1UACL

Crystal structure of hyhel-10 fv mutant sfsf complexed with turkey white lysozyme
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
107
structure length
107
Chain Sequence
DIVLTQSPATLSVTPGNSVSLSCRASQSIGNNLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lysozyme binding Ig kappa chain V23-J2 region
publication title Structural consequences of target epitope-directed functional alteration of an antibody. The case of anti-hen lysozyme antibody, HyHEL-10
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hydrolase
total genus 21
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2003-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1uacL00
3FKUS 4PJDF 4DVBA 1I9RH 3STZB 2OL3B 3QDJE 4HKXA 2XY2A 5I76B 3DTXB 3H8NA 3O8XB 1CTNA 5I8KH 4FQCH 2PO6D 4JRWA 2CDFA 2RCSL 4IRSC 2BY0A 3EYVA 4BFGA 2XKUA 1NAMA 5K9JL 1R3HA 3QEUB 1CLOH 1J5OL 2JB6B 4BM7A 3FRPA 1FZJB 4NM8L 1CFNA 4WI2A 5DGQA 2O5ZL 5DJ6A 2BSED 1T66D 3QIUD 4XT1C 4ZYKA 4OF0A 2HJLA 3E6HA 4WRLA 4HFUH 4MYWB 3QXAA 1FORH 3ULUE 2R2HA 1X6NA 1CXLA 4XBGB 3LIZL 3DROA 5CD5C 5I66B 4JFQA 2HLFC 4BKLB 3QWQB 2MCPL 5EA0L 1TJGH 2XZAH 4TSBL 2Q87A 3T2NH 3ECBA 5EOQH 3R1GH 5ADOL 2AK4E 3ZE2E 1K3ZA 4ELMA 1F6AA 3K2UH 3F7VA 1J05B 1TVHA 3FO2A 2FGWL 3P9LB 1IEHA 5DQ9B 1IGTB 3MZTA 5DRZA 1ZAGA 2ILLA 4G9FE 2LTQC 1G6RH 3V5HA 4WUUA 5KSAA 1WT5C 1F3JB 3WFEH 3I02A 2AKRA 5DJCB 3IDGA 1HSAA 1UGNA 4K94H 1X44A 3L3JB 4XVJH 1ZA3A 1EA9C 2MMXA 4GAYA 2W0LA 4O2EB 1CGYA 1E27B 3O9WB 4PJXF 1D9KD 1A1OA 1AKJA 4Q9RL 1JWSB 2PTUA 3WUWB 2Q6WA 4EQ2A 5ECJE 5C8JB 3SY0A 3N1QC 2BVQB 4KI5D 1P7QA 1MLBB 1RU9H 2F8XC 3ARBD 4XCFH 1U8PB 5E9DD 2X4OB 2WBJD 3BJLA 4LCWA 4O2CB 2HVKB 1KLUA 1TXKA 2PYEB 1MCDA 4TSAL 4UILH 1BZ9A 1G7IA 3MGAA 4HSQA 1J7VR 5CJ5A 4WFHE 2H9GA 3CFIC 1AXIB 1VFMA 2ADJA 3QCTH 5IBTH 3VXRE 1Q9WB 4FMFA 1LO4H 1VGEL 4JFHD 2DKSA 1FC1A 3BRFA 5DZNA 1I75A 4YDIH 4M6MH 4PTUA 4XX1E 1N5AB 2QBWA 3EO0A 1YPZB 2XKSA 2A6DA 3S96B 3FOLB 4QXWA 4NN5C 1CDUA 2AGJH 3MLVH 4MA8H 5DR5L 4P2RD 3MUJA 4F7MA 4X0KA 4G8GB 2DIJA 3MLZH 4R96A 1P53A 2Q20A 1N0XL 2J5LC 4PR5B 3PQYB 1TJIL 1NMBL 4GH7B 3HC3L 4CGTA 1LWRA 4EZMA 3GSQA 3RWIB 3GSRA 5FUOH 1ZLUK 4Q0XH 4X8JA 2A0LD 4H88L 3IVKA 4P23D 4KGLA 2EYTA 4PJFB 2ARWA 1NFDF 3VI3E 4GKNA 2IBZX 4PJIF 2FYYB 5IF0B 4PGDA 5JNYB 1YECL 4ZNEA 1UXSA 1M05B 3S5LB 1ED3A 3V0AC 1NC2B 3GI8H 4AH2B 1KTLA 3D9AL 3RVTC 1AQKL 5ESQA 3MV8D 5E2TL 3FMGH 4YR6A 4XP4H 2PCPA 2Q8AH 5GRVK 4ALAL 1UKSA 1FHGA 5F1OB 3U0TA 5BQ7A 2VXUH 1RQ5A 5C1MB 4LCCC 2DTML 2B0SL 4EVNB 4X6BB 4HUVB 3ILPA 3L3KB 4CW1B 2YPLD 1I9RL 3TJHD 3BP7B 4KHTH 3IU3B 5I8KL 4Y5VC 5GGRB 1MCIA 3QXTA 1E4XL 5E8DH 3VRLF 1RHHB 3I3DA 1UWXK 4HXAH 4N90E 4OI9A 4FQ2H 1UXWA 4MJ2A 4R2GC 8CGTA 1PSKH 3QQNA 5DWUL 4E0RA 4P9HH 2GT9A 4MNGA 4AEIH 2EXWD 1Z5LA 3WS6A 1FL5A 1NGPL 1YMME 5D7LD 5EUOE 2WLYA 2PTTB 4QWWD 3REWA 4UOW1 2WM0A 2J12B 4HFUL 2DI7A 4DFIA 3IGAA 1UENA 4AT6B 1IE5A 4PJ9D 3O4LB 5FXCH 5HHOA 4PRHB 4Z7OF 2HJKB 1VEPA 2RFXB 1R24A 5F9JA 4J12A 4ELMF 1YN6A 1MWAB 4RNRA 3GUTA 5EOQL 2NY6B 3R1GL 3RWGA 2C3HA 3U0PB 3JTSB 1CDBA 4PJ5D 4H26A 1K5NB 5JIIA 3F7YB 2VLLA 2Q7NA 3K4DA 2VXQH 5E8OB 3MRBA 1WISA 1G6RL 3UTOA 4Y5XA 5CKGA 3H3KA 4HFWB 5DRXA 4GRLB 3EOAA 5KTEH 1JHTB 3SCMB 3B9KA 1NCWH 1XZ0A 1GGYA 5DQDH 1DQJB 4XVJL 3VA6A 5C0ND 4BZYA 4JZNB 4HH9A 2EC9T 4IIQC 1ONQA 1CD1B 4NKMB 1ADQA 5DJ2B 5EBWA 1RU9L 4XCFL 4WO4A 4PRBB 4HC1H 2FJHA 4K3EH 1Q8MA 1BEYH 4PRPD 1A6PA 2P5EA 5ESAB 1AY1L 4Y4KC 4NIKB 5EC1A 3BD4A 5EO0B 5IFAH 2HT3C 5I1DA 4MS8C 4UILL 5F9DC 4XNYL 5C08B 3AMKA 3HN3A 2R1WA 4XMKL 5CIPH 4GW4A 5A2JH 5CSZA 5IBTL 5D2LE 1LO4L 4N0FB 4U1HB 3SJVE 5E94A 4M7KL 1RJLA 4M6ML 3BH8A 1FV1B 3C5JB 1BZ7B 4DZ8B 1QSEB 5JA9A 5DEGA 5EULV 1MHPL 6CGTA 4NQEA 3TBVA 3QDHA 2AGJL 3MLVL 1RIVH 4MA8L 4L8CB 3IRZA 2VZVA 43CAB 3HUJF 1KJ2L 3P0GB 4CN4A 3K3QA 5FV1L 3MLZL 3WBDA 1U58A 2CK0H 3K80A 3Q6GH 2A2QT 4G9DB 3FAWA 3L6FB 1WWCA 5FUOL 4FQQA 2GJ6A 3HKFA 4KHXH 4Q0XL 1Q0YH 3RGVC 3BAEL 1I1CA 1IAKB 3C8KA 4NGHH 1ZHKA 1INQB 4NT6B 1T7XA 2OS7A 4UT9H 4N8CL 4E41E 5IUSA 2BVPB 3MO1B 2ICEB 3P30H 4OFPA 3HR6A 3GI8L 2J8HA 2OTWB 1ACYH 4V1DB 1OQXA 3TF7C 2VLKB 2YWZA 3FMGL 2IBGA 4XP4L 4PS4H 4BJLA 3CFBA 2Q8AL 3ARVA 4X98A 5JOFB 4FABH 3DUUA 1DJSA 2VXUL 5KN5A 3B3IB 1ITCA 4PG9A 1F58H 4LLWA 1GAFH 3S36L 4CL7A 4UV7H 4WW2A 5L88H 4MNQB 4YXKH 3VFMB 1HNFA 3MNZB 1PYWB 2R23A 4ZSOB 1AGCA 5E8DL 4EN3C 4F8QA 3L5JA 4MB5A 1XCTA 4CMMB 3PL6B 5BOZG 1H8SA 3CDCA 3L3OB 2WP3T 1BECA 1A6WH 4HEME 5KS9F 1PSKL 4WNQB 1W72B 4P9HL 3VFPB 4AEIL 4OJFH 1JK8A 1QBBA 1RZFH 3MV9E 2HVJA 5GRJL 5T5FH 4CN1A 5CEZH 2IMNA 3FTGA 5D7JC 3EYFB 4IJ3B 4UINH 2EC8A 3WJLA 2BSSB 3E2HC 3ZZ1A 4NO0B 3EUUA 5J0BA 1Z3GH 3PIQB 1MI5A 3WLWD 4FQXA 4IS6A 4HXBH 4XHJC 1A4KB 5JDSB 1TMCB 5CSBA 1JWMB 4ZODA 5EOTA 5C0AD 5IHBA 4XXCC 4OIBA 5BS0B 4LLVB 3W0WE 1G7LB 4QYOA 1EFXB 4OZIB 2VO5A 2X4SA 3IF1B 3IJYB 5BOPA 3OZ9H 5IIEB 1ZLVH 2BNRB 2EDXA 3U9PH 1XGQA 3RVTD 1D5ZA 2O93L 3UJJH 3BDYH 5DYOB 1AXTH 1R3KB 4WFFE 4HWBL 5KTEL 4XP9H 3SDXA 2F5BL 3P77B 1NCWL 2VMFA 5DJ8A 4Z95H 1H9VA 3VRJA 1ZEAH 4U1NA 4PJ8C 3KNBB 3PXJA 4LKXB 2WAHA 2DM2A 5CZVH 1MQ8A 1WC7B 4KKLC 3BIKA 4G7YH 3BOVA 3CX5K 4WUKH 