUT 2DDQH 3AVEA 3PE9A 2YPVL 3HZYB 4JZJC 2FSEB 4LGSB 2JJSC 4NZTH 4Y4KB 2YWYA 1QTYT 5JIKA 2EDBA 5JHDA 3P9MB 3GJEA 1L0XA 1A6TB 3H9YA 1N5YH 1FBIL 3GRWH 1BQHG 2HH0L 1U8MA 4X4YA 3VWKD 1X7QA 4ZOCA 2Z92B 3VGHA 3ZKNC 1P7HL 2ZNXA 5GRXG 3NCBB 4Z76B 4XXDA 4DAGH 1S7QA 2QKIB 1NGQL 3HFMH 3NZHH 5HD8D 2WP3O 3VMOA 5EPMB 4PGBB 3GSUA 3HC3L 2CIKA 4JY4B 4HK0B 1PY9A 4KK6C 2CIIB 5IOPA 3RI5F 3MLVH 2XACC 1OD9A 2GJ6E 3ZE2E 5FF6B 4F8QA 4QXTB 4F9PC 2V5TA 1YUHB 1T1YA 4YC2B 1PJ9A 4QTHA 2ADJB 2UWEB 3IJHA 1WK0A 4OFIA 2X89A 2C3GA 2VWEE 5IG7B 4HBCL 2XIDA 3FN0L 5LWYH 1E27B 3G5YA 3T09A 1G7PB 1H3XA 2GTZA 1NANH 3STLA 4BFBD 3UBXA 1J0ZA 5C0EB 1JFQH 4BQ6A 5HPMB 4J8RB 4JRYA 4FFYL 1H0DA 1INQA 3NIFE 3HZVA 4XNMA 3S4SG 3D0LB 2JJUA 3NCYP 1RULH 3N0PB 2A6IA 3FQRB 3C60A 4K94L 5ENWB 2EIDA 5IQ7H 1UM4H 2DTMH 3NFSL 1QFPA 1MLBB 3T3PF 3WN5B 3L9RB 3ZDYF 1X5JA 3RWGA 4PRNB 4RBPK 3QDGB 4QTIL 1CE6A 4PY8J 3ZL4L 4F33A 4GAYA 2CDGB 1BBDH 3LKQA 3TT1H 4Y8AA 2B4CL 2GQHA 5HGGS 2JB6A 1MFCH 2DD8L 3ARBA 5HYSG 1A47A 1LD9B 1WGOA 5E8EA 2YRLA 1O5DT 4WW2A 2XV6B 3ECBB 3QO1B 4YHNB 3VRIA 1YNTA 4LSPH 5L0QC 3TBYB 4K23L 4MX7B 5BRZE 2IGFH 1AGDB 1D5BA 1VGKB 5E4EB 3U79A 4JRXD 4EI6B 5SWQB 3MV01 4DTGL 1R3IL 4K8RH 3KPSB 3C6LB 4X5WA 1AI1L 4F8TA 2AEPH 4TVSa 2A73B 4WTWA 3BEWA 3W9DA 1BX2B 4NQDE 2XKUA 5AG8A 4TTDD 1KULA 1FL3B 2F5BH 3IDNA 2PUQT 2HT4D 1Y6NR 4JZNB 1Z3GH 2FBJH 5CBEB 1XGYL 4H1LB 2BHUA 3IS1X 1NGYB 4OCYL 3NTCL 4XPGL 3H8NA 3I6LD 4U0RB 5IR1A 3O4LE 3BP4B 2UWEF 4Y4FB 4AENB 2ICWB 2DAVA 2CDEB 4DKAA 4GS7B 3SY0A 3T2OA 2BMKA 1CXIA 4RRPA 3O3UN 2BRQA 5FOJA 5HYQA 4NRYA 3W9EB 5DJZB 2DLIA 1X5FA 4ZD3H 2BERA 5KTEH 1EVTC 1YQVH 2XTJE 4AMKH 3MCKB 5GSVB 3MODL 1LEKA 3WNNA 1KJVA 5L9DL 1CXKA 3QUML 3C5SA 1EUUA 3IU3A 3LEVH 5KZCB 3QIBB 5HBBA 