1UACL

Crystal structure of hyhel-10 fv mutant sfsf complexed with turkey white lysozyme
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
107
structure length
107
Chain Sequence
DIVLTQSPATLSVTPGNSVSLSCRASQSIGNNLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural consequences of target epitope-directed functional alteration of an antibody. The case of anti-hen lysozyme antibody, HyHEL-10
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hydrolase
molecule keywords lysozyme binding Ig kappa chain V23-J2 region
total genus 21
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2003-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1uacL00
3ULVL 4U1MA 5ISZB 4JY4A 2FJFB 3BH8B 3GRWH 3GSOA 4CVXA 5CINL 1UYWL 3QIUD 4PLNC 4PJCA 4JDTH 1T83C 4GLRI 1S5IH 4LCIL 4XWGH 1F8TL 3D69A 5IF0B 4DOHE 3WS3A 1F13A 4XNXL 1B0GB 2PW1A 4NKDB 3OKDB 1YEKH 3WD5L 3PF2A 3CX5K 3EYUL 1S9KC 3BO8B 2BY0A 1FIGL 1LE9A 2X9XA 1EIBA 1S7SB 1ACYH 2NX5D 3FB7A 3ILQC 4MZ2A 5EB9A 5IEHB 5J6GB 1UXWB 1FBIL 4FQPA 2R23B 4S1DD 1LO3H 4PD4K 2OK0H 5DUML 5FA3A 5C1MB 4NN7C 1CLYH 4P5TA 4UOW0 2XWBA 5EUKA 4PR5A 3VFVB 1NJ9A 5DURB 2CK0H 2YUVA 3NACH 4JY6A 4HWZA 4WI3A 1FLRL 3MV9E 5I17A 1P2CA 1U8LA 5B39A 5FA4A 1S7XB 4RDQG 3HMWH 4IBLT 4RISL 5GSVA 1RQ5A 3D6GA 5F9JA 1U95A 3DV6A 4PRNA 4K7PY 1I85C 5KBNC 3S35X 4G3YL 1GRWA 5D1QB 3QBTB 5AUMB 2NXZB 1C08B 3MJ9H 1WFTA 4X6DA 2IG2H 2OTWA 3K3QA 3L5WB 4KMLB 4AYFA 3OKDA 3DARA 5CMAA 2R39A 1YYML 1LEKB 2CLZA 1FYTE 3HI6L 4M7JL 4D8PA 2F19H 1ORQA 2WBJB 3DETC 4NQVB 4Y2OA 1NBYB 4LP4A 4Y4KD 3SGDH 3VCLB 3ZKMC 3U7WH 1HI6A 2NX5A 1JZ6A 1KJVB 1KOAA 2X4UA 1I1RA 4IJ3B 1RVFL 2PTTA 1UFUA 1BIIB 5JW5B 5DJZB 1Q38A 5TPWH 3HZKA 3QUKB 3WHXB 4MJ6A 4KZEL 4G8EB 4P2OD 5F1OB 5C0CE 5MEQB 5HDLA 2A83B 4JFZL 1YMHA 3MBXL 3RWCA 3DUHA 4CADB 2BVEA 4H26B 3FFCB 4OLYH 1IEAA 5JW3L 5KSAA 3J7HA 3W11C 1ZE3C 3O6KL 3N9GH 3QEGH 4UIMB 3HG1A 4G8GE 3IXTB 4XNUH 4N5EC 2VQ1A 5AAWA 4K3HA 1WAAA 4NQCD 4FG6C 12E8H 5E24E 4Z7UF 4OQ1A 3CDGA 4G43B 3QG7L 1J0KA 1BREA 3AM8C 1FZMB 1X3DA 3CLFH 1A6AB 1ROWA 5E03A 4C4KO 5D7LA 4Z8FL 4HV8B 3U4EB 1INQB 3MCKA 5HJ3B 2NY4C 4H5SB 2GJ6A 5DI8B 1ZKAA 4LL9A 3QDMB 4H0IA 2GTWB 4OSUL 1GGCL 1K8IA 4F57H 4G80A 5FYJU 5GPRA 4XBPA 1W72B 5SWSE 3EJYD 1NCWL 1NC2A 1KIRA 1ZGLM 3NPSB 2ADFL 1MY7A 4I77L 1XF5A 3D39B 3TYGL 2C5DC 3VH8A 1MCOL 2YRZA 3IJSA 5DI8A 4QNPE 5KOMC 5GS0L 3OKKA 1D6EA 4PJ8C 3LIZL 3SDCC 2VDOH 4S1SH 1PKQA 1EAPB 4JANB 1ZXQA 2ZUXA 4S1QH 4K23H 4QOKA 4YHNB 4KVCL 2H6PB 1YNTB 5SWZD 1D5XA 4NUJB 3RWEA 3ZKQD 4E5XA 4MJIA 3BX7C 3V0VB 2ICEB 4Y5XA 3RKDC 1MVFA 4GG6B 5AYQA 5EU6A 2IJ0C 4P5MB 5FUCC 3V4PH 5D7LD 8CGTA 1MHEA 3DSFH 3P30L 1Z3GL 4OGXH 2AJSL 5D6DA 1JGDA 1N0XL 2ZSWB 3FRPG 4C4KT 2OR9H 2FL5A 3BQUB 5DJXA 3U7AA 5IOPB 1U3HB 2BSTA 4HWBL 4HJJH 4PP1D 1OSPH 3W9DA 1G6RL 3BKCH 4POZD 1IT9L 4MJ4A 3EO0A 2VDRL 1JWSA 2V5YA 1DN0B 3VFSA 3AAZA 3O0RH 4OFYD 1BIIA 2DLEA 3HZYA 1C7SA 3QXDB 3MXVH 1FGVL 3VXTA 3CSGA 3OKNA 2ZUSA 4KV5F 2ZUWA 3OL2A 3V8CA 3MLYL 3QEQE 4XVUD 3T4AA 2AERT 1I8MA 1ZWIA 1MJJB 1XH3B 2Q76A 2VDLH 5I1LB 3D3VA 2BJML 3C2AL 1P7QD 2WINA 1QPPA 5D2LB 3SE9H 3SDXE 1N6VA 3BKJH 3EDJA 4K3EL 1ZV5A 2KH2B 3ZHKA 2WMPA 1FRGL 2EXWC 4F9PA 1IAIH 2CLRB 5M7QA 2DM4A 3WFDH 1KGCE 3L7EB 5C8JA 5D2LE 5GRWA 1G84A 3V79C 1U92A 3KPLA 3FOLA 3HC0A 4MA8L 3FN0L 2PXYB 5T3ZL 5CD5D 1I3RB 4XCNB 1JPTL 1MNUH 3ZE0F 2G2RA 1RJYA 2ICWI 1UKTA 4MNQD 4WUUD 1IC5L 3VMPA 4NQDA 1QLRA 3MRJB 4PJDE 2F8XC 2VERN 2W07A 3BD5A 2FJHA 4UDUB 5FO9B 4KY1L 5C0DA 4EI5B 5AD0A 4H0GA 1D6VL 1I8MB 4AQOA 5C07B 4TSBL 4F7CB 4PGBB 4XCYA 3EOAA 1P4IL 4HHAA 1A9EA 1C1EH 2F53A 3IETB 4PJGB 1PLGH 3MO1B 1YEGL 4JFED 3SPVA 3VFPB 5LGJB 3O9WA 5LVEA 1OP3H 2Z8RA 4TYUA 4H1LB 1BBDL 5EZJA 3K7UA 4G8GA 3WLBB 1GGIL 1NCAL 5HHQA 3RX5A 4NOFA 1DBMH 4MYWB 5F88A 1H5BC 3N85H 2AQ3A 4G5ZH 5MERB 4MA7L 1RJLA 3EO1B 1YEJL 5CP7A 5GGVY 1KCUH 3GZKA 4TUJB 4RFEA 5D96C 2R4SH 2W0FB 3MFGB 3NMEA 2ZUUA 4UUJB 1JZ2A 3BUYA 4LCWB 4U0RC 1MUJB 4LEOA 5J6HA 3NA9L 5F88B 4MJIB 2XA3A 5JIIA 3MUGA 3MRKA 4YHNA 2BDNH 4OZ4A 4ZS7L 3BZFA 3QQ4A 1JTOA 3S36L 1CD1A 4O9HL 5E00A 4Y4HD 5SWSB 1JHKH 4NKQB 4OAWB 4N0FB 3D0LA 2F53D 4U1IB 1I4FB 3GRWA 4PJBF 2NW3A 3TPUB 3F7VB 2ZZUT 4GBXB 4NWUH 3KPSD 1KBGL 1LO5B 3DVGA 4JHZA 3FJTA 5A2LH 5CZVL 2VMFA 4QHMA 4HIEB 1HCFX 1AQKH 3PABA 2HT4D 3GBNL 5EG6C 5C70A 5GGVL 4WHCA 4PRBB 1J10A 2H32B 4U3CA 4U1GC 1AXTL 4H5SA 1GIGH 3GK8H 3CXDH 4FS0A 1H3TA 3KYNA 4P57B 5IB4A 4Q9QH 1QSFD 4C57C 1U8NB 5ACZB 1XGQB 2J8UB 3GHEH 1PQZA 1MREH 2UYLB 3ESVF 5MENE 2FDBP 4JFDD 3SDCB 3QUYC 4TVPL 2GJZA 1GC1L 4YPJA 3H9ZA 1OAUL 3BZEA 5GZOC 1FDLH 2VQ1B 3RZWA 4XBGA 1YJDC 3PV6A 2R0ZL 1IGFH 3ARUA 2MNUA 4WTZA 4OJFL 1TJGH 4LLMB 3SOBL 2IBBA 3HUJB 4S0TD 3H9SD 3BGMB 5IT2H 4RMVA 1BFOA 5D2NB 1LWRA 5AEAA 2Y07L 4Y19A 2C26A 1ORSA 1OM3L 2FO1A 2J8UF 2YBRA 3IS0X 4L9DA 2O5XH 5E1AB 2VAJA 4PS4L 3WO4C 3GO1H 4NRXB 5IEKA 3C6LA 3SDXA 3LS5H 4GMSH 4HCRA 1DBJH 4PJXA 4L1DA 3U82B 3MRCB 3VFWB 3WLWC 1CXLA 3OMZA 3L5JA 4OLWL 2X4UB 3UTSE 2HMIC 2QQKL 4X6EA 2FSEB 3RIAF 5IHUH 3GIVA 4G8FA 5DJAB 1RK0B 4WW1A 2EYRB 1KT2A 1L4IA 1EBPA 5CMAB 1DSFL 1JWMB 1WCBB 2FECI 5EO1A 3S4SB 4L3CA 1I8IA 