4P4KB 4BQBA 4JPWL 4U1KA 4WV1A 4Y8AA 3LPWA 4XCEB 5CJXC 5HYSG 4WI9A 5IFAL 1T0NA 3RBGA 2VXSH 2ZKHH 4X99B 4N0CD 3TZVB 5LQBH 1D5XA 5K59F 2IPUG 4D0DB 4P59H 1NANI 4JN1H 2ADGB 1HZHH 5IW6A 3BGMA 5GSRB 1CG9A 2VN7A 3QEQD 5CJ8A 3TN0D 3AFLA 3UTSE 4JRXE 1B0WA 1QR4A 4PJIE 1D6EA 5I1LB 4WU5A 3A6CH 3RAJH 1RIVL 1L6ZA 3GHEH 3LEYH 1A1NB 3VDAA 5L7XH 4LVOC 2CK0L 3Q6GL 5F70A 3JV5A 2DBLH 2VL5A 1BJ1H 3T77A 1UCTA 5CEZD 3ORJA 4N0YH 1PY4A 3WHE0 4PRIB 2NZ9C 4M5ZH 1S7UB 5J12B 4NGHL 1CD0A 4URTB 1Q94B 4P2CG 4OKVA 1FJ1A 3DURA 4LDEB 1E0OB 2GITA 3MRHB 3SE4C 4HIEB 1FAIH 5C0BE 4NFCA 3RFZC 2ADIA 1I1YB 3SDAB 3BRGC 3ZKXC 3T0EB 2AK4A 2A83A 2XWTB 4JFXA 3TV3H 3W39B 2ZUTA 5IFHH 2WWKT 3VRLE 1U36A 4JZOB 3WNKA 1FSKB 3CXDH 4Y1AD 3BFOA 4NQSA 3T3PF 5IVOA 1ZHLA 3QISA 3MFFB 4UQ3A 4PS4L 4HIHA 5C9JB 5GGRY 4XNXL 4G6FD 4IDJH 3WSQL 2XZZA 5J56B 2EDWA 3VXSE 1JYXA 3QXDA 1AC0A 1R5WB 4LPWA 3PWUB 1F58L 1EEYA 2OK0L 2ZOKA 1KCRH 2CGRH 4PRAB 3MLTB 4ORZC 2QKIB 2O61B 4UV7L 3VDCA 5L88L 5J1AA 2NY7L 5I71C 2B5IB 3BPLC 3M1BA 4QNPE 4X9GA 4UUJA 1X4XA 3HG1B 3S35H 2VISB 3BH9B 2LAGB 1N7ML 5FO9A 3V6OA 5TH2B 2Z93A 3FQXA 4W6YB 4TRPH 4GBXC 3QUZD 1H15A 1RZFL 3HE7B 5A43C 3ESVF 5T5FL 1NFIA 1S3KH 3MNVB 5CEZL 4EUPB 5IFJA 4XPAH 5F7NC 1YN7A 1Q9LB 4MNHA 5K33A 1Q0XH 5EPMB 3FB5A 1CL7I 1Z3GL 4MJIA 1ZHNB 5FUZH 4HXBL 5SWZE 2Y36H 4L4TA 1RAMA 5AAMA 4R3SB 1NGWB 1BQLH 4F9LA 4F80A 4HX1A 3V5DA 1TQBB 5I1JH 5BJTB 3D25B 1AGBB 2PUQT 3MMEB 4PJBA 3OZ9L 4U7SA 2EDQA 3C9NA 2FX9H 2R2CA 4PJXB 5F93C 2CO7B 4GKZB 3KXFB 1CDCA 1U42A 3SGKC 3BDYL 3UJJL 2DB8A 1TPXB 1GGTA 4UB0H 1IARB 3MRCB 1A22B 5JHDE 3VWJA 4U2YA 1ZEAL 1ZK9A 3V5KA 2H3NA 1O7VA 3T2QA 3MRQB 4JM2F 5CZVL 3KDMA 5H94B 4X5WB 4WUKL 4L1HA 1U8MA 4LLUB 1TZGL 4GW5B 4KPHH 2VITB 3O6MH 4P4RA 1ZTXL 4IOIA 4ENEC 3HUJE 3K8KA 2X4UB 4UI2A 2VXSL 5FO8A 1T6VN 1EUUA 3HHRB 5SX5K 1CICA 2ZKHL 4HK0B 1S9XA 3BPCA 3SDCA 1FNSH 1R5IB 4JN1L 4P59L 5DHVB 5BMFH 1A3LH 2FLBT 3O81A 2HFEB 1RI8A 2NY3B 3HZVB 4TUKL 4NP4L 3PWLA 3PV7A 2VWEC 2F54D 5D7JD 3EGSA 4ZO7A 1FYTE 4GSDL 5D72H 3HI5L 3GRWA 1U95A 1QBMH 3IU4H 3UC0H 5JPNB 3O0RH 4LARH 3QWRA 1I7RA 4MA3A 2VDOL 5CWSA 5F6HJ 4JDVA 4K7FA 3K81A 3LEYL 1NFDB 5DI8B 5F3BB 5ICYA 5IK3A 3ZE0F 3ARDA 5DA4A 2DBLL 4JGMA 1EJOH 3TBYB 1JTOA 1YMMA 2D03L 1NMAH 1R3JA 1DVFB 4L3EB 3AROA 4NN6B 4RFEB 3TYFA 2DQUH 5K9OA 4MXVF 1S7QB 4EI6A 4WU7B 5DC0A 4PLJD 5KJRH 2NW3A 2BSRA 5DUMH 1RUKH 1T3FB 4FTVB 3T0VA 3P4NB 1PQZA 3UJIL 1XGYH 3NN8B 1S9YA 1MFDH 3ZDZF 2EDLA 5DFVD 4DVBB 3TV3L 3CXDL 1N2RA 5DGRA 2HKHH 1DBBH 1KIPB 1CZ8H 4P9MH 1KB5A 1NAMB 1A1MA 2V5TA 1ZLUH 2ED7A 1ROWA 4IDJL 1S5IH 2B7DT 5IP4A 1NLBH 1R3HB 2UZYB 2H6PA 3CLFL 4CVZA 2IPTH 1U6AL 3WN5A 2CGRL 3E6HB 4YFLF 3VWKC 3PGDA 1MAKA 3QXAB 2R2HB 4KDTC 3N9GL 5TDNA 3G5XA 4DQOH 1UACH 4G7VH 3IDXH 3S98A 5TF0A 4LHQB 3RVUD 4YHZL 4KQ3H 1UEYA 3KR3H 1YYML 1LO5B 3ECBB 2EIDA 1S3KL 5B21A 4ODUB 4ELMB 1F6AB 5TF1L 2DQTH 5GGTH 5TGBA 4D9QD 3FO2B 2QHRL 1IM3B 4XPAL 5DJZB 5DRZB 2NXYB 2W38A 3V5HB 4WUUB 2NZ9D 1T5WA 5D96B 3RTQC 4OZGE 3BHBA 1EEZA 4EKXA 3IDGB 1HSAB 2Y36L 1BMGA 1ZA3B 1DANU 3C5ZC 1BQLL 1UWXH 3ES6A 4LRIC 5I1JL 1A1OB 1AKJB 5DURB 1ORSA 2Q6WB 5JUEH 3VFSA 4K9EL 5MEOA 4RAUA 3SY0B 3FQTA 1P7QB 2Z9TA 4QKXB 1BBDH 4OV6F 5FGCE 5KSBE 3CJJA 2HLAA 3DBXA 4LCWB 2ZUQB 4KRMB 3AU1A 4JM4H 4UB0L 1S7SA 1BZ9B 1G7IB 4YDLB 4XPTL 1U8QA 4FZEH 1EGJA 2H9GB 2WBKA 2FHFA 5CILH 4GMTL 1A6UH 4WI3A 1NBQA 3ULVF 1I8LA 3GSNA 1TTUA 5HY9A 1Z9MA 1FNAA 3X13A 5BRZE 2VIRA 2HJFA 4KPHL 4PTUB 3WNMA 3O6ML 5HGHA 4ZFZB 5FYKH 3EO0B 4JVPA 4GQ9L 2A6DB 2Z0BA 3D3VA 5IHUH 4IM8A 4N8VG 3RVVD 2P8MA 2JELH 4D94A 4R96B 1X7QA 5E8EA 4JG0H 1FNSL 4GBXD 4H25A 3BZFB 4JKKA 4PBXA 1A3LL 3TO4A 3FQRA 3GSQB 1JZ7A 4X7SH 3AUVA 5AYQA 5IBUG 4XMLH 1QD0A 4FFYL 4BK5A 2DQCH 5TQ2H 2XFXA 4RQQB 1OAQL 1U8OA 5D72L 3IVKB 1QBML 2GHWB 2BOCA 2EYTB 3QT2A 3U6RA 2MHAA 3O0RL 4LARL 4GKNB 5GHWH 3WJJA 2V9RA 4FXKA 2MOVA 3QHZH 2NY2C 1UXSB 4UV4L 3BPNC 1EJOL 3T3PE 1MHEA 2CQVA 4KH2A 1RIHH 1X9QA 1KTLB 1BWWA 1NMAL 2FH8A 1QO3A 2X7LA 3T0BA 3BGFC 5ESQB 3V52H 2PCPB 4L8DA 4PV9A 3F58L 3SBWC 5KJRL 3B5TA 1RUKL 5DUML 3SGJC 3U0TB 4Y16C 3RNKA 2EIEA 1OSPL 1XGYL 1JYVA 4OM1L 1I9JH 2BNQE 5EIQA 1MLCA 1LE9A 4YDVA 1JWUA 4NZJA 2HKHL 1DBBL 4JRYD 4P9ML 3B9VA 5L6YH 5B8CA 2C4XA 1SBSH 5I19H 4Q6YA 5TE6H 1NLBL 1J0YA 4ENED 5ISZB 3AM8C 3PJSA 4E0RB 2P8PA 2VOTA 4HIXH 1Z5LB 1CU4H 2IPTL 5KS9B 1ZS8A 3GEWB 1FL5B 3KWWA 4IHOA 3KYOA 3QDMA 1AD9A 5HVGB 2EEDA 4Y5YC 1ETZA 5DMIH 4KUZH 3NPSB 2ZP0T 1A2YB 5BVPH 1UACL 3IDXL 5HHOB 3QDGB 5F3HA 2CLRA 1BREA 1X5YA 4KQ3L 3P9MB 4X4ME 5FYKD 5D8JL 1R24B 5F9JB 3CX5J 3KR3L 1YN6B 4JFDD 3F65A 4RNRB 3GUTB 3RWGB 3J8F7 2DQTL 3DIFA 5GGTL 2ENYA 4OTXL 4WFED 5D7KD 3KPRE 5GISH 3DV4A 1F4WH 3W11C 1CD9B 2VLLB 1CE1L 2BP3A 4P5TA 3MRBB 2BCKA 4OCRL 5CJOL 2CDGA 4Y5XB 4JRXA 5DRXB 1T83A 5JW4R 2E27H 3EOAB 4XPGL 2ZCHH 3KS0J 2C7UA 3B9KB 1AO7D 5EZOH 1XZ0B 2K7PA 1KEMH 1YY9D 3O8XC 4OZHF 1CFBA 4I0KA 3S97C 1ONQB 5LBSL 4QXTB 1PKQE 5JUEL 1F11A 5E5RB 5HGBA 4RGNB 1BBDL 2BFVH 4ZG1A 1X5IA 3MC0A 5IQ9A 4WEUD 1SM3H 2P5EB 1RURH 3IFLH 4JM4L 2XWJA 3U2SA 4Z7QE 5DMGC 3CK0L 2P5WD 3FFCE 3OJDA 4R8WH 5C0BA 3GMMA 2PXYD 2W9EL 4FZEL 3CZFA 1RD6A 1QYGL 2AJVH 