4QF1A 2CMRL 4M8QA 4NCC1 4NM4H 1TCMA 3X11A 4MNGE 3GO1L 4PGEA 2AK1H 1JYXA 2XZCH 3GJFH 3QCVL 3S3JA 2V7HB 4IIQA 1J0IA 1FFQA 4NNXB 5DHYB 4Q74A 1IFHH 5ICZB 4PTTB 5TGBB 4WO4A 2IPKB 3FFDA 3NH7L 2I60H 4EBQL 2OI9B 2F53A 5I8OL 3OAYH 5ICXA 3RAJH 4OZ4A 5DO2C 2C3VB 1NCWH 4X7DC 1FZMA 5FUOL 3U4EA 1KLUB 4LLWA 4Y4FD 2RHEA 3CXHK 3B8SA 1EUTA 4LNVA 1HNGA 4APQD 4X6CA 3KAAA 4XC1L 5CZXD 1SQ2N 4ZOEA 5L7XL 5DS8B 4Q9CA 4IRJD 2ADFL 1MCLA 3GI9L 2JB5H 5GS1A 3D85B 5SWSB 3SE9H 4LSRH 4LVHC 1J1PL 4XH2A 4OUUB 4ZQKA 1YNKH 2DQDH 5CJQH 4ODSL 3SDDB 2FX8L 2HT2C 1QRNE 3QRGL 4O02L 5FYKD 2WINB 3SE3C 4PBVC 5EOQH 3PWUA 3MLZL 4NIKB 3GSNB 3BRGC 3MUGB 1ADQL 5IGXL 4RDQG 5F7DA 2EDWA 3IU4L 4JAMA 2NLJB 4M6MH 1P7QD 1U8KB 3WEXB 5DWUL 1KEGH 5FK9A 4OFYA 2Y9RT 4K9EC 3V5HA 1MHPL 4FFZL 5FO7A 1QO3A 3BP6A 5E8DH 1I9RL 3KYOB 2KPNA 4D9LL 5E99L 4G6JL 4N0FA 5ELIA 4TSCH 5DFWH 3UYOD 3FO1A 5CGMA 2NY2C 5I1AA 3M17B 3AS2A 2ZUXA 3M1BA 3VE0A 1EH9A 1EJ6A 4OIIH 5H94B 1CDGA 5FECA 1CGYA 1TIUA 2YSSA 2OCFD 4Y7MA 5T1MA 3W81A 1LE5B 3QI9C 3X3FL 5C0GA 5J11C 3QFJE 3ARDD 2AK4A 4HUWB 1QLEL 3GSQA 4O51A 4LLVB 5D96C 2LTQC 2Y36H 3PWLA 1CGSL 3CDFA 1T5WA 1J9CT 2IH3B 2NZ9D 1LGVA 4RFEB 5DD6A 2NY0C 3W2DL 2GFBA 1MCSA 3RNKA 4ELKA 4FQPA 3KDMA 4R4BB 1JHLH 1R24A 2VAAA 1JHKL 1G7IB 2VXVL 5JLZB 2IMMA 3P0YH 4G6FD 32C2B 2WIIB 3BXNA 3DVNB 3L3GA 2R2BA 2C3WA 1IARB 3BDYH 1Z9MA 3KXFE 4LLQB 1H5BA 3RZCD 2V2XB 4C54A 3TM6A 3U7WH 1P84K 3OB0H 4G8IA 4YIQA 5DVMA 3MBXL 5L8LB 2PYFA 5IEHA 3OR6B 4S1SH 5C07A 3SDYH 3KLHD 2EC9T 1IM3A 1FH5L 2QR0B 1DN0A 2GY7B 2BC4B 1JNLL 4XHQA 1DL7H 3IYLW 4KKLC 5C6TH 2D03L 2H6PA 1QFOA 2CIKB 4PJDF 4NT6A 5TGBA 1FZKA 3IRZA 1OHQA 5IF0A 4HJ0D 3CFIC 4M1DL 4U6XB 15C8L 3OKDB 3RL1B 2K1MA 3MNWA 3K4ZA 4R7DA 3BMVA 4JE4B 3GDBA 1U6AL 3FL7A 