2CDEB 3O4LD 2FX9L 4XBEH 2MKLC 4NRYA 3RWIB 3T0ED 1D9KD 5T33H 4J1UA 5C09B 3QUZD 4FG6D 3FB5B 1IBGL 5DUBA 3P2TA 4X98B 1AD0B 2VUYA 3UJTL 4I18B 3T0WA 3O2VH 3MPCA 4OZGA 1D6EB 1JRHH 4DWHA 1MLBB 4KROB 1NJ9B 1OAZL 4P2QB 4XHJC 3V4VL 2IQ9L 4BUGA 1S7TA 5BV7B 4QYOA 4WWKB 4HKXA 32C2B 4ETQA 2FIRT 4QF1A 5DHYB 1X6NA 5JLZA 1BJ1H 4PJ7A 5I30H 1U8IB 4XPFH 4EOWL 3R8QA 1XGRA 1RURL 2E6QA 4NKDA 1YNKH 3VH8G 4D9QD 4RFNB 3RGVC 5F3HA 2BNRA 4P9HH 5FF6B 3X3GH 1JUFA 2HTKD 2Z31D 3G5ZA 5MEND 4XNQA 3QUXC 3FONB 5E1HB 3R06B 4CVXB 3QUZA 2QTEA 3CVHA 4UBDD 4Z7WE 5TE4L 2X09A 3THMH 1A6WL 1JNJA 1TZIB 4LPYA 2DL9A 4Y5VA 2R4RL 3HC4H 1BHGA 5I1CH 3K2UL 1LO2H 5C0NC 2JCCB 4OQTA 5I71C 2O61B 4QRRA 5EO9A 1H3XA 1J1XL 2XQBH 4U6VH 4JFFA 3WV0A 2VITA 3O4OC 4U2YA 1CGSH 3S3SA 3CUPB 3VG9B 1Q9LA 3BSZL 1S5HB 4M1CD 5D8JL 5KOVC 2UVEA 3GMOA 1A2YA 3LEXA 3IU4L 5HYQB 3RDTB 2BNUB 3UP1A 4ORZC 2X7LB 3U1SL 2ZCLH 4BFIA 3X14A 2F5BH 2F58H 2V17L 3GKWL 3RP1A 5CCKH 3B8SA 2OYPA 1MCWM 5IB1A 3ZDYE 1TETL 4R7DA 2DQUH 5FAAA 5FYKE 3BI9X 2R0WH 4K3DH 2AJ3A 2O5YL 3O4LE 4LFHD 3TA3B 3O6MH 5AUMA 3HB3D 3JV6A 3CFJB 2E27H 3I85A 3BPNB 1X5AA 2X5PA 3T0EE 4UTBH 4PJEB 4PJHF 4YE4H 1FO0B 3TJEL 2IH1B 4KHXL 2UWEF 1FFPB 1K6QH 2DQCL 3GSRB 2JIXB 5FO7A 5BZWB 3CGTA 3DX6B 4PR5B 5GRZA 3PGFL 3P0YH 4OZFB 5EPMB 5J3HD 4K7FA 1A4KB 1QRNE 2DDQL 5JXEA 2N1KA 2YA1A 3O9WC 4OT1L 2VAAB 1S7SA 5FYKH 1UB5B 2OTPA 5LXGL 3QDJD 3ARED 4M7KL 4HXAH 4NNXB 4YHKL 2V2TA 3LD8B 2ZOLB 4S1RL 2C9AA 5EWIL 4O2CB 1NGWA 1K8DB 5DD0H 4GKOA 3WBDA 3WCYA 1IC7H 1MFCL 4FP8L 3C6SB 1KTDB 2UWEE 5ESAB 1JGLH 1OGTB 3HE6A 3QXWA 2Q6WB 5KS9A 1Y6KR 2GK0B 3VI4F 4YHOH 4UNTA 7CGTA 1DDHA 5HDBE 4MA1C 2WP3T 4U7KA 4X99A 15C8L 3BAEH 4OGZA 3HB3C 4E9LA 2I07A 2V9RA 4PJ9D 3TO2A 1FL3B 1RUPL 4U33A 3WNOA 4QXGH 3SQBA 2VDPL 5J11B 5AZ2L 2AXGB 4NHUA 5F1NA 5B38G 1BOGB 3VFTB 5FO8A 1PX4A 5IMKA 2A1WH 4QXGL 1LNUB 1EFXD 1PVHA 2Z0BA 3AREA 3MYJA 3HFML 2P43B 1WUNT 3FRUB 1K4DB 1BZ9B 2QQNL 2X4SB 3S35H 1R0AL 4YXHL 5FDWB 3U6RB 2ICWJ 1JK8A 15C8H 3QIWB 4CU7A 3F12B 1Y18B 4EUPH 4JPVL 3VWKD 2DJ4A 4MA3A 3QFJA 1YQVH 1ZHKB 3REVA 2X1OA 3JWNC 4NQXB 1K2DA 1VSCA 4HPOH 4WO4D 4MQXC 5DJ8B 4L8DB 3MGOA 3MRPB 5T1DH 5CBAB 3TF7C 2P5EB 2J7LA 3JTTB 1GGUA 2HWZL 3QH3A 1A6PA 1GSMA 3I6LE 2FWOB 3IAQA 4M7LH 3ROLA 2V5MA 2GTZB 1HHIA 4M61B 4IRSD 3W81A 2ATPA 3MRQB 4XP4H 4JKWA 3LOWA 4KQ3H 3QDGD 1HSAB 1G6RA 3X13A 2IF7A 1IGJA 1YDPB 2XQYK 5GJSH 3N50A 4HK0B 5H94B 4BKLB 4F7EA 4C59B 1L7IH 1JYVA 1PD6A 2ESVB 4G42B 4L29A 4GKSA 1L9NA 2E9WA 3MXWH 3NCFB 1ACZA 1G7IB 1MI5A 3RTQD 2DIBA 1SJXA 5KN5B 3QUYB 2EDXA 1A7BA 5E6ZA 1Q9OA 4ENED 2EYSB 3LQZA 3RL1A 1W8OA 1I8KA 5B8CA 5E2UH 2BVPA 3QUYD 1WF5A 1OOAA 4N1EA 3ULUL 2R8SL 5J57B 3E6FB 2IPKB 2WQ8A 3KNBB 4OCYL 1HNFA 3GI9L 5FECA 4M4RA 5EC2A 1A5FH 3CMOH 5CUSL 2V17H 3GSNL 5TDNB 1LILA 3Q5YA 3QDGB 4Y5VC 1A6VL 4HT1L 4FHBD 1KN4L 3OGCB 5C07E 4MCZA 5HYSA 5DTFB 5M94B 3TJHC 1T0NA 2OL3B 4KFZC 3LKSB 3MLSL 3GGWA 1FFPA 3DX7A 5DA0B 2HWZH 2ITDA 4JGUA 1RZFL 3C5ZB 1WTGT 4KMTH 4M3KB 2AK1L 2OZ4A 3UCRA 2NY3C 3QUYA 4QRQB 1NGZB 4U1LA 5CGYD 5F8RC 5EBMA 3GFUA 4TRPH 5GZND 4YXHH 5DJDA 5C6TL 3S37X 3QT2A 3HFMH 4LVNC 3MJ9A 1EFXB 3FAXA 3PQYA 4PJ5A 5KSVB 2EDBA 3I75B 3NAAH 3KR3L 3P0VL 1QBAA 3P77A 5H8DA 1LO0L 3P4OA 4TQEL 5F72S 1T0MB 5KZCD 4LLWA 2IBGA 2BY1A 4ZODA 2G60L 3FFDB 1UZ8B 4ZQKB 5LGHL 4QHLA 3UTTB 2QHLA 2VLKE 3MODL 1T7VA 3MRMB 3FT2A 3QIBC 3VXUB 4KROD 4F58L 4R97C 3MV9A 3M17A 1W0VB 3RWJB 2PYEE 5D6CB 4NN7B 5DEFB 1AHWC 4WTZG 5E9DE 3DROB 2V5RA 3L6FA 3ULVE 1D5BA 2A9NL 4HGWB 5GRYA 3V6FB 2V6HA 2VZSA 1DR9A 1Q0YL 3CH8A 4PYHA 4OT1H 2B1AL 1TVHA 1WEJH 3TT1L 3WFHA 4GMTH 4GOSA 4FQQB 3P0YL 5JZ7C 5D7LE 1QKZL 1CGXA 2A2QT 1YUHB 4M6AA 3PUCA 3B9KC 1CICC 1CFSB 3T0DA 2JIXD 3ILQD 3DXAD 1YJDL 1MFAH 4ODUB 1KPVA 1S3KL 1TFHA 2GJJA 2Z8WC 3MACH 4K7PX 5DQJA 5HXMA 3SO3B 1WC7A 1DBJL 4UTBL 4UT6L 2Q6WA 5KS9B 4PJHB 3TA3D 2O5YH 3MV9D 1MJ8H 1MAMH 5BV7C 1QA9A 5D1XB 5A1AA 1KPVB 2DM2A 4KKBD 2UUDH 5JPMA 1BVKA 4J1UB 4JDVA 3LKPB 3VDCA 4ZXBA 3T3PE 3UZVB 5CJXA 3V0AC 2IH3A 5C86A 4LRIC 2E7BA 3B9VA 3U1SH 4ODHL 1I8LA 1G9NL 5DHVH 1NKRA 4G6JL 5DHVB 1NMBL 1IGIL 4LHJB 4TVPH 1M05B 4ZUVB 1IAKB 4WEBH 4OIIH 3SGKC 3MJ7B 3VGAB 4M8VA 2VDNH 3BSZH 2OL3H 1G7MB 4HWEL 1F00I 1S78C 1DBAL 4Q9QL 1U8OA 3M17B 3ESUF 2GITB 5JW4R 5D2NE 3ZE0E 4MSWA 1VPOH 4U6VL 2OXGA 3FQWA 4MDIB 1SYVA 4XVJL 3M1BA 5C08D 3CFKA 2E5EA 5AAMA 1WWAX 1MQ8A 1OAXL 4GW5A 3RTQC 4DW2H 1OW0A 2R4RH 3A67H 1MWAB 2AJVL 4QHLB 3IKKA 2VL5A 4WHTA 3IDIB 1A6WH 2KKQA 1NMAL 3CSYB 4NWUL 4GH7B 2YZ1A 1KPRB 2EO9A 3F7QA 2BMKA 2P49B 3P4OB 3OAZK 4LLWB 3P77B 3BIKB 4MMXC 3D3VD 3IGAB 2WP3O 1ERNA 4KI5F 1I9RL 2ICWA 5CZXC 5GS1C 4XHQA 2BDNL 4XCEA 1UWXK 4QNPF 4Y2DD 3HS0A 3PWJB 2R2EA 3FQNB 4MDJA 4U6HB 1QUNA 3QEHB 4XPFL 4X83A 2HVJB 2N7BA 1FL6B 1FFNA 4YDJB 4Q6IC 3PQYE 4DKDC 3EHBC 4MNHB 4WWKD 3UC0L 3EHBD 1CGUA 1KCUL 4NQTA 4ZOAA 3ZSSA 4G8IA 3CFBB 1A14L 4MA7H 3AY4A 5DJ2A 2HFGL 4U6TA 5E8PA 1E28B 2H9GA 3HR5A 2QADB 4MQ7B 1C8PA 2XTLA 3T3PF 3LKSA 4JREC 4HC1A 2VLKA 4WDIB 4WUUA 1WV7T 4MX7A 3AMKA 4GO6B 1LDPL 1IBGH 5GIRA 5IFJB 3VXRA 4XNQB 4MQTB 4BH7A 4YBQD 1F4HA 2V2WA 3LQAC 3UTQA 4ODWB 1LEIA 2HT3C 5CEZE 1HSBA 1HHKB 3GJFK 