2R1WB 5CILL 1RZIB 3OXSA 5CSZB 3F7QA 3LKRA 1A6UL 1AHWA 1G7QA 3ET9F 4NRXB 1U3JA 3KPLA 3VWKD 3MJ8A 3BH8B 2WMPA 1QACA 3CIQA 3W9EA 4RIRA 3PWVA 3QG7H 3O6FA 5DEGB 3V6FB 2B1HH 3G9AB 4M6NL 1MAJA 4U1SA 5IHUL 4NQEB 3CCHA 3ZE0E 5GZOC 5K9KA 1CLCA 2AV1B 4YO0A 3ARWA 3Q6FA 1BD2D 4LF3B 1U58B 2ZSWA 4LCYB 1EXUA 4OGXH 4PRDA 5IHLB 7FABH 2CLVA 3EKCA 4X7SL 3HAEA 1IILE 3WIHL 3V0WL 1IEBA 2EDDA 2GJ6B 1II4E 4MXVE 2DQCL 5TQ2L 3ALPA 1NDMA 4DEPB 3STBA 4HV8A 4YHYB 3C8KB 1A6TA 4I0PB 4XXDA 5KZCD 1ZHKB 3O9WC 1OAXL 4MZ2A 4R90L 5K9QG 3QHZL 1S9WB 4UQ2A 4BZ2H 4BQCA 1YEDA 2E6JA 1RIHL 1YUHA 2Z8VC 3KS0H 1DBAH 1TTFA 3V52L 2VL4A 1IAIM 2AEPH 4U1JB 4ZOEA 1LK2B 4ZTPH 2YA2A 3PUCA 4X98B 5DEZA 3FJTA 4I13B 3ZDYF 5KN5B 1KFAH 2XWBA 1IC7H 1AGDA 1N4XL 4PG9B 1I9JL 5SWZA 3WFHA 4LCUA 4Z7UE 1KN2L 4I9WE 4KRNA 3LSOA 3T09A 4WW2B 1J12A 4U6XB 4CNIA 3HR5B 2R2BB 4YEEA 3MUGA 5GGSA 2IADB 2R23B 1AGCB 5L6YL 4ELKA 1SBSL 4QHKI 5C6TH 5F8QC 3SHSA 3NCJL 2ADFL 4GJTB 2R0WH 4HJGA 4KGJA 2YOCA 3CDYA 5JHDA 2VLMD 3HNTL 1J87A 4X9BA 1CU4L 1JK8B 4LASH 2ICCA 5IMMB 3VJ6A 3EO1A 2X9WA 5EU7E 2HVJB 5LCVH 1VKXB 5DMJB 1QPPA 4L8SA 4U3XA 2HT4C 2JF1A 4I1NB 2DOCA 4BK4A 3TGXA 3ARYA 2IAMA 3T2OA 5JXAH 1J9CT 3HPJA 4IOFC 4FQXB 5HVHB 4IS6B 1YDPB 3MJGX 4TSCL 1LMKA 1CGSL 3NIDE 4AIZA 1EV2E 3AREA 5KSVA 5EOTB 1KJMA 4WFGE 1CE6A 1LD9B 2NY2D 4MLIA 4QYOB 4CVUA 2ZOLA 4QGTA 3PGFH 2X4SB 5GISL 5AD0A 4OD1H 3GM8A 5J6HA 1XGQB 5CGYC 1QFWH 1S9VB 5BV7B 5EIIA 5JPMA 5L8JB 1XF2A 1FYTA 1FFNB 2X1QA 3PHQA 1RJYB 4G6KH 5EZOL 1KEML 5DJ8B 4U1NB 4OI7A 3RZCA 3GHBH 3MV7D 1NUGA 3KJ4B 2VDNH 4B41A 5IB5A 1P1ZA 4FG6C 2HFGH 3LN5A 3U83A 4QHMA 5ADPH 1OOAA 2YC1A 4U3CA 4U1KB 4D8PA 4FQHA 4ODSL 4J4PA 4FXGA 4MJ5B 1SM3L 4KI5E 3VXPA 4H5SA 4R8WL 1N3NA 3TCLA 3TJEH 5F7YC 1D5XB 5I8OH 2YN5A 1G9NC 4JO3H 4QT5A 1UYWL 3GJFA 4HF5L 5IW6B 4MLSA 4TUOA 1CG9B 4HZLA 1Y6NR 4FN0A 4ETYA 1Z0MA 1GZQB 3V6ZB 1J1PL 2LAAA 4XB7A 1M7IA 2J8UA 2NY6C 4JFHE 2Y9RT 5C09E 1D6EB 5LGJB 1MNUL 3FB7B 4WU5B 2P44B 4B0MM 1H0DB 5IJVA 4NC1C 1FVEA 2FBJH 2I27N 3BKML 4R4NC 4OGXL 1C5DA 4P2RE 4GRLC 5J4MA 2VL5B 4UTAH 1RJCA 3SCMC 4H20L 3A6BH 4LGSB 3OMZA 4OLVH 1CFTA 4Y19E 3DURB 3S36X 3VFOB 2GITB 4OF8A 2VERN 3G6DL 1RHFA 1RMFH 4FP8H 1Q1JH 5EDXA 1G1CA 4BZ2L 3O8XD 5T1DH 1Y0LA 3BSZL 5SX5H 2ZPKH 4JFXB 3LHPH 1OD9A 3SQOL 4PP2B 4NQSB 4K71C 1ZHLB 5FV2A 5FYLH 3MRNA 4X6DF 4PY8I 4UQ3B 2DQDH 3JTTA 3RHWF 3QFJE 4HIHB 2Z91A 3GSWA 1DLHB 1IVLA 3MV8E 4XPFH 2IH3B 3U4BH 1KFAL 4OZGA 4XP1L 5DMGD 5BO1H 1IC7L 3EOTL 3QXDB 4UDUA 5GZND 4U4BA 2FJGB 3S4SA 5LKNA 3NFPA 2ZOKB 3HZYA 3GBNH 1MPAH 1IAII 1QLEL 1MJUH 3MBXH 3M1BB 2PN5A 5KSBA 2A77L 4WW1A 5C6TL 2DQFA 4YBQC 2R0WL 3ALXA 5FO9B 2AJSH 1DQDH 3FQXB 5GZOD 1H15B 4LASL 1XH3A 5ITFA 4J1UA 1NFIB 2Q76A 4M61A 3GI9H 3RWFA 4N9GB 2CKBA 5IFJB 4ORGA 4MJ6A 5JIPA 1EO7A 4YBHA 4NQXA 5D7LE 1B4RA 2KH2B 1CK0H 1FIGH 5BRZA 4HLJA 1LNUA 1EJ6A 1HQRA 2CO6B 3FB5B 4MJIB 3C60A 4KK5D 1MAMH 4JFOA 1GGUA 1AD0A 3RU8H 3O9WD 1SYVA 3UJTL 4HWZA 4PLKC 1XF3A 4EBQH 1JL8A 4L4TB 1T21A 2QLVB 1MVUA 1CLYH 3ZL4H 1S7WA 4HX1B 3V5DB 4YFDB 4K55A 4Q97A 3PGFL 4U7KA 4PJBB 1CD8A 4H1LA 4OD1L 5FOBA 4PJAF 3C9NB 2FNBA 1QFWL 4PJ5E 1UJ3A 2ZCKH 1TZHA 5KVFH 1G7JA 1RUQL 4DW2H 2NTFB 5J57B 2AEIT 4G6KL 4R0LA 4NJAH 4RRPA 3V5KB 3UAJC 5BVJA 2Q3AA 5CEXA 4M6OH 1DUZB 2VDNL 3KDMB 3RBSA 1BHGA 3PL6C 1JBJA 2HFGL 4HUXA 2DQHL 3HZKB 3MBEA 5TDOB 3G5VA 5ADPL 2EDKA 4LSSL 5F7FA 3HLAA 4P4RB 1KPVA 1OWRM 4G8GD 5FYLD 4HMCA 3HRPA 5IJKA 3PQYD 4RMRA 5DRNA 5SX4I 1CICB 4PRPE 4IJ3C 4N0UE 3I6GA 2W0KA 3BPCB 2VDLL 5D93B 1RZKL 4JO3L 3SDCB 1P7KA 3TBTA 2C1PB 4C56D 3MRRA 3V6BR 3PWLB 4X6CA 3R0MA 5EU6A 4HGWA 2I24N 4JVUA 1RUMH 1DE4A 4M93B 4RZCA 4HKJA 1U95B 2Y5TA 3D5OF 3CNKA 2D7OA 4IOFD 1I7RB 4MA3B 5HHMD 3RWHA 1NC2D 1XMWA 4JDVB 4K7FB 4NCDA 4D9LH 5ICYB 1X5GA 1D5BA 5E56A 5T1MB 2P46B 3LKQA 2GFBA 3ARDB 4HK3N 5ESVA 1HINH 1YMMB 4UTAL 2GAZA 5IV2B 1LP9E 1F45A 3O11A 4OFYD 1IGIH 3BO8A 2OBGA 2MWCA 4PFEA 4NQTA 4OLVL 3TYFB 3HMXA 5CGYD 2AI0H 5K9OB 1MCOH 1P9MA 2NW3B 1IZKA 1XIWA 4ZAKD 4P4KC 1PQZB 4Q6IA 1FH5L 2KQNA 5T1DL 3HC4H 1IGFH 4MWFA 4EOWL 1N64H 2GSGA 3R8QA 1Z0NA 3GKZA 2B1AH 4PV8A 4YWGL 4ZUVA 4P3CH 3KPRA 4M1GH 2EDHA 3NA9H 5JXEA 2HRPL 1FP5A 4YHPA 5IBLC 3TZVC 1J1XH 4Y0GA 1KB5B 1A1MB 4BSVA 5JQ6L 4QXUL 3ARUA 4U31A 4XPFL 5I74B 3SDDA 2H6PB 1EO5A 3G6JF 1OW0A 2AJ3B 4JO2H 4CVZB 2PYFA 4OAWA 4RBPK 2P48B 4AJ0A 3LB6C 3EJZC 2OLDA 3WN5B 2APWA 3FN0H 3D2UA 4RDQG 1K8DA 1MPAL 4PD4K 3PGDB 3H3PL 2R0KL 4XNQA 1PX4A 4PRHD 3MBXL 5LGHH 3C6LB 5CP3A 1L7IH 5IOPA 1M71B 1ZV5A 3G5XB 5GS0C 2XI9A 4N8PA 4OCSL 3OXRA 2V2WA 2XXCB 4WI4A 2GK0B 3SKNA 4F3FA 5JW4M 1T89C 2AJSL 1DQDL 1CF8H 1ERNA 4LU5H 3ZKMD 1CGTA 3RL1B 1I9IH 3HC0A 2OR9H 2JCCE 2D9QB 5J12C 3FB6A 1NCBH 4U6YB 5TGBB 4R4ND 5C07E 4XI5C 1CK0L 1KLGB 4OQ1A 2DAVA 5DZLA 4LIQL 2XQBH 3Q1SH 3SDAC 1I4FA 5HI4D 5FYJU 5HHPA 2BHUA 3WUWG 3T0EC 2R0LL 1G0XA 1MAML 3RU8L 2G5BA 3K4AA 3X3GH 5KVGH 1J86A 2DL2A 5FECA 4GRWF 1FSKC 4PYGA 3WNNA 5GGUA 3KPNA 2VQ1A 3ES6B 3ZL4L 2I9TB 4OZHB 3HCVA 1ORSB 3VFSB 1QHPA 4POUB 4RAUB 5MEOB 1KNOA 5HDOA 5I1AA 5MENE 1W72H 4UMGA 1OGAA 2ZCKL 2MQCA 3KVQA 2HLAB 4NN7B 4TVPE 3QPQC 5J3HC 3AU1B 2QSTA 1S7SB 5EOCL 4NJAL 