1UB4A

Crystal structure of mazef complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
110
structure length
103
Chain Sequence
VSRYVPDMGDLIWVDFDPGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MazF protein
publication title Crystal Structure of the MazE/MazF Complex. Molecular Bases of Antidote-Toxin Recognition
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 27
structure length 103
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ub4A00
5CKBA 2MF2A 1VUBA 3NFCA 3VUBA 4ELZC 1X75C 4VUBA 3HPWA 4OF1A 4MZTA 4HKEA 4MZPA 3JRZA 5DLOA 5CKHA 1UB4A 5CQXA 5HK3A 5CKFA 3JSCA 5HK0A 5CCAA 1NE8A 3TCJA 5CK9A 4MDXA 5CQYA 2C06A 2KMTA 5CR2A 5CKEA 4ME7A 4ELYC 3G7ZA 2VUBA 4MZMA 5CO7A 5CKDA 5HKCA 1M1FA
chains in the Genus database with same CATH superfamily
3BW1A 5FU7B 4J9BA 2BKDN 1FMKA 2CREA 2K9GA 2MOXA 4PJOC 2YHTA 1VQ6T 2MWPA 2VWFA 1M2VB 3QPHA 4JLIA 4C8QF 2SRCA 2DXUA 2FB7A 3CCVA 1BCMA 3TREA 3P8DA 3JB9H 2GBQA 4HCBA 2LCLA 1VYTA 1IZ6A 4QT7A 4KRTA 1PC0A 1UJYA 1NEGA 1N27A 1MV0B 2HEQA 2HMAA 5C0MA 1ZUKA 4QVZA 1N9SA 4WTOB 2P84A 2RQUA 3VUBA 3M4YA 2XHCA 3JCMV 1QKXA 3CCQA 1NBEB 4M78E 1BI3A 1YN8A 4ESRA 3U23A 3QKJA 3CC4Q 3MP1A 3REBB 2QA4Q 3CMAQ 1X2QA 1ZQ1A 2C0IA 2J6OA 1I0CA 3TEEA 1PD1A 3J81E 2DBMA 4NL2A 2OTLQ 4R56A 1TG0A 1RAEB 2DZ9A 2OX7A 1VQ7T 1YCYA 4HVUA 1YJ9T 1B7TA 2VGMA 2DL3A 4HA8A 5GAMf 3NHNA 1JJ2P 1W2BA 2DK3A 4BY6C 4X1VA 1Q7YR 2KBTA 1K1ZA 2LTOA 5DY9A 2KRNA 5GANh 3S3OA 3URGA 4AFSC 4HCKA 2HKQB 3BY7A 3H0HA 4RTYA 1RAIB 2MK5A 3OS5A 4LNPA 2RQRA 4XU2A 2EQIA 2K2VA 3PMIA 1YJWT 3OB9A 5FROA 3EGXA 3CCUT 2DNUA 2V1QA 1YIJQ 1ZHIA 2QXFA 2OAWA 4J9HA 1JU5C 5J26A 1XNIA 2EKOA 1K76A 4M7DD 4LD9K 1WXTA 2KGTA 4FW1A 3MEWA 3RESA 4ATOA 4ELYC 1EX4A 2EGAA 1VQ8A 4EDUA 1X75C 4RKUE 3RKWA 5KH6A 3E9FA 1WLPB 4LDXA 1WFWA 3VRZA 3H0IA 3OS2A 2A3LA 5FU6B 1VQKT 2ZCFB 1SRMA 3A5ZB 4C92F 1X01A 4XU1A 3Q1JA 3I56A 1JXOA 4GLKA 4R55A 1MNEA 2C0TA 4IUPA 1AOJA 1WYXA 2CZ7B 2QAZA 2QQAA 3CCJQ 4M75E 2KROA 3OW2A 2XI9A 2QQ9A 2AHJB 4M77E 4C5EA 1W70A 3A8GB 2CH4W 4OMLA 3CD6Q 1NJIU 3CBOA 3HL8A 2PU9B 1M27C 1S72A 3GF5A 1KQSA 1T3LA 1RUWA 2W0ZA 1Q82U 2MAMA 5KCHA 1YITQ 1Q7YC 3G6ET 5KYXA 5FLXE 4C8QG 4PJOE 3WVEB 1VQ4A 1IGUA 3V7RA 1GL5A 2HL3A 3M54A 1XTDA 1Q95G 1M30A 2DPPB 5LJ3h 2XKOC 4BI8B 2DX1A 3R6OA 2EQMA 3I56T 4J6WA 3EGXB 5GJVB 1WJRA 2X3XD 3M0RA 3QJYA 2DIGA 2DF6A 5GANj 3JCMJ 1MMAA 3V8KA 4DEYA 2QI2A 3CXCP 1UGSB 1OV3A 2BZ8A 1WX6A 2EJ9A 2YRDA 4LUDA 1CSKA 1G3YA 2HD0A 2EQUA 2K3YA 1QVGS 5CKEA 4ME7A 3QZ5B 3C12A 3OYCA 1OEBA 4M7DB 4E7JA 2DD4A 2QDLA 2Y90A 1S72T 2EKHA 4EPCA 1YJNQ 4BE1A 1GFDA 1B34A 5CKFA 3CMEA 1N6AA 1VQNA 2ROLA 1GFCA 3H41A 1KIKA 1K73U 2O9VA 1I4K1 4Z02A 3JCMc 4PK4A 2H3EB 3TQ7P 4XTUA 4N0AC 2M0OA 2WACA 2RD1A 4J8OA 5FU7C 4AG1C 1PM3A 3CC2A 3VS5A 4RCBA 1EIFA 2K79A 1UGVA 2X35A 1Y0MA 4DQ2A 1B3QA 5DLOA 4QQDA 3M9QA 1UB4A 3X24B 3PVLA 1FX7A 2ZPFB 4DBRA 4B6MA 2L89A 1M8MA 4ANJA 1VQOQ 3JCMW 2VV5A 2PZ1A 3OYNA 3VS7A 2ZPEB 4FIBA 3SHWA 3A1PA 1QW1A 1M9SA 5KYXB 2NLUA 1WXUA 5J3BA 5GANd 4OGCA 2EGEA 3CCJA 1PKSA 2J06A 3CCRA 4DOVA 1G2BA 1AWWA 2CZ1B 2KRMA 3S6WA 3IQLA 5GAOn 2PTKA 2X4XA 4FT4A 3VYGA 3CMET 2KAFA 3ME9A 2F2XA 5IXFA 2P0QA 1OQKA 1VQ5Q 3BFMA 1YI2A 3V8LA 4IKFA 3LGLA 2KEAA 3OMGA 3OY9A 3JCMQ 3MCAB 4KGVB 4C8QD 1DJ7B 3EHRA 1X69A 5IHKA 3A8HB 4JRPA 3CCEQ 5LJ3j 1AWOA 2EQKA 2QEXA 3E9GA 4OMOA 2E64A 3UDCA 2LQNA 2X4WA 4RTWA 3M0PA 3ZL7C 4ZN1A 5FWCA 1I8FA 1B34B 5GAN6 2COWA 1IREB 1Y07A 4OVAA 1N9RA 1K8AR 4D6WA 3EH1A 2FZKB 3VV0A 2HL5C 3QWYA 3CQTA 2LZ6B 1NG2A 2PUKB 3UWNA 5A2QE 4PFZA 1FWZA 3SDZA 2ZAEA 3RKYA 1VQMA 1NPRA 1R0CB 3REAB 1WNLA 1YI2T 1YJNA 4GBQA 2O2OA 5FU6C 1ABQA 1G3TA 5GAMh 1E6GA 2QEXT 4LDYA 5M9OA 2ESWA 4FM4B 4Z8AA 2XMFA 3QBYA 4M78F 4CI0C 3I55T 5LJ3d 3V8JA 2D0NA 2R5MA 2RPNA 4O6JA 1TS9A 3CC7T 2KE9A 2CS7A 3ZEHA 4F14A 2DLPA 1Z9QA 2JT4A 2CSIA 2LP5A 1KD1C 3CCLQ 1IGQA 2OAUA 4M7AE 2GQIA 1XOVA 3RBBB 1Y7XA 4BDZA 3OYJA 2RJFA 1VQMT 1Q86U 1BYMA 4AFZC 2DZCA 2NYSA 4C92D 4C8QB 4KUIA 3L2QA 2FRYA 3E1SA 1OU8A 2FVUA 2O01E 4HCZA 1K8AC 2R5AA 2AZSA 3ER0A 1VQ5A 2P0PA 1WJSA 1ZA2B 4QQGA 2EQJA 2LT4A 1VIFA 2EGCA 2KDSA 1MGQA 4C92A 1YJ9Q 2BUDA 2L3QA 2RMOA 4JUVA 4HT8A 3PGGA 1H3HA 1K9MU 1NPPA 2V8KA 3VUZA 3LGFA 1KJWA 3CCVQ 1YHQA 4V2SA 3H9NA 1I5LA 3L2WA 5GAN5 4JRIA 2KT1A 4PFPA 4M7DC 4HKEA 2DXCA 4OB3B 1TH7A 1UJ0A 4OMQA 3HPWA 2DYIA 4DOWA 2E4HA 3F70A 2HQHA 3QWXX 4YTLA 3JAME 4IIOA 4J6YA 2CDTA 3I35A 3J80E 3LW5E 5DM7R 2OJ2A 3OW2S 2RM4A 2RK1A 5LJ5g 1M1KU 2CP2A 3PIPA 4M75F 2HKNA 4OB2B 1D09B 4M77F 3PIOA 2DO3A 3C95A 1O75A 4J9GA 3FDRA 2RQTA 1JQQA 4J9EA 1AZGB 3CCMT 1VQKQ 2L5QA 4RG2A 1W2BP 1W1FA 2JJ9A 1ZUUA 2FYKA 2AKKA 3OS1A 3NPFA 2F2WA 1PSEA 3CBPA 2YRVA 2K6DA 1YHQT 2ED0A 1VQ6A 1YCSB 2LC4A 4PJOF 4RMOA 1WQWA 4F7UE 2EYXA 5FRMA 2EW3A 1VQPA 5C6SA 4MMLA 2A08A 3TVTA 4QKUA 4IURA 1AWJA 4JLGA 2QQBA 1OPLA 1T0JA 1BIAA 3GPLA 1UEBA 2RHUA 2X4JA 2FG0A 4C92B 2M51A 5IXBA 3OSSC 1H3ZA 1WHLA 3HP9A 2K5LA 2BZYA 4CC4B 