4XP1H 1MCDA 3MRKB 2J6EL 3B3IB 3EZJB 2XACC 4CNIA 3ELAT 3HE6C 5J6HB 4MNQB 4P46D 5AWNL 3BPCB 1EEYB 2D9CA 1MNUL 3CPLB 3RAJL 2VLJE 3EYQD 5JPNB 3UBXB 2X89D 5DD5L 3LS5L 3Q6GH 4GMSL 3DGGA 5CLWA 3TBSA 2CKNA 3LN4A 3S7GA 3DTXA 4NKMA 2HFFA 2ESVA 4ZS6D 3IVKB 4PGEA 4FQ1L 1IAIL 5D7KD 1SM3L 1DQTA 4ORGB 3BZ4B 5IT2L 4N8PA 5CSZB 3GSXA 4HS3A 2R29L 4QCIA 2FR4A 4HHAB 3LSOB 4KK9C 1TJGL 5B3NA 2CRMA 5EN2A 3QCUL 1I1AD 3O45A 1UZ8A 3FFDA 3SBWA 5HVGB 4NZTH 2ATPB 4YHYC 2Y5EA 3FQTA 4MWFB 3V0WH 2HVKA 5D1ZD 2N7AA 2NZIA 1LQSR 2EYTA 5IVXB 3ILPB 3GHEL 1T20B 1A9BB 4A6YH 4M93C 3ZDZF 4HC1L 5BMFL 5I16A 3LSOA 2FECL 5EU7C 3AGVA 4R0LA 4KUZH 2H2SC 3QDME 2AVGA 3M1BB 4F7TB 1QSEB 2NYYC 5KAQF 4NRZA 3ULUD 1E4XL 4WV1C 3QJFB 5EBWB 3QUMH 3EYVB 3BDYH 5I16B 2CKBA 4UV4H 1EJOL 3MBEC 2KUTA 3OZ9H 2E7MA 4LSPL 5TGBB 1GYAA 2XPGA 2JELL 1Z3GH 4OGXL 3TBSB 2NY2C 1MCBA 4XMKH 4CW1A 3DVIA 1M05A 3GSUB 4XCFL 3SE4A 5DZNA 2R69H 4MNGB 4NGHL 3O6FC 5J1SC 3KPRE 4NHUB 3R1GL 1XGUA 4Y4HB 4HF5L 1XH3A 1N3NB 3GSXB 5CSZA 3ETBF 3TVMA 5FM4A 3OKNB 3LRSB 4M00A 3HI5L 3MZGB 4QRUB 3NA9H 4KROC 5DRNB 4N5UA 3IU3B 3SY0B 3T1WA 3RY6A 4HZAA 3T65A 5B8CC 4CRPA 4EIGB 1NBZA 4RGND 5BCAA 3UYRH 1DFBL 4PLJC 2YD6A 2OXHA 4QKXB 3KYKH 5IR1A 2C4XA 2EDJA 3W9DB 3O9WD 3EOTL 5EOQL 2ARJA 1HOCA 4HQQL 4P2YA 2XT1B 4LHUG 5HHXL 3UTSA 5I1KH 2ZNXA 3VDAA 1KTDA 3BPCA 4YWGL 4NCC2 1VFOA 5D70L 2YC1B 1A6TA 1YUHA 4KJQD 2DTSA 3RKPA 25C8L 4KH2A 4WI6A 4YX2H 5EUOF 4QRTA 5KSBB 1I4FA 1LVEA 2A0LD 1UB5A 4BSJA 5GGUA 4G42A 1A1NA 1RY7B 4MD4B 2OCFD 5C07D 1V8HA 4BQ9A 1EPFA 4OLXH 4P23D 1KENH 1UWGH 2FX8H 4ELMF 4NIKB 2V2XB 3GI8L 4ZFFB 3EJYC 1IC5H 4IIQC 4WUUB 4C56A 2MFNA 1KIQB 1FNSL 1FNGA 2R1YA 1WFUA 5LJYH 4P0DA 1WAAF 4JHAH 1FO0A 3TC9A 4K55A 1HE7A 5SX5H 2EDTA 3C8HA 5E8NB 4N1HB 5C0BD 4NSKB 3FN0H 3MRMA 5H2BB 1CVSC 4GRWH 3S5LG 1RJLB 2ZNWA 4MD0A 1MFBH 4NCC1 1MWAA 3WFDL 4YDJA 2X4PB 2J3SA 3B9KB 3TBYB 4XXDA 5D93C 5IHZA 1X44A 1C5DB 3BKJL 1RZ7H 3MNWB 3ZT7A 5I1EL 1U8OB 4M7JH 2EE9A 4BFIB 3DRTB 3IGAA 4RA0C 4HUXA 1I9JL 1FE8L 3NIFE 1QFHA 2AK4A 1FGVH 3V52H 4JN2A 5EU4A 1H8OA 5EH1A 4H26A 1BVLA 3C9NB 5TQ2L 1WIOA 1T21B 1CL7H 5CJQH 1IT9H 4QCIB 2J4WH 5T3XE 3TO2B 3VFNB 4TSAL 4OIBA 1MH5B 2CK0L 4Y19D 4F3FB 3BQUD 1YC8A 3V6OA 1DUYB 3NN8B 3KAAA 4HXBH 5FGBA 5C09E 5A3ID 3DSFL 4PJFF 3AS2A 3V4PL 3C6LD 4R2GB 1HQ4A 1X4YA 2F54E 2BNRB 4PLJD 2EDLA 4LSSH 1J1PH 3DX8B 5E2WL 1DQJA 2XXCB 3KPPB 3RHWF 1UM4H 1B0RA 3ARBA 2NZ9D 4K9EC 5DWUL 5GZOD 4G7YH 3QDJE 4JKMA 4AENB 4ZXBB 2MHAA 1BJMA 4GRMA 2UZYB 3LIZH 1T83A 2K3TA 4X6DB 3KNBA 2ARJQ 3CU1A 3FN3A 3BN3B 4D0BA 1EX0A 5JLZB 2VAAA 5L0QB 1DQJB 1AKJA 3QUZC 2CDGB 3UPRA 4YR6B 3GRWL 1DN0A 2NXYD 3D39D 3TYGH 3H42H 4CMHB 3FT4A 3T0EA 2BNQA 3WUWA 2JTDA 4L3ED 2EYSA 4PB0L 5A16B 2ICCA 5D4QA 5I17B 1YPZE 5DR5H 1EEZA 3RVXC 2DQIH 1BQSA 4R96B 4DQOH 3UZEA 5IMOB 5FYJD 1KLGB 2YMXL 1HILB 1U6AH 2CRZA 2X41A 1UWEL 1FG9C 2EIZB 2NMSA 3QG7H 5I2IA 2VIRA 1V05A 4KUCF 1CXKA 4K3GA 4NUJA 4HK3N 5HHPB 3RWEB 1EGJA 3LQMA 4NP4H 4XNUL 4JRXE 4PRHA 4R90H 2DL2A 4Z9KB 3IDNB 2AEQH 1MCSA 1SMAA 1KT2B 4MDJB 5KVMC 4NQEB 5SX4I 1JTTA 1IM9B 1NLBH 5JW3H 4NHCH 1L0XA 4GS7B 4ZSOE 3RWJA 3BH8A 3T0XA 4I0PC 1F4WL 5DT1H 3IDJA 4JFZH 5IW1B 1G7QB 2ZUVA 4AEHL 1RI8A 4HIJB 4P2OB 2YWZA 1A7PL 3H7LA 1KIRB 4KZEH 1BMGA 3OKEA 5TPWL 2YBRB 4IMLA 1O7SA 3BMVA 3F12A 2OM5A 1KLUA 4GSDL 1AGBA 4JFFD 3CXHJ 4ZS6C 4DEPB 4NZUL 1U8HA 2APFA 4RRPG 3W5NA 3D85D 1SQ2N 3HI6H 4P48A 5I8CA 1YYMH 1EVTC 3T8XB 1A7RL 2LU3A 3MLXL 2R1WB 1FL3A 4PRHD 3CX2A 3MJ7A 1JUFB 3MA7B 5L6YL 2OQJA 1HHGB 1MAJA 4HUVB 1A1NB 3TESA 5ACZA 4GT7A 1PQZB 3D25B 2VE6B 5I1EH 5JOFB 4N0UE 3LH2H 5IMLB 2ZPKH 4NKIH 1KJ3H 5KW9L 2A38A 4A6YB 5GJTH 3TWCL 3NACL 4H25B 2FBJH 4QF1B 4G6KL 2R56H 4XMPH 4NNYB 1MFBL 1PG7W 5DHYA 2Z91A 1CLYL 2FEDC 4Y16A 3OGOE 3X11B 4XVTH 1J0ZA 1NDGA 4RZCA 5B8CB 1SHMA 4PJHA 1ND0A 5KSBF 1ACYL 2NX5B 4KRLB 4L3EE 4X80H 1GGTA 3U0WL 5J9PB 1RIHH 4PJ8B 1NBYA 2DM7A 2ZCKH 5FM8A 1U91A 4OAWA 1RUQH 1CD1B 3D85A 4OF6A 1QO3A 2XWJB 5C0GA 3G6DL 5DQDH 1UH3A 1KTLB 1QRND 4G9FA 1HQRB 5FYJE 1P4BH 5C09A 3TBVB 2E9IA 5FGBC 4LCIH 3QNZA 4XWGL 3GIZH 4OZIB 1KENL 3STLB 3TA3C 4OLXL 4CUCA 4IDJH 5GRUL 3BUYB 2XZCL 4ZUSA 5EO1B 3SE3A 2WUCH 4OGYH 5F9DC 3VD3A 1JWMA 2NXZC 1J8KA 2D7QA 3C60C 5ANME 4N9GA 3KJ4C 2XRAH 3U36A 4FNLL 5F7KC 4HWZB 1YECH 1F4XL 4S11A 3G5YB 2FHCA 4HDIB 4LSRH 1GOFA 3DMMD 5LCVL 2FEEL 2VKWA 3O9WB 1GPOH 4M7ZC 4X4MA 5EZJB 3IT8D 1FORH 1MRCL 5EO0B 2VXUL 3MO1A 4KKCC 5LGJA 3V5DB 4RGNB 4KXZH 3IFNL 4P9HC 3S37L 1MFDH 3NABL 3QEQB 3V5KB 1NGYB 4MAYB 4W6YB 3HUJF 2QADC 3S37H 2NY6C 3BPOB 4Q7DA 3SDAA 3NZHL 3D2UD 3MFFA 4N0YL 4XT1C 4XAKD 5EU7E 3BVNB 3QIBB 4G8GD 5F1NB 3R1GH 1ZMYA 3NOIA 1PZ5A 4G9DB 5ISZA 4PJ5B 1K5NA 5KSVA 3BZ4A 1M7DB 4HPYH 3RGHA 4FQ2L 3EJZC 1YECL 1NFDB 1Z0MA 2JELH 3G5VB 3KPLB 5KSBE 4IRZH 5DMGC 1VEOA 3WJLA 2DQEL 4P57A 5E9DD 3ULVD 2APVA 1FC2D 4ODTH 3U6RA 2FLBT 3PWLB 1OCWH 1E4XH 5HVFB 3IFLH 4RMUA 3KPRD 4UQ2B 2NLJA 4XP6L 2WINB 3TCLB 2QSQA 4HIEA 3VD4A 3GIZL 5LGKA 5I1LA 2W9DH 3NFSL 3VGEA 1N8ZA 4A6YL 4XMLH 2P42B 1QRNB 2QJDA 2YA0A 3T2PA 2XNAA 4OLUL 5FHBL 3VG9C 4O00A 3F7VA 2DQHL 1X5GA 2HMID 3LKOA 2FEDD 3EW3B 3HC3H 3K0WA 4NZTL 1U8QB 