1UADA

Crystal structure of the rala-gppnhp-sec5 ral-binding domain complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
173
structure length
173
Chain Sequence
SLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the interaction between RalA and Sec5, a subunit of the Sec6/8 complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
molecule keywords Ras-related protein Ral-A
total genus 59
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1uadA00
2XSZA 1K5DA 3RRYA 2YC2C 1CJTC 4YMUA 5A5GA 1RW4A 4U00A 4LBVA 2OHFA 5FTKA 1IOZA 4LJ7A 2JGNA 2B8WA 3IEVA 2CMKA 2W6ID 3BGWA 2W0MA 5TVKA 5DH9A 2OE2A 4TWZA 4B73A 2PEZA 2GESA 3ADKA 5EUMA 5L3QA 3BOSA 2VLIA 3I4LA 2BV3A 1VG1A 1XCMA 1QHHA 2DB3A 2QP4A 1SVKA 3KKQA 3LX5A 3OEEA 3PUVA 1AZSC 3CM0A 2P5SA 4HLCA 5FL7A 3WMFA 4URZR 3HU1A 2QSZA 2IUSA 2B7CA 2ZVQX 5FBVB 1F2UA 5IF9A 3QXJA 1Z6TA 4G5QA 1DPFA 3AB3A 3ZVMA 3DMNA 1P2VA 2FF7A 3K0SA 2QT1A 1SVSA 3A1UA 3MD0A 1PJRA 4IW3B 5EQTA 4BFTA 2QE7D 4JBWA 4Q9IA 4AIIA 2BBTA 1KMHA 1JR3A 3GJ4A 4RD3A 5KU1A 3LVRE 4L9WA 2JJ1D 2BCJQ 4EFNA 2REOA 3OF5A 3ZVLA 3U7FB 3C14C 2AXNA 3LQQA 4B76A 4YDSA 1CIPA 1L4YA 1XTJA 4ZPXA 1MKYA 5EE1A 2OZEA 2NPFA 3SYLA 4A8JB 4TSFD 3LY5A 4DSTA 5IHPA 1P5ZB 3AQ4A 5DYGA 1JJVA 2RGGA 5H1YA 1KZ7B 3OIUA 4GZLA 5F9HA 2QAGC 1KI6A 2F3RA 2V7QA 4BLSA 3KQHA 2Q3MA 1BO6A 4A15A 4BFVA 3R7WA 2A78A 4PC3A 5GVRA 1IY0A 4DZZA 5J4LA 1XWIA 5BXQC 1G3QA 2Q3HA 3THWB 2PZEA 4NL4H 3EWAA 1NMXA 3CB4A 5B2ZA 1IJFA 1S96A 2PMDA 4IHQA 3CRW1 1HURA 2F43B 1J7KA 2ZI7A 2JLUA 3U2QA 1RRPA 1DAMA 4GFDA 5DHAA 4ZCLA 4YLGA 3TNFA 4D4MA 5CLLA 2QAJA 2BOVA 1ETUA 1YZGA 2AL7A 3TKLA 4EKDA 2HT6A 3UPUA 3BB1A 121PA 3A4NA 2EFCB 4E03A 2P5TB 4RKEA 1R5NA 4NCJA 5DIFA 1SXJE 2I3BA 2ZRGA 3B1WA 3E70C 4XWAA 3SFVA 1J70A 2ZU0C 4LI0A 4A2WA 1JECA 3QBVA 3WBKA 1QDEA 4HAZA 1F48A 5FPSA 4MRSA 2QROA 5FUYA 4L5BA 2QRZA 3DKVA 3EIHA 4QKQA 1P2TA 3ZIAA 2QN6A 3U7HB 1UAAA 4S2EA 4UNSA 4B33A 2FG5A 4PPGA 4BGDA 4LJ9A 2XB2A 4KHZA 4IEEA 4UKDA 5KSPA 1DAGA 4URUR 2IC5A 1CR2A 5C4GB 2PL3A 4FMBB 4B71A 3Q72A 2GHIA 3AF3A 4Q01A 5BQ5A 5L8VA 2FWRA 4B47A 3K9LA 2PT5A 3U3RA 2E87A 3IBGA 2GAAA 3P4XA 1CU1A 2HLDA 4TTPA 3O8DA 1G18A 4UJ3A 3L2OB 1QHXA 2QTHA 1L4UA 2R6FA 4DBLC 3AUXA 3LO5A 1VIYA 4M1OA 1VKJA 4ITRC 5HCIA 3TW4A 1G4UR 5HKKA 4PPFA 1TPZA 1E2PA 2RGXA 4TTRA 5LPNA 4Q4JB 5CM9C 1E9EA 1LS6A 3BD9A 4DT1A 4L16A 2WJIA 1Z0JA 3QVUA 2GXAA 3RRZA 2ZUBA 3UG7A 1SVOA 2XOKD 1CKEA 3BFKA 3EIQA 4TQUS 2R6CA 3QG1A 1SXJC 5KTYA 3MWYW 1E79A 4LJ8A 3W3ZB 3LBIA 4O3MA 4KVAA 2JLRA 1E3MA 3KXKA 4QM6A 2ZEJA 3GLGB 4W5HA 2IF2A 3LQRA 4Q5IA 3SU8A 3U6BA 3EX7C 3CKLA 1YR9A 5L3SB 4HLQB 1E1QA 3QI2A 5KNCA 5J47A 4GP7A 5GJVC 3PEYA 1U9IA 2G1JA 3A8TA 4QOSA 3WMEA 1UKZA 3PEUA 3KKMA 4LYHA 4WOPA 2MSDB 3BFXA 4HATA 2PX0A 4CF7A 1C4OA 3AVVA 1NVVR 4PQFA 4G5OA 2V54A 1M34E 4N0EA 3IDQA 1WP9A 1XEXB 1Z6AA 4GDFA 2W2TA 4KJZA 2FSGA 2P6NA 1UEJA 4HLUC 3SFZA 2OEPA 3Q7PA 4RD0A 4Q7MB 1E0JA 2J0SA 1ESNA 2C5LA 1BKDR 2W6JD 3VTKA 4D4JA 1WF3A 5FTLA 2PCJA 4PZZA 4LJ4A 3TK1A 5B30A 4JJKA 3TMKA 1B0UA 1I2MA 4TYPA 3TLXA 5FH9A 1GP2A 3X1XA 2WWHA 2OM2A 4C0HA 4LDJA 4RZXA 4C0LA 2YWFA 2PEYA 4EJSB 3GLIA 4TZ0A 4G01B 4GPTA 3ZIAD 2OBNA 4JLNA 1A5TA 1KYIA 1P73A 1COWD 1P4SA 2GJSA 1FTSA 4G5RA 1QHYA 3B5JA 3VU9A 1R0WA 2QE7A 3VKWA 5LDDC 4GZMA 2REBA 3K8YA 3WYAA 1D2EA 2WJYA 5GJBA 4D0GA 3L0PA 2DHRA 4LC0A 4UXHA 5FOSA 4W9MC 3IUYA 1GNQA 3K0AB 4NZYA 3CX8A 2GILA 2ZPTX 2NG1A 4BUJA 4E5UA 4RY2A 3MJRA 4GMXA 3T1TA 4A6XA 2RGCA 1E9DA 4V0MA 1NY6A 3IQXA 2XEXA 3C7KA 2O8DB 1E9FA 3RVBA 5KOYA 2ODBA 2DFNA 2QL6A 3EW9A 1NY5A 5FOVA 3LFUA 1B23P 1YR6A 2J1LA 4IFBA 2NZ8A 1HE1C 2XOKA 3GLGA 1KNXA 2QQ0A 3LWNA 2QQEA 1WBDA 1JNYA 1E9AA 2D7CA 1W44A 1NRJB 1K5GA 5AJZA 3N5CA 4QM7A 5H8WA 4FW9A 3G82C 4OKSA 2XAUA 1BIFA 3Q5EA 2G0NA 5FOXA 2OFOA 1CJVC 2XTMA 3B6EA 2V1UA 4KFTA 5GVSA 3QKRA 1FL9A 2A7QA 2O52A 2J45A 4JVSB 2GZDA 2CE2X 4TMVA 1ZUNB 3LXRA 2WVJA 4KODA 1XU4A 2FGKA 4U5XA 2VA8A 4BLRA 4BEJA 2CJWA 4B3FX 4X8HA 1BOFA 5ANRB 3R9XA 3WP1B 4Q9LA 4OQMA 2IYTA 3B82A 5A4JA 1TAGA 1V43A 2EVWX 5EP1A 4A0HA 4DSOA 3U61B 4BRUA 2W2VA 1ZNYA 4ZI3A 1LB1B 2AWNA 3EZ9A 5JSZB 1S1CA 3EC1A 3Q3JB 4L9SA 3BIFA 4OHWA 5CITA 5LD2C 4Q1CA 4ZIRB 1XPOA 2NQ2C 4FCTA 1DELA 5EXXA 3ICEA 1TF7A 3QNUA 4KYUA 1QF9A 4CZ2A 1Z2AA 3SNHA 1JPJA 2BIFA 2AXPA 1U9IC 4B3XA 3PITA 1N25A 4NONA 4B75A 3WXMA 2J0VA 4POAA 3AKCA 3DM9B 1EXMA 3OAAA 1KO4A 1CS4C 1UKVY 2CXXA 4HEJA 3PXGA 4NMMA 1KDTA 4Q4AA 1IN8A 1CP2A 4RKFA 2R8RA 3W6NA 4HLUA 2BBOA 1E9RA 4QHSA 2V1XA 4Q9JA 2CBZA 4TSFA 3GPLA 4OK5A 3THXA 5FUXA 2IYVA 1F3OA 4DLUA 1QHHB 4AURA 1RYFA 3OFND 3KL4A 4CGZA 2VTKA 1KSHA 2FSHA 3ZGXA 4C30A 1NJFA 4JLPA 4DCUA 4JLBA 5KDOA 2ZRDA 2PLFA 4O2RA 1G19A 1XTSA 2ANBA 2GTPA 2QPOA 3O8BA 3NVAA 5AJWA 4ZDWA 2CVHA 3IILA 1IN4A 1OFIA 1WMSA 2G83A 4TTQA 3KX2A 3IO5A 4MGIR 2LKCA 4DXAA 4FMDB 4QGFA 5DN6D 3W6OA 3ZYCA 4WVFA 5LB4A 1Z0KA 2Q0HA 5CM8B 2GCPA 5HPYB 2FSIA 5FOUA 2DFLA 3TQFA 2ZTSA 4GBMA 2XTNA 4F4IA 1JQJC 1XZQA 1N5LA 2OFWA 3CF6R 4BLQA 5DI3A 1OXUA 2A30A 3GEIA 4IVPA 5JLJA 5JS7A 3TSZA 4HUTA 5KPDA 1EFRA 3S1AA 2JASA 1P2SA 1U0JA 1ZD9A 5M04A 2KI5A 2ZSAA 3C15C 4PTLA 5CB6A 3DKPA 