2QASA 4A4GA 3G6EQ 5IHNA 3OSVA 1TTHB 2CP6A 2DL7A 1RABB 5CVIA 2RI3A 4J5YA 2LVMA 2X4YA 2FEIA 4D8KA 1JJ2S 2DKGA 2L8DA 1PRLC 2BZXA 3I56Q 4JS4A 5HKCA 1VQ7A 1RAHB 4BACA 5GAOp 3BDUA 1YJ9A 4KH1B 1QWFA 3QDFA 3RERA 3AHUA 1KC8U 3JRZA 3DB3A 2GTJA 1LNXA 4JRKA 5IN1A 2O88A 2JOYA 1VQPT 1MMNA 2YRCA 2L3RA 1VIEA 2V8JA 2YT6A 3FJ5A 1C1AA 4P5NA 1KQSP 2JTEA 2KSSA 3SEMA 1QVPA 1SG5A 5KYUA 1S72Q 4X34A 1YJWA 3SWNA 4JS5A 2JUFA 1GBQA 3CCUA 1RAFB 3QYHB 3MKDA 2IG0A 3RMQA 1LOJA 3JCMh 5GAN3 3TSWA 1WPYA 3H6ZA 2WSFE 1VQ4Q 3VJPA 1LCKA 2LQKA 2DL8A 2QDYB 1P92A 3OYBA 4ZTJA 2VC8A 4IUQA 2XICA 5KYNA 3OYLA 2CKKA 4M7DE 4A4KA 1VQKA 5AT1B 3QSUA 4B9XA 2LQ8A 4QVDA 1G8XA 3VS4A 1UHCA 2P4TA 2RJCA 4C5IA 5IAYA 2K3XA 2KY9A 2F1LA 4HVVA 1D0YA 1WDXA 1TSFA 2MYSA 4ELZC 2X3WD 4M77G 4ZN3A 5GAOm 3RR6A 5D6XA 5LJ5f 4FCYA 1C0MA 2KT8A 2F69A 4C8QC 2ZPHB 1Q81U 3DKMA 3GLXA 3M56A 1BI2A 4N4HA 1NE8A 3CMEQ 3CPWS 1WHGA 1BB9A 2BTTA 2HQEA 1VQNQ 5GMKl 1NLOC 3C94A 5GMKh 2JZ2A 2E6ZA 2DAQA 1U06A 3RMSA 1U5SA 1BK2A 2KK4A 2DA9A 4M78D 1RACB 1ZUYA 2BE7D 2RNAA 4LN2A 3G7ZA 1TXQA 1G3WA 2Z0WA 2D8JA 1FXXA 1R77A 3G6EA 5I22A 1B07A 2RO0A 3HRSA 3CC2Q 1NJIR 4KULA 3M0UA 1WHHA 2F5TX 1MMGA 2DM1A 4RTUA 4EMKA 1UDLA 2QYZA 4JDSA 1Q82R 4M78A 4XU3A 3N5BB 5KYUB 1VQ9A 1UGQB 5EC7A 3SWNB 2M1HA 2LT1A 3S3MA 3D7SB 3QDRB 3FIFA 1K4US 5GAN2 1TUGB 2AIRB 4DA4A 1MMDA 3RDVA 2M9UA 4LDWA 1UGPB 1Q7YU 1YP5A 2CP3A 1T3SA 3CCRQ 1K0XA 2JXBA 1HYOA 1EZZB 2RI5A 3M58A 4MDXA 1TUDA 3CCSA 2DFUA 5FW9A 1V76A 1T0HA 2CUDA 1AWXA 3KXTA 1K9AA 2X51A 1FYNA 2ZPGB 3EG3A 1YI2Q 2M16A 3FB9A 2VB6A 4AG2C 4DBHA 4N4IA 4M7AF 2XG8D 2QEXQ 4X9CA 2AT1B 3TU4K 2CP7A 1GBRA 3VS0A 3TSZA 3EFSA 4BD3A 3X20B 3T9NA 1OU9A 3EG9A 2CP5A 5GANg 2BE9B 1VQ9T 2LNVA 3E2UA 3HFNA 5AYFA 1SKUB 1N5ZA 1O9SA 1TOVA 2HBPA 3P8BB 2LCCA 3V7CA 2CT4A 1M90U 3HRTA 1JEGA 3VKIA 2MIOA 4C92C 2P4RA 4M75D 1M4ZA 1NJIC 3NTKA 1MHNA 2EJGA 2DBKA 4M77D 2K7AA 4MZMA 2NUTA 3CCST 1VQMQ 2RHIA 1KG1A 1Q82C 4EMKB 2DTOA 2ROTA 2K5IA 2HZYA 4FW2A 3CEYA 4M78B 1X2KA 4MZPA 1QP3A 3JCMX 4M75A 1JJ2A 1IB8A 3RNJA 3HRUA 4M77A 1RL2A 4AFQC 4NL3A 3HFOA 4LUEA 4E7KA 1V29B 2JS2A 2EYYA 3JCMd 2DTIA 2CZ6B 2FZGB 4DBFA 4KT0E 3M4GA 1VUBA 4WF2A 3OYDA 2H3JA 3UF4A 3KBGA 4RCCA 1R8OB 5LJ5e 1IRXA 4PLIA 1I1JA 1M1GA 3I5RA 4J9IA 2V26A 2LRQA 4ZTFA 4PJOA 4C8QE 3ULRB 1NLPC 4ZGJB 1EFNA 1AT1B 2J05A 3EHQA 1PNJA 2QA4T 3CMAT 3JB9F 3G71T 2QK0A 1LVKA 2DVEA 4L59A 2GNCA 2P0KA 4J9FA 2A36A 2L2PA 4XU0A 4C5HA 1W6XA 5CK9A 1AVZC 3EG9B 2KYBA 2DXBA 1U1TA 4BE2A 4C92G 3OYMA 4JJNK 1UGRB 4F7UF 4KGZB 3JCMP 5LJ3g 1IHVA 1OX8A 1K0SA 1ZSZA 3RKXA 4GY5A 2FPDA 1QP2A 1BU1A 2YUNA 2G3RA 4PFOA 1QCOA 2NUTB 1QVGP 2G6FX 1YHQQ 4NOYA 3I55A 5D6WA 4TVRA 4E7SA 4M75B 4C0GA 4OMFB 4KGXB 1D1BA 4VUBA 3CC7A 3LLRA 3L42A 4M77B 2DJZA 3OMCA 5CQXA 4LXCA 3CPWA 1VOMA 5CCAA 4OMNA 3MHXA 4O5VA 1RLPC 2ATCB 4GLMA 4HXJA 2KMTA 4NS5A 1KK7A 2PNIA 3M0QA 1VA7A 2WSCE 1QVFP 2WSEE 2RQVA 4Y92A 2HDAA 1LJOA 3VS2A 1M3BA 2I2LA 4PJOB 1YBYA 1PSFA 2YXYA 1WHKA 4J83A 4PNOA 4XTWA 4A4FA 3META 7AT1B 2ZGWA 3SD4A 3OA6A 3SWNC 5GANf 1KD1U 2FRWA 2KXCA 5LL6S 3DLMA 1OULA 5CR2A 3WVDB 1Q86R 4PJJA 3GP8A 2JMAA 3THKA 1H641 2RJEA 1X43A 1HJDA 5CO7A 1VQ6Q 1UFFA 3QIIA 2E3HA 5HK0A 2D8HA 2YLBA 2AKLA 4HCCA 1VQPQ 3VU3C 3I9QA 2EYZA 1K9MR 2IVWA 1ZSZB 4E6RA 1N8RU 4IUUA 4BI4A 2SEMA 1JBMA 4IUTA 1CKAA 2YSQA 1OOTA 2RJDA 3M0SA 4C0DB 3H8ZA 2DVJA 4BI3A 1R0BG 2J6FA 3JV3A 1HSQA 2QG9B 4MMKA 2F2VA 4BY6B 4FL6A 2JTFA 4JRQA 1SPKA 3UPUA 2EJFA 1M1FA 3JB9G 1VQ7Q 5KE2A 3QJ6A 3CCMA 2V8IA 5CAIA 2DL5A 4BDYA 1YWOA 3JSCA 2KR3A 2K2MA 2EYQA 1UUEA 1ZBXA 2AK5A 2ABLA 4PKCC 4Z89A 2IPOB 4E7HA 5KCOA 1PHTA 1ARKA 3A98A 3MPUB 4M78C 5ECAA 3G4SA 1I5OB 4J9CA 3HTRA 4FYYB 2JW4A 1YJWQ 4M7AD 1Q86C 3LWHA 3CCUQ 3RUXA 1S1NA 2LX9A 2EWNA 2KNBB 3BE3A 3EG2A 3UATA 2PVDB 2HNIA 2VVKA 4N4GA 5LJ3f 4IUVA 5GAMg 1VQOT 1WJQA 4ZNXA 2EVRA 4M7AA 1D0XA 4AFUC 1SHFA 4XAXB 4L5GA 1WI7A 5GAMj 2QGFB 1U1SA 1K9MC 1XJWB 3VS3A 2FZCB 4EMGA 4UC4A 1KFZA 2VXFA 3QZ9B 2JM8A 1WIEA 1Y57A 2Y4XA 8AT1B 3LX7A 5J39A 2E10A 2RN8A 1QKWA 1QLYA 2DJQA 2YWWA 2O4XA 2XDDA 2D9TA 4CC2A 5I11A 2LJ3A 4JJBA 1JXMA 2QGGA 3G4ST 1TWBA 4C0ZA 3CCET 3JCMb 1PD0A 4FSXA 1GRIA 1WXBA 2EBPA 1KC8R 1MV3A 3OYAA 1BCOA 2XU8A 1A0NB 5GANe 2LCSA 2RQWA 3FLGA 3GOXA 1KQ1A 2RHZA 4A63B 2GTOA 2EYWA 4M78G 3J7AF 2KRSA 2FHDA 2A37A 4DBQA 5I2SA 1OX9A 2O31A 3M0TA 3MO8A 4FYVB 4ORZA 3FJPA 2DMOA 3JB9D 1ZSGA 4LE9A 2CZ0B 1VQ9Q 4M75C 5GAMd 3EG1A 1QQJA 4XTXA 1PG5B 4M77C 5GAN7 1D1AA 5D7UA 3OW2P 2YLCA 3UA6A 4QVCA 2V1RA 2E70A 3MP8A 4M7AB 2J7IA 4KUDK 8ATCB 1SSFA 4XTYA 3RIRA 2JVVA 3CCSQ 5L23A 1OYXA 4JJCA 1C6VX 3VS6A 4J7FA 3A8MB 2XDBA 3PTAA 3P8HA 3G1JA 5IHIA 1U8RA 2PQWA 3OQ5A 1PRMC 3LH0A 1I07A 1D3BA 2CGHA 4F7UA 2DYBA 1OPKA 4A54A 1G3SA 3TCJA 2R57A 2E5QA 1IO6A 4EMHA 1M2OA 4QW2A 2O4XB 1X6OA 3CCLT 1Q81R 1M8VA 3OYGA 2VGNA 3LWIA 2GFUA 3LYIA 5HCKA 3PVQA 4WCIA 1KC8C 4A4EA 4JPBW 1RAAB 1WA7A 1SEMA 4Q5WA 1VQLT 4E7ZA 5D6YA 2FPEA 1ZSZC 4PJLA 5IH2A 2L0AA 3OYKA 