3T65A 4XBEH 4MZ3A 2PW1B 2ATPB 5EZJA 1B4RA 4I3GA 4WGVB 3EYOB 1KFAL 3LH2L 4PJDE 4PJHF 3KLSA 2JCCF 2JB5L 1UB5A 4XCCH 3MRBB 2D0GA 2F19L 3QWQB 1G7PA 4YX2L 1B2WL 1A9EA 4PIRF 4QHUB 4OB5H 4JM2A 3IDJB 1WISA 4JO1H 1MCFA 4XI5C 4O4YH 1B88A 4CDHA 5C0IB 1S7WB 4JJ5B 3OB0K 5A2IH 5SWZD 2PW2B 4PV8B 1WJ3A 4Q6YA 4FQJL 5BOZG 4YDKL 4NQDA 3KPOB 4WWKC 5E9DB 5HYSA 2PCPA 1KB5A 1AQKH 3MV7B 3SGEI 4K71C 3L7EB 1EEYA 5AZEH 2ZCLH 1AHWB 2ED8A 5DGRA 2Q76B 4K07A 4APQB 2VN7A 3GJFA 3AY4A 4PJGE 3T0EA 1KJ3L 1P69B 5DUMH 3FONA 5CMAA 1H8SA 3IDYC 3HR6A 3EO0A 1RK1B 4QRTA 4N0CD 1CFQA 4N68A 4ZTOL 3WO4B 5C9JA 3VD4A 4G6AC 4LLUA 2P8LA 2CDFB 2IG2L 4K9EH 1EV2E 3NIGE 4I3SL 4EIZC 4UQ3A 5BRZD 2E8ZA 4YPJA 4Y1AB 3H0TB 3FRPG 5AYUL 1XIWD 4LHUG 1HSAA 3JBG7 3I3DA 1PX4A 2K3TA 1T1XB 2X40A 3O6MH 1C12B 1FZJA 3SPVB 3GFUA 5HI3C 2AJUH 4YDKH 3QBTB 4MNQB 1LQSR 2NTSP 3SKNA 5MEQA 4J12A 2QQNL 3T0EC 1JI2A 4KJQD 5K9QI 5GGQL 3MZTA 4PJIE 1FVDB 2D0HA 4HCRA 1ACYL 1NGWA 1Z3GL 3AREA 2A2QT 2Y1VA 4MNQE 3QZWB 1BFVH 4ZXBD 1OP3H 4MD5A 3C5ZA 5BV7B 2WLZA 1UB6B 1VHPA 2MHAB 3BVNB 43CAB 4YX2H 1KJMA 4JJHA 4NSKA 2FB4L 3UZQA 4F37K 1NFDF 2EDKA 4OKDA 1D9KA 5DMYA 2W9DL 2NYYD 2YA1A 3HNVL 1W8NA 1G7QA 3TIDB 3W9EA 3F7VB 4XBEL 1E4JA 4M1GH 1K2DB 1NSNH 2D4FA 2JCCE 1OSZB 5F96L 3I02B 3MBED 4NT6B 3VXRA 4GXUM 4XWGH 4IHOA 3V8CA 5K33A 4RBPH 3IXAA 4K71B 4KY1L 4ORGB 3C8HA 4UTBL 4NQCE 4ODWA 3GMPB 3DV4A 2ZJSH 1D5ZB 2UWEA 1JPSL 2A1WH 3TZVD 3EYQD 1ADQA 3O9WA 1IQDB 2BSSB 3GIZH 5JR1L 4NP4L 3BW9B 4L8SC 4GRWB 1DEDA 3EZ8A 1BOGB 2ZUUA 4P9MH 3U36A 1NGPL 3F7YA 1JMZA 4BFIB 3GK8L 4LVHB 3MUJA 2W9EL 4OBSA 5GIRA 4U1GB 1CFSB 5FGBA 5LQBH 1BZ9B 2VAJA 3DX7A 4XXCC 1OLZA 3MRCA 4Z7QE 1U3HA 1YN6A 1FVCB 1T2QH 4G6FB 2R0WL 1Q9LA 2R56H 5L2JB 1YECL 5D7IA 3MOBH 5INCB 1YN7A 