2NMVA 1JR6A 2WWXA 2O5VA 2BJVA 2C03A 2H7VA 3HWSA 2WMOB 2ZYTX 4HI0E 4RZ2A 3AVUA 4TT3A 1XCGB 1OW3B 4V0KA 5FBQB 4K46A 4Q1FA 1NNEA 1UFQA 1Q0UA 2RKOA 2ZAMA 2FEMA 4BASA 2IHBA 4FCWA 1RRCA 4QGHA 4LC1A 4MQBA 3TIFA 3AGQA 4IDQA 3HP1A 4LY6A 4F7WA 1DOAA 1IHUA 4XSGA 1BH2A 3I5YA 3KJGA 1CR1A 3CWQA 2J87A 1MV5A 2HJGA 2WIAA 1EGAA 4ARZB 4EQ6A 4XD7D 3M0EA 2PH1A 3I32A 2ZRHA 3KB2A 1JEDA 3VMFA 4DCNA 5JMTA 3UK6A 2LCFA 2BM0A 4OHZA 1U90A 2QAGB 3THOA 1P9NA 1CTQA 2GCNA 5JWOA 1ZNXA 1RZ3A 2VHCA 4Z51A 4JT4A 1GUAA 2QORA 1QZXA 2VHQA 2ZJAA 3CPJB 4RZ3A 2Z43A 4CW7A 2H16A 2VYFA 2Q3FA 3BAFA 4DIEA 1RFLA 4NKRA 1JXMA 4JJZA 1NF3A 3B78A 4E22A 4M2LA 1RRGA 1Y3AA 1IBRA 4GNKA 5CJ2A 3WNBA 2D3WA 1P62B 2FA9A 1NN1A 2Q6TA 2C9OA 5TV2A 1NSFA 4TL9A 2QU8A 2R6AA 2VF8A 4QGAA 3O8RA 1TTTA 1II9A 1HQYE 1NG9A 5KYKA 5UKDA 1VMAA 2ZRPA 3H2YA 3QY0A 1S3GA 2ZRFA 3K0FB 3OE7D 4JLKA 2WJGA 2ZS9A 2QA5A 2WPDA 3D8BA 2YKGA 2IYXA 2WM9B 5CYOA 4F93B 1SVWA 1G8FA 3EC2A 3TE6A 3CNLA 4IVQA 1GFIA 2BBSA 1XEFA 2AK3A 2REXB 4BLOA 1CRQA 5F98A 2L0XA 3LW7A 4QNRA 3GLFE 4MDEA 4FIDA 3IKJA 2DBYA 1KAOA 4C0AC 2JLVA 1W0KA 1DADA 1P9WA 1YR8A 2QT0A 1JR3E 2ONJA 3VKGA 4IDPA 4D25A 3IHWA 2XXAA 3JVUA 2QEQA 3CRVA 4Q7LA 1OLOA 3QPUA 1QHGA 2PLRA 5CK5A 1PVOA 1PUJA 1J99A 1G6HA 1KI6B 4KFUA 5HTKA 1HV8A 4DEXA 3VFDA 4PO9A 3F8TA 3PENA 4P4SB 3QIAA 2QNRA 2W6IA 4CIDA 4C7OA 3NC0C 2D62A 1XEWY 1NMYA 3M1IA 2GK7A 1GSIA 2QMUA 3C4JA 3EWSA 4LOAA 4G5SA 2P3SA 3K1JA 4AWXA 5C18A 5K8UA 3RC8A 1JJ7A 2ERYA 1GNPA 3EZ2A 5IRCD 3VKHA 1SXJA 4QBIA 2UVQA 1KMHB 1G291 2CLDX 2W83A 1E9BA 2HLDD 4URWR 4M1MA 2V9PA 4F91B 1F5NA 1H8HA 2IW3A 1T5IA 1ZU5A 1NVUQ 3F5FA 1GVNB 2J46A 3NTUA 4LRWA 1N0WA 1GRRA 1IY1A 2KSQA 3RABA 4LV5B 4R98A 1RJ9B 1NVVQ 1MRNA 4FWIB 4QBHA 5GJCA 5E95A 4CEJA 4R9UC 1E2JA 5L3QB 1G21E 3VR2A 1UBEA 4KCGA 3RS2A 1T4GA 4BLTA 2CL6X 1V5WA 2R2AA 1WCV1 2GXSA 2ZVPX 4FN5A 5DISB 1JEEA 1ELOA 1UKEA 2IYRA 3WBJA 2OSBA 2KE5A 5JHGB 1KHTA 4C0JA 3QKSB 3BBPA 3GLHA 4TMTA 2W00A 5KDLA 2I1VB 4MDFA 1Z0FA 1LNZA 3L82B 2AK2A 2WJHA 3RRNA 1DE0A 4IJMA 2ASEA 2QGNA 2WJJA 3AVQA 4TL7A 4LBYA 4XOIA 5LD2B 5D3MB 3EZ6A 4ON9A 3U60B 4OHXA 1ODFA 5G40A 4UNPA 3QVVA 3Q7QA 4B6FA 2FX3A 4JIMA 221PA 2OXCA 2AD1A 1VYVA 1LVGA 2EQBA 3JZMA 1MOZA 3WMGA 3K70C 3FHTA 4QNMA 2MSCB 1KO1A 1ZCBA 1F2TA 3EASA 2C04A 2O8DA 1NL3A 1DAEA 1XDBA 4H9GA 3AVPA 4M1YA 1PLJA 4MKIA 1KTVA 3P27A 4A82A 2HDNB 2AN9A 1VCMA 2EFHB 2IEYA 3A58B 3LV8A 3LX8A 5EXSA 5SZIA 1OH8A 1UKYA 4NP6A 2KWIA 1XTIA 1MO6A 4PC6A 4I4LA 4FXPA 3V00A 4OI0A 4B3CA 1DARA 2WSMA 3NH9A 3I61A 3TH5A 3G0HA 2IYZA 2ZUCA 4RSGA 5JEDA 1UBGA 4NYJR 1OXTA 4HAYA 4O2LA 1XPRA 5C2JB 5DSZA 4DLSA 4G3XA 4V02A 2ZXUA 5F3WB 2ZR9A 1BMFA 4OHVA 3IPYA 2HCBA 3IQWA 2IXFA 1AK2A 2IF0A 5EXPA 3FGNA 3LBNA 4OQXA 4DCVA 2ZANA 4V03A 5DNYB 2C96A 1TX4B 4NU0A 3GLIE 2J3EA 2BKEA 1NBMD 2ZRBA 3HR7A 3QBTA 1E0KA 4IDNA 3L43A 3LW8A 1QHNA 5BN5A 2CK3D 1WXQA 4R2HA 2OXRA 3VX4A 1R0YA 2WIBA 1OT3A 3D3QA 2VQSA 5FI1B 1NBMA 1RRFA 2ZRAA 4M53A 5KSYA 4C2UA 1YRAA 3RS4A 1JQLB 1Z5ZA 2ZE7A 1XEXA 4K81B 1AGPA 5JFGA 3T15A 3KB1A 1S3SA 3KZ1E 3FYHA 3NWJA 1AM4D 1G9XA 5C46F 4BFZA 1U8YA 3DEFA 2ZJ8A 4IRUB 4ZDJA 2ATVA 1KSFX 2RGBA 4MGZR 2YYZA 2ZM5A 4OQFA 2FN4A 1N6NA 3OIYA 3TUJC 4ERNA 3GFPA 4LSGA 4DLRA 3V4FA 1XEWX 3TAHA 2ZR7A 3K0AA 1KI3A 1NKSA 2JCSA 4PO1A 4WIAA 2DYKA 4UNNA 4HDCA 4FCVA 3QE0A 2KJQA 2QAGA 1OV4A 1XMSA 1XD9A 1A1VA 3A1VA 4CVNA 4P31A 4MKGA 2JEOA 4ARZA 1CJKC 3KJIA 4I1VA 3KJEA 4EQ6B 1R4AA 2DFKB 2F1IA 3EG5A 3IHLA 4LJYA 3MJHA 1DAFA 3Q85A 3EPHA 1IAQA 2J59A 1Q20A 1FMJA 3FHOA 1W5SA 2BWJA 3THXB 1ZM3A 2CHQA 5DYIA 1GTVA 4LX0A 1IY2A 5TARA 1G6OA 2XNDA 2O8EB 3I92A 4NYMR 3C16C 1SXJB 1EFHA 1N6RA 1P61B 4CEHA 3TVDA 3EA0A 2JJ2D 2A5YB 1Z6XA 2R44A 4LHZA 3BJIC 3PIRA 1F2UB 1VYTA 2JIZD 2AHOA 5AWFC 4TYYA 1CEEA 2ZYWX 2W58A 3K09A 1KDPA 3D6TB 3QENA 5CIQA 3AVWA 3HU2A 3GD7A 2ZYVX 2JJ2A 4EPYA 1QG2A 1W48A 1GL9B 2FDCA 4JLOA 4PR0A 4JLMA 2TMKA 4YMWA 3S1AB 3KKNA 2Z0MA 5JI3E 3CZQA 1E99A 3UMSA 1SKYB 1LFDB 4UXIA 5FTNA 2O0HA 1Z08A 1KK0A 3LA6A 4M1TA 1D6JA 3AV0B 4W7SA 4OYHA 4HAVA 4B6EA 3VNUA 4AG5A 1RKBA 2JLSA 3KTAA 4TQ9A 2X1VA 4IDOA 2IYLD 2NO9A 4HAUA 2GVZC 1CXZA 4A0RA 1T3SA 4DB4A 3EZFA 1D2MA 1HTWA 8OHMA 3GLFB 2D7DA 4D4LA 3DM5A 5FPYA 4CRWB 2AFHE 2IT1A 2QPTA 2C95A 1NLFA 3GJ8A 5EE3A 3QEOA 2HYIC 4M9SA 2PT7A 3OIVA 4H1UA 4NE2A 1J8MF 1Z0IA 1UADA 3A6PC 4D4KA 4YONB 3B60A 1JPNA 3LAWA 1DO2A 3KUCA 4QL3A 1SHKA 1QVAA 1Z28A 1Q1ZA 3QKRB 4GOKA 1IQPA 4TMWA 4O25A 1KZGB 821PA 1E0SA 2CCGA 1M2OB 4KBGA 1VYUA 2ZRMA 1LW7A 2RGEA 2G0TA 5KSOA 1U81A 2DR3A 5FUWA 4OI1A 3AP1A 1XMVA 3MAAC 3THYA 1UF9A 2QUZA 3ETLA 1CR0A 5FBWB 3KQNA 521PA 4PHHA 4YC7A 3GJ3A 4AKHA 3B1YA 2Y8EA 1N0VC 3KTAB 4ILEA 1N6LA 2E1RA 1TQDA 2N46A 3FMOB 4RD1A 5J4VA 2GEDA 3H0KA 2AD5A 3QF4A 1D9XA 5BYKA 3UKDA 1EWRA 4DRZA 1G7TA 2G9NA 1LS1A 2NO6A 4XD7A 4XTRA 3A36A 3HYRA 3QOFA 3E1SA 2IUUA 2J0UB 1RVDA 2WOJA 1E2LA 1HA3A 2OESA 3VHLB 4MYCA 4PQRA 4A92A 1D2NA 1S0UA 4JS0A 4DT1B 2P67A 2YNMA 1AS0A 2FU5C 4MGYR 4ZDKA 3LRPA 1Q44A 4EPWA 3EIEA 1W0JA 2WZQA 1C9KA 1D9ZA 1E96A 4X8MA 4BRWA 1E2MA 1XMIA 2JIZA 3JVVA 3ZD6A 1ZJ6A 3HR8A 3PR1A 5G3YA 2AWOA 4XIGS 4Q02A 1AKEA 3CX6A 