3G71Q 3OBWA 5LJ3e 2OTJT 4M75G 3M53A 2VASA 1QWEA 3EFRA 4C0DC 5A0DA 3VS1A 2ZPIB 2E1HA 5FWBA 2LDMA 2MCNA 1MNDA 3SB2A 1IHWA 2DL4A 3CCVT 4CC3A 1SF9A 3C0CA 4KBMB 3S3NA 3DLLA 4JJDA 1YNZA 4R0KA 1BIBA 2FL7A 2M0YA 3R6NA 1FMWA 4A4HA 2MMPA 1JB0E 2LJ1A 3FRNA 4PJOG 4CC7A 4C5GA 2HBWA 2RB6A 3L2ZA 1NM7A 4C0FA 1M5Q1 2DXTA 1VYVA 3GBQA 3CCQT 2ENMA 1G83A 2QTXA 3CXCS 3A8LB 2MWOA 1RLQC 4E47A 1QCNA 1X27A 2GF7A 2GCXA 3X26B 2KYMA 2E41A 4J7IA 2VUBA 3EFOA 4RTXA 1D3BB 2E65A 1X6GA 4PJNA 4F7UB 1GCQA 3V7SA 4RTVA 1YWPA 4F16A 2GGRA 1Q81C 1WGSA 2E12A 4M7DA 4E2FB 4E7LA 2CT3A 4AT1B 2KXDA 1NYFA 1UECA 2PUOB 3JCMg 3M57A 3L2UA 1HK9A 2EFIA 2J6KA 4X9DA 3EAEA 1M90R 2JNGA 4F04B 3M59A 4A53A 1ZBJA 2GQVA 4LDVA 4Y91A 3OYHA 3MEVA 2LJ0A 4OGEA 1WQ7A 2LX7A 2QTVA 1AZEA 3NTHA 1UTIA 3EG0A 4J6XA 3QYGB 4JZ3A 3HSBA 3I55Q 1KHIA 5GAOq 1K73R 2MI6A 2ZZDA 4PJMA 4II1A 1Y96A 1VQ8T 3OYFA 3CC7Q 3CPWP 5GAN4 5A0GA 3NMZC 1RAGB 4XTVA 3SFMA 3FC3A 1Z9ZA 2W10A 3MP6A 3CC4A 5CQYA 2QA4A 1PCXA 3CMAA 1YFNA 1UE9A 3G71A 2DRKA 2LMJA 2OTLA 3NGPA 5GMKj 4EIKA 1MUZA 2MPXC 2L3SA 3MEUA 3QUIA 3X25B 1ABOA 2E3IA 2M02A 3EFOB 1J3TA 1FMVA 4Y28E 9ATCB 2RHYA 3A8OB 2H8HA 2B8AA 1HD3A 4PJOD 5GAOr 2DILA 2RHXA 3UT1A 5KE3A 2D0QB 2X9HA 4RUGA 4FYXB 2DE0X 2DD5A 3PFSA 2HCKA 4OMMA 1M3AA 3FEOA 1YIJA 4M7AC 1M90C 3H0FA 5GAMe 4OMPA 3QXEB 3OS0A 1VQ4T 4IIMA 3CC4T 4XK8E 3VRYA 2XDPA 1RI0A 1QVFS 5IT9E 2OTLT 2YUQA 2YUOA 1XQHA 1K73C 2O9SA 4PL6A 4AMCA 2HSEB 1RADB 1SHGA 1CKBA 2FO0A 2NUZA 3MJXA 1RI9A 4Z88A 1Y96B 2RK2A 3BDLA 5EG2A 5FRNA 3OBYA 2CUBA 3HKSA 3CCMQ 4BUGA 2DRMA 3GIBA 3PMTA 5GAOl 2JM9A 2LNHB 3CD6A 3EGDA 1VQNT 1G5VA 3AT1B 2AZVA 1YIJT 2C06A 1UHFA 3CBMA 1QMCA 2DETA 1UG1A 2I0NA 1PKTA 1BBZA 1NEBA 2YUPA 3JB9I 2RA2A 1YITA 1KD1R 2NUPA 4RTTA 3LH5A 3G4SQ 4OF1A 4HVWA 4FU6A 3CC2T 4PLLA 3JCMf 2DIQA 2XIDA 3O5ZA 4M7AG 1GXIE 1NYGA 5KYYA 1ACMB 3CPFA 4C8QA 3JB9J 3INZA 4ZGDB 2CH4A 3C4SA 3L1AA 2HQXA 2NWMA 3GNFB 4OB0B 1KHCA 2VXEA 3NFCA 2K57A 2XD0A 2RI2A 4JZ4A 5KYWA 2R58A 1ZA1B 1N8RR 3CCJT 3KFVA 3CCRT 3CXCA 4CRIA 1ZLMA 2PVGB 4MDWA 2OI3A 2COZA 5I2MA 2KI7A 3CD6T 2QQRA 2K4YA 3ASKA 4DEXA 2DERA 4BE0A 2DEQA 4C92E 1WHJA 2K3BA 1AD5A 1GCPA 4J9DA 1YITT 3O8VA 5LJ5h 2DTHA 5I21A 1HXDA 3OYIA 1H8KA 1V1CA 2Y4YA 1KQ2A 1K8AU 1SSHA 3KUFA 4M7DF 5CKDA 1SRLA 2CP0A 4K11A 1Y71A 3QO3A 2E5KA 4D8DA 2XK0A 3EGDB 4MZTA 2D6FA 2YDLA 2ZPBB 1IXDA 1U3OA 3ZFJA 2EAYA 1VQOA 1PWTA 5GAN8 2EPDA 1W2BS 4BB7A 3EGUA 3X28B 2ECZA 2NUPB 3NTIA 4OB1B 1QCFA 2KVQG 5CKBA 1JRIA 4LDUA 1M1KR 3OYEA 3M55A 1ZX6A 3L2VA 1H92A 5DLQE 3QG1A 5KYYB 2ED1A 1VQLQ 3UA7A 1WHMA 1YJNT 2LQWA 2D1XA 1BI0A 3E19A 4XTZA 2OTJQ 1N8RC 5KYWB 4EMKC 2HAXA 2VYTA 4F7UG 2VKNA 5L8RE 5A0LA 3CCEA 2KQWA 5HY6A 1TU0B 5GMKm 1F1BB 4RG8A 4QQ6A 2C0OA 1GCQC 1QVGA 2E6NA 4OP0A 2CSQA 2JN0A 5GJWB 3WXMB 2A0FB 2COYA 2A7YA 3QHSA 3VYHB 2HSPA 2MF2A 1I81A 1OZ3A 1AHJB 5CIUA 2CYZB 5CKHA 5HK3A 4N0AA 3PT9A 3CCQQ 4FYWB 1JO8A 4L6V5 3JCMe 1M2VA 1W4SA 6AT1B 2FPFA 4FSSA 2RH2A 5LJ5j 1E7OA 1D1CA 1QVFA 1VQ5T 1WZOA 1KQSS 2IIMA 2GFAA 1BKBA 5GMKi 1AEYA 3I5SA 3L2RA 2RF0A 1NZ9A 1OZ2A 2L3PA 4HT9A 1M1KC 1KSWA 3HHTB 4LD6A 4F17A 3MEAA 2JS0A 3ZBDA 2EIFA 2K5FA 1LPLA 3CCLA 2PVOB 1VYUA 2B86A 4XQ3A 5GMKe 3GNGA 2A28A 3DB4A 2QQSA 1TUCA 2DEUA 4KH0B 4M7DG 1E6HA 1VQ8Q 3EH2A 3M5AA 2JTMA 4M4ZA 3PNWC 4E7IA 4B9WA 1VQLA 3OYYA 1BI1A 1X6BA 2F5KA 2JMCA 4FT2A 5LJ5d 2OTJA 3PE0A 2BIVA 1D0ZA 1M3CA 4RTZA 1OI1A 4ZGEB
chains in the Genus database with same CATH topology
3BW1A 5FU7B 3M59A 2BKDN 4A53A 2KDSA 1MGQA 4C92A 4PJOC 2YHTA 1VQ6T 2GQVA 2MWPA 4LDVA 3QPHA 2BUDA 4JLIA 4Y91A 3OYHA 4JUVA 4HT8A 3PGGA 4C8QF 2DXUA 3MEVA 2FB7A 3CCVA 1K9MU 3RKXA 4GY5A 3TREA 1NPPA 2V8KA 3P8DA 3VUZA 1QP2A 3LGFA 3JB9H 4OGEA 1WQ7A 4HCBA 2G3RA 2LCLA 1YHQA 4V2SA 1IZ6A 1I5LA 3NTHA 3L2WA 4NOYA 3GPLA 3I55A 4J6XA 5D6WA 5GAN5 3QYGB 1N27A 4JRIA 3HSBA 4M7DC 4HKEA 2DXCA 5C0MA 4TVRA 1KHIA 4QVZA 4OB3B 4M75B 1K8AC 1N9SA 4C0GA 4OMFB 2MI6A 2ZZDA 5GAOq 3VUBA 3M4YA 2XHCA 1TH7A 4VUBA 3JCMV 3HPWA 4II1A 3CC7A 4DOWA 3F70A 3LLRA 1Y96A 3L42A 4M77B 2DJZA 3OMCA 4YTLA 3OYFA 3CCQA 3JAME 5CQXA 1VQ8T 4J6YA 5GAN4 3CPWA 5A0GA 4M78E 3J80E 5CCAA 1BI3A 4XTVA 3LW5E 3MHXA 4O5VA 3SFMA 5DM7R 3FC3A 2RM4A 3OW2S 2RK1A 5LJ5g 3MP6A 3CC4A 5CQYA 1M1KU 2QA4A 2KMTA 3QKJA 3CMAA 3MP1A 3G71A 4NS5A 3PIPA 1ZQ1A 4M75F 3TEEA 2OTLA 3J81E 2WSCE 4NL2A 2WSEE 4OB2B 4M77F 4R56A 2DO3A 3C95A 3PIOA 1LJOA 1O75A 2DZ9A 5GMKj 2I2LA 1VQ7T 3FDRA 4PJOB 1YCYA 1YJ9T 3CCMT 1YBYA 3MEUA 2VGMA 3QUIA 3X25B 2L5QA 4HA8A 1PSFA 5GAMf 4RG2A 4J83A 4PNOA 1W2BA 4XTWA 4A4FA 3META 2DK3A 2ZGWA 3SD4A 2FYKA 4BY6C 3OA6A 3SWNC 5GANf 1KD1U 5CR2A 4Y28E 3DLMA 5LL6S 3OS1A 2LTOA 5DY9A 3WVDB 5GANh 2RHYA 3S3OA 1PSEA 3A8OB 3URGA 3GP8A 3CBPA 2B8AA 2YRVA 1H641 1YHQT 2RJEA 4PJOD 5CO7A 2RHXA 3BY7A 5GAOr 3UT1A 1VQ6A 5KE3A 2D0QB 3OS5A 2LC4A 4PJOF 4RMOA 4DA4A 1WQWA 2DD5A 3PFSA 4XU2A 4F7UE 2K2VA 3FEOA 3PMIA 3QIIA 1YJWT 3OB9A 5FROA 1YIJA 5FRMA 5HK0A 3CCUT 1VQPA 2YLBA 5C6SA 4MMLA 