4KUCD 2UZIH 4PJFE 2EDEA 2X10A 3QB7C 5ANMA 1JL8A 1MVFA 2R0LH 1HINH 4WHTB 4HLZG 1YEGL 1I1YA 5CEZD 3D3VB 1LILA 1JHTA 3O2DH 3L9RA 4MD0B 4I77L 5F9JA 5DRXB 1RK0A 1MPAH 3P4MB 3WFHB 4GAJL 2KQNA 3S96A 5F1SA 2DKUA 2H2PC 2OMNA 4JHAL 3FT2A 5EIIA 5DZOA 1R0AL 4I9WE 2Q87A 4G6KH 5ID1A 3ULUC 2Z91A 4FQQB 4CU6A 2AK4E 2VB5A 4NN6B 1QO3B 3MR9B 5E8DL 3TV3H 3MRIA 2W9LA 5I1DB 2GIYA 1QBLL 4X6CF 2CRYA 1NCTA 1KEGL 4QRPB 3KXFA 2GJJA 5TE4L 2X4PA 3NACH 3QXTA 1WZ1L 1P9MC 3LN4B 4PLKD 1QKZH 1A64A 1NGXB 5DJYA 4EJ1C 2AW2A 1IILE 2DL2A 1MCEA 4MDIB 1UEMA 1YEJH 2DBJA 4Q9QH 1PW3A 2ZSVB 4H8WL 1A6VL 4CNIB 1CN4A 2ARJB 3MA7B 3HAEA 5BZDB 1E28A 5IHUL 1RUQL 4BFEA 4OGXL 4W4NA 3GSRA 2ITCB 5C0BE 1BP3B 5LGHL 1G7JB 1EGJA 3R0NA 1PD6A 3HE6A 2OTWB 5I75B 2IC2A 4KRNA 1EPFA 1L6ZA 1SHMA 4U1SB 3CU7A 3L1OH 4WI2A 1T03L 4DUWA 4WU5B 3T1FA 2VKWA 2LVCA 2YEZA 3DI2B 3C6LC 3NGBB 4QY8A 5CINL 4U1LB 2W65B 4Y2OA 1RUQH 2H32A 3MRKA 3K8LA 4MNQD 5HGBA 2AV1B 3CK0H 1FFOA 3GBML 5FYKH 4NUJB 2PYEA 2LFGA 2VL5A 3CXDH 4JPIB 4PJCA 3MACH 3WNOA 3ES6A 1IKNC 5CGTA 2KH2B 3VXTB 1FP5A 1NDGA 4NYLA 4Y8DC 1WBZB 3U9UA 1NC2A 1IC4H 4M1DH 4Y1AD 1I7TA 3KYKL 1V7NL 4JRXA 3UO1H 5CZXC 5CP3A 5GGRY 1CI5A 3QG6A 1C08B 1WWCA 3BDBA 4P4KC 1YYLH 1T89A 1KB5L 1VENA 3OXSA 4LEOB 3IAGC 2OTPA 4GS7C 4P49A 5CSZA 2N56A 5F6IC 2ERJB 5IMKA 1UWGL 3BZDA 2CLVA 3UCRA 2IFFH 2XA8H 1CFNA 3PQYD 1N5AA 1F97A 3C09B 3EFFB 4JHAH 3P77A 2XOTA 4RCAA 5D72L 4OGAD 1DBAL 2FL5A 3QCUL 3INUH 2OTUA 5C0JA 1VERA 3RY6C 1C7SA 5EC1B 5GRUL 3QPXL 1KENH 1RFDL 1OY3B 4HDIB 4EI5D 1AGEB 1JTOA 2AKRA 2A0LC 4G8EB 4MXWH 5CEZE 4WW2F 3MREB 4P3CL 3VH8B 4QHUA 1S7UA 2P1YA 3W11D 5LAXA 1BQHA 3WO3B 3PWUB 5KS9A 4Q9RH 1Q9WA 1F2XK 2H9GB 2ADIB 3HE7C 4CVXA 4NWUH 3RWEB 3AM8C 3O3BA 2C1PA 5TQ2H 3SGKA 3JV5A 4QHLB 