2XB4A 3BH0A 4D2IA 3QXCA 3AEZA 1KJYA 2XZOA 3H84A 1FNMA 4V0OA 2HXYA 4BZXA 4M4SA 3GJXC 1A2BA 3P32A 1U94A 1X8KA 1FX0A 1Y63A 2GKSA 1US8B 3BC1A 1Z29A 4P32A 3GFTA 1NP6A 2VHJA 4TQAA 4XSHA 4M8NE 2HJVA 1VPLA 1AA9A 3HPQA 3AVTA 2UZIR 4NTZA 1ZD1A 4KAXA 3CRMA 4ZIRA 4XJXA 1X86B 4WZAE 4M21A 5BN4A 1JI0A 4HYYA 3X1WA 1M7GA 2P0EA 1XCPA 1FOEB 2D4HA 2QM8A 3I73A 4LBWA 4AKIA 3NXSA 3PV0A 4RJLA 4C3ZA 3A4MA 1E2DA 1FW6A 1FP7A 3MUFA 5TDHA 2DPXA 3TVTA 5EP3A 1N6OA 1F2TB 2RGNC 3F3YA 2GVDC 4HB0A 2OBMA 4U7DA 1Z0DA 3DMDA 4LBZA 4OK3A 2DY1A 3K9NA 2F1RA 1G7RA 3VR4A 2H1LA 3HPRA 4TLAA 1YQTA 4KSCA 3U7EB 1JR3D 4YMTA 2ZJOA 3L0SA 5HZHA 3FHCB 3ASYA 4TMZA 1D5CA 2QTFA 1MH1A 3PQCA 5HZKA 4BEBA 5HE9A 2C99A 3AH8A 5J40A 1YZKA 1R5OA 1XJCA 4D80A 2HUPA 5FTMA 1W36B 2VPPA 1XPUA 2VP5A 4R7ZA 1G8GA 1OXSC 3CPHA 3PUZA 3NHBA 1KSJA 4B2LA 5JBQA 3T34A 1N6HA 2JLWA 4HDQB 4AI6A 3B1XA 3B2EA 4C0KA 2WWYA 3EZ7A 2CLCX 1S4QA 2QP9X 1GRNA 2B7BA 4MRRA 4N3NA 3W3AA 3SBDA 1IJEA 2NTYC 4NCHA 3T1VA 3ZDQA 4UXJA 2XSZD 3PFIA 4PHFA 3UIEA 4P3YA 4TLBA 1KO7A 4CYMA 1TU4A 1X1RA 2YWGA 4OI4A 5AUOB 3W9YA 4A36A 4US2R 3CWZA 2WOOA 3IGFA 3QQ5A 1ZAKA 2VSOA 5C4MA 1JALA 4HSEA 1WB9A 4ESHA 2ZI5A 2ZRKA 1Z07A 2H17A 3QG5A 3WYFA 3GMTA 1MABB 3RS0A 4BE7B 2G88A 3OEED 2IA5A 2ERXA 2XTZA 1TF5A 3ZD7A 5LBIA 2ZRCA 3LLUA 4NYIR 3GJ0A 2QM7A 3X2SA 4EIWA 5DHFA 1E1RA 3MWLA 4JL6A 4F4CA 2FNAA 2BMEA 2ZE5A 3AF4A 4QJ3A 2F43A 1OXXK 1OPXA 1SXJD 4JVLA 4PANA 5DI3B 4AYTA 4OHYA 4HLDA 3L8ZA 5KO2A 4YXWD 2X2EA 2IK8A 3FMIA 4DUGA 1VIAA 1GAJA 2JJ8A 3MLEA 1G3UA 1T91A 3N70A 4AKEA 3OEHA 3GLHB 3ADDA 4AKGA 1YZNA 3AP2A 5EE9A 5KNDA 1H8EA 4GI7A 1E0AA 2A5FA 2FMXA 4B74A 1RPZA 4C2TA 1W49A 2V8OA 4DIDA 1XXHE 3BRWD 5CK4A 2KBFA 3MRSA 5GJWC 4JVMA 4JLAA 1G16A 2GCOB 5K8IA 2W2XA 4DLZA 3BB3A 2VSXA 2Q21A 421PA 4H1VA 3HDTA 5JJKA 3CF0A 3ADBA 5D3QA 4Z1MD 4DDWA 5FBRB 1T8UA 1S9DA 1IN6A 1VG8A 3WHKA 4CDGA 2V7QD 4RFSA 5B57C 3VU9B 5IK2D 3EPJA 4M0LA 3RHFA 1P75A 3CW2A 4KV9A 2OCBA 1X3SA 2IYQA 3U5ZB 5CLQA 4A8JC 2Q9AA 2B92A 3O47A 1BMFD 2VP6A 3WNCA 2IX3A 3ECCA 1Z06A 2R62A 3NC1C 4B34A 3UMRA 5L3VA 1CJUC 1FP6A 1ZM7A 2VP9A 2ZI6A 5BYJA 5JRZA 2IYSA 4EJSC 4ABYA 4QFMA 3U6KA 1M6NA 2FFQA 1P60A 4DDUA 4PSKA 1HUQA 1ZW6A 3NEJA 2CL7X 1CBUA 1Q1BA 1YJ5A 3B7GA 1OYYA 2C9CA 3UMFA 3G5UA 2PJRA 2DCUA 2BDTA 4KYIB 4RZUA 2VEDA 1YZLA 4LHWA 2VO1A 3U7GA 5JRJA 1TMKA 3PUYA 3NIBA 4I1SA 5K8LA 1Q3HA 1KY3A 4W5JA 4AYXA 4XWKA 2IS2A 2HYDA 3W5JA 4WZ6A 3I5XA 2EFGA 3THYB 1WA5A 1DEKA 1SVLA 2F9MA 2A2ZA 1KI9A 2GDJA 3T35A 3ZZTA 3EPLA 1R10A 3HU3A 2R9VA 4P33A 1A4RA 3NBXX 2CJWB 4JZKA 4CEIB 2IYYA 3SC3A 3RWMB 4GOJA 4AD8A 5P21A 1OFHA 3LVQE 1HT2E 2GJAA 4HUQB 2WSSA 1KK2A 2CHGA 1O3YA 3CR7A 3U44A 3BB4A 1CR4A 2Q9CA 2QMOA 3P20A 3CONA 1E4YA 2PZFA 4DLWA 1N3BA 4M9ZA 1IONA 5JI2E 3IO3A 4D0NA 1I4LD 2O8CA 4JYCA 3K09C 2EYQA 1QG4A 2YVUA 4HB4A 3WNDA 2ONKA 4DWJA 3CR8A 2R65A 3PJRA 4MRNA 1ZUHA 1WE2A 2VHTA 1II0A 1X8LA 1NG1A 1T8TA 4JKYA 4ZDIA 1FUUA 3QKUA 1PLKA 3CNOA 4TYQA 4US0R 2PBRA 2VHUA 2GA8A 4LGMA 1MO4A 4BPBA 1ZCAA 4DHEA 1E2IA 5FPTA 1N6IA 3J81k 3IIJA 3BE4A 4EPTA 2J5XA 1PZNA 1XP8A 2UKDA 2ZRLA 1EK0A 1U0HC 5FPKA 1DTSA 1AS3A 1GKUB 3NBYC 1UJ2A 2K5UA 1S8FA 1W0KD 1NKTA 3C5CA 3FMFA 1SKQA 3ND9A 3AKYA 5CIWA 1S2MA 4Q4HB 3RYTC 1WRBA 3JZAA 1L8QA 4D81A 1LV7A 2OLJA 4C0QC 2F9LA 5EP4A 2GBLA 2FFHA 3AKEA 1ZC3A 2GF0A 2HEIA 4HDOB 3DO6A 5FOWA 5SZHB 2ZRNA 4NPHA 1R8SA 3REGA 1W4AA 4Q1BA 1E4VA 2O8BA 1E6CA 2JLZA 2A9KA 1E2HA 2YV5A 1AZTA 1QHIA 1T3HA 2J0QA 2KB0A 1KO5A 1OB2A 1TQ4A 1GL7A 4L4UA 3MCAA 1MABA 5EZ6B 3NDBB 3CO5A 2BMFA 1E69A 3BERA 3UG6A 2BHRA 4FINA 2WICA 1N6KA 5TXGA 2B8TA 1YVDA 2PZGA 4OJQA 3RLFA 4CEIA 3TR0A 2BBWA 1W7AA 2O0JA 4HB3A 3T5DA 3C41J 2VSFA 2XITA 2Z4SA 1XRJA 3R7WB 4LJ5A 4LPKA 3SE0A 1J90A 4IXNA 4PPQA 3RSLA 2FEOA 5JSZA 1KJWA 3K0CC 4U02A 5AJYA 2J41A 5FBLB 3SQWA 1FX0B 4RD4A 1CRPA 2OG2A 2C2HA 3K53A 4XVRA 1OFUX 4JLVA 3TW8B 1G3IA 2CL0X 5AR1A 2FH5B 1L7VC 2CEAA 1C1YA 1FPMA 3BH7A 2VH5R 4PQYA 3P1JA 2EYUA 4ASUD 2OFXA 1NI3A 2ZR0A 1KOFA 1SKYE 4LUCA 4PSAA 2QBYB 721PA 4BFXA 3B8HA 3R20A 1VCNA 3QXXA 1YZQA 1DVRA 2GEUA 5JECA 1M7HA 4Q21A 4X8LA 4JL8A 3C8UA 2PX3A 4YMSA 1E79D 3MMPA 2GXQA 4RD2A 1NN5A 2YWEA 1T0HB 2ECKA 4RFVA 2P6RA 5BN3A 2OUKA 1W36D 1G8PA 1BS1A 4MA4A 3SHWA 4EAQA 2SHKA 4DSUA 3SS8A 4LHVA 1Z8FA 3PUWA 2FZLA 3UXMA 4ESVA 4EUNA 2OAP1 2G77B 1TU3A 1K8RA 3DL0A 1KI1A 2J0UA 2B6HA 1ZP6A 1E2EA 4WAUA 4OL0A 1DS6A 4IXMA 5E4FA 3OIWA 3OZXA 4DCSA 3SJAA 2BEKA 4PPNA 4WA7A 3A4LA 4A0GA 3U3MA 2X8AA 4BZPA 2ZJ5A 3W90A 1SVMA 2YC4C 4P4SA 4BFSA 3A1WA 4B32A 3V4RA 3I72A 3FFAA 1EESA 4JLDA 4Q9HA 3TAUA 3GCGA 1NMZA 4ZCIA 3QF4B 2H8KA 3KUDA 4TMKA 1GIAA 4Q1DA 3EARA 1OB5A 3P26A 2XGJA 3T61A 1MT0A 1T5LA 4NH0A 4A6PA 4II7A 3IIKA 4PO8A 2F3TA 1RIFA 4ACAA 3VR5A 5L3SA 2QP3A 2UZ3A 1G17A 4ZI2A 2P65A 4B2IA 1OIWA 2H92A 1F60A 1FZQA 2JLQA 2HT1A 1G7SA 3DOFA 3KQUA 4LJ6A 1XTKA 2CDNA 1ONBA 1NJGA 1O87A 2CCKA 1YHNA 2FSFA 2XNSA 3AVOA 5EZ5A 3K0FA 4B3BA 4DUGD 1AQUA 2GBLC 3L0IB 4OBEA 3TUIC 5EUQB 4WW0A 2GJ8A 1OIVA 4Q48A 3WRYC 2YWHA 5C1BA 4JT2A 1E2FA 2GJ9A 4DC9A 2JDIA 1U8AA 4QGGA 1OF1A 1QRAA 3GEEA 4PSVA 1H8HD 1Z47A 3IIMA 1VG9B 1Z83A 2GZHA 4XH9B 5FOTA 