4DGIH 2VLRE 3U36B 2B5IC 1U8QB 3T3ME 4G43B 4NKIH 3BP5B 2HN7B 1L4IA 2R15A 4LDLB 4WFHD 4A2LA 1OF2A 3O2DH 1QSED 2D9CA 3GSNB 2I9LA 2Z4QA 5DD0H 1QLRB 3X13B 1U8NB 4PGEA 3NFSH 3VXRD 3ULUL 2VIRB 2HJFB 3HE7C 4ZO6A 3CGTA 5AWNL 3BUYA 5HGHB 4I8DA 4YXHL 3E1F1 2CUMA 5F71A 3D3VB 3DNKA 4LQFH 4Y88A 4EDWL 4YBQD 3UPRA 1F90L 1F4YL 4QOKE 1C5CH 1S7XA 3O3UN 1X7QB 2XKNA 4WI5A 5E8EB 2APXA 3MLSH 4H25B 3U4AA 2P45B 1V7MH 2YPVL 1FDLH 3TO4B 4Z7UA 1E4KA 3FQRB 1G9EA 4NRZA 3WHXA 4W6WB 2XFXB 1RUML 1U8OB 3D85B 3QEQE 4HJ0D 3S5LG 1OAUL 1UVQA 5HYSB 5TQ0L 1TQBC 2BOCB 2MHAB 1BF2A 4PTTA 4QXGH 4DKEL 2IALA 1C16A 2V6HA 3OHXA 4ERSH 2YPKA 4X6EA 4D9LL 4V1DD 4PLKD 4RISH 4DZBA 4LOUC 1IAIL 1MHEB 1TPXC 5DXWA 3PDOB 3UYPA 4X6DE 4NO2A 4ISVA 3UZEA 3EOBB 2O26U 3VH8A 1QO3B 3QCVH 2BY3A 1WTGT 4G3YL 4KTEH 1NANH 1T1ZA 5C0DA 1MCOL 4XAWL 4OFKA 1T7WA 4L8DB 2FZ3A 4PJ7A 3EDFA 4M9PA 1EO8H 3S88L 4M48L 25C8H 4OLZL 1UWEH 4L29A 3KLHC 1LK3H 3UAJD 4MNQD 2A9MH 1UA6L 2APFA 3DRTA 5HYJA 3MLXH 5F8RC 4XVSL 3ZMRA 1N64L 4RMWA 4MHHI 4MB3A 4JAMA 1MLCB 2B1AL 1LE9B 5F7LB 4G42A 4P3CL 4PREA 4BUHA 4YDVB 4OZFA 3C5SB 1EVUA 1JWUB 1U91A 5GS0H 4WTZG 5AZ2H 4Y1AE 5B8CB 4Z7NE 1ZWIB 5CLTA 1ZT4B 3U0WL 4P57A 4YHOH 2DQJH 2NY3C 4BSWA 1JPSH 2EC9U 3LQAC 2P8PB 3NIGE 5I6XB 1C12B 5EG6C 2FECI 2W9DL 4TULH 1B0GB 2DQGH 1JTPA 2ZUSA 3HPLA 2DLFL 1ZS8B 3KWWB 1NUDA 4IHOB 3KYOB 1K8IB 3QDMB 1FNHA 3MCLH 4NO0D 1TVBB 2WINA 4KI1A 5KOMC 1D9KA 3ROOA 2DJ4A 4Y2OA 2CLRB 3L5XH 5E08H 4KK6C 2BXYA 4QLRA 4ZPVB 4TOYH 1CF8L 3ARBA 1DVFC 3V95A 1JHKL 4LU5L 4N5UA 1EFXD 5E9DA 2WBJA 2GUOA 2OR9L 5ANMA 4NN6C 4G6JH 1IQDB 1PG7W 3DIFB 5DD6A 4EIZC 2GTZA 1FRGH 5EFIA 5IROA 2APTA 4PB0H 1MREL 3DV4B 1KPUA 4S10A 2FB4H 1RVFH 3VFVA 4Z9KB 4PPTA 5F6IB 5H2BA 4DAGL 2XQBL 3Q1SL 2CDGB 4LPUA 2ICWJ 4U7MA 4YLQT 3CUPA 4JKMA 4C4KO 3X3GL 5KVGL 1PKOA 4PJCF 1FO0H 1IAMA 4MVBC 4YE4L 1MH5A 3LCYA 1NL0H 4L4VA 4U3HA 5A3IC 3K46A 1HXMB 3PWPA 1NCUA 3QH3A 4P2RA 5T3ZH 4X5XA 1BQHA 5HGBB 3O3EA 4LPYA 3OKNB 3X14A 1AGFA 3GRWL 5ELIA 1T6WA 2R1YA 4EUPH 4K7PH 5HYEA 2XWJB 1P4BL 4F2MA 3OJDB 5DJ0A 1VPOH 1W0WA 2P47B 5F96H 5IVXA 2E7MA 1CCZA 1YYLH 3CZFB 4P23A 3FT3A 4NKIL 1DUYA 2DS4A 3OXSB 5D7IE 1JGLL 2W60A 3LKRB 3LB6D 1AHWB 1G7QB 5TJWK 3O2DL 2JJSA 4OSUH 5DD0L 4MDJA 4AZ8A 1I3GH 4GXUM 1JP5A 2WLZA 4RIRB 3PWVB 4DKFL 3O6FB 1NCCL 5IMLA 3DVGA 1YQVL 5GS0D 3WDJA 1LEIB 4U1SB 3CCHB 5K9KB 1ZHBA 4X7TB 1FZMA 3SKJL 2NXYC 3CMGA 4YO0B 2E5EA 3MLSL 3DYMA 1V7ML 1G6RA 2ZSWB 4KRLB 4PRDB 1FDLL 4GMSH 5D96C 2OJEB 2CLVB 4Z77A 1B9ZA 3CVIH 3QXVA 5CD3A 5HGDA 4NYLA 2VDPH 3DX9A 3T4YA 3X3FL 3MXWH 1MELA 5SWQA 3KYNA 4HV8B 3O41A 3MLRH 1A6TB 2YPLA 1WFUA 4XI5D 1EHXA 4JFEE 1UT9A 5FHBH 2F54E 3FO9A 3SDAD 5D1XD 3T0ED 3LKSB 5IVZA 4ERSL 5M94B 1T1YA 4DN4H 1C8PA 2YMXH 4PGJA 4XWOC 4E41D 5T3XE 1YEDB 2ZUQC 4TQEH 4KVCH 1DL7L 2GIYA 3Q3GA 4YDLC 1WZKA 3QCVL 2X89D 3O4OB 4WHYH 3QHTC 3PWNB 3FB8A 4QRQB 3G6JE 2VN4A 4L3CA 5DHVH 3NCYP 2IGFH 2LQRA 4JHAH 3SE3A 3LQAH 3MPCA 1UWEL 4PJ9A 1LK3L 1AGDB 3WFHB 3HI1A 3S34H 4LCUB 3L5IA 3KYKH 3MLXL 3LSOB 3MREA 4CU8A 1FPTL 3WNLA 1KJ3L 3HG1D 3L7EB 4MD4A 1CQKA 4WDIA 3LS4H 2FEEI 3MUGB 5GS0L 1A7QH 5T3ZD 3IFOA 4DVRL 2P1YA 5AZ2L 4ELKB 1A9BA 5IM7A 4HUUA 3HE7D 1DDHA 4CAGA 4I3GA 4HJGB 4YHOL 2DQJL 4LQ1A 2A74A 4QHUA 1QRNE 3V4UH 5FGRA 1QA9A 3ZO0A 3FQUA 4ZTOL 4L8SB 3MCLL 1QBAA 2W0FA 3VXQA 1PEWA 5JQHC 2IAMB 3RX5A 3I9GH 5CCKH 1G9MH 3AS2A 3HPJB 4L3AA 5CINH 5J1SC 5E08L 5LXGH 2HTKC 3WHE1 4AIZB 5E2WL 4XPBL 3MFGB 4PRPA 1T1XA 4N0UA 1JGEA 1KJMB 1NCAH 3GSVA 1ZSDA 3U82B 3L3GB 1HWGB 1CE6B 1NAMH 3KXFD 4KVNH 2ZOLB 4PB0L 2BERA 3WFZA 3LN4A 5INDB 4LOUD 5AD0B 1RVFL 4NJ9L 5J06A 4KY1L 4QTHA 3VMPA 3VD9A 5EUKA 3R06B 5JPMB 5EIIB 1RULH 4PJAB 3RWCA 4OV5A 4DUWA 3KPQA 3PHQB 3PV6A 4Q2ZB 4WFFD 1FO0L 1A14H 5LJYH 3ARGB 4ZUTA 3SE8L 1NL0L 4GFTB 5DD3L 5DS8A 4HJJL 3T0AA 3MYZA 4GXVH 1P1ZB 2FL5A 4P5KA 3BW9A 1K4CB 2F9BT 2VRAA 4GRMA 1LP9A 3BDBA 1U92A 2EICA 4X80H 3MJ7A 4D8PB 4HS8H 3V0VB 4FQJH 1D7FA 4FXGB 4HBCH 4FFWC 1F42A 5IVXF 3VXPB 4U2ZA 4K7PL 4ACPA 1A4JA 4LLYA 3KLAB 1HDMA 3OB0K 4H5SB 1VPOL 2YRZA 5F96L 1N3NB 3QIBD 1NKRA 2VLJA 1YYLL 1PJ9A 2NY3D 2RHEA 3TCLB 1J8HA 3FCTA 3NPSC 4QT5B 3GJFB 4WI7A 1YC7A 3D39E 4AEHH 4CMHB 5AYUH 1MY5A 1RUPH 4ONGH 4HZLB 4PBVC 3DGCR 4OSUL 2VDQH 4WWKA 1I3GL 3VFTA 1RV6X 3RX8A 1D5IH 3QUYB 1M7IB 2BVYA 3RVWC 2J8UB 1HI6A 3TPUA 4ODHL 3KPSE 5D5MA 3UTSD 4NZDA 3HZMA 5I1HH 1HHIA 2OSLA 2MPAH 1GHFL 3BMVA 4CUCA 5IJVB 1P5UA 4KK6D 1M1SA 1DVFD 4L3ED 3RWJA 2R69L 2DD8L 5FDYA 4Y5XC 1C5DB 1JYWA 1G7HA 12E8L 4GMSL 3VXMB 1OLZA 1ZT1A 2JIXD 5C0RH 5I1EH 2DJSA 2DJUA 3B9KC 2VDPL 5EN2A 1UJTA 4FFVC 2DLIA 3MXWL 1IL1A 3NCYS 4FTVD 4PJHE 3ROLA 1T0MB 1YEIH 5TDPA 4F9PA 3T04D 1FN4A 1SY6H 4QHNB 1S5HA 2FECL 3QA3A 2D2OA 2C3XA 4FQLH 4NO3A 5A1AA 2X70A 1FAKT 2YBRB 4PD4J 4RGNC 4HS3A 2YMXL 4Z78B 2NW2B 3CVHH 1Y0LB 4HC1A 4MVBD 3OAYK 3SGEI 4XPHL 1CQYA 3CFKA 4TQEL 5JMOC 3VXUA 1HILB 3BUTA 2NYYD 2WNGA 1INDH 4G6ML 1QRKA 4NOFA 3ULSB 4LLDA 5CIPA 3JTTB 5EBMA 4LSPH 4P2OC 2BY1A 1A6ZA 3NFNA 2J4WL 2CR6A 3TA3A 4OLYL 3TM6A 5I18L 4IRZH 3RKPA 3VXSD 4JREB 3M45A 3I50H 5I8EA 1A9EA 2AV7A 4HKZA 3HZYB 4LLMA 4OF6A 1KC5H 3MCKA 5KVDH 5IEHA 2DWEA 5C0AA 2HMIC 