4M7AC 1M90C 4HCCA 1ZHIA 2QXFA 4IURA 3VU3C 4JLGA 5GAMe 2QQBA 5J26A 1XNIA 1BIAA 2EKOA 3QXEB 1UEBA 2RHUA 3OS0A 2X4JA 1VQ4T 4M7DD 4LD9K 4C92B 2IVWA 3MEWA 3CC4T 3OSSC 3RESA 1N8RU 4IUUA 4XK8E 1H3ZA 4ATOA 4ELYC 3HP9A 2K5LA 4BI4A 1VQ8A 1JBMA 4IUTA 4EDUA 2XDPA 4A4GA 1RI0A 1QVFS 1X75C 4RKUE 3RKWA 5KH6A 3E9FA 5IT9E 2OTLT 3OSVA 2RJDA 4LDXA 4C0DB 3H8ZA 5CVIA 4BI3A 3OS2A 2A3LA 2RI3A 5FU6B 1XQHA 4J5YA 1VQKT 2ZCFB 2LVMA 2X4YA 3A5ZB 4PL6A 1K73C 1JJ2S 4MMKA 2DKGA 4C92F 2L8DA 1X01A 4XU1A 3Q1JA 4FL6A 4BY6B 3I56A 2JTFA 4GLKA 4JRQA 4R55A 3UPUA 1Y96B 2RK2A 4JS4A 5HKCA 1VQ7A 2EJFA 1M1FA 3JB9G 3BDLA 4IUPA 5EG2A 5GAOp 4BACA 3BDUA 1YJ9A 5FRNA 3OBYA 2CZ7B 5KE2A 3QJ6A 3CCMA 2V8IA 3HKSA 5CAIA 2QQAA 3RERA 3AHUA 4M75E 3JRZA 3DB3A 1KC8U 3OW2A 2XI9A 4BUGA 4BDYA 3GIBA 2QQ9A 3PMTA 3JSCA 5GAOl 2AHJB 1LNXA 2EYQA 4M77E 1ZBXA 4C5EA 3CD6A 4JRKA 3A8GB 1VQNT 5IN1A 1G5VA 2JOYA 1YIJT 4PKCC 2C06A 1VQPT 4E7HA 3CBMA 1NJIU 2L3RA 1VIEA 2V8JA 5KCOA 3CBOA 3HL8A 2PU9B 4P5NA 1S72A 3GF5A 2KSSA 1KQSA 1QVPA 3JB9I 2RA2A 1YITA 4M78C 3G4SA 4X34A 1Q82U 2MAMA 5KCHA 3SWNA 4JS5A 1YJWA 1Q7YC 2JUFA 4OF1A 3CCUA 4FU6A 3CC2T 4PLLA 4M7AD 3G6ET 3QYHB 1Q86C 2IG0A 3RMQA 3LWHA 3JCMf 2DIQA 5FLXE 4C8QG 2XIDA 3RUXA 1LOJA 3JCMh 2LX9A 2EWNA 3WVEB 5GAN3 4PJOE 1WPYA 3H6ZA 1VQ4A 3V7RA 2WSFE 4M7AG 1GXIE 3M54A 2PVDB 2HNIA 1XTDA 4N4GA 5LJ3f 3VJPA 4IUVA 3CPFA 5GAMg 1VQOT 4C8QA 5LJ3h 2DPPB 3INZA 2LQKA 4ZGDB 3JB9J 2QDYB 3C4SA 3L1AA 1WJQA 2HQXA 2XKOC 5LJ3g 4M7AA 1P92A 3OYBA 4BI8B 3R6OA 2EQMA 3I56T 4J6WA 4L5GA 3GNFB 4OB0B 4XAXB 1KHCA 2VXEA 3NFCA 5GAMj 1BYMA 2VC8A 1WJRA 1U1SA 4IUQA 2K57A 2XICA 2RI2A 2XD0A 3QJYA 3OYLA 2CKKA 2DIGA 4M7DE 5GANj 4A4KA 3JCMJ 2R58A 1K9MC 3V8KA 1VQKA 3CCJT 3QSUA 2QI2A 1UGSB 3CCRT 4B9XA 2LQ8A 3CXCA 4CRIA 4QVDA 4EMGA 2PVGB 4UC4A 2EJ9A 2P4TA 4MDWA 2RJCA 4C5IA 2VXFA 3QZ9B 5IAYA 2K3XA 1G3YA 5I2MA 2KY9A 3CD6T 2HD0A 2EQUA 2K3YA 2QQRA 1QVGS 5CKEA 2K4YA 2Y4XA 3ASKA 4ME7A 3QZ5B 3LX7A 5J39A 2E10A 4BE0A 2DEQA 4C92E 3C12A 2O4XA 4ELZC 2D9TA 2XDDA 3OYCA 2DD4A 4E7JA 4M77G 4M7DB 2Y90A 1S72T 4ZN3A 5GAOm 4EPCA 5LJ5f 5D6XA 1YITT 4BE1A 1B34A 3O8VA 2F69A 5CKFA 4C8QC 3G4ST 3CMEA 4C0ZA 5LJ5h 1N6AA 2ZPHB 1Q81U 3DKMA 3GLXA 3M56A 1BI2A 4N4HA 1VQNA 1NE8A 3CPWS 2DTHA 3JCMb 5I21A 4FSXA 2HQEA 1HXDA 5GMKl 3OYIA 1K73U 3C94A 3JCMc 1I4K1 4Z02A 5GMKh 2JZ2A 2Y4YA 2E6ZA 2DAQA 1KQ2A 3RMSA 4XTUA 3OYAA 1K8AU 2XU8A 4N0AC 2M0OA 2KK4A 2WACA 4M78D 2RD1A 3KUFA 4J8OA 5FU7C 5GANe 4M7DF 3G7ZA 5CKDA 3CCET 3FLGA 3GOXA 1G3WA 1KQ1A 3CC2A 1Y71A 2RHZA 1FXXA 3QO3A 3G6EA 4RCBA 1EIFA 2RO0A 3HRSA 4M78G 2X35A 2XK0A 4KULA 4MZTA 4DQ2A 3J7AF 5DLOA 4QQDA 3M9QA 1UB4A 2FHDA 2F5TX 3X24B 2D6FA 1FX7A 2ZPFB 4EMKA 2ZPBB 3ZFJA 2EAYA 2L89A 4JDSA 5I2SA 1VQOA 4M78A 5GAN8 3MO8A 4XU3A 3N5BB 1W2BS 3FJPA 3JCMW 2VV5A 4BB7A 3X28B 3OYNA 1VQ9A 1UGQB 3JB9D 3NTIA 3SWNB 2M1HA 2LT1A 2ZPEB 2CZ0B 4OB1B 4FIBA 4M75C 3S3MA 5GAMd 3QDRB 1QW1A 3FIFA 1M9SA 5GAN2 2KVQG 2NLUA 5CKBA 1JRIA 4LDUA 4M77C 4XTXA 5J3BA 5GANd 5GAN7 2M9UA 4LDWA 4OGCA 1UGPB 3OYEA 3CCJA 1Q7YU 3M55A 3CCRA 4DOVA 3L2VA 5DLQE 3QG1A 2CZ1B 3S6WA 2YLCA 2RI5A 4QVCA 1YJNT 5GAOn 3MP8A 2E70A 2X4XA 4FT4A 3VYGA 3M58A 4MDXA 3CMET 4M7AB 1BI0A 2KAFA 3ME9A 4KUDK 1SSFA 3CCSA 4XTYA 2P0QA 3E19A 3RIRA 4XTZA 2JVVA 1N8RC 1OYXA 3BFMA 1YI2A 3V8LA 4EMKC 2HAXA 3KXTA 4IKFA 2VYTA 3LGLA 4J7FA 4F7UG 3A8MB 2ZPGB 5L8RE 3PTAA 3OMGA 3OY9A 3P8HA 3JCMQ 2XDBA 2M16A 3MCAB 4C8QD 5A0LA 1DJ7B 3CCEA 1U8RA 2PQWA 2KQWA 3A8HB 3FB9A 5HY6A 4JRPA 3OQ5A 5LJ3j 3LH0A 2EQKA 1D3BA 2CGHA 5GMKm 4F7UA 4RG8A 4QQ6A 3E9GA 4A54A 1G3SA 4N4IA 2QEXA 4M7AF 2XG8D 3TCJA 2E64A 3UDCA 4X9CA 2R57A 2E5QA 1QVGA 2E6NA 2X4WA 3TU4K 4EMHA 4OP0A 4QW2A 2JN0A 2O4XB 3WXMB 1X6OA 4ZN1A 3CCLT 3EFSA 4BD3A 3X20B 1M8VA 3T9NA 3OYGA 1I8FA 2VGNA 1B34B 3LWIA 2A7YA 3QHSA 5GAN6 5GANg 1VQ9T 3VYHB 2LNVA 2MF2A 2GFUA 3LYIA 1IREB 1I81A 1OZ3A 3HFNA 1Y07A 4OVAA 5AYFA 1N9RA 1AHJB 1KC8C 4A4EA 4D6WA 5CIUA 2CYZB 5CKHA 3VV0A 5HK3A 4N0AA 3PT9A 1O9SA 2HBPA 3P8BB 2OTJA 2LCCA 4L6V5 3V7CA 2PUKB 4Q5WA 1VQLT 3UWNA 1M90U 3JCMe 1W4SA 3HRTA 5A2QE 5D6YA 3VKIA 4C92C 4M75D 1M4ZA 1NJIC 1FWZA 1MHNA 3NTKA 3SDZA 2EJGA 3RKYA 3OYKA 3OBWA 2RH2A 1VQMA 5LJ5j 4M77D 5LJ3e 2OTJT 4MZMA 3CCST 4M75G 1NPRA 1QVFA 1VQ5T 2RHIA 3M53A 1KG1A 1Q82C 4EMKB 2DTOA 1KQSS 1WNLA 2K5IA 3EFRA 4C0DC 2GFAA 3CEYA 4M78B 5A0DA 1YI2T 1YJNA 4MZPA 2ZPIB 2E1HA 1QP3A 3JCMX 1BKBA 5GMKi 5FU6C 2LDMA 4M75A 1G3TA 3L2RA 1JJ2A 1NZ9A 5GAMh 3SB2A 3HRUA 1OZ2A 4M77A 1RL2A 4NL3A 3CCVT 3HFOA 4HT9A 4E7KA 2QEXT 1M1KC 1V29B 4KBMB 4LDYA 3S3NA 5M9OA 3DLLA 3JCMd 3HHTB 4FM4B 4LD6A 2DTIA 2CZ6B 1BIBA 2FL7A 3QBYA 4KT0E 4M78F 4A4HA 3M4GA 3MEAA 3ZBDA 4CI0C 3I55T 1VUBA 2EIFA 4WF2A 5LJ3d 2MMPA 3OYDA 1JB0E 3V8JA 2H3JA 3FRNA 2K5FA 4PJOG 4C5GA 2R5MA 2RB6A 3L2ZA 4O6JA 4C0FA 3CC7T 1M5Q1 2DXTA 2CS7A 3KBGA 4RCCA 3ZEHA 1R8OB 5LJ5e 3CCQT 4PLIA 1M1GA 2QTXA 3CCLA 2LRQA 2PVOB 3CXCS 4ZTFA 4PJOA 4C8QE 3A8LB 1KD1C 2MWOA 4XQ3A 4E47A 4ZGJB 5GMKe 