3GJ7A 4E09A 3A1SA 1DBSA 4KLNA 4MGKR 3W8RA 4QJ5A 1R7RA 3I8SA 1T0JB 3OFNA 2N1BA 5DGXA 2NIPA 1OSNA 4GMDA 3VR6A 1G41A 3B13B 4A9AA 4Z1MA 1M8PA 1UBFA 1OE0A 1XMJA 3GJ6A 1AN0A 4NCKA 1Q12A 2I4IA 3QEJA 2QMHA 3U3JA 3CNNA 4FWTA 2AR7A 3NBZC 1GILA 2JAQA 3QPWA 4WZBE 1UDWA 1W5TA 2JATA 3L8YA 2ZSDA 1Z22A 4C0SA 1KO8A 1SZPA 2J7PD 1R8QA 1HEIA 4IOJA 2GF9A 4GSYA 2GWHA 3B9QA 1IXRC 3UATA 3WY9A 4LK2A 4JSTA 1EFRD 3FMPB 1NIPA 2A5JA 3T06B 3VNVA 1OFTA 1ZC4A 1S1MA 4PZYA 1KGDA 2J7PA 4UNQA 1HQCA 1XBTA 2DFTA 2O8CB 4KU4A 4PHTA 2XJ9A 5AK0A 2LWIA 1VECA 1IXZA 3ND8A 3LD9A 3SR0A 4JVNA 1N5KA 1W0JD 5TB5A 1YZUA 2YJTD 4HAWA 2J7KA 4DJTA 2R6GA 3KJHA 3RANA 4PHGA 4HUQA 2WJVA 3B1ZA 1IN5A 2G6BA 2ZJ2A 4KITB 3W5IA 2ORVA 4PAOA 2RHDA 4A2PA 5E3HA 2ZSBA 2ZS8A 5EP2A 5IT5A 4TYNA 4PC2A 4DDVA 2RGDA 3ZS9A 1WQ1R 2EWVA 3FTQA 4IOMA 1HH4A 3WHLA 2WAXA 4P0TA 1Q22A 1FTNA 2A3RA 4OQNA 4PFSA 1COWA 1W1WA 1TL7C 2IEZA 3VX3A 4I1OA 2VF7A 1U0LA 2BVNA 3I1FA 2NGRA 3SJBA 2FPKA 1T3LA 3OAAD 3T1QA 1HY3A 1N6PA 3RSOA 1CULC 2QMEA 5E7MA 5KNBA 5CYPA 2QGZA 3QXHA 2ORIA 2YOHA 1M1YE 1ZRHA 2E9SA 3IEUA 1KDOA 1OHHA 3T12A 4A8JA 3ZZ0A 4D82A 1W2GA 3ONWA 4DLXA 1AJEA 4I99A 3FB4A 3FE2A 2FJUA 4KO8A 5AUQA 2FV8A 3MG9A 2ZETA 3P4YA 3KQKA 4Q19A 1W36C 2IWRA 1Z3IX 4A0FA 4FMCB 2WWWA 3SI7A 1ZBDA 1XX6A 2GJKA 3DVLA 4EJSA 3GLIB 1FFHA 1Z6YA 1E98A 4LHYA 1AGRA 1R0ZA 4QRHA 3REFA 2ZI4A 2RMKA 4Q4HA 3ZQJA 3NG1A 2J9RA 2XJ4A 1DAHA 3BS4A 4KXFB 2BEJA 3PVSA 1ZU4A 2CE7A 1OJLA 3RRMA 3TQCA 1EX6A 4Q18A 1R6BX 2IWHA 3TBKA 1KY2A 2C8VA 4EPXA 2F55A 1M74A 4CT4B 3QF7A 1KI4A 1R5BA 1XXHA 2IS4A 2YZ2A 4Q7KA 1WBBA 4JSYA 1U8ZA 2X2FA 4KFRA 3OESA 3QUSA 4LV6A 4Q47A 4KFSA 4JL5A 1YU9A 2AFIE 3NBFA 1RYHA 3E5HA 5EXTA 4DEYA 1G7CA 1SVIA 2ZUDA 1AQYA 2RAPA 5G3ZA 2YOGA 4IVRA 2V3CC 3FVQA 1RJ9A 1TADA 2ZJYA 4I81A 1LF0A 4FD2A 5JJLA 1E2QA 3FOZA 2F1JA 3H4MA 2ZAOA 5G41A 4CEHB 1KAGA 2CHVA 2EFDB 1G8YA 4UJ5A 1DG1G 3FKSD 1NN3A 3RDPA 3UANA 3AVXA 1DO0A 2OCYC 2NO7A 3ZQ6A 2QY9A 2FPMA 3SEAA 4GP6A 1E2GA 1YE8A 4IFEA 1ZNWA 2AKYA 3I3SR 3SHFA 1P7CA 4M9XA 4PC7A 5AJXA 4ZO4A 1KI2A 3GLGE 3R9IA 1R2QA 3PCRB 4QHTA 5BW8A 3EPKA 5J4KA 1KDRA 1YKSA 2WSSD 2C98A 2CLSA 2V4ZA 5JEEA 3BXZA 2X77A 2IS6A 1TQ2A 2W0SA 3X1DA 5JCZA 1UM8A 3NH6A 4DCTA 1KK3A 4Y0AA 2FZ4A 2FFAA 2RHMA 5HCNA 4TYWA 2CNWA 1NLZA 4DLVA 3DPUA 4IOLA 1E2NA 2FGJA 2IXGA 3H1TA 2NPIA 3BFVA 1A2KC 4JBYA 5E7IA 2NOAA 1X8JA 2GRJA 4TL6A 1ZIOA 4C4PA 1TUIA 1I4DD 3SYKA 4LYJA 2OILA 4DDTA 1OH5A 1G3MA 4O0MA 4CEJB 1E9SA 2NO1A 2W6JA 3WYGA 3AUYA 1FNNA 1EFUA 5DN6A 4AG6A 4IEIA 1VCOA 4NHOA 2G3YA 4J0QA 4LZZA 4Z8XA 1Z2CA 3ZS8A 4HZUA 3KKPA 1PUIA 1TEVA 3CZPA 3CUEF 2ATXA 4Q1AA 4M1WA 4YDHB 5EJEA 3K70B 4DLYA 4XWOA 1DAKA 1VG0B 2OT3B 3RC3A 2F1HA 2IBMA 4QG7A 3B1VA 1RE0A 3CRRA 4RFSB 1G5TA 3SQXA 2GK6A 4UQOA 3CPEA 5ELXA 3SJCA 2QPAA 4G1UC 3SN6A 1KSGA 4GL2A 5D3MA 5CDFA 1OH6A 3ZVRA 3V9PA 2FOLA 4BFWA 4MYUA 5JS8A 2WMNB 1ZNZA 1IM2A 1XD8A 2IYUA 2HF9A 3QPVA 3K0CA 4PAQA 4IKEA 3ASZA 3LBHA 1NN0A 2WHXA 2PCLA 3O8CA 3MSXA 3AP3A 1ZD8A 5FR2A 4LHXA 1GKYA 2ZSEA 3TRFA 2RCNA 4FMCF 4JLJA 4QHYA 5TY0A 4US1R 1QVRA 1P9RA 4I1UA 3BWDD 2ZREA 4TLEA 4WBSA 3GQBA 4F92B 2WTUA 3GLHE 4MH0R 4V0LA 4YMVA 4BECA 3PUXA 4RCYA 1ZM4A 2EW1A 5FUVA 4BFYA 3N2IA 5CJPA 4B3DA 4B35A 1Z63A 3GJ5A 5B58C 1GM5A 2D06A 3NKVA 4MKFA 2BC9A 2X19A 4OK6A 1TUEA 5BWMA 2VBCA 2OV2A 2WKRA 4TLDA 4M9QA 2GXUA 4MRVA 1HT1E 1OHHD 2OLKA 4PXAA 4ASUA 1OIXA 1P6XA 4N1AA 2V6IA 4XTCS 3SBEA 3E2IA 4ACBA 2ZITA 4TZ6A 1XZPA 5KDDA 2O8BB 4KSBA 4ZCMA 2CNWD 5J4HA 5E7JA 2ZI9A 1XB2A 1FQJA 3FWYA 1G1MA 3QKSA 4QXAA 1XTQA 3DZ8A 3Q9LA 3QJYA 3KQLA 4HAXA 2ZJBA 3RNLA 2ZE6A 3M4YA 1FMLA 2LKDA 1W46A 1YRBA 3C5HA 2WAYA 1J2JA 3LH5A 5CB8A 3FKQA 1DG3A 1HE8B 3EA5A 4C7OB 2GETA 4AK9A 2N42A 2P6UA 4WXPA 3D31A 1KIMA 3CLVA 3ZVNA 4M1KA 5FL7D 4DKXA 1E1QD 2D74A 3I8XA 2Q9BA 2V6JA 1GRQA 2GZAA 1ZMXA 4Q4LA 2DWOA 3ZH9B 3U3OA 4ZKEA 1GL6A 5K8TA 1D8TA 1EFCA 4GRAA 3T1OA 2CCJA 2FFBA 3SDZA 1FUKA 1XNJA 2O8FB 1Q1QA 3ICQB 1NVXQ 3CRQA 5TMPA 4HZIA 4LYFA 5JWHA 2YHSA 5AUPB 3MGCA 3MFYA 4F4JA 5KSZA 5J5CA 2JJ1A 2BKUA 3VQTA 1UBCA 3TR5A 3HJNA 2WWGA 4D6PA 2OCAA 1U99A 2RH5A 4HZUB 4Q4AB 2QSYA 1VCIA 2D2EA 4KI0A 5DLQC 4TT3D 3SZRA 4BWYA 1ZINA 2P2LA 1FQKA 2RB4A 2JLYA 4TN1A 2GNOA 4LV8B 4M1SA 3SYNA 1AKYA 4BLPA 3X1YA 1NSTA 3U44B 4PZLA 1XJQA 2DWPA 2H18A 5FI0B 3TGPA 1N5IA 4V0ME 4DSNA 4Q03A 3W6PA 2XX3A 2EWWA 2RGAA 4B2PA 2FPLA 4QBGB 4X8OA 4R71A 1GITA 1Z6GA 2IXEA 1NIJA 1II8B 1JBKA 1KKMA 4PAMA 2JA1A 4EPRA 2XXAB 1CF4A 3U3KA 3BORA 1TNDA 2VP4A 4L15A 1LF5A 2D2FA 1XD2B 3I62A 3MWKA 4GOXA 1VHTA 1I2DA 1VDZA 4A1FA 2PJZA 1XF9A 1G5RA 5JHHB 4MUAA 4AYWA 2HV8A 4XVQA 3TJZA 4D0LB 1F6BA 1W2HA 1XFAA 4YQFA 1Q57A 4NYJQ 5DO9A 3VAAA 1AIPA 1E2KA 3W8NA 4E07A 3U4QA 1MO5A 2QG6A 4JYBA 2FE4A 1KI8A 3ADCA 3OHMA 3AM1A 1BYUA 3AF0A 2ZIAA 2CVFA 4LJAA 4EPVA 3FFBA 2CK3A 4URVR 1CLUA 1EX7A 1GNRA 4Q4JA 4DLTA 2MSEB 4B43A 1PV4A 3K9HA 1JB1A 1K6MA 3F0TA 4JKIA 1GG2A 2R6DA 1XTRA 5A0FA 4A2QA 2VP2A 4IOKA 3AF1A 1S9HA 3SOPA 5JZVA 1GDDA 3NDPA 4G0NA 4RCZA 5LB2A 3ZLJA 2NO0A 3KXLA 2VL7A 2HF8A 4C0BA 3A37A 2BCGY 5AUNB 1EG7A 1W4CA 1JAHA 3K9GA 4Q7JB 5CDFE 2WBLC 4Z8YA 3VR1A 3OEHD 4EDHA 2ZROA 