2FH6A 1QR1A 1KSRA 4NM4H 1R0AH 1MF2H 2QSVA 4WW1B 3WFBH 2DQFB 4S1DD 5BZDA 1WLHA 5KG9B 4JRYE 4JKLA 3KYMA 5DLMH 5GS1A 1HKLH 4DEPC 1XH3B 5ITFB 4UIMA 2HKFL 4J1UB 2Q76B 4YHYC 4M61B 4I0PC 3RWFB 4PB9L 4ODXA 5I75B 3G04A 4MJ6B 1DZBA 3RDTC 4DCQB 2A73B 4W4OC 4NQXB 3SDYH 3JWDC 3AC0A 1IC1A 2VDRH 4G5ZL 1FL3A 3I9GL 4NQDA 2P8LA 1G9ML 1LNUB 3UTQA 1TTGA 1HQRB 3DRQA 3KG5A 1I8KA 5CINL 3C60B 3VFUA 1JRHI 4JFOB 1E6OH 3H9SE 2VWEE 5BZWA 1SYVB 3C08L 4HWZB 1BOYA 5DURD 4Y5VA 5IR1A 2J1KA 3MGOA 1T21B 2AJUH 1MVUB 2UUDK 4X5LA 1KN4L 4TTGA 4RDQF 5FYKE 1S7WB 1YEFH 1I3UA 4GRWB 1NGYA 4JFDE 4RBPH 4XWOD 1Q9OA 3EHBD 4LHUG 1MRFL 2IQ9H 4LCWD 5FOBB 4O58H 3QNXA 5DFWH 1EHLL 1PG7X 3RP1A 1UJ3B 1HSBB 1RULL 3NGBB 3O6KH 5J1TC 4QRUA 4JFFB 3QEQA 1G7JB 1T7YA 5DEFA 3IDIA 3TN0A 3BXNA 5I8CA 3F12A 4R0LB 3J7HA 4NUJA 4KKAC 4WW2C 35C8H 5IESL 3PG2A 5L8LB 2EZ0C 4QRRE 5CEXB 3VCLA 1AO7E 4J3VA 2DF3A 3LAFA 15C8H 4GXVL 3K7UA 4RWYH 5C0JB 4HUXB 4LGPB 2B2XL 3MBEB 1QSZA 1FL6A 4I18B 4WHYG 4X80L 3QIWD 4K3DH 3HMWL 4HBCL 1KPVB 3T8XA 2FHCA 5DSCA 2VXTH 1IBGH 1B2WH 2ZCLL 3L5WA 1IC4H 2BVOA 5DC4B 4DTGH 4ODVH 1ZKAA 1OY3B 3JV0A 5DRNB 3I6GB 2Y7QA 1M7DB 3WJLC 4OM0H 2P5WE 1GGCL 1JPGA 4UAOB 4UIKL 4YDKL 4Q9CA 3VD7A 1U0QA 1P7KB 6FABH 1T04B 5AYUL 2I60H 4L5FL 4NWTH 1FFPA 4FQXC 5HVHC 4DKAA 5T1LD 3K74B 3OF6D 2VR5A 4X6CB 5D5MF 2QJDA 1D5IL 4HGWB 4XVTL 5EU6B 1DE4B 4HKJB 2XG5A 3P4OA 3GBLA 2XXMB 2Y5TB 1ADQH 4XCCH 4Y1AA 2W59A 2FX8L 3RWHB 1CR9H 1YPZF 4LRNH 2HTKD 5BV7C 2CUIA 2GFBB 5L2JA 1KCLA 5ESVB 2GAZB 4OFVA 4XNUH 3WIFA 5I1EL 1BD2E 1GGBH 2A9NH 3ILQC 2IPUK 3BO8B 3CSPA 4NUGH 3ZYJA 2DMCA 2R8SL 1YEIL 4LPCA 1U8HB 2VAJA 3H9ZA 3KJ4C 1SY6L 2VKWA 2O5XH 5M95B 1XIWB 4KXZI 4FQLL 4OIIH 4IRJB 4PJFF 3WKNA 4Q6IB 2GSIA 1OM3H 3CVHL 4MWFB 3QNZA 1CXIA 4ZUSB 2GSGB 1OARH 1HQ4A 4JKPH 2Q3ZA 3FRPG 3QUZA 4KK8C 2Z92B 4ZUVB 3IKCB 1INDL 4NNYA 5ISZD 5JHLH 1NMCB 3BKJL 1JHLL 4KJWC 4BSVB 3VMNA 3TH4T 1PY9A 5KW9H 5EU5B 5GGSY 4XAKD 3E6FB 1AI1H 1LEGA 3C09B 1MCQA 4XNZB 5MEQA 4IRZL 3VFGH 4EXPX 3D2UB 5LVEA 3VGAB 5FF6A 3G5YB 5KVDL 2F53B 5FA4A 2IFGA 3QDGD 1NQBA 3BT2H 5IOPB 1U3ZA 1P4LA 2Z8RA 3OXRB 2V2WB 2D3VA 3GSXA 3SKNB 5F7MC 3F7RA 3MOAL 1FLRH 5DLML 2FO4A 3OR7A 3CFEB 4M6AA 2GK2A 3H3BC 3HC0B 1C08A 5E1AA 3DWTA 2R4RL 3FB6B 2VLME 3PGCA 3TBWA 5D7IA 1TZIA 3C8DA 2OJZH 2AXGA 2DWDA 5IQ7H 5CJQL 3R8BB 3L3HA 3B43A 2LVEA 2D4DA 1I4FB 3H7BB 4FFVD 5HHPB 1UB6A 4D9RE 4FFZH 5I2IA 1SBBA 5HD8C 1NJ9A 5HBBA 4B5EA 4R4BA 5FECB 4XRCA 3N1PC 1G0YR 1ZVSA 4LCIH 1ZLWK 2AJUL 4PBWD 5GGUB 1BOGA 2DIAA 2VQ1B 3KPNB 3WCYA 2BC4B 1KJVA 1MCWM 1EBAA 1OHQA 4PJCB 2NCMA 4O02H 3HCVB 1GOHA 4LFHD 2IQ9L 3QHFL 1KNOB 4GT7A 1UM5L 4O58L 5D1QD 3O45A 1TIUA 3QI9A 1OGAB 5C71A 3O6KL 5EU4A 3ZKNC 3DUSA 4YGVA 1I1AA 2M8XA 3V8OA 2F54A 4OKDA 5D7JA 2L7JA 3DMMB 3THMH 1HEZB 4P2OD 1CGVA 4LBEA 1MCNA 4U33A 5I16A 3H6JA 15C8L 1Z9LA 2NQCA 2VQTA 3MV7E 1OF2B 2I9LB 2Z4QB 3V6OC 1KCVH 1OGTA 3HFMH 4HDIA 2HMID 3BUYB 4PJEE 4ZNCD 5C86A 3NAAL 1V5JA 2J88H 1IBGL 2VXTL 2B4CC 3MGTB 5I15H 3VFWA 4DTGL 1SMAA 2XZCH 2LABA 3UPRB 1DR9A 2AK1H 2BRQA 4BUGA 4JO1H 5BV7H 1JNNH 2XKNB 1IGCH 1KIRA 4M1CD 4C83A 1H3TA 4Z7UB 2I60L 5HI3C 1QPXA 3B9DA 4NWTL 4XH2B 3WNOA 4F33A 4I0PD 3ZHKA 5I1IL 3BESR 3GZKA 4M03A 4U6TA 2YK1H 1FNLA 5J11B 4NRZB 3RDTD 4Y2DD 4XP5H 2P49B 3N50A 5HGAA 2JB5H 4F9LC 1UVQB 2H26A 2AJXL 4XCCL 2IALB 1C16B 1CR9L 3OHXB 2YPKB 4X6EB 4DZBB 3O6LL 3F8UB 4XNUL 4ISVB 4KKBC 1LO3H 4JR9L 1GGBL 3VH8B 4NUGL 3EYQC 5F1IA 4B53A 1IM9A 2X4NA 3WS3A 2YUVA 3UTTE 2FZ3B 4PJ7B 3X11A 2I07A 4HCRH 2JTDA 2VTFA 1JNLH 3TIEA 2ESVE 4OIIL 4C57C 5F7EL 1V3MA 4RFOH 1OM3L 1X6LA 1N5YL 3ULVC 5HYJB 3DRTB 2EZ0D 3RHWK 2C26A 2VZSA 1WSST 5HGGS 3ZDXF 4IMLA 1NKOA 4G42B 4PREB 4YHNA 5HHXL 4HULB 2BNQD 2JJWA 4OZFB 1CICC 3Q5OA 5JHLL 1U91B 2NNAA 4HS6A 3RL2B 5D93C 2V5RA 5CZXC 3SDCC 4ZS7H 1FG2A 4P57B 3MACL 1AI1L 3DVIA 4BSWB 2OXGA 3F6LA 3VFGL 5CUSL 1KENH 1MEXH 4M93C 3L7FA 5DQJA 1LDPH 4RMTA 4OGAD 3BT2L 4OLXL 4FQXD 1XF5A 1NSNH 4R26H 4PRNA 2PKDA 3WMSA 4KJQC 1JNHB 4F7PA 3ROOB 3EOYG 4OQTL 4GAJH 3ARDC 4ZFGH 1TITA 3KHOA 1YC8A 2IANA 1FLRL 2WW8A 5E9DB 2GUOB 5ANMB 1NFKA 4Z8FH 4DGVH 1CIDA 5EFIB 4WGVB 3QUKA 4A6YB 2OJZL 4L9LA 1KPUB 5TE7H 3VFVB 1F2XK 3DLQR 5IQ7L 3KPTA 3ILQD 1BFOA 3UTZA 3CUPB 5J9PA 4FFZL 3MRFA 4GG8A 1HYSC 3OTTA 4JN2A 4S1QH 3I6LD 4LCIL 4UOW0 1MH5B 4JM2D 4L4VB 1ZGLM 3PWPB 4JO4H 3TFKC 1S8DA 4RAHA 3EIFA 4NKDA 3G5ZB 4V2CB 2UWEA 5I74C 2P7TA 5C2BH 4X5XB 4ZO8A 3O3EB 4J3UA 1MSPA 4KTDH 4GBXA 4KK8D 1NLDL 1AGFB 1FIEA 3LPGA 1BVZA 3WN5C 4PJHA 3ELAT 2C4FT 2PYEE 2ATKA 4KJWD 4F2MB 3OAUL 3THML 1W0WB 3NOIA 2NY1B 5IVXB 5C0FA 1L6XA 1O5DT 1WZ1H 4Q74A 5DHXB 1RZGB 4MA1B 1DBJL 5CEYA 3QULA 3C6LC 3FFCD 1AJ7H 3FT3B 4P23B 3GMNA 2W60B 2EDOA 3BKCL 3JV4A 1U8LA 4MDJB 5F7WC 4UT7L 2GW5A 3VFNB 2BOBB 3ARFC 5IMLB 3DVGB 2J88L 5MP6H 1YPZE 5FB8B 5GGTA 1TCRA 3TPKA 2XZCL 1IGJA 3LRSB 3QQ3B 1ZHBB 2R56H 2AK1L 1FZMB 3A67L 4G8GE 4JO1L 5FYLE 4AM0A 1LE5A 2OYPA 1IGCL 4QRTA 3MYJA 3PQYE 1G6RB 3R4DA 2W65A 2ZUXA 3S3JA 1A7BA 4W68A 5F7HA 1HH6A 2PR4H 2YK1L 2YA1A 4LSVH 4NYLB 2H1PH 4XP5L 3DX9B 4MSWA 2IJ0C 4MA7H 3KYNB 4EI5A 3O41B 2YPLB 3EO9H 5E2UL 4PJFE 1PZUB 3FO9B 2HP4A 3HB3C 2X4RA 