4WWKB 5GGTA 3BKJL 1BJ1H 3ZTJH 5DEFA 1ZT4B 5FO7B 1WFTA 3I50L 3SGEH 3PL6D 3W39A 2CJUL 5C08B 4I18C 2V17H 4TTGA 4OZFB 3QUKB 3NGBC 2R69L 3WFBL 3IDYB 5EULV 3S3SA 1BFTA 3T0ED 3D18A 5E99H 4KK6D 3QEGH 4XMPL 1R3LB 3LOWA 2Y6SC 2RJMA 3QDGE 1EO8L 3TN0B 1XF3B 4ONHB 3EUUA 4M5YL 4CN4A 1CD1A 1OTTC 4PV9B 3VWKC 2X1OA 1FG2B 5JIHA 1YEEL 4PJCE 1MREL 1HH6B 3TP4A 1FN4A 1JF5A 4X98B 3VRLF 4NRXB 4X9GA 1MCRA 1OLLA 5IHZB 4UV7L 3D69B 1FIGL 3VWJC 5GS0L 3ESVF 4M1GL 1T4KB 2B1HH 4R97C 2VOTA 3AAZB 1N4XL 1F45A 2BCKB 3V4VH 1F42A 5DJXA 3S3PA 1RHFA 1JZ4A 2DM2A 3MGTA 2DBLL 2E8YA 4N90E 1BAFL 1NQBA 2WIMA 1CICA 2R0WH 1V3JA 5IBTL 4ZDHB 3TWCL 1Z0NA 1C5DB 4LPXA 2KZ1B 3O6KH 5CGYD 3WXVH 2AABH 1HH9A 5FUOH 1WCBA 3TNMB 3H9HA 1WBYA 1KIPA 1A3QA 5D8JH 1UJTA 2WUBH 1ZLWH 4MNHA 2I60L 3DPBA 3S98A 3VWKA 1T0NA 2BNUA 5D6CA 4JFDA 3H6JA 4E5XA 5I1CH 1RVFH 5E6IB 3O8XA 4TQEL 3UX9B 2BC4A 1YYLL 4M03A 2NY1B 2FJFB 4ALAL 1NANI 4XVJH 4K3GA 2AK1L 3UEZA 3QEUB 4K3JL 3U2SB 5IM7A 1UH3A 4M93B 1PG7X 1FC2D 3VXMD 1V5JA 3ALWA 4B41A 3OKOA 3QWRA 3K3QA 4ORGA 2ATPA 3P40A 5JUEL 1F6AA 4WUKL 3UTPE 1CD9B 1FV1B 8CGTA 4IRSA 1J88A 3EYVA 3AC0A 2XY1A 4L4TD 4FNLL 3K46A 1XIWA 5C0DA 3EW3B 2X4QB 1WAAA 5J6GA 4WEBH 5L7XH 1MNUL 2AJVL 4X6EB 1I7UA 4MVBD 4EI5A 5C0AE 2MCPH 1DZBA 3Q5YA 4OBRA 3BO8A 1PVHA 5LGHH 3ILQD 4JFEA 1BBJA 4PJEE 4KMLB 2YPLA 4S1QH 3ZYZA 4CW1A 1H3VA 2JELL 4HIEA 2BOCA 2E7BA 4I2XA 5INCA 3C6SB 4X5XB 2VYRE 3E3QE 5ISZD 3SKJL 3IDIA 4Q6IC 3IFLH 2Y7QA 2ARWA 3OAZK 4PJXA 5D1QB 1QBML 3BPOB 3QFDB 5F72S 2AJVH 2XN9E 4KTEH 3VD3A 4HKZB 1SYVB 5KAQG 1JRHH 5CGYC 5EOCL 1WZKA 3QUMH 3QIBC 3PWPD 4LFHG 1IZJA 1EO5A 5M95B 2CRZA 1HIMH 2VXQL 3WL9B 1PBYA 4GW5A 3V6OA 3ARGA 4I0PB 4F7TB 1NEZG 1N6UA 4PB9L 2UY6A 3QEQE 1CVSC 2CUHA 4K2UL 5F9OH 2AXFB 2MQCA 