1ZM9A 5JJIA 3CH4B 2QZ4A 3CH5A 4N0DA 3QSYA 4NBSA 4TLCA 1KNQA 4Q00A 4XVUA 2F6RA 1ZYUA 2IL1A 3KDSE 4Z54A 3DHWC 3LLMA 2C9YA 2YOFA 1KK1A 1KKLA 3CBQA 1NLYA 4LWZA 1U98A 4Q9KA 5EE5B 3IBYA 1E32A 4EFLA 1GWNA 2ODEA 2ZSFA 3R9WA 4F38A 1ESMA 4RVCA 2ZU6A 3TUZC 2RGNA 1QBKC 2MMCA 3QKTA 2GEVA 3ZZUA 5GADl 2BJWA 4G5GA 5JCPA 2VP0A 3PG5A 1H8ED 3WP0A 2KBEA 3CIOA 4BFUA 4MYTA 3M6AA 3PEWA 1SULA 1G64A 3AF2A 2H5EA 2ZQ5A 1JAIA 1SGWA 5HE8A 1W4RA 2B21A 5FPHA 1TEXA 1OKKD 4M22A 4JBXA 3WRXC 1IXSB 4LCBA 2AKAB 1GOTA 1MR3F 3IPXA 3KKOA 1EFTA 1U2RA 4V0NA 2XZLA 3BK7A 1UDXA 4MRPA 4B3GA 4URYR 4R2IA 1ZIPA 2OO7A 4BZQA 1WDTA 4DVGA 5AJVB 3NEYA 1G20E 3GP8A 2XZPA 5G53C 1G5PA 1R0XA 2Z6VA 4MITA 3AVYA 5KUTA 3GLFA 3EXAA 3A1TA 1YZTA 3H86A 1N0UA 3B9PA 2JDID 3RWOA 2WKQA 2F7SA 4W5WA 4TL8A 2V55B 3RS3A 2IS1A 621PA 4MUBA 1QHSA 2WWFA 4NCNA 5KHOC 1JXOA 5JWRA 2EU8A 1BYIA 4MKHA 3RS7A 3R8FA 4C9BA 4FMDF 2QRNA 5FR1A 4RD6A 4URXR 4OQLA 3Q5DA 1X1SA 3DOEA 1UEIA 2ODWA 3GFOA 3LNCA 4K8OA 5FL3A 1XXHB 2GAOA 2WKPA 4S35A 4QC2A 1CJMA 1YR7A 2AX4A 2ZRIA 2I1QA 3RS5A 3DDCA 2DWQA 2MMGA 3KFVA 3EAQA 2Z4RA 1N5JA 2O8EA 4P4UA 2OBLA 4YXWA 5DE3A 2HXSA 4DB2A 1TF2A 4QBFA 2O8FA 2QBYA 5H70A 1LY1A 1AS2A 4CT5A 3TSOA 1H65A 2OAQ1 5L3RA 2BMDA 2PMKA 3L0OA 3K70D 5F9FA 3AKDA 1HYQA 5B64A 1G4AE 4OI2A 5IDVA 1TQ6A 4LPSA 2ANCA 2G1KA 1KMQA 3DZDA 4IDHA 4LYAA 4NCIA 1EWQA 5DI9A 4ZV4A 3MWJA 3GEHA 1SQ5A 1XJ0A 2IYWA 2ZRJA 3KFXA 1E9CA 1P3JA 5IK2A 1VTKA 4Y0VA 4HB2A 4QJ4A 2EFEB 3Q8XB 3FPAA 1A82A 1E94E 3CX7A 1XD2A 5FTJA 1OKKA 6Q21A 2ZE8A 4OJKA 2NZJA 2QI9C 1P72A 3UWKA 3T5GA 1US8A 2ODNA 4Q66C 3UWOA 4GT1A 2QENA 2QTVB 4EFMA 2VRWA 1ZM2A 2C78A 5HR5A 1T9HA 3NHAA 2JLXA 3SJZA 1W47A 3VR3A 4KVGA 3THWA 4NYIQ 1MRSA 1VHLA 3FKSA 4TMXA 4NYMQ 2Z5FA 3LXXA 3RAPR 2ZJZA 5J4YA 2ZYUX 4KBFA 1KJZA 1OH7A 3TSWA 3QXSA 2A5GA 2BM1A 1Z0AA 1I4TD 2YINC 1SHZA 1E1RD 3D7MA 1UPTA 2WPDD 4AC9A 3BH6A 1GZSA 4JMPA 1NBME 1KI7A 2ORWA 1NVWQ 2WWIA 1W4BA 5SZJA 3R8CA 1L2TA 5EE0A 5H68A 1M7BA 3VHXA 4A4DA 3B85A 4P4TA 3CF2A 3ZJYA 3PEVA 1G3RA 4FI3C 4NDZA 2IHYA 4ZKDA 3AGPA 5HKKD 4WXRA 4B44A 1IN7A 1G8HA 1Q3TA 1RC8A 3KXIA 1II8A 4PC1A 1ZVQA 2BMJA 5F2EA 1A7JA 1J8YF 2HCJB 1GKIA 3X1ZA 1DAIA 4BQSA 4KLZA 1OXVA 1OYWA 2O0KA 3LDAA 3OE7A 4UNRA 3FDIA 2OCPA 2XNDD 1MO3A 4AY2A 1P2UA 1LTQA 4B48A 5KPJA 2H57A 4MYHA 2IUTA 2A5DA 2ZI3A 1PLLA 1N2CE 1Q1EA 1ZUIA 5SZKB 4PX9A 2WV9A 1ANKA 2ZS7A 4D26A 2Z83A 3N2EA 4Q1EA 5FFMA 3U4QB 1T6NA 3W34A 1Q21A 3HYTA 2VIIA 1X6VA 2C77A 2GCOA 4L8GA 3K0EA
chains in the Genus database with same CATH superfamily
2XSZA 1X14A 1CUVA 3H1FA 4BO7A 3RRYA 4LY9A 1CJTC 4Y9TA 4H4DA 2HMTA 4Z4HA 4K9SA 1ORWA 3EVZA 3IBFA 4U00A 2GEFA 1X92A 2YW2A 5IDXA 5FTKA 1IOZA 3FDXA 4LJ7A 3V1MA 2BFPA 3SQLA 2B8WA 2CMKA 1B4DA 1OBFO 3DLCA 4ROTA 5LOVA 5TLSA 5DH9A 2BELA 3HUEA 3PR3A 3UB2A 3QA3E 3COVA 1ODIA 1Y3HA 1JE1A 3KZVA 4HAIA 4C6TB 4PINA 2QQ5A 2CNLA 3UM9A 4E11A 1EVIA 2WI8A 3F5MA 5IVDA 5B6PA 1T1GA 3TDKA 2ZWVA 1Y5NA 2J4CA 2O06A 3ZGOA 4IIDA 1V1MB 2QP4A 2XDYA 1UC9A 4R3NA 4B8WA 1KZYC 4JP1A 3S7ZA 3OEEA 1H69A 4ZXPA 3PUVA 3TXAA 5DP2A 2P5SA 5FL7A 4CM4B 4IZIA 1SBHA 4URZR 5I7WA 1G98A 3K5PA 1CZLA 2B7CA 1SEVA 4QUBA 1F2UA 5TEWA 4BO9A 3GL9A 3NHWA 4BVHA 2BFCB 3SSNA 1OILA 1Z6TA 1DPFA 3AB3A 5TC4A 5EJ2A 3FYSA 1AKTA 3NEPX 5BOSB 1E3QA 2WABA 3K0SA 2QT1A 3MD0A 1Y6ZA 3P9NA 4IW3B 1AHHA 3RT9A 5AW1A 1OFUA 3D5TA 2QE7D 3OX3A 2EZ9A 4P53A 2G7ZA 4MIOA 3EOAI 4JC5A 3TWOA 1KMHA 1ZD4A 3OU6A 4NENA 4RD3A 4MQMA 4X84A 2Q28A 2W37A 2YBDA 2FZCA 4YMLA 1K27A 1N2SA 3G2QA 4LVNA 2PIDA 4V38A 4U6NA 4J0HA 2REOA 3IURA 1E8DA 3OF5A 4OUDA 5E4YA 3U7FB 2ZWIA 3IAHA 3HB5X 1L4YA 1RAGA 5EE1A 1MKYA 1PFWA 2OZEA 2PGXA 3TRIA 4A8JB 2Y0EA 4TSFD 1YS7A 1XEAA 2UZ1A 5TT0A 2WW8A 1ZISA 4BLVA 5DYGA 2RGGA 2EDAA 3FW1A 3K6KA 1NHWA 2HEGA 4YCDA 4HGQA 1KI6A 1D6MA 1K4YA 2EJCA 3PNSA 2PS9A 1C7ZA 2VDLB 4IIGA 1M34B 4MYRA 2JCYA 3ZUPA 1GAWA 4PHCA 1ORTA 4DWVA 2RIPA 1H2RS 4Z9AA 2OXEA 3N6XA 4JUBA 2ADMA 3HLKA 4ZODA 4A91A 1ZD5A 2CW5A 4EJFA 2VPTA 3THWB 3E9ZA 1R18A 2ROQA 3G0IA 3CB4A 3M33A 1Y42X 1VPDA 5DTMA 5DM60 1VJ0A 4G0QA 2F43B 2C3UA 3K71B 3B1FA 3A9CA 3Q15C 3F4BA 3NANA 1LDNA 4DV4B 4WOBA 2AOWA 2FKNA 5DHAA 3X2EA 4OFZA 1XMPA 2EJUA 4IRXA 3TNFA 1MZVA 3WLRA 4N39A 3COYA 3FNQA 1V5IA 1ETUA 4I1IA 4I55B 4XDGA 4FYJA 1FA9A 5HTOA 3C1OA 1N2GA 4K05A 1K86A 121PA 1WS6A 2VNSA 3L41A 2EFCB 5ITSA 2QTBA 1SBTA 4HEQA 1K8ZB 1R5NA 2YHAA 1KZ1A 3LCRA 1SXJE 5BV2P 2I3BA 4HWKA 3AHGA 4PFJA 2VNHA 4XWAA 1OLSA 3SFVA 3P9SA 2XGSA 2ZT5A 3OLVA 4YAKA 1JECA 3B38A 4BWFB 4RVSA 5IABA 4IXDA 1MAVA 3QLUC 4XQEA 3ASVA 1F17A 4RXTA 3GBVA 2HQOA 2ISCA 1SNYA 1KYWA 3LPMA 4GIBA 5FPSA 2HLPA 4AJJA 1LBEA 1P74A 3LUCA 3EQ8A 3RVMA 4QKQA 1P2TA 3U7HB 5JYDA 2VBIA 2FG5A 2VDQB 3FETA 4PPGA 1FDIA 4LJ9A 2L17A 3KR2A 2VG8A 2VQ3A 4IEEA 4N6OA 4URUR 2OHIA 1IWOA 4XEUA 5ALQA 4IDDA 4X24A 3UYKA 3IUBA 4AJOA 2QW1A 4B71A 2GHIA 2RHCA 3BICA 3H5TA 2VZ9A 4B47A 1KEWA 1IYZA 3K9LA 3W9SA 2Y1LA 3U3RA 1T26A 1U2EA 2OL4A 3QLVA 4NENB 4OQDA 1M1NA 5BMVF 2BRUC 2XLBA 1Y3CE 5F5XA 3OFVA 2CLFB 2QTHA 3CS3A 4MQFA 1RWOA 2AMLA 5ALXA 4DBLC 3QU4A 4G0PA 1PJCA 1PNTA 3AUXA 1VIYA 2DPYA 4ITRC 5HCIA 5TR9A 5AI8A 1G4UR 