1MVUB 2JB6B 4K71B 4KRPD 5IGXH 5IB2B 1LEIB 3ZE2F 3AAZB 2LU7A 4QYOB 3W9EA 1FHGA 3EYSH 5L8LB 5CP3A 2MCG1 1H3PL 4YBHA 2Y06L 4Z7NE 2X40A 1FSKB 2Q87A 3TWCH 4Y5YC 5D71H 3GSRA 1MSPA 4R4FH 2FO4B 1ZOXA 4DN4L 4TULH 1AD9A 1E28A 2H9GB 5E8PB 2ZPKL 1P5UA 3QZWG 4X98A 4PBXA 1NFIA 2I9TA 4N0UA 3VI3E 5DD5H 5F7MC 4LCUA 1RUKL 3IDYB 4WENB 3DO7A 5HHME 3HPLA 2AJ3B 4PP1C 4YFLI 1H15B 5SX5K 1OQXA 4R4BB 1FL6A 4RBPH 4PJ5E 2ZWLT 2VLLB 3QXTA 3U7YL 4U1SB 2DLFH 2J6EH 2R0LL 1ZTXL 4QO1A 3NFNA 3SPVB 4NZUH 3EFDL 2NY4D 4UAOC 1AQDA 2VB5A 4M6NH 3EDDA 1JGEB 3I02B 3WL9A 1YPZB 5C0CB 4H20L 1RZIA 1WVZA 2X1WL 2YSSA 1NLDH 3OAYK 4KKCD 4I0PD 2YD8A 4E42B 1N2RA 1ETZB 4NN6C 3MLTB 2OS7A 3EDFA 2Q20A 3DGCR 4F9PC 2VLRB 3CUPA 1A7PH 4FABL 2CRYA 3CH1B 4OCXH 1F4AA 3MGAA 4Z7WB 3WYRA 1H0DA 3W11D 1TZGH 3OB8A 1U0QA 2PYEA 4KRMB 5CGTA 3ROOA 1SYSB 4HBCH 1IQDA 4JPIA 4ZNEA 3UC0H 4QXUL 5E4EB 4R90L 3T77B 1MCJA 1N7ML 1AY1L 2JK5B 2O93L 1ZT4B 4ELMA 2GJZB 3BWAA 4RFOL 4XWOC 4APQC 2EE3A 3G5ZB 4PJBA 4HFUH 1JNNH 1IKFL 1OP3K 4FXLA 2HN7B 1YEDB 5D7SL 2DMCA 3KYNB 3VA6A 3QJHA 4F80A 5EA0H 1VGEH 2L7JA 2JCCA 1LK3L 1MLCB 5I66B 1RU9H 3LDBC 1NMAH 5JW5A 1A7QH 5D1XA 1P9MC 3PP3H 4JFEE 3NTCH 2YUWA 4WFHE 4QT5B 4XI5C 2FGZA 2FIKA 3MLVH 1RULH 3O8XD 5IVZB 5IESL 1ADQH 1S7TB 4LQFH 1W0WA 3GB7A 2R15A 3H42L 2NXYB 4XVJH 3O2DA 3S36X 3R06A 3QCTH 2PYED 2IPTH 3CVHH 1VPOL 2WBJA 3T0VA 3D0LB 5DS8A 4ENEC 1Q72H 1NDMA 1AIFA 4TUKH 5DC0A 3EYOA 4PLOB 1TVDA 2X1XR 5EFIA 4HWEH 3FL7A 3VI3F 2OL3L 2B1HH 5GGRA 3WN5C 3ZKND 4LLQA 4D3CL 3L95B 1G0DA 5DC4B 4P3WA 5ENWB 5E2WH 2VIRB 1J1PL 2Z31A 2NR6C 3RWIA 1RZJH 4KAQH 5TFSH 2NY1B 4Z7UE 4HXBL 4KJPC 4PRNB 5CKGA 4QEGA 3PNWB 5EPMA 5GSVB 1FYTD 5CSBA 2XA8L 4LLYB 3L6FB 3L3HA 4DTGH 5BZWA 4Y8DC 2X4NA 5DJAA 2E7HA 1CQKA 1JWUB 1CL7I 3WFEL 3VFUB 5DJYA 5CJQL 3SGJA 1PJ9A 4TTGA 5TQ2H 2CR6A 3SDAC 5MI0C 3TJHD 3ULVC 3VGHA 1I8IB 3DXAB 1Z9OA 3MUY1 1S7RB 2AJYH 4Z7UB 1QKZH 2FJHB 3QEUA 5FO9A 3EYOB 3NGBC 4YBLB 1XCTA 1FZMA 2PNDA 1FAIL 5J12B 1BD2B 3MOAL 2FSEA 4M4PA 3FB8B 2VR4A 1Q0YH 4UT7H 1UM5H 2GCYA 3B9KD 3I9GL 4PIRF 4Z95L 2FIKB 1DUYA 1WJ3A 2AV7B 3HG1B 1INDH 2FB4H 4U6XB 3L7EA 2ESVE 4AL8H 2KDGA 3O2WL 4U1LB 3F58H 1NCDH 2CLRA 1T2QH 3KHQA 4LQ1A 3K1KC 4TNWK 4LDOB 3LZFL 4I0KA 4AEIL 3VXUD 1RJZA 2VITB 1BVLB 3W39B 2V7NB 1CLOL 5EULV 3U4BH 2UVFA 5HBBA 2I60H 5CJXC 1MIEH 2XTJD 3UTTD 2FX8L 3O3BB 5C0CA 4JPWH 1X5IA 5CILL 4RWYH 1HN1A 1G6VK 3V95A 4U1IA 3VFRB 4TQEH 2CXKA 1R3LA 4BA8A 3UBXI 1DE4A 5JOEA 3QEUB 4JAMA 1J5OH 1JWSB 2B5IB 4JFHE 5E8EB 5D70H 4R4BA 4XPHL 3U9UA 5HHVH 3K8KA 4N90E 5GHWL 2G75B 5I1JL 3BPLC 4MQXD 3VU2A 1MHPH 3CD4A 3VFMB 4QTIL 4NSKA 2UZXB 5F9JB 3O3AA 4WFED 3OKMA 5D7IA 4GXVH 2V5TA 5KN5A 4B50A 4ZDHA 1ZLUH 2Z8VC 3MRFB 1MRDL 4U1KA 4ETYA 5DMIL 2R1XB 2VH5L 1DEDA 5IUSA 1JI1A 5MI0B 1DVFB 3BYYA 5T3XH 2P7TA 2P24B 5C7XL 3RY6C 5TF1H 2BHYA 2XY2A 3NPZB 4JRWA 4P5KB 3CXHK 3CFDB 3I6KA 1KLFA 4L4TD 4HT1H 4MAUH 1A9EB 3GBMH 4NM8L 1U36A 1V3MA 1JTPA 1RPQA 4M6OH 3TP4A 4M43L 4RMWA 1WISA 2YA2A 4XMKL 3V4UH 2QLVB 1UVQA 2XNAB 2H2SD 4X6BA 4LSPH 4H25A 1NC2B 5EBGA 1E4JA 3TNNA 3GI9H 2C4FU 4JQVC 4OLZH 4WO4A 1AIFB 5A2IH 1RK0A 4YNYB 3QDMA 2R8SH 4MVBD 1DUZB 2IEPA 1B88A 3KYAA 4D9RD 4U2ZA 4HC1H 3MRCA 4G6AC 1KGCD 3SO3C 5IW3A 4MHHI 3MA7A 1RZ8B 4TNWF 4C83A 3NIFF 1M7DA 2ESVD 4NN6B 3TVMB 5C07A 4F7CA 1CXFA 4J2XA 1UT9A 3QI9D 4FQHA 2P5WB 3DUSA 2W1NA 2BY3A 3T2NL 4JR9H 3SDDD 2VR5A 4LLMA 4M1GL 4F2MA 1EUUA 4W4NA 1X5ZA 1I3RA 4XCNA 1MCFA 2NR6D 1HYRC 1BM3L 3K8MA 4U6XA 2WBJC 3PWNA 5ANMB 3G9AB 1F5WA 4L8SA 1NCTA 4DKFH 1UH2A 4R0LB 1Z9MA 1YNLH 4DGYH 2UV3A 4YNYA 3VG0H 5ESAA 2DQTL 2Y25A 4BK4A 3IDNA 3U30B 5DGQA 3WXVH 1AI1L 2HVKB 1F3JA 3QIWD 4XP1L 1R0AH 4FMFA 3S35L 2BOCA 1S9YA 4G6AD 3F5WB 4WFEE 4YHPA 2VQUA 3QZWB 3H3BC 4H88L 4CMHC 4D94A 1MELA 2A1WL 4HS3B 2IBZY 3EFFB 2C7UB 4ONOA 4POYA 1T1ZB 3EIFA 5MEPA 4LARL 3LN5B 5CZKA 4RGNE 3BKYH 2D7TL 3QCVH 3DTXB 5DGRA 2VWEE 4LEOB 4HIHB 5FA3B 1WZ1L 4TSCL 4LSQL 1KCSH 3DNKA 3M8OH 4MLIA 5FGRA 2BOBB 3T4YB 3MROB 4LFHG 5DFVC 4KKAD 1DQLH 4G80B 5HHOA 2ICEA 3G6AB 5DLML 2HH0L 1MJ7H 4G9FB 1D5XB 4Y2DB 4JAMB 3P0GB 2D0FA 2JJSA 1QO3B 1F97A 3RVUD 1X5XA 4EXPX 3O3EB 4B41A 4TTDC 2H2PD 3LAFA 4AK1A 2VRAA 4KTYA 1NDMB 3ZDXF 1J12A 3DI2B 1JPFB 1A3QA 2DB8A 1FN4A 4L1HA 4BSVA 2R1WA 5CSGA 4ZFOL 3V8OA 4NFBA 1FFOA 5K9QG 1G7JB 2Y5TA 1BAFH 4PBWD 3HE7C 1Q94A 3P9MA 5C08B 4YO0A 1KCLA 1K6QL 5C0ND 2J8HA 4KHXH 4JRYB 2V7NA 3W39A 4YDLC 4QRSB 3VDBA 1RJYB 3QXVA 4XP9L 4IRJA 5E2TH 4UV7L 4HIXH 1NEZG 4HFWA 1IL1B 1DBAH 3VW3L 1VERA 2E27L 1CLZL 4IMLB 1Q94B 4JQXA 3V6OE 5I1DA 1CF8L 2Y6SC 4XZUA 1BECA 3OAUL 4X9BA 1NUNB 4JRXB 4XGZA 1TVBB 2AABL 5I1IH 1NMBH 5JOPD 1B4RA 3HS0B 2F54A 2DQUL 3QSKB 4NZJA 1TETH 1QLFB 4QRPB 4PRHE 3QRGL 1LP9B 1WZKA 1JN6B 1MFEL 4C54A 4O4YL 2DS4A 2F58L 2F5BL 4WUKL 3QG6A 1OTUD 2X42A 5KSAB 3RWCB 3DXAA 1EK3A 1ZWIB 3DUUB 5HPMB 4P2CG 1PGRB 1KC5H 3OAUH 2GUOB 5SWQB 1JHTA 4DFHA 5I9QC 3EO9H 4PJ7B 2BOBA 5D1QA 3CFKB 5DQ9A 3Q2CA 1JZ5A 1UH4A 1KLGA 4WHDA 5HDOA 3VFUA 4UV7H 1S7UA 5E2TL 5T5NG 3GMPB 5HDBF 4DVBB 2LAGB 2X4NB 4G6FD 1S3KH 2Y72A 3MRRB 3ULVF 5I19L 3TFKD 5B39B 3ZTJG 4D8PB 1XF2A 4PJEE 4JY6B 2Z92B 2W9LA 4ODXA 4JFXB 1NPUA 4AH2B 