2DI9A 4DK6A 5IVZB 4JRYA 3EYSL 1T1YB 4K3HA 4UDTB 3OB0H 3ULVH 2DDQH 3G6AA 5ETUA 4B7LA 1I7ZB 4Y7MA 2X9XA 5HDBF 4JVWA 4HGMA 2XICA 3QQ4A 3I84A 2XNAB 1LO3L 4U6VH 3EAKA 3Q3GB 5C0EA 2AABH 3MRLA 1SJHA 4P2QB 4LSQH 4Z5RA 4G6AC 4L3CB 3CU1A 4HCRL 5ID1A 5D2NA 1PFCA 2IQAA 4GG6A 2KL6A 1I8LC 4HD9A 4RFOL 3FQWA 3K8LA 1TETL 4GS7B 4PJ9B 3E0GA 5CJBA 2FBOJ 3HI1B 3QEGL 1DBKH 3BVNA 2FO1A 3TNMB 2FJFA 3NZ8A 5IGXH 3MREB 4ZQKA 3LKOB 5HYFA 2YHGA 4JGJA 2ED9A 5DJAA 4I9WD 4O4YL 3VI4F 4MD4B 4XP6H 3ZYOA 4YX2L 1KJ2B 3EDJA 3IFOB 4QRPB 4GAGH 3WEXA 3OWEA 5IM7B 4HUUB 4ZS7L 3TO4C 5E2VL 3BJ91 3WIHA 1MHHA 3FT4B 4KQ4L 2K9UA 1P2CB 2A74B 4QHUB 3IJHB 5B3JE 1O0VA 1XR8A 1MEXL 1XGPA 2HFFA 5FCSH 3VGGA 1QA9B 2Y4SA 3FQUB 1A7RH 2BHYA 4J8RA 3QWOA 2X44D 4K3GA 2DRUA 2W0FB 1DSFL 1GC1H 2ARJA 2B8OT 3VXQB 1KPRA 1NSNL 3OAYH 1NCTA 4R26L 4OIAA 3O4LE 1S7TA 4UBDC 4OLUH 4L4TD 4ZFGL 3QJFA 4PRHE 5D1ZB 4KRPD 5E00A 3WXVH 1A0QH 4RAVA 3IXAB 2E7LC 1T1XB 1X5XA 1JGEB 4RSVA 4WENB 3GSVB 4JG1H 1KB5H 4DGVL 2P5WA 1Z6JT 1UWGL 3CH1B 3LN4B 4X4YA 4WFGD 2PXYA 3LY6A 4NC1E 4QTHB 1OP3K 4UNVA 3IDJA 5EUKB 3OQ3B 4KKBD 1VACA 3VGDA 5F21B 3KPOA 2OZ4H 3W9DA 3U7AA 2YUZA 3K0WA 3RWCB 4OV5B 1F6LL 3KPQB 3ZTNH 5C0IA 1GOFA 4GLRH 4JZJA 3PV6B 3VWKA 4YAQA 3V7AG 4S1QL 1BBJA 4ZUTB 4M3JA 5C0CB 4K3JL 1U2HA 3CSGA 2ITDA 4JO4L 5DS8B 4Z7WA 3GMPA 5DUBA 1NAKL 3OJMB 5B8CC 5ALCH 3ULVD 1CXKA 3FHAA 4P5KB 3BW9B 3BWAA 4DJMA 2NLJB 5D6CB 4GRMB 1U92B 4KTDL 3MJ7B 1BD2A 1UZ8A 3OKOA 5I6XC 1N59A 3DXAA 4NQCA 3BD5A 3BP6B 1CICD 1FVDA 4PJGA 5CZXD 1TENA 4G8FA 3SDCD 3ZE1F 3S37H 4MMXC 2VLJB 4NDMA 5C08E 1J8HB 1AJ7L 2VAAA 3FCTB 1P69B 5DF0A 2FDBP 3RZWA 4U1MB 2UUDH 4WWKB 5IEKA 5DJYB 2DKUA 3DGGA 5BW7C 3U30B 1QSEE 3TPUB 4LPXA 3RUGF 5D5MB 2EDEA 1KCSH 4KJQD 5CMAA 4MAYB 4KMTH 2EECA 3HZMB 3ARDD 1ND0A 5C09D 2R56L 1HHIB 2OSLB 3U9UA 3RKDD 3QQ9D 2ZSVA 2WUBL 5GJTL 5F6IC 1B3JA 3RWJB 4PGZA 4BFEA 2K7QA 1T83C 2RIKA 2VZ1A 1ZT1B 4LSVL 4NPYA 4OF7A 3IDUA 2H1PL 5EN2B 1HH9B 5JORA 1IKNC 4OZ4B 1QFUL 4MA7L 2VE6A 5TDPB 4S1SH 4JEGB 3D87B 1FN4B 1WAAF 4DFHA 1S5HB 3S37X 3QA3B 3BGAA 4Y19D 3GSNH 4NO3B 2X70B 1HYSD 2ENSA 1TQCB 4I2XB 3RJDA 2DDQL 4F7EA 1YJDC 1A7NL 5EBLA 3LV3A 2VXVL 3TFKD 4V1DE 4X7CC 2Y07H 3DYOA 3VXUB 1QP1A 4R7DA 2VLKE 1W8NA 2NY4C 4LPVA 4ODWA 4NBXB 3WE6B 2AABL 3TLRA 4XNMB 3GO1H 4Z7VA 4LSQL 4K23H 2WP3O 4LLDB 5CIPB 4EIGB 3CFCH 3NIFF 3HE6B 1A6ZB 1KTRL 3NFNB 4Q58C 1AHWC 3TBSA 3WLBB 3QFJD 3TA3B 1EHNA 4OD3H 5I1KL 5MI0B 2DMKA 3EYOA 1VFBB 4MAUH 2X05A 1IEAB 5GGVL 1A9EB 2AV7B 1QG3A 3O6FC 1VFAA 5IGXL 1AH1A 3C6LD 4LLMB 1A5FH 1LDSA 2GTWA 3MCKB 4MNQE 3UO1L 5IEHB 2DWEB 2EH7H 5C0AB 4XP6L 1I3RA 1HHHB 4ZSOE 4Q9QH 2ZJSL 1QR1B 4GAGL 4JDTH 3NCEB 3VG0H 2I5YH 4P99A 5BZDB 3ARFD 5FGBA 4KTYA 1QTYT 1EMTH 2BVTA 1K2DA 3KYMB 4FQCL 4RGMB 2ZUVA 5GS1B 4UIMB 4XX1G 4ODXB 5E0QA 1KG0A 1KTDB 3G04B 1CLOL 1AP2A 1GC1L 4P3DB 5B3NA 1UZ6F 4JB9H 4NQDB 2FR4A 3QO1B 2P8LB 4WY7H 4P49A 4AIXA 3UTQB 4ZDHA 1OB1A 4N5ED 3AB0B 4PJEA 3WXVL 3V8CA 1EVTC 4N9OB 1FORL 3MROA 1XCQA 4Y5VB 3HB3D 4DUXA 5IR1B 3ALWA 3QUMH 2IFFH 4I4WA 3O4OC 2DYPD 9CGTA 4LK4A 2MKWA 4OZIE 1Q9OB 1TJGL 2XZAL 4N1EA 1EDQA 2OTUB 5E6ID 1I7UA 3TT3H 2BNRE 3T2NL 1NGZA 3QNXB 3SPVA 2OZ4L 3GSUA 3K2UL 1HKFA 4QRUB 1XFPA 1WJ3A 2C3GA 4D3CH 3IDIB 3TN0B 3BXNB 1WBYA 2RQ8A 5I8CB 3F12B 5EBGA 4NUJB 2ZNWA 4Y5YA 3VCLB 3EJJX 5ALCL 2XN9B 3K8MA 3WFEL 5LGKA 4XC3H 1FL6B 4K94L 2NMSA 5T1KA 1XGTA 3WO3B 1SEBA 5EZIH 3WFCH 3T8XB 3PHOA 3G08A 5DSCB 1JF5A 4L8SC 4LNRA 3L5WB 2BVOB 4ZFFA 4M00A 3QZWA 3TO4D 3IFNH 4LKCA 2X1PA 2Y7QB 3RQ3A 4PLNC 2IAMC 5E7FA 4WEBH 2D7PA 4IRSD 1ZLWH 3MJ6A 2BZDA 2YD8A 3D85D 1FFPB 1XEDA 1DQLH 4MCYA 4JANB 5D7SH 3STZA 1S7RB 3P11H 3O8XA 3RI5F 1D6VH 3CFJA 3H7LA 3SEPA 4KV5E 4WI8A 2Z31B 3P4OB 1KCSL 3QCTL 1KXVC 3WD5H 3EDDA 3UDWC 1UCBH 2EIZB 3ZSTA 5HDBE 3QEUA 4YDIL 2JB6A 4LSRH 1WZLA 2A6KB 4F37K 1YJDH 5L2JB 2APVA 4YUEH 2WWKO 5CD5D 5JA8B 3O2WH 3WIFB 2HLFD 4PRIE 1WWWX 4HWUA 2DMBA 4GKSA 3ARGC 3P40A 3AS1A 1MCHA 2VDKH 4XBGA 3IS1X 4TVPH 2XTJB 5A2FA 5ACZA 1MUJA 1HCFX 4ESKA 1KIQB 4W81A 3QJHA 3T0EE 4J4PC 3QNZB 2N56A 3PABA 3QXWA 3P9LA 1HQ4B 3PNWA 3QG6A 3QUZB 3DSNA 4PJDE 3NTCH 1CDHA 4R7NA 4NNYB 1AQDA 1FZOA 2XOTA 4K23L 2ED8A 3CFCL 3DYPA 4CMHC 4EJ1C 2F5AH 4XCNA 4KU1A 5DJCA 2ATPA 4OD3L 3WFDH 4W4NA 5DD5H 3L3JA 3QUYC 3O9WA 4HUKB 2K3TA 2YZ1A 4UT6H 5FF6B 1RPQA 3TH3T 1VFUA 2EH7L 4X7EC 5C8JA 1OAZH 2BVQA 8FABB 1MLBA 4Q9QL 4NZRH 1P4LB 4JDTL 1U8PA 3HG1E 2X4OA 3GSXB 2P42B 4KHTL 2HVKA 4DK3A 5T3ZE 2F8OA 3LEXA 1EMTL 1U3HA 3WL9B 2QQLH 1A02N 3OR7B 3MNWA 2VB5A 4YC2B 2F74A 1GCFA 3QUXA 3PGCB 1D5MA 4HXAL 1HN1A 3DSFH 4FQ2L 4AENB 3K4ZA 4M62H 1TZIB 5D7IB 4NNPH 3MLUH 1Q9WA 2AXGB 4KMLB 4JB9L 2DWDB 3O3DA 5D6DA 3RPIA 3L3HB 5C07D 4J6RH 2YD3A 1RUAH 5I2IB 1VHPA 1NJ9B 3S96A 3FOLA 1WBXA 4XRCB 1ZVSB 1WQVT 3QUML 2IFFL 5MERA 1BOGB 1WGOA 1BJ1J 4HUWB 3PQYA 1BJ8A 4YZFF 2NX5B 3AAZA 3LRGA 4PJXE 3O45B 3QI9B 3KXFE 5B38A 4MDIA 3ZE1E 2NY4D 4JREC 5MEND 4C56A 4OFIA 5EU4B 4HPYH 4H0GA 1I1AB 2EDYA 4AIOA 4TVPD 2VXQL 4RGOH 4YEFA 5IB1B 5HHNB 1OL0A 5I16B 1CT8B 1K4DB 2VLRD 1E28A 2Y23A 3LQZA 4P46B 3LOWA 5DQDL 5CBEA 3VGFA 3T2PA 1OGTB 32C2A 4HDIB 4OFYA 5GXBB 1JGVH 2ZG1A 5I75C 2C3VA 