2OAUA 3GNGA 3DB4A 4M7AE 2GF7A 2GCXA 3X26B 2QA4T 1XOVA 3CMAT 2QQSA 2E41A 4J7IA 2VUBA 3G71T 3JB9F 1Y7XA 4BDZA 4M7DG 1D3BB 2E65A 3OYJA 4F7UB 2RJFA 3V7SA 1VQMT 3M5AA 2JTMA 3PNWC 4E7IA 4B9WA 1VQLA 2DVEA 3OYYA 4L59A 1Q81C 1WGSA 1Q86U 1BI1A 2E12A 2DZCA 2F5KA 2P0KA 4FT2A 4M7DA 4C5HA 4XU0A 4C92D 4C8QB 4KUIA 5CK9A 4E7LA 3L2QA 3E1SA 2FVUA 2PUOB 2O01E 2DXBA 4HCZA 3JCMg 5LJ5d 3M57A 4ZTJA 1U1TA 2R5AA 1HK9A 4C92G 3L2UA 4BE2A 3OYMA 4JJNK 1UGRB 3ER0A 1VQ5A 2EFIA 2P0PA 2BIVA 1WJSA 4X9DA 4F7UF 3EAEA 4QQGA 1OI1A 4ZGEB 2EQJA 2LT4A 3JCMP 2JNGA 1VIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CKB A;  2MF2 A;  1VUB A;  3NFC A;  3VUB A;  4ELZ C;  1X75 C;  4VUB A;  3HPW A;  4OF1 A;  4MZT A;  4HKE A;  4MZP A;  3JRZ A;  5DLO A;  5CKH A;  1UB4 A;  5CQX A;  5HK3 A;  5CKF A;  3JSC A;  5HK0 A;  5CCA A;  1NE8 A;  3TCJ A;  5CK9 A;  4MDX A;  5CQY A;  2C06 A;  2KMT A;  5CR2 A;  5CKE A;  4ME7 A;  4ELY C;  3G7Z A;  2VUB A;  4MZM A;  5CO7 A;  5CKD A;  5HKC A;  1M1F A; 
#chains in the Genus database with same CATH topology
 3BW1 A;  5FU7 B;  4J9B A;  2BKD N;  1FMK A;  2CRE A;  2K9G A;  2MOX A;  4PJO C;  2YHT A;  1VQ6 T;  2MWP A;  2VWF A;  1M2V B;  3QPH A;  4JLI A;  4C8Q F;  2SRC A;  2DXU A;  2FB7 A;  3CCV A;  1BCM A;  3TRE A;  3P8D A;  3JB9 H;  2GBQ A;  4HCB A;  2LCL A;  1VYT A;  1IZ6 A;  4QT7 A;  4KRT A;  1PC0 A;  1UJY A;  1NEG A;  1N27 A;  1MV0 B;  2HEQ A;  2HMA A;  5C0M A;  1ZUK A;  4QVZ A;  1N9S A;  4WTO B;  2P84 A;  2RQU A;  3VUB A;  3M4Y A;  2XHC A;  3JCM V;  1QKX A;  3CCQ A;  1NBE B;  4M78 E;  1BI3 A;  1YN8 A;  4ESR A;  3U23 A;  3QKJ A;  3CC4 Q;  3MP1 A;  3REB B;  2QA4 Q;  3CMA Q;  1X2Q A;  1ZQ1 A;  2C0I A;  2J6O A;  1I0C A;  3TEE A;  1PD1 A;  3J81 E;  2DBM A;  4NL2 A;  2OTL Q;  4R56 A;  1TG0 A;  1RAE B;  2DZ9 A;  2OX7 A;  1VQ7 T;  1YCY A;  4HVU A;  1YJ9 T;  1B7T A;  2VGM A;  2DL3 A;  4HA8 A;  5GAM f;  3NHN A;  1JJ2 P;  1W2B A;  2DK3 A;  4BY6 C;  4X1V A;  1Q7Y R;  2KBT A;  1K1Z A;  2LTO A;  5DY9 A;  2KRN A;  5GAN h;  3S3O A;  3URG A;  4AFS C;  4HCK A;  2HKQ B;  3BY7 A;  3H0H A;  4RTY A;  1RAI B;  2MK5 A;  3OS5 A;  4LNP A;  2RQR A;  4XU2 A;  2EQI A;  2K2V A;  3PMI A;  1YJW T;  3OB9 A;  5FRO A;  3EGX A;  3CCU T;  2DNU A;  2V1Q A;  1YIJ Q;  1ZHI A;  2QXF A;  2OAW A;  4J9H A;  1JU5 C;  5J26 A;  1XNI A;  2EKO A;  1K76 A;  4M7D D;  4LD9 K;  1WXT A;  2KGT A;  4FW1 A;  3MEW A;  3RES A;  4ATO A;  4ELY C;  1EX4 A;  2EGA A;  1VQ8 A;  4EDU A;  1X75 C;  4RKU E;  3RKW A;  5KH6 A;  3E9F A;  1WLP B;  4LDX A;  1WFW A;  3VRZ A;  3H0I A;  3OS2 A;  2A3L A;  5FU6 B;  1VQK T;  2ZCF B;  1SRM A;  3A5Z B;  4C92 F;  1X01 A;  4XU1 A;  3Q1J A;  3I56 A;  1JXO A;  4GLK A;  4R55 A;  1MNE A;  2C0T A;  4IUP A;  1AOJ A;  1WYX A;  2CZ7 B;  2QAZ A;  2QQA A;  3CCJ Q;  4M75 E;  2KRO A;  3OW2 A;  2XI9 A;  2QQ9 A;  2AHJ B;  4M77 E;  4C5E A;  1W70 A;  3A8G B;  2CH4 W;  4OML A;  3CD6 Q;  1NJI U;  3CBO A;  3HL8 A;  2PU9 B;  1M27 C;  1S72 A;  3GF5 A;  1KQS A;  1T3L A;  1RUW A;  2W0Z A;  1Q82 U;  2MAM A;  5KCH A;  1YIT Q;  1Q7Y C;  3G6E T;  5KYX A;  5FLX E;  4C8Q G;  4PJO E;  3WVE B;  1VQ4 A;  1IGU A;  3V7R A;  1GL5 A;  2HL3 A;  3M54 A;  1XTD A;  1Q95 G;  1M30 A;  2DPP B;  5LJ3 h;  2XKO C;  4BI8 B;  2DX1 A;  3R6O A;  2EQM A;  3I56 T;  4J6W A;  3EGX B;  5GJV B;  1WJR A;  2X3X D;  3M0R A;  3QJY A;  2DIG A;  2DF6 A;  5GAN j;  3JCM J;  1MMA A;  3V8K A;  4DEY A;  2QI2 A;  3CXC P;  1UGS B;  1OV3 A;  2BZ8 A;  1WX6 A;  2EJ9 A;  2YRD A;  4LUD A;  1CSK A;  1G3Y A;  2HD0 A;  2EQU A;  2K3Y A;  1QVG S;  5CKE A;  4ME7 A;  3QZ5 B;  3C12 A;  3OYC A;  1OEB A;  4M7D B;  4E7J A;  2DD4 A;  2QDL A;  2Y90 A;  1S72 T;  2EKH A;  4EPC A;  1YJN Q;  4BE1 A;  1GFD A;  1B34 A;  5CKF A;  3CME A;  1N6A A;  1VQN A;  2ROL A;  1GFC A;  3H41 A;  1KIK A;  1K73 U;  2O9V A;  1I4K 1;  4Z02 A;  3JCM c;  4PK4 A;  2H3E B;  3TQ7 P;  4XTU A;  4N0A C;  2M0O A;  2WAC A;  2RD1 A;  4J8O A;  5FU7 C;  4AG1 C;  1PM3 A;  3CC2 A;  3VS5 A;  4RCB A;  1EIF A;  2K79 A;  1UGV A;  2X35 A;  1Y0M A;  4DQ2 A;  1B3Q A;  5DLO A;  4QQD A;  3M9Q A;  1UB4 A;  3X24 B;  3PVL A;  1FX7 A;  2ZPF B;  4DBR A;  4B6M A;  2L89 A;  1M8M A;  4ANJ A;  1VQO Q;  3JCM W;  2VV5 A;  2PZ1 A;  3OYN A;  3VS7 A;  2ZPE B;  4FIB A;  3SHW A;  3A1P A;  1QW1 A;  1M9S A;  5KYX B;  2NLU A;  1WXU A;  5J3B A;  5GAN d;  4OGC A;  2EGE A;  3CCJ A;  1PKS A;  2J06 A;  3CCR A;  4DOV A;  1G2B A;  1AWW A;  2CZ1 B;  2KRM A;  3S6W A;  3IQL A;  5GAO n;  2PTK A;  2X4X A;  4FT4 A;  3VYG A;  3CME T;  2KAF A;  3ME9 A;  2F2X A;  5IXF A;  2P0Q A;  1OQK A;  1VQ5 Q;  3BFM A;  1YI2 A;  3V8L A;  4IKF A;  3LGL A;  2KEA A;  3OMG A;  3OY9 A;  3JCM Q;  3MCA B;  4KGV B;  4C8Q D;  1DJ7 B;  3EHR A;  1X69 A;  5IHK A;  3A8H B;  4JRP A;  3CCE Q;  5LJ3 j;  1AWO A;  2EQK A;  2QEX A;  3E9G A;  4OMO A;  2E64 A;  3UDC A;  2LQN A;  2X4W A;  4RTW A;  3M0P A;  