5B21A 4PYGA 2F54D 3TT1H 1KXVC 3O6LH 4UB0H 2B1AH 5ICXB 5MENB 1KG0B 3EJZD 3MSPA 4GG6A 4V2BA 4J6RH 1HNGA 5IMOA 4E5XB 2A9NH 1RURH 2D31A 3KPTA 2CH8A 4D9QE 2MQ0A 3EYQC 3HI1B 1CTOA 1ZVYA 2NY6D 4ZSOA 5D7JC 1DQLL 2KQNA 5J9PA 4F58H 3GJFB 3P4NA 4BSWA 1C12B 3WFCH 4WI7A 2BXYA 3CNKA 1EXUB 4LP5A 4Q2ZA 4TSCH 3TBTA 3ZYOA 3KPQA 4P2QD 1JF6A 4IMKC 5DQ9B 5LGHH 3MTRA 2D7TH 3BKYL 3LKOB 4M03A 4LARH 4GAYB 2GEEA 4MD5B 3UJTH 4AENA 4FQIH 4NKOA 1RZGB 4JM2F 4G9FE 2QSCH 4ONFH 2HT3D 2WQRA 4MNGA 1O7VA 4X6DE 3AFLA 3WSQL 5C9JA 1D5BB 1CQYA 1DSFH 4OV5A 1EV2E 2DKUA 1BGXH 1AI1H 5EBWA 4KHTH 1Z0NA 4FQCH 1XGQA 4NO5A 4OFIA 1CDHA 4J4PD 3TLRA 1K5NB 4GBXC 4Z5RB 4OLWH 4LNRB 1YMHB 3WNPA 1QFOA 3L3OB 1CR9H 3BE1H 1QSEE 3AC0A 3MV8A 2WIIB 2VLKD 3BVNA 3QIBA 4KDTC 4PS4H 5DEGA 2BRQA 5HI4C 5CHNB 5E8NA 4Z78B 2Y07H 5HD8C 4TVPD 1KN4H 2YSSB 1A6ZB 4POUB 2M2DA 4Z7WF 3KPNA 1JHLH 3SDDB 1E4WL 2C3GA 2XWTA 5KSAD 1J11A 1X5LA 3EOBB 4L9LC 3VXNB 3LV3A 1ORQB 5CUSH 3RY5A 2VLLA 1Y6NR 3BIAX 5F7YC 4QRPD 3QI9B 2RHEA 2W0PA 2AABH 3FKUS 2WM0A 5A40E 1CD0A 5I1IL 5E6IB 4Y7MA 4N90D 1XFPA 5BZDA 1CF8H 3SGDI 4KKLD 3VW3H 2ZOKA 1QSFB 2YC1A 3CPLA 1JF5A 2NY3B 4JY5L 3MXWL 1SY6A 1XR8A 4HUWB 3VXPA 3KPRA 1AQKL 4MXVE 1T0NB 2OL3A 4OZIA 3IJHA 3JWDH 4OB5L 1NC2D 3KLDA 5ERWB 3SEPA 3KPSB 1L7TH 3AUVA 4GBXD 1CDYA 2EDFA 1AKJB 3ZKSD 1F45A 4M8QA 2YS4A 3VFRA 4D0BB 4XP4L 4LK4A 5JIHA 4X4YB 4ODVH 3SQOL 1JHKL 3VJ6B 1W2KT 1JFQH 2PW2A 4IRSB 2DI8A 2X1QA 1ND0B 1DVFD 1VENA 3L1OH 4XTRC 1JGVL 1I75A 2OR7A 5C0DB 4ZS7H 5DMIH 3BXNA 4G9FD 3WS3B 3HMXA 1CFBA 3OSKA 5C2BL 2BVPB 2D03H 2NLJB 2DICA 3GSUA 3ALWA 3PWLA 4D9RE 3BT2H 5HYJA 5L0QC 5CEXA 4HPOL 1ZGLP 2DYPD 2XPGB 2OLDA 1T89A 3N1MC 3NCJH 3BP5A 3QP3A 4Y4FC 3MRNA 3VWKB 3K4AA 4X7TA 3JBG7 2EXWD 2CRIA 4W70A 5DRNA 1FNEB 5DVLA 2X44D 1DBML 2IADA 2AV7A 4XPHH 5C0AB 4PTTA 3SJVB 1IGJB 4G9DA 4M62L 3C09B 3TIEB 5C08E 4OGAD 4X5XA 3TV3L 1XGUB 1HSAA 3I6LD 2QSTA 2FJGB 3H9SE 4KK9D 4M5ZL 3NPSC 1XCTB 4RMTA 1NCUA 4H88H 4U7MA 4LMQI 5I8KH 3FQTB 4MWFA 2YUZA 5E8DH 1NGYA 4JPWL 4O51A 1C16A 5B3JF 5BRZA 1MCIA 2MSPA 5DD3L 4KY1H 5MP6L 3QNYB 2XN9B 1WWBX 3T3MF 2W65B 3QXDA 2HKHH 4OCRL 3O8XC 4PBVC 2VDQL 2DQTH 3OKEB 4MNGE 2HLAA 1C5DA 3VG0L 1YMME 5FCUH 3UTSD 4DGYL 1JGLL 5IIEB 1H3GA 4TUOB 1IZKA 1NCDL 4R0LC 3ZE1F 4DKFL 1X5FA 4HDIA 4AL8L 3CSPA 4WU5B 4N0CD 3B6SA 3ZHDA 1ZGLB 4KGJA 4ZNEE 5DYOB 1H9VA 3PWPD 1BQLH 3FQXB 2P8LA 3RI5K 3KPMA 5HSFA 2BERA 5JW4Q 3SKJL 3AREB 3MYJB 4M7KH 3UBXA 4JG0L 5C6WH 3HNSH 4PJDF 4APQA 1L0QA 4WIQA 2LVCA 4FZEH 2SEBB 4UT7L 4YHIA 1OP5H 4L3AA 2YPLB 4WY7H 1OY3B 3O3DA 3MOAH 1P7QB 3OXSA 4KDTA 3VWJA 1VFAA 5IFHL 1A4JA 3PGFH 2AJYL 5DEZA 1KB5L 2P4AB 4U49A 1PKQB 5KJRL 3MRFA 4FQXD 5CGYC 4BJLA 4X9FA 4IJ3C 2JCCE 4BFEA 4LHQB 2YKLL 3HR6A 3H7BB 3O0RL 5JW4N 1HWGB 5T1MB 2BHUA 4CVZA 1Q9KB 3WIFB 4BELD 4PJXF 3SDXF 4FZ8L 2DBLH 2CDGA 3UPRB 1EEUA 1LD9B 4PJIF 3HR5B 1Q0XH 1U3HD 4MQ7A 1MQKL 2DQDH 3LKNA 3PGCB 2XA8H 4CNIB 4O2CA 1FO0H 4ZTOH 4A6YA 1QFWM 4NNXA 5CCKL 5E8EA 4ALAH 3ARYA 1TVHB 1BFTA 1CE6B 3P30H 5I6XC 5DD6A 1TJIL 4NUGH 1AGEA 4HJGB 3GBML 4NM8H 3LS4H 3VXSB 3IRZA 3IU4H 4ELME 4F33A 4NM4H 1Y6MR 5D8JH 2L0DA 4A2LA 4Y5YB 3ES6B 4LLDA 2DQGL 4S1SL 1MRDH 1IGTB 1W0VA 5IWLA 4O58L 2AXFB 1SJEB 1MH5A 1KLUB 3SE8L 1FZKA 2RBLA 2PYEB 3JSSA 3MR9A 4GXVL 2XQBL 3QWRA 2VXTH 4JQXC 1CG9A 1AGCA 3K2UH 3F6IA 3QUKA 4Z0XB 3EOYG 1MHPL 1UKQA 3WIIL 1RU9L 3QHZH 2HVJA 4HWUA 1F58L 3V6BR 4HIJA 3F6LA 2R2EB 3CX5J 3ZKXB 2ERJC 5IB1B 1G7QA 3IRPX 1MCCA 2GCYB 3DURA 4QWWC 3Q3GA 3G5XA 1YNKL 4H1LH 1OAQL 2BRRL 4Z7VF 4Y88A 1R5WB 12E8L 4IOIA 5D6DC 4JFHD 3HMXL 5DJ0B 1N7MH 1ED3A 5F7DB 1E0OB 2CO6B 4LPXA 5F7WC 1M7IA 1NGZA 5JIKA 3BRDA 4C58B 4QXUH 2APBA 2J88L 3BPOC 4P2RA 1OWRM 5E99H 1BVKB 4JDVB 1TZGL 3QAZB 4HJ0C 2D2OA 2AEIT 3DI3B 4AEIH 1D9KC 1EEZB 1QA9B 1AO7D 1CFQB 4PGEB 4O02H 1EHXA 3IDGA 4WFHD 4Z7OE 4V2CB 1U8LB 1KIQA 3OWEA 2YRLA 4E0RA 2BXZA 1INDL 1IAKA 3CVHB 4KJWD 4OI8A 1F42A 2APTA 1FLTX 3T0EB 3SO5A 2FX9H 2C1PA 3O4LB 5TDNA 1HH6B 4PJCF 1KB5A 1A1OB 1G0YR 1INEH 2WBJD 4Z6AT 1U93B 3OQ3B 3P9LA 3KHOA 4X6CA 3U7YH 3N06B 1AGFB 4X8XA 3ARGA 3QHTC 5IROA 4JO2L 2R0KH 2J2ZA 2EEBA 3NH7H 3C8KB 5K9KA 2QQLL 4D9LL 1Q8MA 2O5XL 1JNLH 1QACA 3FQRA 3NN8A 1FJ1B 2X2YA 4XXCA 1J8HD 3WKML 1NFDA 1MLCA 4DTGL 5I66A 3KVQA 1F6FB 1WWCA 5DURD 3I2CH 3DX9A 5DUBB 3H3PH 5EDXA 4FQQA 3WUWG 2OK0L 1CZ8H 2AJUH 3WXWH 4P4KB 4PRPB 3T0BA 1NAKH 1IEHA 3MMEB 1FBIH 3TIDA 4AZ8A 3B2VL 4OJFH 4JN1L 1DN2A 4OCSL 5JHDA 2Z31C 2CIKA 1B90A 3GSQB 2FEEI 4EJ1C 5JMOC 1IKNC 5FHBH 4KC3B 1S8DA 1R3IL 3D5OF 4M7ZB 4HUXB 1H5BA 5K9OA 3EYVA 1T66D 2VC2L 5K9JH 3CXDL 3R0NA 5FIEA 1N4XH 3MC0A 4L8DA 3IFLL 1UZ6E 2YK1L 2X4PA 3L5XH 5DJDB 4Z7WA 3UYPA 4LKCB 3MUZ1 1MWAH 1U3YA 1GGBH 4KXZI 2X4SA 3CDYA 5D2NA 1SEQL 3V6ZB 4FQ2H 1VGEL 2ATKA 3GSVB 3V6OC 5IMKB 5FM5M 1EUTA 3O45B 1J18A 3QDGE 1DQQB 1GJIA 3FT3B 3IFPB 1A6UL 4JFYB 3ABZA 4X6CF 4HJ0D 4M9PA 3STLA 4HULB 4TNVF 4PUBH 1NANI 4OFPA 5GISH 3ALPA 1F2QA 2JE8A 3IVKA 3QFJD 1DLHB 1P69B 4ZOBA 3FB6B 4QRTB 4B0MM 5KSBA 1MRCH 1WSST 5GSRA 3IAPA 5BV7L 5CEXB 4HBCL 4DOHB 1X9QA 4HIIA 5EC2B 4ONGH 1YEJH 2I9TB 1AC6A 3N85L 1AP2A 4Z0BL 4ONHA 2YPKB 4YDLB 3DIFA 3PP4L 5FYLL 4MB3A 