3FFDB 3RVXC 2VUOA 2EE6A 1QSFA 3WDIA 4HC1L 4K3EL 1BEYL 3EW3B 1KIRB 4C83B 4X6BA 4EVNA 3QNYA 4QOKD 4ZAKA 3V4PH 3L3KA 4XBPB 3C60C 4F33B 1YMHB 3E8UH 5D7SL 2DKMA 3HRZA 5CHNA 4R2GD 3AVEA 1BGXH 5HGAB 1MRCH 1CDGA 2H26B 1UCBL 1BP3B 3L3DA 4KUCF 4W6XB 1REIA 2R9HC 3QDJA 1OTUC 1NFDE 1HHGA 4LSRL 4H8WC 4YHLH 1UJ3C 3LD8B 4N68A 4RFNB 5GRXG 3NGBC 4HIJB 2PTVA 2X4TB 3O2WL 1U3YA 2XG4A 4L3EE 4R0LC 4HH8A 5I1GH 4HUNB 5F1IB 4MHHG 1IM9B 1RIUH 4AT6A 4DKDC 1IC5H 4TVPL 4Y4HB 3X11B 3FO1B 5DK2A 3BX7C 4FTVE 1HE7A 2UZIH 3MBEC 4KHXL 4I18C 5F97E 1X4YA 3ZTJG 3BQUC 1Q0YL 2LE9A 4FMKA 2FSEA 2V5MA 4UZGA 4FQIH 3JTSA 4JFZH 4IMLB 2MTPA 4UT9L 1WFTA 3NTCL 1JTTA 1UH4A 1FQ9C 2NNAB 3D0LA 4HS6B 5DMKA 1JZ3A 3P30L 4LVOB 4UAOC 5KBNC 4QCIA 1WF5A 2G2RA 2A1WH 1ACYL 1FG2B 3Q48A 4APQA 1JHTA 2EEBA 4Q7DA 3PE9A 5DD5L 1V3LA 3BP4A 3T65A 2CDEB 4XC1H 1S78C 1UZ6E 3P4MB 4G9FA 3L7FB 3QB7C 4UT6L 4C55A 4FABL 1YQ2A 5DQJB 2E7HA 4Y4KD 4XBEH 5DJ2A 2VR9A 1OAZL 5SV4A 2HT3D 5DJDA 4MS8D 1G7PB 3IFPA 1NCNA 4PRNB 4NZRL 4WCYH 1GAFL 4JE4B 2GEEA 4YXLH 4WW2F 5DUPH 4F7PB 3C2AH 5FCUH 5ESAA 1HK6A 2IANB 2R1XA 2D7NA 1Q72H 4JLRA 5FYJH 4YXKL 2QQLL 1QFOA 2PW1A 4Z7OE 4K2UH 1JPTH 4Z0XA 4ELME 3MSPA 3P0VH 4LVHB 1FVCA 1S9KC 1HHKA 1P9MC 4M62L 5T3XH 1A6WL 3QUKB 1UH3A 3MLUL 1AFVH 4L9LB 4U1HA 4X9FA 1XIWC 1H3UA 4OJFL 2DM3A 1NGXB 1FFRA 4IRJC 4JFPA 3N0PB 4Q6IC 2X4QB 4WUUE 1KULA 3C5JA 1BFOB 3UTZB 3ARGD 5ENWA 5J9PB 2X4PA 3MRFB 4M7JH 1QVOA 1I1FB 4UINL 3VXRA 5I71B 4JN2B 1MIEH 4JCMA 3VE0B 1NMCC 4KROB 4R9HA 3H0TA 3RGVD 4I5BA 4NO5A 3F6IA 3ZLQC 4J4PD 3L6FA 2UWEB 3MR9A 2P7TB 2VNCA 5DT1H 4JQIH 3C09C 1OW0C 4XNZC 3BKYH 1WICA 4NKQB 2A6IB 4LCWE 2PF6A 4HPYL 4PJHB 3KPMA 3ZHDA 3JSSA 3VGAC 2FIRT 1INQA 5ICZA 1P84K 3U9PL 4OGYH 4RGOL 2KZ1B 5CEYB 3VW3H 1QHOA 3QULB 1AXTL 3SDXF 2BVPA 3GMNB 4HIIA 3QUYD 5DDHA 3MO1A 3NACH 3DETC 4IOSD 4XP9L 1AGEA 2AEQH 2OTWA 1A6AB 4Z95L 3JV4B 4LHUB 1EUTA 2R0ZH 3TIDB 2P24B 1QLFA 1B6UA 1JV5A 3MRKB 3W2DH 4Z6AT 4G7YL 4GRWH 3V7MA 1OP3H 3HAEG 4NRYA 1TCRB 3BWUC 4MCZB 2RJMA 5JOFA 1BJMA 4HAGA 4WIQA 3RUGB 3VXMD 1TJHH 1VB9A 4H8WH 1NBZA 1LE5B 3MYJB 3WNPA 3TP4A 5A2KH 2W65B 5F6HI 4I77H 3V4PL 3O2VH 4FS0A 1MQKH 2IG2H 4EN3D 3E8UL 1HH6B 5AEAA 4WWID 1CFVH 4MNQA 3RY6A 3VRIA 4MSWB 3WKMH 1WITA 1BGXL 4EI5B 5LQBL 1L0YA 2HWZH 4ZSOA 1HZHL 3TCXA 3ISWA 2X4RB 4JFED 3IAQA 4ZMAT 4ZNEE 1W72A 1IJ9A 4YHLL 4BQ8A 1Q9KA 5FYJD 3VG9B 1QNZH 3G6AB 5ETUB 4BH8A 3A6CL 5IB3B 2QEJA 3RAJL 4HKBA 1F13A 2YD7A 3DMMC 5T3XD 1BIHA 5C0EB 3GHEL 4CU6A 4XHJD 4DWHA 5L7XL 1RIUL 2BSSA 2GCYB 4RA3A 1F02I 5EUOA 2BDNH 2E7CA 5ID1B 5D2NB 5DTFB 4JPIA 1OWWA 3O2DA 2IQAB 5E4IA 4AL8H 4GG6B 4N0YL 2FHBA 3FQWB 5J7CC 4M5ZL 2AXFA 2MNUA 3BVNB 3DHJA 2AVGA 2FJFB 2PW2B 1FAIL 4ZQKB 4LLVA 1B0RA 4FQIL 1EFXA 3B9EA 5DJAB 4OZIA 2VZUA 2ZG3A 3C6SA 3IF1A 5IIEA 3ZE2F 4LNVA 1N0LA 5JR1H 3LS5H 3WEXB 4PJ8D 2A1WL 1JI1A 5ISZE 4HKXB 5IFHL 2C9AA 1E4KC 4KKLD 1MHHB 3IAPA 2CDFB 3RVXD 5J11C 3RIAF 1XR8B 4R4FH 4XAKE 4XC1L 2HFFB 5KS9E 3EYVB 1KLFA 4LKXA 2BRRH 3HMXH 4HAFA 2VDMH 3QWOB 1QRND 1WC7A 5HSFA 5IW3A 2ORBH 2ARJB 4NC2B 3T0XA 3C60D 5JW4N 1KPRB 1CFNB 4IEFB 4WCYL 4M7LH 5DJ6B 4DGYH 3QAZB 4HHAA 1S7TB 1KCRL 3MRDA 3C2AL 4ZYKB 5FCUL 3QDGE 5HHOE 2HJLB 3QJFB 5A2IH 4MXWH 5SWSD 4PIRF 5E00B 4DN3H 1Q72L 2CLZA 4L8BA 5L2KD 2R9HD 1T66C 4X99A 5EC2A 1VGKA 2BJMH 3P0VL 3DROB 2RR3A 3S35L 4JFQB 5MHSD 4D0DA 5T3XL 2WIMA 1AFVL 5C9KA 5GSRA 2PXYB 4JFFD 2H2PC 4TRPL 1BFTA 1IMHC 3RX7A 3KPOB 2UV3A 1NEZA 5LAXA 2V5YA 3F7VB 2XV6B 4AMKH 1TVHB 5C0IB 4JZJB 3WV0A 3ARSA 5D2LA 1MY7A 1BBJB 3SJVA 4DOHB 3MUHL 5BXFA 1MIEL 1X5JA 4F57H 3MBED 3DPBA 1Q0XL 2ITDB 5KSAB 3BQUD 4Z7WB 3GMPB 5DUBB 1GZPA 3I02B 2AKRB 3BWAB 5FUZL 5GQBA 5DT1L 1T89A 4X9HA 4RGNE 3JZ7A 3MQIA 1UZ8B 3BKYL 3OKOB 3MLYH 4GAYB 1N59B 3DXAB 4PJBF 4NQCB 3DO3A 2P5EE 4MB4A 3WIIH 1Q94A 1FVDB 3FRUA 4G80A 4PJGB 4G8FB 4J3SA 5EORH 2FX9L 3MA7A 4U6HA 3VW3L 2WZPD 5IWLC 2VAAB 1MHCA 1K6QH 1JZ4A 4BZ1H 2XZQH 3FQNA 3SDAA 5EU6D 5D1XA 1KLUB 3T0EA 1QFWM 5K59E 1WBZA 1CLZH 4JZOA 3D39D 4YNYA 3DGGB 4O9HH 4PJDA 4E41A 2RCSH 3W2DL 2ADJB 5CMAB 4NQEE 5IROC 1ND0B 5JDJA 5K9JH 3U9UB 1KGCD 3KPSD 1CVRA 2ZSVB 1TJHL 3RA7H 1J5OH 1U8KA 4Z0BH 3UBXI 5J89A 4FHBD 1NC4D 2O5ZH 3O2VL 1FG9C 1MQKL 2IG2L 1WEJH 4PRAA 2QKIA 3OAZK 2O61A 4J7RA 2GJ6E 3OBAA 4NPYB 4F7MB 5JORB 4U0RB 4X0KB 1FO0A 4YJZL 2VE6B 5HPMA 1DN0A 2HWZL 3D6GA 3LMJH 5BMFL 4HK3J 4IRJD 3LIZH 3GSRB 2AXJA 2MCPH 1F4HA 5TH2A 1JPFA 4X8JB 5AUMA 4TSBH 2FD6H 4JHBA 1QNZL 4F7EB 3VFRA 3SKOA 3IU4L 3UC0L 5EBLB 5ADOH 4EUPA 3LV3B 4NOBA 4ODBD 3OX8A 2A38A 4PGDB 4R7DB 4PGCA 1HOCA 2NY1C 3S4SG 4U1GB 5AG8A 4MA1C 1GRWA 4Z7VB 4P23C 3MV9A 5DMYA 1ED3B 5ITBH 5EPMA 3CPLA 4JQVA 5EZJA 3TBSB 2JJSC 2HG5A 4KZEH 3EYOB 1JMZA 4O00A 2F53D 5L9DH 2DM7A 2EYRA 4YR6B 4GAFB 2DQUL 5B39A 2GTWB 5BQ7B 5C3LD 3DETD 3MMEA 1I3RB 3ZT5A 4IMKA 2QQKH 4GKZA 1MFDL 3KXFA 4RCAA 3ILPB 4QY8A 2EYSA 1INEH 4KJPC 4NFBA 3W0WA 3QR2A 4TSAH 2ZNXA 4ONHA 4OUUA 1ACZA 1CZ8L 4ODTH 3MRQA 2BRRL 3TJHC 1S5IL 1KG0B 4PLOB 1UXWB 5IHZA 2GT9B 4MNGB 4GW5A 3W5NA 5I17A 1H8OA 3MRGA 4ZDHB 4MXWL 4H1LG 3REWB 4CRPA 2ICWA 2X4UA 5JOEA 2DL9A 3LN9A 3MROB 1XCQB 5B22A 3IGAB 4DQOL 3H9SD 3MRJA 2CIKA 4HK0A 