3ZL7 C;  4ZN1 A;  5FWC A;  1I8F A;  1B34 B;  5GAN 6;  2COW A;  1IRE B;  1Y07 A;  4OVA A;  1N9R A;  1K8A R;  4D6W A;  3EH1 A;  2FZK B;  3VV0 A;  2HL5 C;  3QWY A;  3CQT A;  2LZ6 B;  1NG2 A;  2PUK B;  3UWN A;  5A2Q E;  4PFZ A;  1FWZ A;  3SDZ A;  2ZAE A;  3RKY A;  1VQM A;  1NPR A;  1R0C B;  3REA B;  1WNL A;  1YI2 T;  1YJN A;  4GBQ A;  2O2O A;  5FU6 C;  1ABQ A;  1G3T A;  5GAM h;  1E6G A;  2QEX T;  4LDY A;  5M9O A;  2ESW A;  4FM4 B;  4Z8A A;  2XMF A;  3QBY A;  4M78 F;  4CI0 C;  3I55 T;  5LJ3 d;  3V8J A;  2D0N A;  2R5M A;  2RPN A;  4O6J A;  1TS9 A;  3CC7 T;  2KE9 A;  2CS7 A;  3ZEH A;  4F14 A;  2DLP A;  1Z9Q A;  2JT4 A;  2CSI A;  2LP5 A;  1KD1 C;  3CCL Q;  1IGQ A;  2OAU A;  4M7A E;  2GQI A;  1XOV A;  3RBB B;  1Y7X A;  4BDZ A;  3OYJ A;  2RJF A;  1VQM T;  1Q86 U;  1BYM A;  4AFZ C;  2DZC A;  2NYS A;  4C92 D;  4C8Q B;  4KUI A;  3L2Q A;  2FRY A;  3E1S A;  1OU8 A;  2FVU A;  2O01 E;  4HCZ A;  1K8A C;  2R5A A;  2AZS A;  3ER0 A;  1VQ5 A;  2P0P A;  1WJS A;  1ZA2 B;  4QQG A;  2EQJ A;  2LT4 A;  1VIF A;  2EGC A;  2KDS A;  1MGQ A;  4C92 A;  1YJ9 Q;  2BUD A;  2L3Q A;  2RMO A;  4JUV A;  4HT8 A;  3PGG A;  1H3H A;  1K9M U;  1NPP A;  2V8K A;  3VUZ A;  3LGF A;  1KJW A;  3CCV Q;  1YHQ A;  4V2S A;  3H9N A;  1I5L A;  3L2W A;  5GAN 5;  4JRI A;  2KT1 A;  4PFP A;  4M7D C;  4HKE A;  2DXC A;  4OB3 B;  1TH7 A;  1UJ0 A;  4OMQ A;  3HPW A;  2DYI A;  4DOW A;  2E4H A;  3F70 A;  2HQH A;  3QWX X;  4YTL A;  3JAM E;  4IIO A;  4J6Y A;  2CDT A;  3I35 A;  3J80 E;  3LW5 E;  5DM7 R;  2OJ2 A;  3OW2 S;  2RM4 A;  2RK1 A;  5LJ5 g;  1M1K U;  2CP2 A;  3PIP A;  4M75 F;  2HKN A;  4OB2 B;  1D09 B;  4M77 F;  3PIO A;  2DO3 A;  3C95 A;  1O75 A;  4J9G A;  3FDR A;  2RQT A;  1JQQ A;  4J9E A;  1AZG B;  3CCM T;  1VQK Q;  2L5Q A;  4RG2 A;  1W2B P;  1W1F A;  2JJ9 A;  1ZUU A;  2FYK A;  2AKK A;  3OS1 A;  3NPF A;  2F2W A;  1PSE A;  3CBP A;  2YRV A;  2K6D A;  1YHQ T;  2ED0 A;  1VQ6 A;  1YCS B;  2LC4 A;  4PJO F;  4RMO A;  1WQW A;  4F7U E;  2EYX A;  5FRM A;  2EW3 A;  1VQP A;  5C6S A;  4MML A;  2A08 A;  3TVT A;  4QKU A;  4IUR A;  1AWJ A;  4JLG A;  2QQB A;  1OPL A;  1T0J A;  1BIA A;  3GPL A;  1UEB A;  2RHU A;  2X4J A;  2FG0 A;  4C92 B;  2M51 A;  5IXB A;  3OSS C;  1H3Z A;  1WHL A;  3HP9 A;  2K5L A;  2BZY A;  4CC4 B;  2QAS A;  4A4G A;  3G6E Q;  5IHN A;  3OSV A;  1TTH B;  2CP6 A;  2DL7 A;  1RAB B;  5CVI A;  2RI3 A;  4J5Y A;  2LVM A;  2X4Y A;  2FEI A;  4D8K A;  1JJ2 S;  2DKG A;  2L8D A;  1PRL C;  2BZX A;  3I56 Q;  4JS4 A;  5HKC A;  1VQ7 A;  1RAH B;  4BAC A;  5GAO p;  3BDU A;  1YJ9 A;  4KH1 B;  1QWF A;  3QDF A;  3RER A;  3AHU A;  1KC8 U;  3JRZ A;  3DB3 A;  2GTJ A;  1LNX A;  4JRK A;  5IN1 A;  2O88 A;  2JOY A;  1VQP T;  1MMN A;  2YRC A;  2L3R A;  1VIE A;  2V8J A;  2YT6 A;  3FJ5 A;  1C1A A;  4P5N A;  1KQS P;  2JTE A;  2KSS A;  3SEM A;  1QVP A;  1SG5 A;  5KYU A;  1S72 Q;  4X34 A;  1YJW A;  3SWN A;  4JS5 A;  2JUF A;  1GBQ A;  3CCU A;  1RAF B;  3QYH B;  3MKD A;  2IG0 A;  3RMQ A;  1LOJ A;  3JCM h;  5GAN 3;  3TSW A;  1WPY A;  3H6Z A;  2WSF E;  1VQ4 Q;  3VJP A;  1LCK A;  2LQK A;  2DL8 A;  2QDY B;  1P92 A;  3OYB A;  4ZTJ A;  2VC8 A;  4IUQ A;  2XIC A;  5KYN A;  3OYL A;  2CKK A;  4M7D E;  4A4K A;  1VQK A;  5AT1 B;  3QSU A;  4B9X A;  2LQ8 A;  4QVD A;  1G8X A;  3VS4 A;  1UHC A;  2P4T A;  2RJC A;  4C5I A;  5IAY A;  2K3X A;  2KY9 A;  2F1L A;  4HVV A;  1D0Y A;  1WDX A;  1TSF A;  2MYS A;  4ELZ C;  2X3W D;  4M77 G;  4ZN3 A;  5GAO m;  3RR6 A;  5D6X A;  5LJ5 f;  4FCY A;  1C0M A;  2KT8 A;  2F69 A;  4C8Q C;  2ZPH B;  1Q81 U;  3DKM A;  3GLX A;  3M56 A;  1BI2 A;  4N4H A;  1NE8 A;  3CME Q;  3CPW S;  1WHG A;  1BB9 A;  2BTT A;  2HQE A;  1VQN Q;  5GMK l;  1NLO C;  3C94 A;  5GMK h;  2JZ2 A;  2E6Z A;  2DAQ A;  1U06 A;  3RMS A;  1U5S A;  1BK2 A;  2KK4 A;  2DA9 A;  4M78 D;  1RAC B;  1ZUY A;  2BE7 D;  2RNA A;  4LN2 A;  3G7Z A;  1TXQ A;  1G3W A;  2Z0W A;  2D8J A;  1FXX A;  1R77 A;  3G6E A;  5I22 A;  1B07 A;  2RO0 A;  3HRS A;  3CC2 Q;  1NJI R;  4KUL A;  3M0U A;  1WHH A;  2F5T X;  1MMG A;  2DM1 A;  4RTU A;  4EMK A;  1UDL A;  2QYZ A;  4JDS A;  1Q82 R;  4M78 A;  4XU3 A;  3N5B B;  5KYU B;  1VQ9 A;  1UGQ B;  5EC7 A;  3SWN B;  2M1H A;  2LT1 A;  3S3M A;  3D7S B;  3QDR B;  3FIF A;  1K4U S;  5GAN 2;  1TUG B;  2AIR B;  4DA4 A;  1MMD A;  3RDV A;  2M9U A;  4LDW A;  1UGP B;  1Q7Y U;  1YP5 A;  2CP3 A;  1T3S A;  3CCR Q;  1K0X A;  2JXB A;  1HYO A;  1EZZ B;  2RI5 A;  3M58 A;  4MDX A;  1TUD A;  3CCS A;  2DFU A;  5FW9 A;  1V76 A;  1T0H A;  2CUD A;  1AWX A;  3KXT A;  1K9A A;  2X51 A;  1FYN A;  2ZPG B;  3EG3 A;  1YI2 Q;  2M16 A;  3FB9 A;  2VB6 A;  4AG2 C;  4DBH A;  4N4I A;  4M7A F;  2XG8 D;  2QEX Q;  4X9C A;  2AT1 B;  3TU4 K;  2CP7 A;  1GBR A;  3VS0 A;  3TSZ A;  3EFS A;  4BD3 A;  3X20 B;  3T9N A;  1OU9 A;  3EG9 A;  2CP5 A;  5GAN g;  2BE9 B;  1VQ9 T;  2LNV A;  3E2U A;  3HFN A;  5AYF A;  1SKU B;  