3KAKA 3S2SA 3DAHA 1W29A 4WLOA 5AVTA 5D1NA 5AJUA 2JLAA 3HKCB 1A1SA 4TTRA 4X1IB 3EAGA 4Q4JB 2DJIA 1WCXA 1LS6A 3VR4D 5C5DA 3K6SB 4KZPA 1TO6A 2I7XA 4KN8A 4L2IB 5C3UA 4BN4A 4YMGA 2CF6A 2CHEA 2WJIA 3BG5A 2BR4A 4JR2A 3KT3A 1Y5MA 4L16A 4MPDA 4ZVPA 5TJHA 3RRZA 4BTVA 1YA8A 2F9FA 1ZR4A 1CKEA 2YQ4A 3TGWA 4UMEA 4WCFA 2DBQA 3RREA 3RGWS 3JD1A 1E79A 4JFRA 4LJ8A 3ABZA 3QJ5A 2XNHA 4PYQA 3BIWA 3VDNB 2CKMA 4YH1A 3KXKA 5A05A 4QM6A 3HB7A 3PPVA 3WZLA 1U3DA 1U3CA 4F0JA 1E1QA 1P1CA 2WR8A 3QI2A 5KNCA 5L3SB 3EEYA 1LSSA 4V1CB 3MJVA 2G1JA 4QOSA 3GLRA 6YASA 3EXIB 4B45A 3J81A 3T7JA 1FUEA 3U49A 1IHPA 1XCOA 3WA6A 2PX0A 3GFSA 5KZMB 3VMMA 1U3TA 3AVVA 1J9ZA 2LCQA 1NVVR 4G5OA 3BF8A 4PG6A 3OKFA 4CCAA 1CQIB 1ZLXA 1IEWA 3BM5A 1WP9A 2Q5EA 1Z6AA 3EG9A 5AOBA 2W2TA 3ROZA 1JHQA 4KJZA 3CLUC 5GZ1A 3OC0A 1VIVA 3M1YA 3GP5A 4HLUC 4WKNA 1H1TA 4I50A 3B2NA 2H4HA 3K05A 3CLRD 4ND5A 1VE3A 3CKYA 4E5PA 4B5KA 4WJLA 4GH5A 4JYZA 2YVQA 5FTLA 1AVTA 4BAGA 3PX7A 1P9OA 1UBHS 5ELLA 3V2IA 3KOOA 1DRKA 1R0KA 2ZTMA 4PZZA 4YAIA 5L7WA 5KTMA 2H4JA 4JJKA 4ZREA 3GJSA 1B0UA 3ANYB 4QYXA 1GP2A 2WWHA 2OM2A 4J49A 3IESA 4NF2A 4C0HA 3OZTA 4F38A 4LDJA 4DMFA 3AYZB 1TM5E 4RZXA 5CTAA 4C0LA 2PEYA 3LUBA 4ZT4A 5CB0A 1Y4SA 3N0RA 4JLNA 4NE9A 4PXSA 5GIOE 1C8KA 1COWD 2GJSA 2VDPB 1FTSA 3BIXA 3RKUA 2AZ4A 4DDHA 3CNQS 1QHYA 4L8YA 3A05A 2DB3A 4LKRA 2IU0A 4YJHA 1ECLA 4WN9A 3VKWA 5LDDC 5KQGA 2REBA 3K8YA 3S8YA 5HFJA 3WYAA 3G5MA 2BFWA 3RRXA 1NM5C 4E4YA 4LZNA 1N2OA 2XY4A 4O5AA 4WOKA 2EFJA 4XGIA 5U4XA 2R6R1 4D0GA 4DLLA 1ONNA 1UC8A 3F9IA 2ZIWB 4N3BA 1GZ6A 2WF7A 5ER6A 5FOSA 5CHEA 4H1TA 3UEOA 4NZYA 2W22A 3D6FA 2R1VB 5H3CA 3JW8A 4A73A 1AK1A 1O96A 1X74A 1C3EA 4AW9A 1ZL2A 4E5UA 2X23A 4JYPA 4ITUA 4A6XA 5AVYA 4KQWA 5KC8A 1N75A 2XEXA 3WISA 5E1OA 1EGMB 3UUGA 3U26A 2O8DB 3P19A 1E9FA 4JGGA 2PXXA 3D7RA 2PJDA 4W8HA 2AKEA 4PR3A 3OCYA 3THRA 4L5JA 1J0DA 2I8AA 1QAMA 1CY8A 4RIIA 1B23P 4IFBA 4FWBA 2QQ0A 2GAIA 1WBDA 3BE8A 1U2DA 2ZZNA 2WJPA 5I4CA 2HC9A 2RHLA 1OI7A 3OQJA 3N5CA 1M6EX 4OHCA 1RXWA 1C1DB 4OQPA 2FWBA 2XAUA 3T3HA 3Q5EA 4ZC1A 1KL7A 2G0NA 5FOXA 2SCUB 3ESBA 3PPIA 5GVSA 5AW5A 2B0CA 4IPTA 1XWWA 3SEZA 4CLRB 2VDWA 3C4QA 3IUEA 3LXRA 3KPYA 1M2EA 2QDKA 2FGKA 2ZATA 2NADA 4B3FX 3HR4A 4JC0A 3OY2A 3UV3A 4I3FA 4INAA 1RXIA 4NAHA 2ECFA 4DSOA 3BULA 1Z4JA 3QE2A 4JA2A 2W2VA 2IIBA 4IXTA 1Z33A 5M3BA 1O96B 2ZLBA 1FFXB 2GD1O 1E89A 2AWNA 3DBIA 3EZ9A 3NIWA 1MU0A 2VPQA 4KPUA 5ESDA 2RHBA 1L5ZA 3BIFA 4OHWA 4XVHA 1LWOA 5C0OE 4CF3A 2NQ2C 2WSIA 1VE9A 3E9NA 2QTNA 4FCTA 4RC9A 5EXXA 3VNAA 1OC2A 3FLEA 5I47A 4CFZA 2UU9B 4MB0A 3JRNA 3P94A 2O2EA 4NY1A 5G0WA 2AXPA 4LSMA 4PX2A 1BRTA 1U9IC 3TZBA 2PA0A 3C3AA 2X0FA 4NONA 4B75A 3WLMA 1WUKS 3DBHA 1GNLA 3HB4X 3WXMA 3OE1A 4POAA 3TLMA 5E2AA 1JSXA 2D59A 3MWEA 1B2LA 5ADUS 3N8HA 4KK3A 4ENPA 5E6RA 1NI4B 5IT4A 2FEWB 4LMPA 3PICA 1KDTA 4NMMA 2Q2VA 3KZMA 3R3VA 4ZFNA 2I78A 4KGZA 3T41A 1U8EA 3W6NA 3H9EO 3UK0A 4WNCA 2WFAA 4JENA 2AEMA 1UBKS 1U7WA 4QHSA 5H7XA 3RUFA 4E12A 2V1XA 5BUCA 4Y2TA 5CB4A 4Q9JA 4ND8A 1V5GA 1K8XB 1AUVA 2Q1SA 3CEPB 5LQDA 1HDCA 4JVOA 4TSFA 1I30A 1M1NB 2OP0A 4G25A 4MR7B 3TQOA 2IYVA 3VSBA 2Q7OE 4DLUA 5JO9A 3TOSA 5I9TA 3DGFC 3RTAA 3R6DA 4JLPA 2G5TA 4JLBA 5KDOA 6REQB 2UYQA 3WVNA 3U4GA 7ABPA 4FB4A 1Z5VA 4ND2A 1RACA 2D1SA 2ANBA 2EKBA 1XLTA 2IXAA 5AJWA 1TIKA 5TPWB 1DKNA 3WDLA 2CVHA 2D0IA 1WMSA 2QYSA 3HN7A 4TTQA 3KX2A 9ATCA 5AO9A 1PR6A 4FMPA 5AP9A 3P9YA 4WV3A 1GQQA 4JI3B 1V3TA 3TW8A 2OCXA 3P2OA 1Z0KA 5LB4A 3W6OA 2ZQZA 2Y93A 4M9UA 5EZSA 3PQEA 3A9RA 1B42A 4IGKA 1O9GA 3HDGA 5ILQA 2ZTSA 3AL0C 1XZQA 3DXZA 3ET4A 3I6IA 2VRCA 3OD1A 4FYYA 3SIPA 1GPMA 1OXUA 4G8BA 5JLJA 1JIVA 2QRUA 4LK3A 4YB8A 5B6IA 5JS7A 3TSZA 3DV2A 4QBKA 1KQGA 5H9WA 1D03A 1GZVA 1UWVA 4K9DA 3S1AA 5KPDA 3P9IA 1UL1X 3GAAA 1TA4A 1LCIA 3C48A 1LDGA 3C15C 2NMVA 1N2CB 2R47A 2WWXA 2X1HA 3STUA 4D6XA 2WM8A 3QU5A 5TS2A 4H7DA 1WZIA 3PNMA 5DRTA 1OW3B 5F1PA 5FBQB 3T38A 4FDAA 3ZGNA 2C9DA 5TMDA 1Z56C 2FEMA 1Y98A 4PBTA 1BKYA 1A71A 3SCZA 4YRCA 1LI7A 3AGQA 4JJGA 4IDQA 2IOQA 4GPBA 1ESZA 3HP1A 4F7WA 3L01A 1U0FA 3PVZA 5C4IA 4DNQA 3G8AA 3DBVO 4PRZA 2JLBA 4YCLA 4UU1A 4IUBS 2O7VA 4HXFB 3WGUA 4R5MA 1MXFA 4ARZB 1RHMA 1F3LA 3DMPA 3M0EA 2PH1A 3KB2A 4M7PA 4RLFA 1JEDA 3MQ2A 3FI0A 4W9NC 3BSYA 3UUFA 3DW1X 2LCFA 5HILA 2BM0A 1KPIA 5EZQA 4YK7A 4EGSA 2OB1A 4LFCB 2QAGB 1RWNA 2PYDA 4JJIA 2VP3A 3AJ8A 3B3QA 2GCNA 4IIXA 4DMKA 3E9YA 5KNBD 1DC4A 1RZ3A 3I0ZA 2VHCA 4YIHA 1QZXA 3UHJA 5EKDA 4YP1A 1SPXA 4CNBA 1B8VA 2H16A 1KDYA 4E1AA 1KMCA 1XHFA 1LD3A 2HRQA 3EHDA 3ZLVA 1QONA 3GX1A 1F9AA 2V9CA 5AKKA 4IIVA 3AW9A 4IIHA 4NZZA 1RFLA 4Q9AA 3LPNA 1NPDA 2GN2A 2I8LA 4DV1B 2G5GX 3C5WP 1VJGA 4D3XA 1P62B 3KSZO 3L5OA 4LTMA 1J23A 2YXNA 5D8DA 9MHTA 1NJ8A 4GEKA 1IM8A 2QKYA 1NQTA 3QW4B 5MN5A 2E6KA 1TTTA 4N54A 1I3CA 1QOPB 1YKGA 1UT5A 5A9RA 3QVGB 2CB0A 2GAJA 1PAUA 3H2YA 3RYFA 1S3GA 3M2TA 4FHCA 1R4NA 3OE7D 3TPFA 1YRLA 2ZS9A 1CE8A 3UJDA 3W04A 1RTKA 1IUKA 1GUBA 3AR7A 4WQMA 1W5FA 1H5UA 2CDBA 3A3PA 3AHCA 3MLAA 2HPAA 3W2HA 1IMJA 4F12A 4XM0A 2I6XA 3KM0A 1U7PA 4IVQA 3VR0A 3GOHA 3SZOA 5DHUA 4BLOA 1V37A 2IU3A 2FFRA 3LW7A 4MUJA 1PS8A 1C3JA 1XZDA 3BRQA 1RYMA 