1JNHA 5BS0B 2VDKH 1T5XB 3RZCB 3WFBH 1RZJC 1DQML 1PLGL 5IR1B 1FH5L 3D25A 4F15B 3VXQA 1X7QB 2XZCH 3MV01 3P73B 3X12B 5KVGL 3KPOB 4IDJL 5GRUH 1EGJH 1D6VH 3EFDH 3BZFB 4HEPG 1IM3B 1CN4A 5DD1L 3X13B 2DLFL 1N3NA 4JCMA 2A6KA 1SY6H 4MB5A 3WDJA 1GL4B 3RTQA 1EZVY 4UQ2A 4LVOB 3TCLA 3KLHD 4JZOA 4X80L 4CW1B 1RUKH 3RL1B 2PXYD 3JV6B 5L88L 4MA8H 2R2BA 1YEIH 2CKBB 3LKQB 2FX7H 1E6JL 4G6KH 3VWKC 2X4QB 2P5EA 3AS0A 4JVWA 1S7WB 2P45B 1NCCH 1KJ3L 2A6JA 2YEZB 5JOPE 1G6RB 3VXNA 2NQCA 1AGFA 4WU7A 5IM7A 4R2GC 3EYSL 3L3DB 4K7PH 1A9BA 3S97C 4GRLC 3C2AH 2BJMH 3TBWB 4RX4D 4HH9B 3SDAB 4KRPB 1DBBL 3HAEG 5IGXL 5L6YH 1BZ9A 1NFDE 4EI5A 3TO4C 2DQHH 1HHIB 4M61A 4U1HB 3UTPD 3SKNA 4ZFOA 3NFPB 3JV4B 5DJ6B 3WLWD 1YMMD 4GSDH 1JYNA 1CFQA 5I6XB 1I8LC 3SJVA 3AS3A 4ODTL 1OGAD 4PJEF 3REVB 1B6UA 4Y5VB 4I9WE 3MJ6A 4CJ0A 2NY0B 3MLZH 4I3SH 5GS1A 2UY7A 4OCLC 4PLKD 5F7LB 5K9KB 4M1DL 1T1WB 3A6BL 1QOKA 4N9GB 4LOUD 1PSKL 1X6LA 1FPTL 1OGTA 2VISB 3U46A 2W92A 5I73C 4Z7QF 1MCRA 5DJCB 1S78D 2CR3A 4JG1H 4YC2C 2A6KB 3GMRB 4X9GA 3VFOB 2W91A 1U8KA 2LAAA 1OARH 3BUTA 4NO3B 4BQBA 1HQRA 5JPMB 3P11L 1MJUH 3DXAE 1MHCB 5GS0H 5GRVL 2GJ6D 2W59A 3RY4A 4U3HA 3DLQR 3QDGA 4ZPVA 4YGAB 2XQYG 4J3SA 4UIKL 4DGVL 1RUML 4KK8C 5IFJA 3UO1L 4YEFA 2IANA 4MX7B 2NY2D 3DMMB 4QTHA 5LCVH 4OZGB 1AGCB 1ZT7A 2M1KA 3UAJD 3VXPB 1GGCH 2I26N 4DQOL 2DQIL 1AD0A 4GUPA 5FGCB 1FGNH 3IF1A 3Q1SL 3QPXH 3B9EA 1HIML 4PB0H 4PJEA 2NYYD 3CFBA 4Q9RH 4KRPC 4QOKD 1HKLH 4FFZL 4BZ1H 1NANH 5F9WC 1WT5C 2PF6A 3TO4B 4OFDA 5E6IA 2KPNA 3FHAA 3IYLW 2NCMA 5EU4B 2WUBL 3OG6B 2BY2A 3OKYA 5D5MA 4NQCB 4R7DB 4JJ5A 3LMJH 5EU6D 2D0HA 4OZFA 5HPOA 3NIDF 4M93B 3AVEA 2DJUA 3FN9A 4LCYA 3QEGL 4QHUA 3N9GL 3V6FA 2JIXA 5FO7B 3TN0A 3FMGH 4BZ2L 1T7WA 4OD3H 2ZSVB 4K2UH 4NO0B 3OXRA 3BIKA 2HLFC 1R3JA 1YPZF 3MNWA 5JUEL 4UZGA 1A2YB 2CJUH 4LSUH 1KJ2A 4UDTA 3WHE1 4PTUB 1R6VA 5TDOB 3L3GB 5ECJE 3VD7A 5F71A 4OFYA 1UQSB 3HZVA 4Y19B 5FKPA 3VGAC 1SYVB 5H2BA 4P2OA 2GKIA 5DJ8A 3IDJB 3E8UL 1ZSDA 3ARZA 3D3VE 2F19L 1ZHKA 4Z7NF 5EZOH 4JO3H 4J4PC 4KKBC 2EDKA 3TT3L 3OPZH 5GS0C 1IKNA 4NQEA 3LEXB 4PB9H 4AG4H 1DTUA 1A8JH 4PRHB 4APQB 1IARB 4XPTL 4PB9L 4GG6E 3TH3T 1U8NA 2X05A 4JO3L 1IAOA 3IB4A 5GRJL 1DEEB 2AV1A 4FFWC 1UB6B 5CIPA 1J86A 1RZ7L 4QRSA 3HE7A 3STBA 4U1NB 4MXQC 4QHMB 4BZYA 4Q9CA 1GC1C 2DQJH 3D39E 3GMLB 3ARFB 3LQAL 5HYSB 1JPST 5IHBA 1MLBA 1C16B 5DQJB 4N0RA 1F4WH 5DT1L 4RAUA 5CEZD 3ARDA 1JBJA 3OAZH 3UAJC 4PGJA 3QQ4B 3BPLB 3K2MC 4K2UL 1X4XA 3QO1B 1YEKL 3GI8H 1LEGB 4NQED 1CFSA 4JFQA 2XKNA 3WE6A 4KK6D 1U93A 2LFGA 4WFFE 1KB9K 5DMGD 1UWGL 3ULSA 4P23B 1PG7X 1JV5B 5CZXD 5HHMD 3SE4C 1S9XA 5ICXA 4HKXB 2APWA 3DX8A 1UYWH 3ARVA 1CE1H 3S4SA 2ZG1A 1HQ4B 3S96B 4XXCC 1H3UA 3KPMB 3L7FA 3UTZA 4HIHA 3GM8A 2D3VA 1CBVL 2ED9A 2JJTC 4HGWA 1HHJA 2WK2A 2EDHA 5D7IE 1OPGL 3SKUD 1UADC 5EORH 1B6DA 1RUAL 3VXUA 1ZHNB 5HHXH 4PGDB 4P9MH 5I1KL 2XYCA 3GSWB 3KJ6L 5DK2B 4Z76B 2O26U 3FB5A 3EOTH 3C5SB 1QSEA 5JXAL 2Q7NA 2GSGB 5E1AA 3S3JA 2K7QA 1GGYA 1RUMH 2VZVA 3UTTA 2HTLD 3KYMA 3SKNB 1BFOB 3HI5H 4YGVB 3ALXA 2EYRA 4WW1B 4Y4FD 5EUOE 3KPSA 4ZXBD 4DKEH 4G7YL 1ADQA 2J8UE 5GQBA 3OKOB 4HF5H 3D9AL 1KUMA 1JN6A 1IAII 1UM4L 2D4FA 3F7RA 3KLAB 4R4NC 4BK5A 4PRDA 3JXAA 3QWQB 4LSSL 4OCWH 3R0MA 4NGHH 4YHZL 4U1MB 3N1FC 4L8SB 2AI0H 2YEZA 4X6FA 2X9YA 4XCFH 1KN2H 3ISWA 5IHZB 4NRXA 4XNYL 4EN3B 4WGWB 3PHSA 3OZ9L 1RK1B 3KXFB 2DWEB 4I2XE 3QUML 1Q9WB 1ZANH 3PWPE 1OGAB 1SBBA 1XZ0A 1CXIA 1MCHA 4TSAH 3BGAA 1QSED 1DBKH 4KUZL 3UDWA 5C08A 3B4NA 4W4OA 4JVUA 2VXQH 1IGTA 2ADGB 3G08B 2AS5M 5JXEC 4FQHB 3LB6C 4YXLL 2V9TA 2B0SL 2PTVA 4TVPE 4BYHA 4OZHA 5J1AA 3GBLA 5C0IA 1FE8H 4JRYE 4PY8J 4P2OC 1HSBB 1DBBH 1AGEB 4HJGA 5BRZE 1T03H 4LHUD 2ZUYA 4BH7B 2R2CA 3OJDA 3MRLB 3ZTNH 2XZZA 1JI2A 5JNYB 5SX4H 3RWDB 5FECB 3JUYA 1PY4A 4HD9A 1XCQB 1AFVH 2HRPH 3MROA 1YEFH 3IKCA 4O2FB 5HGHA 1NFDF 1J9CT 4L8BB 5BO1H 4Q9BA 35C8H 1HOCB 5E4IA 3RWFB 1A0QL 3EBAA 4HMCA 4RFNC 3HN3A 1U8JB 2HFEB 1TQBB 1XF3B 1YY8A 2P24A 4R8WL 2OJZL 3GKZA 4JHAL 3BH9A 3QI9A 4LLVB 1CK0H 1IJ9A 2IBZX 5D2LF 4ZAKC 5FV2A 1XF4B 2OZ4H 4NYLB 3IJYA 4XC3H 3RFZC 3K8LA 3VXRE 1RIVL 1QYGL 4YIQA 4CDGC 3U2SB 4WNQA 4YK4C 2YN3A 4PY7B 5C0BE 3V2AR 1K4CB 2NTFB 2HA1A 1B2WH 1DQMH 2ATKB 2VZ1A 3GSVA 4UDUA 3ARBC 2VDKL 3RIAK 2FWOA 3ROLB 1BVZA 2WV3A 4HUMB 4KU1A 3B6SB 1VEPA 4YWGH 1X5KA 4AEEA 3TH4T 2VTFA 5DXWA 3HI1A 3H2WA 4LLAA 3AU1A 4HQQH 4M9OA 5F96L 5IJKA 1EA9C 4OF0A 5ANMA 4IHOA 4EZMA 1PAMA 5JZ7D 3INUH 3X14B 1T66C 3Q5OA 3UYRL 5EIIA 4HS6B 4MA3B 2YR3A 4B53A 1RMFL 3W2DH 1K4DA 4U0QB 2BSRA 2VZ3A 2CIKB 4OF3A 5C9KA 4KMQA 4LPWA 5C3TA 4HGMA 1S9VB 2XTJE 1P84K 1AR1C 3RNKB 5CJBA 2J12B 4ZUUA 5DFTA 3U0TA 4I3GA 4BUHA 2HJFA 4A2MA 4X6DF 1U92B 2DLTA 3PG2A 5EUOA 5DJZA 1Z9SA 4X7TB 2J8UA 3Q0HA 4HMDA 3QXAB 1LMKA 2HFFB 1B4JH 5I1GH 1OAXH 5F21B 1S7QA 1T7YA 1DDHB 3HE6B 5E4EC 4BSWB 2YK1H 2GK0A 4LBEA 4NQVA 1VCAA 5F1SA 1N4XL 3MLPA 2VC2H 5K9JL 5BMFH 4H8WH 2D31B 3GHBL 4LRNL 4X6BB 5ILTL 5DUPH 5IBLD 1NGWB 3V0WL 3NCYP 4TPRH 3DRQA 2QR0B 3E3QC 4X7SH 4NCDA 4GXUN 1A1OA 4OCSH 4P46C 1J0JA 4JN1H 4F7PA 2C1PB 3O4LA 2WNGA 2R29H 4PRPD 1IL1A 4IRSC 1OSZA 3K74B 3H3PL 1CU4H 2XFXB 2BFVH 4UAOB 4HUWA 1UJ3A 4ZDHB 1SM3H 