1N5Z A;  1O9S A;  1TOV A;  2HBP A;  3P8B B;  2LCC A;  3V7C A;  2CT4 A;  1M90 U;  3HRT A;  1JEG A;  3VKI A;  2MIO A;  4C92 C;  2P4R A;  4M75 D;  1M4Z A;  1NJI C;  3NTK A;  1MHN A;  2EJG A;  2DBK A;  4M77 D;  2K7A A;  4MZM A;  2NUT A;  3CCS T;  1VQM Q;  2RHI A;  1KG1 A;  1Q82 C;  4EMK B;  2DTO A;  2ROT A;  2K5I A;  2HZY A;  4FW2 A;  3CEY A;  4M78 B;  1X2K A;  4MZP A;  1QP3 A;  3JCM X;  4M75 A;  1JJ2 A;  1IB8 A;  3RNJ A;  3HRU A;  4M77 A;  1RL2 A;  4AFQ C;  4NL3 A;  3HFO A;  4LUE A;  4E7K A;  1V29 B;  2JS2 A;  2EYY A;  3JCM d;  2DTI A;  2CZ6 B;  2FZG B;  4DBF A;  4KT0 E;  3M4G A;  1VUB A;  4WF2 A;  3OYD A;  2H3J A;  3UF4 A;  3KBG A;  4RCC A;  1R8O B;  5LJ5 e;  1IRX A;  4PLI A;  1I1J A;  1M1G A;  3I5R A;  4J9I A;  2V26 A;  2LRQ A;  4ZTF A;  4PJO A;  4C8Q E;  3ULR B;  1NLP C;  4ZGJ B;  1EFN A;  1AT1 B;  2J05 A;  3EHQ A;  1PNJ A;  2QA4 T;  3CMA T;  3JB9 F;  3G71 T;  2QK0 A;  1LVK A;  2DVE A;  4L59 A;  2GNC A;  2P0K A;  4J9F A;  2A36 A;  2L2P A;  4XU0 A;  4C5H A;  1W6X A;  5CK9 A;  1AVZ C;  3EG9 B;  2KYB A;  2DXB A;  1U1T A;  4BE2 A;  4C92 G;  3OYM A;  4JJN K;  1UGR B;  4F7U F;  4KGZ B;  3JCM P;  5LJ3 g;  1IHV A;  1OX8 A;  1K0S A;  1ZSZ A;  3RKX A;  4GY5 A;  2FPD A;  1QP2 A;  1BU1 A;  2YUN A;  2G3R A;  4PFO A;  1QCO A;  2NUT B;  1QVG P;  2G6F X;  1YHQ Q;  4NOY A;  3I55 A;  5D6W A;  4TVR A;  4E7S A;  4M75 B;  4C0G A;  4OMF B;  4KGX B;  1D1B A;  4VUB A;  3CC7 A;  3LLR A;  3L42 A;  4M77 B;  2DJZ A;  3OMC A;  5CQX A;  4LXC A;  3CPW A;  1VOM A;  5CCA A;  4OMN A;  3MHX A;  4O5V A;  1RLP C;  2ATC B;  4GLM A;  4HXJ A;  2KMT A;  4NS5 A;  1KK7 A;  2PNI A;  3M0Q A;  1VA7 A;  2WSC E;  1QVF P;  2WSE E;  2RQV A;  4Y92 A;  2HDA A;  1LJO A;  3VS2 A;  1M3B A;  2I2L A;  4PJO B;  1YBY A;  1PSF A;  2YXY A;  1WHK A;  4J83 A;  4PNO A;  4XTW A;  4A4F A;  3MET A;  7AT1 B;  2ZGW A;  3SD4 A;  3OA6 A;  3SWN C;  5GAN f;  1KD1 U;  2FRW A;  2KXC A;  5LL6 S;  3DLM A;  1OUL A;  5CR2 A;  3WVD B;  1Q86 R;  4PJJ A;  3GP8 A;  2JMA A;  3THK A;  1H64 1;  2RJE A;  1X43 A;  1HJD A;  5CO7 A;  1VQ6 Q;  1UFF A;  3QII A;  2E3H A;  5HK0 A;  2D8H A;  2YLB A;  2AKL A;  4HCC A;  1VQP Q;  3VU3 C;  3I9Q A;  2EYZ A;  1K9M R;  2IVW A;  1ZSZ B;  4E6R A;  1N8R U;  4IUU A;  4BI4 A;  2SEM A;  1JBM A;  4IUT A;  1CKA A;  2YSQ A;  1OOT A;  2RJD A;  3M0S A;  4C0D B;  3H8Z A;  2DVJ A;  4BI3 A;  1R0B G;  2J6F A;  3JV3 A;  1HSQ A;  2QG9 B;  4MMK A;  2F2V A;  4BY6 B;  4FL6 A;  2JTF A;  4JRQ A;  1SPK A;  3UPU A;  2EJF A;  1M1F A;  3JB9 G;  1VQ7 Q;  5KE2 A;  3QJ6 A;  3CCM A;  2V8I A;  5CAI A;  2DL5 A;  4BDY A;  1YWO A;  3JSC A;  2KR3 A;  2K2M A;  2EYQ A;  1UUE A;  1ZBX A;  2AK5 A;  2ABL A;  4PKC C;  4Z89 A;  2IPO B;  4E7H A;  5KCO A;  1PHT A;  1ARK A;  3A98 A;  3MPU B;  4M78 C;  5ECA A;  3G4S A;  1I5O B;  4J9C A;  3HTR A;  4FYY B;  2JW4 A;  1YJW Q;  4M7A D;  1Q86 C;  3LWH A;  3CCU Q;  3RUX A;  1S1N A;  2LX9 A;  2EWN A;  2KNB B;  3BE3 A;  3EG2 A;  3UAT A;  2PVD B;  2HNI A;  2VVK A;  4N4G A;  5LJ3 f;  4IUV A;  5GAM g;  1VQO T;  1WJQ A;  4ZNX A;  2EVR A;  4M7A A;  1D0X A;  4AFU C;  1SHF A;  4XAX B;  4L5G A;  1WI7 A;  5GAM j;  2QGF B;  1U1S A;  1K9M C;  1XJW B;  3VS3 A;  2FZC B;  4EMG A;  4UC4 A;  1KFZ A;  2VXF A;  3QZ9 B;  2JM8 A;  1WIE A;  1Y57 A;  2Y4X A;  8AT1 B;  3LX7 A;  5J39 A;  2E10 A;  2RN8 A;  1QKW A;  1QLY A;  2DJQ A;  2YWW A;  2O4X A;  2XDD A;  2D9T A;  4CC2 A;  5I11 A;  2LJ3 A;  4JJB A;  1JXM A;  2QGG A;  3G4S T;  1TWB A;  4C0Z A;  3CCE T;  3JCM b;  1PD0 A;  4FSX A;  1GRI A;  1WXB A;  2EBP A;  1KC8 R;  1MV3 A;  3OYA A;  1BCO A;  2XU8 A;  1A0N B;  5GAN e;  2LCS A;  2RQW A;  3FLG A;  3GOX A;  1KQ1 A;  2RHZ A;  4A63 B;  2GTO A;  2EYW A;  4M78 G;  3J7A F;  2KRS A;  2FHD A;  2A37 A;  4DBQ A;  5I2S A;  1OX9 A;  2O31 A;  3M0T A;  3MO8 A;  4FYV B;  4ORZ A;  3FJP A;  2DMO A;  3JB9 D;  1ZSG A;  4LE9 A;  2CZ0 B;  1VQ9 Q;  4M75 C;  5GAM d;  3EG1 A;  1QQJ A;  4XTX A;  1PG5 B;  4M77 C;  5GAN 7;  1D1A A;  5D7U A;  3OW2 P;  2YLC A;  3UA6 A;  4QVC A;  2V1R A;  2E70 A;  3MP8 A;  4M7A B;  2J7I A;  4KUD K;  8ATC B;  1SSF A;  4XTY A;  3RIR A;  2JVV A;  3CCS Q;  5L23 A;  1OYX A;  4JJC A;  1C6V X;  3VS6 A;  4J7F A;  3A8M B;  2XDB A;  3PTA A;  3P8H A;  3G1J A;  5IHI A;  1U8R A;  2PQW A;  3OQ5 A;  1PRM C;  3LH0 A;  1I07 A;  1D3B A;  2CGH A;  4F7U A;  2DYB A;  1OPK A;  4A54 A;  1G3S A;  3TCJ A;  2R57 A;  2E5Q A;  1IO6 A;  4EMH A;  1M2O A;  4QW2 A;  2O4X B;  1X6O A;  3CCL T;  1Q81 R;  1M8V A;  3OYG A;  2VGN A;  3LWI A;  2GFU A;  3LYI A;  5HCK A;  3PVQ A;  4WCI A;  1KC8 C;  4A4E A;  4JPB W;  1RAA B;  1WA7 A;  1SEM A;  4Q5W A;  1VQL T;  4E7Z A;  5D6Y A;  2FPE A;  1ZSZ C;  4PJL A;  5IH2 A;  2L0A A;  3OYK A;  3G71 Q;  3OBW A;  5LJ3 e;  2OTJ T;  4M75 G;  3M53 A;  2VAS A;  1QWE A;  3EFR A;  4C0D C;  5A0D A;  3VS1 A;  2ZPI B;  2E1H A;  5FWB A;  2LDM A;  