4FABH 4D2NA 4MJIB 3QWOA 5J1AA 2FIRT 4LKCB 4FMFA 2EO9A 5DD3H 1S9VB 4GFTB 2Q86B 5JO5B 3I84A 1AP2A 1FO0H 2EO1A 5D1XA 3P4OB 4HWZB 4IS6A 4X9BA 1CU4H 1AHWC 3GM0A 4D94A 3T2NL 1WZMA 4G42A 5E7FA 2IPTL 5DJYB 1NEUA 4O5LL 1CICB 4FTVB 2VLLB 4PYHA 1T1WA 2VLKD 4KGLA 5IB2B 3C8DA 3UYPA 1UB6A 3QIUB 4CGTA 3TN0D 4BELD 2OR9L 4XRCB 3WXWL 3B2VH 4L4VA 2RQ8A 5DD0L 3H3PH 5T3XL 1J1XH 1ITCA 4BKLB 5GJSH 3GMNA 1R3IH 1FG9C 1N3NA 3ZDZE 2DBLH 4C83B 4JM4L 2HT3C 5ITBL 1BJ1J 3EJJX 3FJTA 3BH8A 5KVEL 3CSYA 4M8VA 4JY4A 4HFUL 5D93B 5HGHA 5ACMA 1WWBX 5DK0A 1OAZH 4XBPB 1QLEH 2EDQA 4MX7A 3QHFL 4FQXD 1VGKA 2E7HA 4PJAB 2UYLB 5D7JD 5ETUA 3SO5A 2APTA 4KV5F 4ZAKC 3ARBD 3VMNA 3QIWA 1A7QL 1NC2D 2VDPL 4WNQB 1TVHB 4PR5B 4B7IA 4OZIF 1H8NA 4L4TA 5EA0H 3VXUD 3C5JB 4D9LH 1AXTH 3U7WL 2ICWJ 3QNXB 3WKML 3TO2B 1MCWW 3BP5A 4P2CG 4JRYB 1QA9B 4PJHB 4Y5XB 1CLCA 1VACA 5JXEA 4NNPL 4D0CB 5I74B 1ZWIB 2PKDA 1NBZB 1JHLL 5E0QA 4M4RA 1CGWA 4NC2B 4D0DB 2H2SC 2IADA 4LPCA 4PPTA 5ENWA 4YXKH 3U0PB 2AJSL 4HWEH 1ZOXA 5I1KH 5DUPL 2NY0B 1GGUA 2R0KL 5IBUB 4U3XA 3W5MA 2X4NA 2DQDL 1MLCB 3HPLB 4WHYG 5I76B 4LAQH 4P3CH 5D1QA 4KDWA 3SGDI 2AJ3B 1J8HD 5JDSA 1Q9KA 3QUXA 2EC8A 2JJVA 5I8EA 4OSUH 5CBAA 4PUBH 5ITFB 2VLRD 3IETB 3U48A 5I1JH 3X12A 4YHML 4P2RD 4S10A 2P4AB 5GXBB 3FOMA 2XQYG 3HR5B 1X5LA 4JO4L 4LCIH 5FCUL 5DJCA 4ETYA 5HDOA 1M71A 4RAUB 2L4OA 1QNZH 1IVLA 3HC3H 1UG9A 4OZIA 4NDMA 1FYTE 1DVFC 1INDH 5IJKA 4OLXL 3NH7H 5TF1H 2VLJD 2FH6A 4KTYA 5HI4C 1T5XB 4XZUA 1CF8L 2FGZA 4JFQA 4FFZH 5MENA 4A6YL 4JFEE 4PJEA 4ZUVA 3W9DB 3Q2CA 3VFRA 5J57B 3JSSA 5GGTL 5DWUH 4J7RA 1OB1B 4M7LT 5IW6B 5AD0B 1F2QA 2ZCLL 3QHZH 4GT7A 1BVZA 2XQYK 1RV6X 1DQMH 2WBJD 2OL3H 4EN3C 4NKQB 1WTLA 3QDHA 1ZHNA 2I9TA 3QFJD 5CKGA 2FGWH 2HVJB 3O11A 1ZA3A 1ORSB 5CEXA 