5EC1A 1KELH 2DLHA 4L4TE 5D6CA 1WCQA 2I27N 3OKMB 5D7IB 1S7UB 4FQXA 4IRJD 4UUJA 5F7EH 3HNVH 2NY5C 3Q6GL 4OV6F 5E08H 2AKRA 4ZUWB 3MACL 4W6XB 1TITA 2R0KL 3DUUA 5F93C 2UWEB 2Y1VA 4P46B 5AWNH 5EU6E 1E6OH 5DUPL 2H45A 1QSFE 2PXYC 5ILTH 4H1LA 4AJ0A 2OI9C 1EH9A 3PWJA 4ZOCA 1T0MA 4GMTL 1GHFH 5IVXE 3IDMB 1WEJL 4MS8D 1DANT 3AS1A 1A3RH 4JKPL 2Z35A 5I76A 3GB7B 1JGUH 4XGZB 5C0JB 1CT8B 1VADB 1LDPH 4NC1E 3BWUC 3FTGA 1A7NH 2X6MA 2IC2A 5EBMB 4P2RE 2EKJA 4HCRL 3L3OA 4O02L 3LN9A 1NEZA 1T5WA 5DSCB 4FQLL 5CLTA 5IJVA 2IGFL 5MEQA 4QRRD 1IILE 1A21A 1OLZA 1A14H 3C5ZA 1QBBA 2CK2A 1T1ZA 4Y4KC 2ED8A 1YEHL 2ZUQC 4KGLA 3I6GA 3PV7A 2OMNA 1TZIA 2JJWA 5KVFH 4XBGB 2Q7YA 4O5LH 5JHDD 2G60H 4P5TC 2VLJB 3RVVC 3RHWK 3EYFA 5D2LA 1UACL 4L8CB 2X10A 1QD0A 3INUL 4KKNA 3QFJE 1BOYA 5IFAL 3D3VB 4U3XA 1XGRB 1W72L 2ED7A 1VHPA 1T0PB 4KK5C 4QHKI 2RQ8A 2OP4L 1KNOB 2GY5A 4CN1A 5C6TH 3C08H 4KWUA 3PL6A 3QHZL 3QXAA 1NGPH 2R2HA 3MV8E 4B7IA 3MLTA 4ZO9A 1K3IA 4NQDE 4DW2L 4GFTB 4P2QA 2DBJA 4CVZB 2Q8BL 5TJWK 1NKOA 4RGMB 3ARFC 3CFCH 2VXTL 1L6XA 4K94C 1U58A 3L9RB 1ZHLA 3C5ZD 4OKVA 3DBXA 3SE8H 1EERB 3KS0H 4OKDA 4LU5L 4RAHA 2CLZB 2CMRH 4XVSL 1F4YL 1QG3A 4U1SA 3QRFM 1R3KA 1HHHB 3MLSH 4BKLA 4WW2B 4F7EB 4R4ND 2VDNL 1UXWA 3DUSB 2OZ4L 4D0DA 1I9EA 3FO9B 4WEBL 4NM4L 1OVZA 4NRYB 1IVLA 3BMWA 5D9SB 5F70A 1RHFA 4G6JH 3BGFB 4JFPA 2JKXA 1XGPB 1A6VH 3AXLB 3GSNH 1BWMA 1AC0A 4MXVF 1TJIH 4NUGL 3LKRB 1CDIA 1P53A 5GGRB 4XH2B 6FABH 5IF0A 1CDCA 3DYPA 2FO4A 4EUPG 1FO0L 4ZTOL 4LCCB 4OCYH 5MERA 3MJGX 5BOPA 1FCGA 5GRVK 4X6EB 2DM3A 4NOBA 1E27A 1MJ8L 3K4ZA 4KK5D 1D5IH 4K8RL 5IEHA 4XPGL 3FT2B 4UT6H 1NQBA 5D2NC 1K2DB 1W72A 4DZ8B 2NNAB 1T03L 2HP4A 1JZ7A 4Z7VE 1J8HA 1U8MB 4QXTB 1YJDH 5KJRH 2D4DA 3MRHB 4F2MB 1B0GA 1S7VA 1KB5H 2VXVH 3V5HB 4KVNH 1I1CA 2R1XA 1HHHA 4BQ6A 1QLFA 4QRPA 1DBKL 2E9JA 1MPAL 4GAJL 2RFXB 4JRXA 4AIXA 3SKJH 3O3AB 1EMTL 3QUMB 3VE0A 1FNEA 3ARTA 1MFNA 4M7LL 5E5UB 1KXQE 1BF2A 4X4ZA 1KCRL 5FUOH 1II4E 2P5ED 1KN2L 3U9UB 1K85A 1DP0A 5T1DL 4ZMAT 1DUZA 5TQ0L 1M71A 4PY8I 4OCWL 4PRBA 4P49A 1FZOA 2HFTA 4AT6A 5K59F 3M45A 3D9AH 1YQVL 2HKFH 1GOGA 2XZAH 2FYYB 2AEPL 3BD3A 3X3FH 4OTXL 5DD3H 3TGXA 2QQNH 5E8DL 2PW2B 4IRSA 2GFBA 4J23A 5JDJA 3ZE1E 5KZCB 5DRWB 2GAZA 1P7HL 1NGXA 4M5ZH 1WBZA 1DVFA 2EE6A 1LEKA 3MUGB 4K7FB 2H3NA 1SVZA 1YMMA 4MXWH 1RUPH 4MGXA 3G6AA 3SJVD 5A43C 5GGTA 3RJDA 5EORL 4NPYB 4P3CH 3EAKA 3T4YA 1RK1A 2ZCHL 1XF1A 4HZLB 1KEGL 1MI5D 5E9DA 3NCJL 3QUMA 3VE0B 2XXMB 3E6HA 4Y2DC 3BRGC 2AK1H 2GT9B 4RFEB 5IBUB 1XR9B 4KMTL 4NPYA 4RIRB 4YDIL 3V9FA 1H3VA 5C2BH 5INCB 3OKOA 2Y36H 3ZYIA 5D1XC 4RGOL 3O11A 2IMMA 2LABA 1JGVH 1YDPA 5F7UA 1XAUA 1JFQL 4FFVC 3MRGB 2XICA 5FK9A 1MVUA 2JB6A 3C87A 1JP5A 4FFVD 3FZUC 3T08A 1A6ZA 4XCYB 3LPWA 2AKRB 5F97E 2Z91B 4Y16B 3CMOL 4YDVA 2DQJL 2IANE 1S5HA 3RNQB 4JREB 2DQCH 1Q9LB 1FZOB 2H32H 4X9IA 3BKMH 3L3HB 4N8VB 5F1IB 3KYOA 4KI5D 4NC0B 4YE4L 1JMZA 5DO2C 3HAEA 4ZD3H 1J1OL 3MLWL 5D72L 1GZQA 1F3DH 3G5VA 1JZ8A 4K3DL 1T89C 2R0WL 5E6ID 2CKBL 4H0HB 4ZFGL 4APQD 5JORA 4KQ4L 4ZO7A 2WBKA 3FB8A 5GJSL 4DGIH 1BD2A 1CCZA 3TT3H 4U6YB 3C5JB 3QULB 4LVOC 3BGFC 5D5MF 1UC6A 2ZCLL 5FGSA 3E8UH 1YC7A 1X5HA 3RDTD 3RQ3A 2XG4A 4NKOB 2IPUK 4L9LA 4LPUA 4NDMB 4K9EL 3KWWB 3S98A 4YXKH 1T1YA 1MOEA 4MJ6B 1U8IA 5A2JH 3V5DA 2W0KA 4M48L 4AM0B 4PJFE 4QT5A 3P4MA 5J0BA 1CGSL 3FZUD 5IW1A 2AQ2A 4FTVD 3WDHA 1JWUA 2CJUL 4LSUL 1FC1A 1H8NA 1PEWA 4M7LT 4WO4B 2A6IB 4FQCL 4N0CC 1N5AB 4PJBB 1WT5A 2Q3AA 1RHHB 1HXMB 1CVRA 4UT9H 1B3JA 1ZHBB 4ELMB 3WSQH 2Z31B 3CFDA 1C08A 5D9SA 2C1OA 3PIQB 2VYRE 1HYSD 1HKLL 3H3KA 4LLQB 4K71C 4Q9RL 4ONFL 4PRPE 3GMNB 2DIAA 5EFIB 3ROOB 1BJ8A 4JANA 2Z92A 4ODXB 3AU1B 1P6AB 5FUCE 4JFOA 4FQJL 1H0DB 1NUGA 4EOWH 5HDQH 1U91B 2B4CH 4X5LA 1JPGA 4RQQB 3GIVB 4G8FB 5F7NC 5I30L 5MEOB 1U58B 3L9RA 1PZUB 4PJ8A 3QWRD 3BAEL 3LRGA 5F6HJ 4AY0A 3L3KA 2BNQB 3WUWB 2YD2A 1P84J 3FT4B 3IJSB 1TZHA 4JGMA 3G04B 3MGTA 3P40A 1XF5B 4EI6B 2BVQA 3UO1H 4XX1E 5DDHB 3V4VH 3X11A 1RZIB 3ZMRA 2IFFL 4OBRA 4Q74A 5IV2B 3O2VL 1KNOA 3GJEA 2H26B 5HYIA 3TN0B 5GGTH 3KG5A 1IC7L 1MFCH 1WZMA 5FUZH 5IKCA 2HN7A 4X6CE 4X7DC 1Z2KA 5EWIH 1C7TA 3H8NA 1QR4A 5T33L 4L8CA 3QDJB 4NN5B 3FCTA 3B5HA 1DL7H 1HHGA 4MQSB 3BWAB 4TOYL 1FYHB 1ZT4A 4KPHH 4PJCB 2VLJA 3S5LB 1FPTH 2B5IC 2F54B 1R5IB 4FXKB 3UJJL 4UIMA 2JJTA 5I1HH 1A7OH 3IS1X 4F3FA 4IEFB 4I3SL 1OD9A 4P2RD 5I1DB 2IWGA 4RBPK 3C5ZC 3AB0B 5FHAH 5I19H 3MLRL 4CADA 3TJEH 1VFUA 1E4KC 3C9NA 2HJLA 4KI5C 2FRGP 3QHFL 5HYEA 1ZLVH 3W9EB 2AK4B 3BZDA 3UTTE 4LLUB 3DHJA 4K8RD 4PG2C 1I1AA 2ZUQB 1AJ7L 3CK0L 1EFQA 2LU4A 5I76B 2XZQL 4UTAH 5C0IB 1OP5K 3CLEL 2BSED 4U31A 1U2HA 2FZ3A 3IDMA 1FVCB 3GKWH 4I2XB 3NFNB 2ADGA 3G08A 2YD3A 1NL0H 3O41B 1QNZL 3REWA 3BFOA 2R0ZH 2D7OA 3B9KA 3QRGH 4BFGA 5MHSD 1NCCL 1FDLL 1M71B 4M5YL 1O0VA 4PLKC 4Y2DA 3L5WA 1FL5A 3QUXD 4WI8A 1S9WA 3SCMB 1G9EA 4DN3H 3SDCD 2HTKC 1MCNA 2ZG3A 3RVWD 1E6JH 2FX7L 1AH1A 5INDA 4M6ML 3JZ7A 4CU6A 2N56A 5F9OL 2IPUG 1WTLA 2AW2A 4S2SA 1U41A 4YHLL 32C2A 4ETQB 3BIBX 1JPSL 4I3RL 2M8XA 1GIGL 1J1XH 2DRUA 2X4RA 1P2CB 4NJAH 2BVOA 3HC4L 4RNRA 1BAFL 5A16A 1S9VA 4DCQA 5LWYL 3I50H 3MCLL 3THML 3KDMB 2PN5A 3V5HA 5TE4H 2ZKHH 4H8WC 