2BJML 5E5MA 4G7VL 1OGAD 5GSVA 4M1DH 3OR6A 1NMBH 3QIBA 3HC3H 4RRPG 1AXSA 2HFEA 3B8SA 1NGZB 4S2SA 3P4LA 1JFQH 3SPVB 5GRVL 4PJ9C 4GS7C 3DMMD 2VZTA 3GSUB 2QV2A 4AMKL 2EE3A 4H26B 1B6DA 1WBYB 1I85C 5JPNA 4PGBA 43C9A 4F57L 3UTSA 1NFDA 1YECH 5F3BA 1I7TA 1OPGH 5KANI 4PJIA 3I6LE 2ZZUT 2YN3A 4QRRD 3TBYA 4YQXH 3D9AH 4L3EA 5T1KB 1XGTB 3SO3B 5JOPD 2OR8A 4HH9B 1SEBB 5E2TH 2JKXA 3PHOB 3WIIL 3G08B 1CBVH 2JIXA 4LNRB 1F00I 1S7QA 1SHMA 4ZFFB 4A6YH 1N6QH 5EBWB 1T3FA 4FTVA 4LEOA 4LKCB 4WO4B 4R6UA 2FJHB 4GXUN 5GIRA 4BZ1L 2XZQL 5EC1B 5D1ZC 5I1DB 1YNTA 4MCYB 1JVKA 4NQUA 4HZAA 3ZT7A 1CLZL 3UZQA 4O9HL 5FKPA 2LU7A 3CFJB 3OG4B 4GW4B 1KIPA 1E4XH 3C8HA 3CX2A 4AY0A 2ERJB 5E94B 1RJLB 3RA7L 3BISA 5DWUH 4HGKC 1GH7A 4Z0BL 2GYSA 2Y5EA 1QFWI 5FYKL 1NGPH 1WEJL 3TBVB 3D1MC 3VXSA 1WTLA 2JELL 4GKSB 2H2PD 4JG0L 3EYUH 4XGZA 5CGMA 4QRSA 3LMJL 4PG2C 1UEMA 4JFYA 4U1IA 2KUTA 2XA8H 5HYJD 5ACZB 4FQQB 1RJZA 4XMLL 1MUJB 2F15A 4LAQH 2QQNH 4P9HC 2ARJQ 2FD6L 1LO5A 3QJHB 4ODUA 3AXLA 2CRIA 3PABB 5GHWL 3PNWB 1IM3A 5DZOA 3AMLA 3BIBX 3ZDZE 3QG6B 3RTQD 2EDTA 1T80A 4QF1A 5DJZA 3BDXA 1DQMH 4R7NB 1AQDB 1FZOB 3C5ZD 3OKKA 4O5LH 3SN6N 5ITBL 5FOJA 2E9BA 2GQHA 1DQQA 5TFSH 5L0QB 4XCNB 4KZEL 2ATPB 4WWKC 1JNJA 2J6EH 5L9DL 3JV6A 3QCUH 3U30C 1QFHA 3CFBB 4YBLB 3IDNA 5F9WB 3DUUB 4MAYC 1KCKA 1G7MA 1V05A 2VSCA 3OKEA 3EFFA 2QQKL 4FRWA 4LLWB 2NPLX 1INEL 1F5WA 1AY1H 2D4FA 3EFDH 3LEXB 3V6OE 1U3HB 2AQ3A 3MNWB 4ZXBA 2V2XA 4XNYH 4ODTL 1XCTB 2CSPA 2F74B 3QUXB 3CLEH 4F9PC 4XMKH 5I19L 1D5MB 5TE6L 1SY6A 1X3DA 3Q0HA 1BWMA 1MCLA 2YEZA 1F3RB 3T0DA 4HIXL 4M7KH 3GGWA 1MFEH 1P84J 4JJHA 1IGYA 3O3DB 1TQCC 1J0JA 3RPIB 3CVHA 1BPVA 4MJIE 1RZ8A 4L4VD 4ZFZA 3FTGB 3PWPD 1MHPH 2NY5C 3QIWA 5FK9A 1WBXB 4OLWH 1PEZA 4L4TE 5DRWA 5DMIL 4D9RD 4KUZL 5MERB 1KJ2H 5BVPL 4M1DL 1MJ7H 1BVLA 1MI5B 3BZFA 5F9AC 3HUJA 2OL3H 2YSSA 4PJBE 3AAZB 1EAPA 3HE6C 1JFQL 2W9LA 2CK2A 3UCRA 3TA3C 5B38B 5MI0C 4MDIB 4RQQA 3GSOA 2NY1D 3KGRA 1WCBA 3BAEH 4C56B 1MCJA 1YA5A 3WLWC 5T1LA 3OF6A 1F4WL 3FO0H 4N8CH 1D5ZB 3VD5A 1OPGL 2E27L 2XT1B 2ZCHL 1E28B 4YHIA 5HHMB 3LQZB 3SDXB 3GMOA 2FIKA 3VRJB 4YQXL 1VA9A 5CBEB 5C70A 5T33H 4Y16D 3ULVE 4RGMC 1KUMA 3D69A 4TYUA 32C2B 5GS1C 1FNEA 1CBVL 3BIKB 2VJXA 3O3BA 4POYA 1BAFH 2C3VB 3D48R 4N0RA 4A6YL 4KJPD 1N6QL 1M6OA 3MXVH 1N26A 1CN4A 4WV1B 2BFVL 3T4AA 2Z35A 1QSFB 1RURL 3IFLL 1T0NB 3QNYB 2QR0A 4ZAKB 1MOEA 3S36H 3AB0C 5CHNB 3HRZB 2FCBA 4OD2A 3QXUA 4MQXC 4JQXC 2G75A 4MD0A 4LMQE 2AJVL 4FQPA 1CFQA 3EDEA 4CN6A 3ARRA 3P0YH 1IGMH 1TFHA 3BGMB 3L3DB 1BM3H 3VH8G 3FAXA 5ISZA 3QDJB 4M7ZB 3WXWH 5FA3A 3SO5A 4N0CC 1HHGB 1CWVA 4BQ9A 5IVNA 3QG7L 5F7DA 5KS9A 2B1HL 5GRJH 3KAAA 4P2QD 4RWHA 3TN0C 1I1RA 1L0XA 5D9SA 3AY4C 1ZMYA 1JGDA 3EYUL 4ZFOL 4C54A 1SQ2N 2AJZA 3I85A 7FABL 2Z8WC 1A2YA 2XA8L 5DK2B 3T77B 3QDGA 4J3WA 4OZFG 3DV6A 3P9MA 3LH2H 2L4OA 4LAQL 2QQNL 4QNPF 3UTTD 2YUWA 1UB5A 3W11D 2ESVD 1EBPA 3TYGH 2FSEB 4OKVB 1FJ1B 5FIEA 1MIMH 4QRPD 4OCLC 5E2JA 1DQML 2X09A 2AS5M 2ADIB 1WIOA 1X5HA 1LVEA 1A7OH 3D0LB 2H41A 5DMKB 4EXKA 2IEPA 4O5LL 5F7KC 1NCDH 5C0GA 2AK4B 4QCIB 2A83B 2G2RB 1C7SA 4WEMB 4HWBH 5TFSL 4APQB 3B6SA 2F5BH 4I3RH 1DBAL 2J6EL 3BP4B 4G8EA 3QCUL 3T65B 3U7YH 2AEPL 4ZTPL 4G9FB 2Z31C 3MRPA 4OF3A 5GPRA 4QXTA 2VZOA 5F1KC 4XWGH 5D1ZD 5DJDB 4JPWH 4CVXA 3IFPB 1EEYB 2C4FU 3BZ4A 2HRLA 5D1QA 3EFDL 5J1AB 2NY5H 2R1XB 4JLRB 2J2ZA 2PW1B 4K71B 5H37G 4Z0XB 4UUJB 4HUMB 1J0HA 3CLEL 1FVCB 3Q2CA 1RZIA 1HHKB 3ZHLA 4P2OA 2XTJC 4MD5A 3TVMA 2Z93B 1OQOA 4NRXA 2V7NA 3OPZH 1MFEL 5A16A 4JFPB 4M7LT 5LCVL 1BQSA 2BHZA 3CZJA 3W5MA 5ENWB 4NCC1 2UYLA 5C0CD 1U93A 2X4PB 3V6FA 2X41A 4AQOA 1C1EH 5T5NG 1BQHG 1YN7B 1QVOB 1XAUA 1F8TH 4OLWL 3VXRB 3PF2A 2Q86A 3QUZC 5JXAL 4MNHB 1JZ6A 3BPOB 2AV1A 5FFLA 4OZHE 3STLA 3H0TB 1MJ7L 4LF3A 3L5HA 4I5BB 4LCYA 4BQ6A 4NO5B 4KZDH 2OL3L 3MR9B 4RX4A 3WDHA 3MRIA 2VLJD 4I0PA 3KPMB 5HJ3A 1J8HD 1R6VA 3RDTA 4Y2DA 5ICZB 4W4OA 2PYED 3FO0L 2C1OA 2AQ1A 4KKNA 1T22A 1S9WA 1JGUH 4WWKD 5JIKA 4HIIB 5DDHB 4OQTA 3GKWH 1AGEB 3VWJB 2H3NB 5T33L 4MAYD 3GHBL 3NMEA 1QLFB 1G9NH 1NUFA 1JV5B 4TNVF 4X7FC 4YC2C 4U1JA 1BAFL 1LK2A 3D3VE 2NZIA 1X5KA 2QADB 4NRYB 3B5HA 4KKCC 2E8ZA 4NHCH 1CI5A 1U8MB 4XNXH 2BSTA 3WSQH 3MXVL 2B39A 3RI5K 1MWAH 4D2NA 2GI7A 1NBZB 3U4EA 4LSDA 3AS0A 4IOIB 5JZ7C 1L0QA 2C3WA 2OK0H 1KOAA 3VXTA 3OB8A 5FO8B 1FGVH 2YA0A 1A21A 1CVSC 1X5ZA 2NY7H 4U6XA 3VRIB 1JZ5A 3HR5A 1S9XB 2R2BA 3TJEL 5F7UA 5I8OL 3P0YL 2IADA 5GS3A 1IGML 5DHYA 5FM5M 2J8UF 1BM3L 1MCCA 2BNQA 2HT4D 3WXWL 1PBYA 3D0VA 4P5MA 3EGSB 1N7MH 1WV7T 2HAZA 3QI9C 1Q9KB 4Y8DC 3VXUD 4BH8B 5IMMA 1T20A 3VD3A 1VKXA 1I1AC 4OCWH 4HKBB 1QQDA 5CWSB 2M2DA 2FBJL 3HE6D 2ICES 2VR4A 2SEBA 4NWUH 5IK3B 3TA3D 5EUOB 1R3JB 4JPIB 3A6BL 4P46C 3LH2L 3SE9H 1YDPA 3MJ9H 2OMBA 2AXFB 5KVMC 1LHZA 3ZDYE 3HNVH 3TYGL 2F58H 2H32A 1MIML 4EI6B 1LD9A 1RMFL 1B0RB 2BSRB 4FP8L 5J13B 5D70H 3C6SB 4X4MA 1Q1JL 1WVZA 1A7OL 1S9YB 3OAZH 1S9VA 1NCDL 2Y25A 2ZPKL 4PLJC 3RY5A 4E42A 3LHPL 1FFNA 3U1SH 4FG6D 1KIUA 1RJYA 4I3RL 1N2RB 5C2UB 5FYLL 3U7YL 2DQDL 5DFVC 4OZGF 1OT2A 1UM6H 4JY6A 3QDME 4NQDD 3TNNA 3U4BL 4XWGL 5BO1L 4JM2A 4K9EC 1TZGH 3RPKA 4HHAB 4MQXD 1KB9K 3LD8C 3MRDB 4RFNC 4MJ5A 1ZTXH