3B9VA 3TC9A 1U8NB 3IFNL 4WHYH 1G7JA 3SE9L 1A5FL 3MLYL 3SDDA 4ELME 2NCMA 4R0LC 3MV11 2OS7A 3FRUA 5FXCH 5EU3B 4LCWE 3BZEA 1R3HA 1KG0B 4FOMA 2J6EH 3PNWB 3TO4C 4F58L 1A6WL 1OTUC 1S7RA 2C7UA 2FO4A 3ALXA 3NTCH 3U6RA 4P9HL 4AY0A 3GSOB 3QUYB 3D39B 5IROC 4F9LC 3VDAA 4HCRL 2CUMA 4OM0L 4ZFGL 4PJ8D 3JWDC 1TQCC 1UM5L 4Z7UA 5DFTA 3WIIL 4WHCA 5BCAA 5D7KE 2A6JA 3NACL 2NY1C 2V7HA 4IIQB 2OZ4L 4GBXA 5A43C 5EOTA 1VFAA 1OPGL 2DIBA 2GT9A 4S11A 2HN7B 2HLAA 4HIHB 4GG6E 4X7TB 3EFDL 4X99B 1WITA 3QNXA 3NFNA 5J8OA 4IRZH 4U6HB 3LS5L 1XZ0A 1QA9A 2NY4C 3QXAB 1RI8A 3MROB 1F4AA 1U92A 2DWEB 4G3YH 1XGUA 1J8KA 1G7LA 3OJDB 4XB7A 1N0XH 1JGDB 5EZOH 3PWJA 1KBGH 2Y07H 4FQXB 4NQVA 2P8PA 2YBRA 3NZ8B 1A14H 3HNSH 5I8KH 4WI6A 1KNOA 1ZT7A 4MZ2A 4KJQC 1LEIA 4OUUA 3PXJA 3QG7L 1T2XA 4MMZC 2AGJL 3OG6B 4Z5RA 4L3EE 1Z9SA 5DC9B 4POZC 1YJDL 5DRWA 5SX5H 4LL9A 3RWHB 4RWYH 3SDXA 1RUAL 3ECBA 2R56L 3QO1A 4YHNA 1MFEL 2D7PA 5GHWH 1AR1D 3X3FH 3TBYA 4Q6IB 4R4ND 1A7PH 1OAUH 3CDGA 3IKCA 3G6JB 1MVUB 3GZKA 3JV4A 4NUGH 2XZQL 3V6FA 3U46A 1NBYB 5EU6E 5F7EL 2AQ1A 3ETBF 5F7NC 2WM0A 4XMLL 3B3IB 1M6OA 2ITDA 3LQZA 2QHRL 2PTUA 2YWZA 1OGAA 3OAYK 4WI9A 1TZGL 2Q3AA 4LK4A 5KSBB 5I66A 2B1AH 1H3UA 1A6AB 1KN2H 4YGVB 3S37H 2AXFA 4K3DL 1RUKL 1U3ZA 4W68A 1JWUB 3QEHB 1BQSA 2V5MA 5ADOH 2CDEA 5KJRL 4RGMC 2NY0D 2X4RA 1AXIB 3TESA 1UM4L 25C8L 2QADC 4LSVH 2Q7YB 4U7SA 3HNVH 5EU3A 2BOBB 2I07A 1QFWI 5F7FA 3QRFM 4QRPE 4TUKL 5IW3A 5JTWA 4JN2A 4P59H 3LHPL 3VGEA 2Z8RA 4GRWF 4MXQD 2PO6A 4R3SA 1F6LL 1KACB 4P5TC 4PJ7B 3G6DL 5GJTH 3ME0A 1WBYB 3WNMA 2BNQA 3FB5A 1QG3A 4TNWF 4P3DB 1A9BA 4HAFA 5M94B 1BFVL 1C5CL 4HIJA 3EDJA 5KSUB 4JQVC 5GRWA 4MJ5B 4HEME 5ESAB 1D5XB 1OSPL 3RUGE 1H15A 3ARTA 3GSWB 4U7KA 3WHXA 2N7AA 3O4LB 4JFYB 3CVIL 3U0WL 3ULVH 