4F9LA 1CGTA 2DQFA 4LDEB 2F53B 2AGJH 3IETA 2PCPA 3TZVD 3X3GL 5LBSH 4N8CH 3U30C 4P9HL 4XAWH 1G7PB 3C60B 3JV0A 3A0OA 4OUOA 2O5ZH 2QEJA 2QSVA 4O9HH 4U4BA 1XIWD 3PHQA 4TN9A 1CXHA 2NY1C 4AIOA 1FQ9C 4XNMA 5BS0D 1MF2L 4NQSA 1F3JB 4XNZC 2VLME 2E7LA 4NQDB 3QNXA 4PGDA 5CIPH 4G7VH 3F62A 3FO2A 4POZC 2NW2B 4Z0BH 4LBEB 5HI3C 2Q8AL 5J06A 3S9DB 5IW6A 1YYLH 5F9AC 3M8OL 5ICYB 1QBMH 5IROC 3VFWA 4JY4B 1JCKA 3UTZB 1OAZH 5IEKB 1HH9B 4WW2F 3O2DH 2D7NA 4LPTA 3D18B 4NJ9L 1A02N 3GSNA 1I7ZA 2A6DB 1A1MA 5FYLD 2LV4A 3QJHB 4D0DB 4CJ1A 2X70A 3E3QE 1D9KB 4ZPTA 4C56D 1J7VR 4HK3J 5D7JD 4XBEL 4OZHE 4MJ5B 1F11B 3HPJB 1OB1A 4P99A 2DWDA 3QEQA 2GFBB 5BQ7B 3T77A 2CUMA 5BS0A 3TPKA 2G9HB 5D1ZA 4NNPL 5DK0B 5IB3B 4YFLF 1AP2B 1I1FB 3IKCB 5CJ5A 2P5EE 4X5WA 3DVNB 3TBYA 2QKIA 4UMGA 5T3ZH 4HW6A 1J05B 3ET9F 5GSRB 4PRIA 3OX8A 2GW5A 2HYMA 3GO1L 4MVBC 5E5MA 1JE6A 1NC4B 3PXHA 3TNNB 1N2RB 2FD6H 1GH7A 1I7TA 1P6FA 4R3SB 3B83A 1QFUL 3L5IA 4HAGA 5GZNC 1JGEA 3I02A 4M1GH 3MNVA 3U2SA 2PYFB 5F6IB 3MX0A 5BJTB 3H9SB 5T5FH 3TBVA 3V0VA 5D7JA 4L4VB 3RBGA 3SOBH 3WIHL 1KSRA 1CZ8L 2AJUL 2VDLL 3WXWL 5C0GB 5HYFA 4RGMC 3IDXL 1F90L 1H15A 1OAUH 2EZ0D 4U1KB 3TVMD 5I0DA 5E56A 1GC1H 2QL1A 2WWKT 5F1KC 3HPLB 5I73B 5GGUB 1XZ0B 3ZT5A 4KTDL 3WIHA 2BZDA 3VXMA 4X0KA 4Y4HC 1OAKH 2NY5L 4LKCA 1MEXL 3NGBB 1VADA 3NH7L 4YHMH 4TUJA 3BKCL 1G6RH 1OSPL 4NQCE 4KZDH 4PRID 2ZJSH 5GGVH 2F5AH 3FO1A 3WKNA 2BP3A 4OF8A 1YEEH 1QR1A 2JB5H 3ARBD 1N0XH 1BF8A 1KBGH 3W0WE 1C5CL 5CEZL 1INEL 3MRDB 4M6OL 3CDGB 4G43A 1OLLA 4GKZB 3KS0J 5IQ7L 4EQ3A 3OR7A 5ITFA 1ITBB 3MMEA 3DVFA 4JFPB 4WRLA 4KVCH 1E4KA 4NBYB 1QEWA 4S1QL 4YEEA 3OKLA 4P5TD 4WCYH 2VH5H 5JDSB 1PG7L 2MOVA 3I3DA 4RRPA 3U79A 3IF1B 1BQHG 1AO7B 4L4TA 4R96A 5HY9B 3OF6D 1ZT7B 3JWOL 4KI5E 3QAZC 1OGAA 3JTSA 2ADFH 4LVNB 2R4SL 4Y1AE 2IFGA 2J88H 4ELKB 2EIDA 4I48B 4PRAA 3S96A 1N64H 2RIKA 4F57L 1ZA6B 7FABL 4G5ZL 1RIUH 3QEHA 3QDMD 4OSUH 4NRZB 4XP5H 2EH7H 1GGIH 1NCAH 5E70A 1ZLSL 1NAML 4CMMA 1OHQA 5EZIH 4HG4K 3B2UD 3QO1A 2BC4A 1NAMH 1ZLSH 1KPUA 3ARDB 2EH7L 3GMMB 4RCAA 1TDQA 4XHJD 5CILH 2W60A 1S7RA 5AG8A 3KYMB 3SBWC 4DUWA 3LB6D 1FVEB 4OM1L 5T1LA 3G9VA 5EO0A 2I60L 4HKZA 1IE5A 3I6GB 4GG8B 5HGAA 3U4BL 3F7YA 3FHQA 4F15C 2J5LB 5DA4A 4OLYL 3T2QA 1SJHB 3JWOH 3MBXH 1JPTH 3EO0B 2GITA 1G1CA 3T0EC 1OQOA 4QY8A 3BEWA 1N6QH 3U36B 5T3ZE 4MAYC 4HLZH 1JZ4A 1IAOB 1JGDB 3DJ9A 1G9NC 3HZMA 3H9HA 1MHEB 4I5BB 1FRGH 3LS4L 3VXSD 2H8PB 5B3JE 4K3EH 4MXQD 1EEYA 1TJHL 4PJGF 1LE9B 1IMHC 4U1GB 3SE9L 4OZHF 4WTXA 5C0FA 4LCCC 2HRLA 3L95A 2JB5L 3ARBB 5T1KA 3KJ4B 3W0WD 1YEEL 2A6JB 2ZJSL 5IG7A 1Q0XL 4Z0XA 4FZ8H 4MNQE 4G3YH 5D1QD 2I5YL 1NDGB 3D39A 4OLVH 4RZCB 2GI7A 5TDOA 1Z5LA 1NBVH 1OAKL 4P2QE 5HGDA 1OL0A 1FZKB 1HEZA 4L3EA 4Z77B 4JZOB 4KTDH 1LK2A 4H1LG 4HJJL 3ARRA 2I9LB 3RX8A 3NVQA 1F90H 3HKFA 3VI4E 4LLDB 3W0WB 1FYTB 5F3BA 5DUMH 1LO3L 5SWZA 2AJSH 4F33B 1XF4A 4NYLA 5D7LB 1N59A 3BN9D 1RZJL 2HT2D 1FIGH 1XT5A 4FZEL 4Y5XC 4YZFF 4KK6C 3J8F7 2JK5A 3WD5H 2DKMA 4XB7A 2B1HL 2GHWB 1BQLL 3PWPB 5F7FA 3HNTL 2VDOL 3WEXB 3HCVB 3S8WA 1Q72L 3NZ8A 4ZFZA 2EZ0C 4UU9A 3S3PA 3T1FB 3LPGA 5T1MA 4HIIB 3QXUA 3O8XB 1UJTA 5DZLA 3MLVL 3MOBL 2HKHL 4OCRH 5L2KA 3NTCL 4HLJA 5I0ZA 4P23C 5KG9A 5T3XD 3GNML 4QRRE 1CFTB 4Z7VA 5EBLB 3PXJA 4LAQH 4P4RB 5EA0L 3G6JF 2VSDA 3LRSA 3ARDD 1OGAE 5CBEB 5D7JB 4URTB 4ZAKB 4LIQE 3EGSB 3HLAB 4WWID 2PYFA 4WV1B 3GMRA 4EVNA 4PV8B 1IKFH 1OWWA 4Y89A 5EZIL 4HBQA 3BP4A 3CVIH 4RFOH 2QHRL 4X7CC 2ZG2A 3UEZA 5ISZE 4XP5L 3BN9C 5I2IB 2XOTA 2AJXL 1DJSA 3BRFA 2YWYA 4WU5A 3OX8B 2E9BA 3VRJA 1QBML 3VGGA 5IIEA 2DYPB 4OQTH 4L5FH 1WBYB 3DV6B 1U95B 3MV7A 1YYLL 3QJFA 5K59E 4EDXA 1MHHA 2Q8AH 2JJVA 4HUUA 4F7TA 4FABH 4XX1G 4NQDD 5L2KD 1T7ZA 1UCBL 5DVOA 3CCHA 5DMKA 4TVSa 2CPCA 3CFIC 2ID5A 2EYTB 3L1OL 2MQCA 1OF2B 2P1YA 3GSQA 1OW0C 2CQVA 4ZPVB 3WNNA 3FB7B 1UGNA 3TZVB 2AGJL 2GQHA 3ZKNC 1J8HE 5IB2A 3D0VA 3MNZA 4GRMB 1CFNB 4PV9B 3ARDC 1C5CH 4QHNB 4P4KA 4QOKE 3C5SA 4OB5H 3RPKA 1QRNA 5LAXB 1TQBC 4DUVA 4ZNCD 5B4MC 1M6OB 2IG2L 4NJAL 3PGDA 4KZDL 4HGKC 4YHML 1UXSA 4ISVB 2HFEA 2FJFA 1MEXH 4ZO6A 5IW6B 3L7FB 4Q6IA 1WWWX 4CGTA 1WBXA 4JEGB 4ZYKB 1G1YA 4DN4H 1AE6L 1RJCA 3SCMD 3DECA 1FLRH 2YN5A 3ULSB 5JO5A 2Y06H 5KS9E 3QQ3B 4RAVB 2H1PH 5JNYA 1QVOB 1LEGA 4C56E 1FZJA 3QFDA 1E4WH 2UY6A 2CO7B 5EU3B 3D48R 5DRZB 1T4KB 2CUIA 4U1HA 43C9B 1T04A 3CK0H 3DPBA 2EDEA 3KLSA 4GQPH 4JLRB 4PG9A 2GTZA 5EN2B 4LHUA 3VGDA 1CDGA 1XGYL 3GMLA 2FD6L 2Z4QB 2ITCA 1NGQH 1NC4D 4PGCA 4PJIA 3EJJX 2K7PA 1F8TH 1E4XI 1S5IL 1BQHB 5DRXB 3BE1L 3D2UA 1CR9L 3DIFB 3PDOA 3W82A 1KB9J 3V7AG 1IGMH 5HYJD 4I4WB 2Y4SA 3QIUB 4HSQA 2FLRT 4NT6B 1BLNA 3PWVA 5ISZD 3ULVH 5CIPB 4MD0B 3LKQA 1CICA 4NNPH 43CAA 1LP9E 1F3RB 4LMQE 1BGXL 1Q9WA 4JFDA 4TTDD 1JF1A 5I1HL 4X8JA 5CJOL 3DYOA 3ZKMD 5KTEL 2M26A 1AXSB 4ZTPH 1KJ2L 3U9PL 1LNUA 1VFBB 5HD8D 3RRQA 4I4WA 1R5WA 2MQ3A 2AAVA 3HLAA 1V7MH 3QIBD 2VZTA 1OAYH 4PPTA 2OI9B 3MNVB 4PJDA 4NN5C 1I9IH 1R24A 5BVJB 5EIQA 1U8PA 1KTLA 5GGTL 3CSBA 3ZDYF 4D0CA 1AGDA 3RWGA 4PGZA 1ITCA 3V6ZA 3IFNH 4I8DA 2IFFH 1MCEA 1UQSA 3HZVB 2VXUH 5EOTB 5C71A 4PJFB 1VEMA 3FAWA 5HVWA 4PTUA 2Y6SD 4Z5RA 2OBGA 2GSGA 2QKIB 4EUPB 3WFCL 5ESQA 1CG9B 2IPKA<