3HWX1 4NFLA 5D86A 1YJAA 2HUNA 1W0KA 4R7TA 4CM5A 5F9MA 1P9WA 1FS5A 2QT0A 2ONJA 5JW6A 5KBYA 1X15A 3VKGA 4IDPA 2XQIA 3V8BA 1QHGA 1CK4A 4P8RA 4EM6A 4F8YA 5E1BA 3O83A 1J99A 4TKMA 1T0UA 2J3QA 3P0RA 2PMCA 3F8TA 1ZUD1 4R8RA 4S0ZA 4FTWA 1NWCA 4K87A 1NT4A 3BDAA 3O4JA 3QIAA 1Z39A 2W6IA 2ZPUA 3IALA 5AVSA 4BE9A 4R9VA 1RPAA 3FFXA 4EOGA 2FYTA 4CIAA 1PQ4A 3NZEA 1IZ7A 3IELA 2G1AA 2QMUA 4Y2VA 2F67A 1EQ2A 3EEBA 1JXAA 1RWKA 1U4OA 3QU2A 2P3SA 3VR4H 4HX2A 2ERYA 2FN3A 3EZ2A 2AJLI 5DSXA 3G7NA 4MO9A 2CSXA 2W42A 2JB9A 2VDRB 2XYQA 1VPVA 4M1MA 4UD2A 2V9PA 3T9AA 9GPBA 4F91B 2LBPA 4O4JB 1F5NA 1H8HA 4P3OA 4QD3A 3UXHA 4J3FA 3Q2OA 5DV9A 5JROA 3GJTA 1GTL1 4ZO9A 3WIUA 4P7JA 3GB9A 4BNHA 1LBHA 3QUQA 2HA6A 4N9WA 3VVLA 2VSYA 1L4MA 1NNSA 5BW6B 1GRRA 2C0CA 4U3JB 5LQMA 2Q27A 2Z8XA 1A69A 1JTFA 3QEBZ 4R98A 3ZU5A 4JI2B 4H17A 4NOLA 5KX5B 2OZLB 4EI7A 2NTJA 2DR0A 1RTTA 3PNYA 1EZZA 2P2YA 2Y4OA 2JFXA 3TNDA 3UJ9A 4QBHA 4U7JA 3KSMA 2GPTA 1OASA 1J20A 1E5QA 1GFZA 5TF4A 3G02A 1FLNA 1T9DA 1VKZA 1FNBA 3W9UA 2O5CA 5L3QB 2ZULA 5FEMA 1KVRA 1T4GA 3PA6A 5H16A 2EKDA 2RH8A 1MDFA 5JAOA 1RQ7A 1WCV1 2OCLA 2GXSA 2ZVPX 4PQGA 5K0EA 1JEYA 2E48A 2PQ6A 4JK3A 5LM3A 1QMPA 1ELOA 1T4CA 1UKEA 4FT4A 4C20A 1XU7A 4ZV9A 5HA5A 1KHTA 5KEIA 4KG7A 4UUMA 1QIHA 5LMUB 4TKVA 1I8TA 3TINA 2W00A 2VN8A 4PLYA 4YT5A 2I1VB 2JS7A 3ZV4A 4QDUA 5KTKA 4TTTS 3ENNA 4NJEA 5HF6A 2WJHA 5I8PA 2Z1MA 4HWOA 3QVTA 2ASEA 4YMIA 2UXCB 1RAAA 1Z5GA 2VDNB 2ZDGA 3EFBA 3LCJA 4JLWA 4LBYA 3U9LA 3VO1A 3WYEA 3AU8A 3G9UA 2FCRA 4IYRA 1ZMBA 4ON9A 1O0SA 1ODFA 4IUCS 4WKCA 5K3CA 3QVVA 3Q7QA 3MTJA 4B6FA 4NIMA 2HWXA 2BGIA 3ABIA 1ZI6A 1I0LA 4MS3B 4BVEA 4D5EA 1ML3A 1YB4A 3ZLTA 1P6QA 3WMGA 1NVEA 4K9MA 1WU8A 4XWWA 4BNJA 2MSCB 2R7NA 3AJDA 2ZCVA 3IYLW 5CFLA 3V4SA 4GKJB 1E3SA 1NL3A 1XDBA 3MB8A 4H9GA 1NQ5A 1OWNA 2WB4A 1PLJA 2VWPA 4MKIA 2IHNA 4NH4A 2WJWA 3N1UA 4KWEA 1DC5A 2HDNB 1H0RA 4OO3A 2EFHB 2IEYA 3GVHA 3KLNA 3HKDB 1LKZA 3P9CA 4I4IA 3DE7X 5F7XA 4CMIA 4R6WA 3FOEC 1H2HA 4NS1A 1VIDA 1OH8A 3AUUA 4O4LF 1VLVA 1AG9A 1MO6A 1PR0A 1WNTA 2C3PA 2OKCA 1B76A 4FXPA 4KVZA 4RHXA 4YFYA 1B6SA 4XGNA 1I7NA 1N7IA 1CQWA 1XCLA 3AJEA 2PZBA 2V7XA 1TIBA 4DV3B 2E4VA 2HTEA 1UBGA 4ZCRA 1A9RA 1S5PA 3HABA 4HAYA 3CNHA 3ZDRA 5C2JB 2D5BA 5DSZA 1G1AA 4G3XA 4R16A 1BMFA 2YFYA 4OHVA 1N32B 5LMNB 2GEBA 2ZBGA 5CCEA 1VA5A 1RZRA 5EPEA 3MCTA 3LHFA 2IXFA 3F5QA 1AK2A 5EXPA 4C05A 2OHGA 2MINB 2QX7A 4HDRA 3VAYA 1E4EB 1TX4B 1XL0A 2C96A 2H5IA 3A1EA 3A31A 3EPRA 3NTRA 4LVUA 1YSCA 3AR4A 2ZRBA 3GLIE 3CYFA 3HR7A 4NCXA 3S2EA 5KI6A 3LW8A 3BZWA 5BSHA 1WXQA 3TLBA 4I5GA 4R2HA 2HQ1A 2ALJA 3QV1A 3VX4A 4B81A 1R0YA 2QJRA 5ETJA 2WIBA 3B89A 1R16A 2VQSA 3PUHA 5AXCA 3CG0A 3GMDA 3TLKA 5KSYA 4C2UA 2JFFA 3ROKA 3NIGB 2H8GA 3BGSA 2W2OA 3G68A 1MB4A 1OLXB 3HP7A 4UHBA 2IUEA 2E0IA 1S3SA 4MAFA 5CT6A 1HNZB 3TW0A 3FYHA 3NWJA 1A5SB 1AM4D 4PW0A 2B4YA 4E4RA 4EZBA 4NICA 1XZGA 4G07A 4EG3A 2Y9PB 2L82A 2ZJ8A 4V0SA 2RGBA 2P40A 3UJHA 3E3NA 5K09A 2YXDA 3BE5A 3TUJC 3W8EA 4DZRA 2ZM5A 3QFSA 1XZJA 3AI3A 2XGMA 5IZCC 3TAHA 2ZR7A 3K0AA 4IL5A 2PFGA 4WIAA 3BE6A 4RK0A 3H19A 2FPOA 3CW9A 5COBA 2ZWOA 4FCVA 5ITZA 2B61A 2QAGA 3H2BA 1V11A 3HNOA 5IC5A 1YU6A 3A1VA 2EQAA 3ZV7A 4JI0B 2H11A 4P31A 4MKGA 4R6XA 4ARZA 3KJIA 4U9HS 3EH1A 4I1VA 4INJA 1LGYA 2VOEA 2DFKB 3I2FA 4LJYA 2AQ8A 4CI9A 3MJHA 3CTMA 2P9BA 3PXUA 3FZEA 3Q85A 2NVBA 2XCQA 3CE6A 3I39X 3T7DA 4MJLA 1CPYA 1IAQA 2XDAA 3EPHA 1XKQA 1FMJA 2WHYA 3LXUX 4QUKA 2YRXA 3B9BA 3E9CA 5C52B 3IV7A 2Z08A 4LX0A 5AVRA 3D3KA 1OA1A 1JAXA 3IMEA 2I54A 2XNDA 3DZIA 4FFMA 4BTLA 2AXQA 3I92A 4O4IB 4NYMR 2NSLA 2PIAA 4CEHA 1N6RA 3I30X 3T9EA 4B46A 2JJ2D 4PGGA 5FULA 2JHFA 1JKJA 4MRMA 4WZBB 2WKWA 3BJIC 3PGVA 3F47A 1VP9A 1IBSA 2FSPA 2ZYWX 5DMXA 2BEWA 1IVYA 1Y1SA 4CNQA 2FDRA 1LUAA 2X2PA 2JGRA 1QH8A 3DXYA 3GD7A 2QRGA 3BPSA 1GL9B 4J1NA 4HH0A 3S1AB 4JLMA 3U3XA 3AO0B 3KKNA 1HSOA 1KGSA 1YULA 3CZQA 1DGQA 4BU1A 4UTXA 5FTNA 1UBUS 1XTUA 3GQVA 3A6HA 3H6HA 2FZKA 1KK0A 1Q16A 1Y3FE 2FE1A 2PH5A 3N7UA 3L8CA 3GI1A 4GBED 3FRIA 4W7SA 4B4DA 2B82A 3ZZ1A 4B6EA 4TQGA 2VCEA 1QYRA 4QZVA 3RYIA 3PF9A 4IICA 5EGSA 4TQ9A 4M8SA 2B3TA 4WL0A 4BIIA 3KT0A 3M6IA 1DLIA 3HB9A 3D54D 4UBIA 4DB4A 1BJTA 3EZFA 1D2MA 2N47A 5BNIA 7AT1A 2FRXA 3DM5A 3O8OB 1OMOA 2JA2A 4CRWB 2RSLA 4MV9A 3ENWA 3ZNOA 3BK2A 1RXYA 3GJ8A 3QEOA 4R41A 3QLVC 3C3YA 1N8SA 4HMQA 3FKJA 3OIVA 4WX2B 4PRLA 4WNAA 1VGVA 1T2AA 4ZK2A 2WLSA 3ANSA 5GONB 3A6PC 2O48X 3HFRA 4O63O 4YONB 3RAGA 3B60A 3OTQA 3PWSA 1JPNA 3HM9A 1DO2A 3CVVA 2IPAB 4CMJA 3KUCA 4QL3A 1SHKA 4X1KB 1Z28A 5E0OA 3JWJA 5LLSA 4CQLA 4O3FA 2BFOA 1FJXA 2SCUA 4O25A 3CZ4A 3JQEA 1USUA 4BJHB 3SG0A 4ZPJA 1E0SA 4BGEA 1C3VA 1IEVA 1OLUA 2V6FA 3A27A 4KBGA 5REQB 4E14A 2C9ZA 1VYUA 2RGEA 4Y1FA 3BA1A 2E82A 4RJ2A 5FUWA 4OI1A 5IH7A 2AEJA 3ZJ4A 3FRHA 3MAAC 13PKA 3O9ZA 3MS7A 4U7TB 1UF9A 2QUZA 1WSBA 2CNNA 5AHKA 1QH1A 521PA 3AR3A 4ZHQA 1T2EA 1X1TA 2H2IA 3B1YA 2VUSA 1VA4A 3B6IA 4WLNA 1ZRMA 2A1TR 2GYYA 3BWXA 1ZFNA 5AOAA 1TQDA 3DFFA 1GADO 2N46A 3FMOB 2GEDA 3H0KA 4QWMA 4OAQA 2D8AA 3UKDA 2DC1A 1EWRA 1DIOB 2EX1A 5EIXA 3NPMA 4KREA 1U2PA 2AFVA 2NO6A 4XD7A 2A5LA 1GCUA 2IKQA 2PBFA 2E7ZA 3C3BA 