1YEFH 5T1LD 3VFPA 1XGPA 1IC7L 3X13B 3O9WC 4OTXL 2YRPA 3T3ME 3TH4T 2P8LB 4KHXL 4UINH 3O45A 3CCHB 2P5WE 5HJ3B 2DQFB 1CL7L 1ES0B 4NM4L 3LQAH 1JPST 3ZYIA 4D9QD 3WXWH 3ILQC 5A2JH 3TCXA 1QR1B 3MV9E 1HHGB 4GRLD 2VLME 1MCQA 4P46D 2Y25A 5DVLA 4IRSB 3I6GB 5F21B 3TPUA 4YR6B 5HY9B 4JQXA 3OV6A 3MODH 4URTB 4QHMA 1EBAA 1JYNA 2IPTH 3SE8H 4LCCA 1HK6A 2ORBL 4HJJH 3EIFA 5DR5H 5J3HD 4IEFB 4JLRA 3AS0A 4KKCC 3BYTA 4PJ5E 1QVOA 1AR2A 4WCYL 3KPLA 4ORZC 1MY5A 3EAKA 4O2FB 4HUXA 2HRLA 5CZVH 1ZVSA 3IB4A 5MERB 1IL1A 4X5LA 1FNFA 2VXTL 3FT3B 5JMRA 5D1ZC 2ZCHH 1A7RH 4PP1D 3BKCH 3RWCB 4HZLB 4WJ5B 2XWJB 3MLWH 3CVHL 1J87A 3CLEL 4RMRA 5EUKB 5IBLD 2DRUA 4KQ4H 4Z9KB 3RVVC 4XBGA 3HKFA 4TVPL 4HULB 1FL6B 2VLJE 3PG2A 3ESUF 1QBMH 1IAKB 2W91A 3UMTA 4YK4C 2XFXA 3C87A 4UV4H 4X7FC 4JQIH 2ITDB 1KB9J 2GI7A 4QXTA 5JXAL 5E00B 3KPQB 1UYWH 4LVEA 4YGAB 4YUEH 1S7TB 5IFAH 3SJVE 4EDXA 1LO2L 5BV7C 4LKXA 3ZKXB 1C5CH 1QYGL 3H42H 5DQJA 1T1XA 3KJ6H 2E9JA 5KG9A 3BAEH 5IFJB 2HT3D 2ZKHL 5TDNB 4R2GC 1D5MB 4PJAF 3VFRB 2A6DA 3HI6L 4P59L 5BZWA 1QZ1A 5ID0B 4LHQB 5GISH 4Y4HD 4OD2A 4BQBA 4L9LC 1NCNA 2VABB 3HUJE 1A3LH 3V5DB 1N8ZA 5FHAH 5E1HB 4HWBL 3PV6A 3WD5H 1U3HD 3G08B 4F9PA 1FFPA 2HWZH 1VPOH 5I30L 1IKFL 1KCVH 5ADPH 1CLYL 3E6HA 4CUCA 5JA9A 3UTQB 1JMXA 1KN2L 3IDMA 4FFYH 3CUPA 1CL7H 3BYYA 3U7AA 4Y1AE 5I1EL 3W2DH 3RBSA 1FNLA 3ARSA 4I5BB 2GJZB 1LNUB 2ZG3A 5FHBH 4R8WH 4KV5E 5F6HJ 1G84A 2YUZA 3L3HB 4EQ2A 5L2KE 1JNJA 3MLSL 3MRLB 3PWPA 4Y88A 4D9RD 2MCG1 3CFCL 3O0RL 2FECI 4PB0L 3HS0B 1DR9A 2YD9A 2VDOH 1G6RB 3E6FB 2VZSA 1ZHLA 5EZJB 4OZIE 2BVPB 1T7WA 3OZ9H 3WLBB 4MGXA 5KAQF 3OKLA 4YDLC 4OFPA 4ERSL 1FJ1B 4P46A 1HKLH 3OZ9L 3S34H 3VXUA 3QIUC 1HHIA 4JZOA 2Z35A 1QLFB 3RA7H 1NMAL 1V8HA 3VJ6A 2ZPKL 3MXVH 5C2BL 2YA0A 4NJAL<