4Y2UA 4E51A 2LVBA 4HDAA 5GAJA 3E1SA 3WMRA 1YS2X 2J0UB 3C3PA 4NVRA 2H51A 1Z62A 1K9VF 2B20A 1E2LA 2GZMA 1RJDA 3H5LA 3WYBA 1VI2A 1WZCA 1DRVA 4PQRA 1K88A 1QFYA 5BO5A 3W6UA 2EKQA 1JX6A 2V6MA 3GUZA 3V46A 1OTHA 4DIUA 1IY9A 2FU5C 2Y05A 3IDSA 4ZRNA 3LRPA 3EIEA 4Q9DA 4TT8A 3TJRA 1W0JA 1RAHA 1C9KA 4BRWA 1E96A 1Q19A 4MOWA 4RPGA 1E2MA 1H1DA 4DA9A 2R1UA 3BRCA 3FI9A 2EAUA 3BGIA 3NNNA 1QAOA 2WYHA 4Z6KA 3ZCRA 5M7EA 4IX9A 2PO5A 2D7JA 3E3OA 3KYIB 4RV9A 3CX6A 4KQ9A 3REOA 3LL7A 4O4LB 3BH0A 1N33B 4R0MA 3DYIA 3E23A 3QXCA 3AEZA 1EEXB 2VYVD 4X85A 1L8AA 5HDBB 4V0OA 3NHMA 4LE1A 4ARAA 4BZXA 6ADHA 3GRVA 3GJXC 5HYVA 4P35A 3HDHA 1ULSA 2B25A 1Y63A 3E22A 3IT1A 3OX1A 3EVGA 4EYKA 1NP6A 4QPCA 2OLEA 4GKBA 4TQAA 1SKAA 2KX7A 1JPUA 3CKMA 1X1CA 2UZIR 1I2ZA 2OHXA 2HAEA 4HADA 1XZMA 5A2QA 4WZAE 3LQKA 1TA0A 3HO6A 3RS8A 4DRXA 1ENYA 4HYYA 3X1WA 4YT4A 4DV5B 4AKIA 4JB2A 2DLCX 2IOFK 1UIRA 3EXHB 3F96A 1P0CA 3R0VA 2JGDA 2K2QB 3HWRA 4JEMA 4IIFA 1V9SA 1TK3A 1Z35A 3C4VA 4MVJH 4BO6A 2ZUWA 5TDHA 3RC7A 3TVTA 1M6YA 3WWDA 3GRRA 2NP7A 1VB3A 2HNAA 2RGNC 1FNSA 2TMDA 4PX3A 4R2MA 3RIYA 4TM8A 3DMDA 2Q8QA 2DY1A 3I04A 5E6UB 4TKUB 4CCYA 1CNMA 3NVDA 2CZGA 5IJ0A 4KSCA 3U7EB 1V48A 4HTAA 1C4WA 5HZHA 1EDBA 5F5LA 1R9NA 3O6VA 3GIWA 4R1OA 4TMZA 2ZGVA 4RYDA 4RTJA 4E5YA 1NOJA 2PLAA 4BEBA 4FQ5A 4ZICA 5A7GA 1QYIA 2C99A 1N9GA 1BMQA 1YZKA 4YRRA 1R4MA 4PZEA 4CLEA 2UZAA 2HUPA 3FVRA 4P5DA 2OPHA 1H22A 2F3UA 4IWYA 4U2GA 2GN4A 5ECYA 4DIFA 2VP5A 4NMXB 3U9SA 1W36B 1PR2A 1G8GA 1UAGA 3CPHA 2Q5IA 3ILYA 3ORRA 3PUZA 3Q1LA 2XBUA 3SYMA 3F7TA 3X0DA 4B2LA 5C7OO 3EW7A 5JBQA 3WJ2A 2CDCA 3NNDA 3I1JA 3OJCA 3B1XA 3HJAA 1DKOA 5SYMA 5KKAA 5DU2A 1GRNA 5IUKC 3NBAA 3R0ZA 1Z18A 4P58A 3VNQA 3E9MA 3I09A 2A35A 4O08A 2IZ1A 1TJ4A 1EH5A 1U3UA 1FNDA 2V3VA 3GNSA 4XIYA 4BC1A 3IEPA 4HDKB 2JIPA 4UXJA 2XSZD 3WKBA 4KQXA 1AB6A 1CUGA 5BR7A 2PMFA 2X1LA 4HNGA 3ESRA 5K0NA 2HRBA 1T3GA 1KO7A 1TU4A 4OI4A 5AUOB 1HO3A 5FXMA 3TZCA 3WB1A 3CWZA 2LZ0A 3LC1O 4BKQA 1ZAKA 3TN7A 4BX9A 5A9TA 3DT6A 4EF6A 4S1VA 1PUXA 3QG5A 4GVPA 3WYFA 3TNYA 1MABB 4G23A 1JIJA 3LWZA 3QHAA 3OEED 4ZHSA 2IA5A 2ONYA 2XTZA 2AOUA 3HI6A 4IIYA 3ZD7A 4F9TA 2BHLA 1VHQA 2VAPA 2ZRCA 3QV2A 1WMDA 2XUKA 2RG1A 1V8BA 4MHOA 5DHFA 4A03A 2PQ2A 3MWLA 4JL6A 4F8EA 1J0XO 4UDNA 5LA6F 1WW3A 4CMBA 2FP3A 4QDTA 3KNZA 4R5HA 3KCQA 1YHYA 1WMAA 5K4HA 5B3JC 5DI3B 3DZKA 4ZO7A 3MRTA 3DH0A 2X2EA 2C2ZA 2EHDA 4WN3A 5KMGB 3FMIA 4D46A 4J6EA 1G3UA 1T91A 2H31A 3KHTA 2AEEA 1NBEA 3ZBQA 3ZBPA 5EE9A 4L0QA 1C30B 2WZDA 1PDOA 1IXKA 1BX3A 2BEUB 4GWGA 2ZJ1A 1XAGA 4MMYB 5DLYA 3W5SA 3W8FA 4B74A 1RPZA 2V8OA 4C2TA 3IAXA 1WQ4A 1XXHE 5CK4A 2A33A 5IAGA 2MCFA 4RGVA 4JLAA 4YP5A 4MKXA 4EMUA 3PD7A 2GCOB 2NVUA 4Z0PA 4HT3B 4DV6B 4MZXA 1EM8B 3WKCA 4HGZA 4IFTA 4QOJA 1PCXA 5GQSA 2V7GA 3HDTA 1MF7A 5JJKA 2KLHA 3CF0A 3ADBA 1YRYE 1QDLB 1JIKA 4NZ9A 1T8UA 3LL4A 4AULA 4PM4A 3A1NA 3OA0A 1L1EA 3T99A 2LP4Y 3RAEC 1DKQA 3OCJA 1JP7A 2OCBA 1X3SA 3PP8A 1J07A 3U5ZB 4LF6B 2JKVA 3FSGD 4J0CA 4DY4A 1RVV1 1QIEA 5T41A 4MIKA 1BE0A 3TBHA 2VP6A 5JZBA 1CY1A 4M6WA 5AI0A 3WNCA 1A7AA 2A57A 1XZNA 2CLLB 2QXYA 3DQZA 3HUDA 3CURA 2KPOA 3V9AA 1C1HA 2QLNA 1V3UA 2IYSA 3DKKA 4QFMA 3U6KA 4UE3S 2FFQA 4EP1A 3DNPA 4Y6OA 1GYQA 1WVIA 2EKPA 3C97A 2PPVA 3ESZA 2BLLA 2IHUA 1OVGA 3NEJA 4XQ0A 2VJOA 1O8CA 3B7GA 1TVKB 3G5UA 4FZRA 3OE5A 4J91A 1T29A 5IZCA 1MQ9A 2QI9F 4PG8A 5CD9A 2VO1A 5IT9A 3IC5A 1GSAA 2BW0A 2BGJA 1MQAA 2KMLA 3JQPA 1UXKA 4E15A 5C7IO 4W5JA 4GW3A 4YN3A 4AYXA 1SIBE 2P3QA 4XWKA 1QHFA 2F90A 4PYJA 5CPBA 3ZU6A 1NP7A 1HT3A 3I5XA 1RT9A 5KJFA 4PO3X 3V7NA 2F9MA 4F5WA 1E7MA 3AONB 1M2NA 2GDJA 3K20A 3DHNA 5BNZA 3CGGA 3VOSA 3ZZTA 1EB8A 4JHLA 5J5AA 1NP3A 1XZAA 4PONA 3PNKA 1R8YA 3NBXX 3KOYA 4FS8A 1JFFA 4FNAA 2XNKA 2XYGA 4ONEA 4WOJA 5DW3A 2C92A 3HL4A 3UC5A 4AMBA 4C21A 1P5JA 1Y1PA 5LQUA 3RWMB 4DQUA 1SU8A 4TUYF 5DP1A 4I4TA 5FUQA 4HUQB 3H5WA 3QLJA 3V8NA 1RWBA 2DQYA 3R3HA 3PDHA 3RIHA 1NBAA 3H8WA 1CR4A 2Q9CA 1GG5A 4MV0A 2JHCA 3D2BA 4QDZA 1NR7A 4J4TA 4MS4A 1ZICA 1RNLA 4WNYA 5DGHA 2FK7A 4D0NA 1I4LD 1ST2A 4GYYA 4ZAWA 4HRAA 1XAIA 1W76A 2O8CA 1KJ9A 2YVUA 1R8JA 2EOAA 3EUFA 4EX7A 3M2PA 4LNUA 1JWLA 4JAVC 1IMOA 1GQYA 2OAGA 4NPHA 4FR2A 1D4OA 4QARA 3N2KA 4ZEWA 3PJRA 3R6GA 1CX9B 2A4KA 5T64A 4DDMA 4BFLA 4RSRA 4RV5A 2GM4A 3SKYA 3OP1A 1QO9A 3EUEA 3DCNA 3PC7A 1PLKA 3QKUA 3ZU4A 5B7NA 4HLNA 4Y9DA 1EVYA 5LBUA 1P7PA 4ARSA 2I6FA 4XX0A 3TFQA 3KR0A 3FNRA 3RC1A 1ZOPA 2GA8A 1VFPA 3FPSA 2VA9A 3VI4B 1E2IA 1O08A 2RK4A 2H2DA 4Q3LA 4YCSA 1UBLS 4R9SA 3J81k 3NJ4A 1WOYA 3E22B 3R24A 3DPIA 2D2VA 4HH3C 4BP9A 1XP8A 4TTAA 2XMSA 2EKZA 3PZBA 2AF4C 1I2CA 5KOJA 4IUDS 1UJ2A 2K5UA 1W0KD 1T8WA 4Q4CA 1QJ4A 3FMFA 5JS6A 1PZHA 3ND9A 7REQB 2UXBB 5CIWA 1D5WA 3UVEA 2HDOA 5BWLA 1MC4A 2E5WA 1Q77A 1L8QA 2GM5A 5JNSA 3W5BA 2P1RA 2I03A 3ASUA 3QVXA 1X7XA 1A9YA 5EP4A 4CU2A 5A5EA 1PKXA 3V4PB 1PJ2A 4KIGA 5AH0A 2CNOA 2P2GA 1IZ0A 4YV2A 3DO6A 1CEQA 5SZHB 3VUEA 1MIHA 2ZRNA 3D7LA 1RHJA 1R8SA 1Q92A 1IDN1 1W4AA 2P78A 1VZ3A 2QM0A 2V7VA 2XPCA 2Z57A 3OZ7A 4U8GA 4U9UA 4IM7A 1W73A 3I5AA 2YV5A 1GDTA 4YP0A 4X45A 2P9CA 3D5QA 2VKQA 3TZLA 3Q3EA 4K6KA 1TQ4A 4XIJA 1GL7A 2J67A 2VJLA 1M