2MCN A;  1MND A;  3SB2 A;  1IHW A;  2DL4 A;  3CCV T;  4CC3 A;  1SF9 A;  3C0C A;  4KBM B;  3S3N A;  3DLL A;  4JJD A;  1YNZ A;  4R0K A;  1BIB A;  2FL7 A;  2M0Y A;  3R6N A;  1FMW A;  4A4H A;  2MMP A;  1JB0 E;  2LJ1 A;  3FRN A;  4PJO G;  4CC7 A;  4C5G A;  2HBW A;  2RB6 A;  3L2Z A;  1NM7 A;  4C0F A;  1M5Q 1;  2DXT A;  1VYV A;  3GBQ A;  3CCQ T;  2ENM A;  1G83 A;  2QTX A;  3CXC S;  3A8L B;  2MWO A;  1RLQ C;  4E47 A;  1QCN A;  1X27 A;  2GF7 A;  2GCX A;  3X26 B;  2KYM A;  2E41 A;  4J7I A;  2VUB A;  3EFO A;  4RTX A;  1D3B B;  2E65 A;  1X6G A;  4PJN A;  4F7U B;  1GCQ A;  3V7S A;  4RTV A;  1YWP A;  4F16 A;  2GGR A;  1Q81 C;  1WGS A;  2E12 A;  4M7D A;  4E2F B;  4E7L A;  2CT3 A;  4AT1 B;  2KXD A;  1NYF A;  1UEC A;  2PUO B;  3JCM g;  3M57 A;  3L2U A;  1HK9 A;  2EFI A;  2J6K A;  4X9D A;  3EAE A;  1M90 R;  2JNG A;  4F04 B;  3M59 A;  4A53 A;  1ZBJ A;  2GQV A;  4LDV A;  4Y91 A;  3OYH A;  3MEV A;  2LJ0 A;  4OGE A;  1WQ7 A;  2LX7 A;  2QTV A;  1AZE A;  3NTH A;  1UTI A;  3EG0 A;  4J6X A;  3QYG B;  4JZ3 A;  3HSB A;  3I55 Q;  1KHI A;  5GAO q;  1K73 R;  2MI6 A;  2ZZD A;  4PJM A;  4II1 A;  1Y96 A;  1VQ8 T;  3OYF A;  3CC7 Q;  3CPW P;  5GAN 4;  5A0G A;  3NMZ C;  1RAG B;  4XTV A;  3SFM A;  3FC3 A;  1Z9Z A;  2W10 A;  3MP6 A;  3CC4 A;  5CQY A;  2QA4 A;  1PCX A;  3CMA A;  1YFN A;  1UE9 A;  3G71 A;  2DRK A;  2LMJ A;  2OTL A;  3NGP A;  5GMK j;  4EIK A;  1MUZ A;  2MPX C;  2L3S A;  3MEU A;  3QUI A;  3X25 B;  1ABO A;  2E3I A;  2M02 A;  3EFO B;  1J3T A;  1FMV A;  4Y28 E;  9ATC B;  2RHY A;  3A8O B;  2H8H A;  2B8A A;  1HD3 A;  4PJO D;  5GAO r;  2DIL A;  2RHX A;  3UT1 A;  5KE3 A;  2D0Q B;  2X9H A;  4RUG A;  4FYX B;  2DE0 X;  2DD5 A;  3PFS A;  2HCK A;  4OMM A;  1M3A A;  3FEO A;  1YIJ A;  4M7A C;  1M90 C;  3H0F A;  5GAM e;  4OMP A;  3QXE B;  3OS0 A;  1VQ4 T;  4IIM A;  3CC4 T;  4XK8 E;  3VRY A;  2XDP A;  1RI0 A;  1QVF S;  5IT9 E;  2OTL T;  2YUQ A;  2YUO A;  1XQH A;  1K73 C;  2O9S A;  4PL6 A;  4AMC A;  2HSE B;  1RAD B;  1SHG A;  1CKB A;  2FO0 A;  2NUZ A;  3MJX A;  1RI9 A;  4Z88 A;  1Y96 B;  2RK2 A;  3BDL A;  5EG2 A;  5FRN A;  3OBY A;  2CUB A;  3HKS A;  3CCM Q;  4BUG A;  2DRM A;  3GIB A;  3PMT A;  5GAO l;  2JM9 A;  2LNH B;  3CD6 A;  3EGD A;  1VQN T;  1G5V A;  3AT1 B;  2AZV A;  1YIJ T;  2C06 A;  1UHF A;  3CBM A;  1QMC A;  2DET A;  1UG1 A;  2I0N A;  1PKT A;  1BBZ A;  1NEB A;  2YUP A;  3JB9 I;  2RA2 A;  1YIT A;  1KD1 R;  2NUP A;  4RTT A;  3LH5 A;  3G4S Q;  4OF1 A;  4HVW A;  4FU6 A;  3CC2 T;  4PLL A;  3JCM f;  2DIQ A;  2XID A;  3O5Z A;  4M7A G;  1GXI E;  1NYG A;  5KYY A;  1ACM B;  3CPF A;  4C8Q A;  3JB9 J;  3INZ A;  4ZGD B;  2CH4 A;  3C4S A;  3L1A A;  2HQX A;  2NWM A;  3GNF B;  4OB0 B;  1KHC A;  2VXE A;  3NFC A;  2K57 A;  2XD0 A;  2RI2 A;  4JZ4 A;  5KYW A;  2R58 A;  1ZA1 B;  1N8R R;  3CCJ T;  3KFV A;  3CCR T;  3CXC A;  4CRI A;  1ZLM A;  2PVG B;  4MDW A;  2OI3 A;  2COZ A;  5I2M A;  2KI7 A;  3CD6 T;  2QQR A;  2K4Y A;  3ASK A;  4DEX A;  2DER A;  4BE0 A;  2DEQ A;  4C92 E;  1WHJ A;  2K3B A;  1AD5 A;  1GCP A;  4J9D A;  1YIT T;  3O8V A;  5LJ5 h;  2DTH A;  5I21 A;  1HXD A;  3OYI A;  1H8K A;  1V1C A;  2Y4Y A;  1KQ2 A;  1K8A U;  1SSH A;  3KUF A;  4M7D F;  5CKD A;  1SRL A;  2CP0 A;  4K11 A;  1Y71 A;  3QO3 A;  2E5K A;  4D8D A;  2XK0 A;  3EGD B;  4MZT A;  2D6F A;  2YDL A;  2ZPB B;  1IXD A;  1U3O A;  3ZFJ A;  2EAY A;  1VQO A;  1PWT A;  5GAN 8;  2EPD A;  1W2B S;  4BB7 A;  3EGU A;  3X28 B;  2ECZ A;  2NUP B;  3NTI A;  4OB1 B;  1QCF A;  2KVQ G;  5CKB A;  1JRI A;  4LDU A;  1M1K R;  3OYE A;  3M55 A;  1ZX6 A;  3L2V A;  1H92 A;  5DLQ E;  3QG1 A;  5KYY B;  2ED1 A;  1VQL Q;  3UA7 A;  1WHM A;  1YJN T;  2LQW A;  2D1X A;  1BI0 A;  3E19 A;  4XTZ A;  2OTJ Q;  1N8R C;  5KYW B;  4EMK C;  2HAX A;  2VYT A;  4F7U G;  2VKN A;  5L8R E;  5A0L A;  3CCE A;  2KQW A;  5HY6 A;  1TU0 B;  5GMK m;  1F1B B;  4RG8 A;  4QQ6 A;  2C0O A;  1GCQ C;  1QVG A;  2E6N A;  4OP0 A;  2CSQ A;  2JN0 A;  5GJW B;  3WXM B;  2A0F B;  2COY A;  2A7Y A;  3QHS A;  3VYH B;  2HSP A;  2MF2 A;  1I81 A;  1OZ3 A;  1AHJ B;  5CIU A;  2CYZ B;  5CKH A;  5HK3 A;  4N0A A;  3PT9 A;  3CCQ Q;  4FYW B;  1JO8 A;  4L6V 5;  3JCM e;  1M2V A;  1W4S A;  6AT1 B;  2FPF A;  4FSS A;  2RH2 A;  5LJ5 j;  1E7O A;  1D1C A;  1QVF A;  1VQ5 T;  1WZO A;  1KQS S;  2IIM A;  2GFA A;  1BKB A;  5GMK i;  1AEY A;  3I5S A;  3L2R A;  2RF0 A;  1NZ9 A;  1OZ2 A;  2L3P A;  4HT9 A;  1M1K C;  1KSW A;  3HHT B;  4LD6 A;  4F17 A;  3MEA A;  2JS0 A;  3ZBD A;  2EIF A;  2K5F A;  1LPL A;  3CCL A;  2PVO B;  1VYU A;  2B86 A;  4XQ3 A;  5GMK e;  3GNG A;  2A28 A;  3DB4 A;  2QQS A;  1TUC A;  2DEU A;  4KH0 B;  4M7D G;  1E6H A;  1VQ8 Q;  3EH2 A;  3M5A A;  2JTM A;  4M4Z A;  3PNW C;  4E7I A;  4B9W A;  1VQL A;  3OYY A;  1BI1 A;  1X6B A;  2F5K A;  2JMC A;  4FT2 A;  5LJ5 d;  2OTJ A;  3PE0 A;  2BIV A;  1D0Z A;  1M3C A;  4RTZ A;  1OI1 A;  4ZGE B; 
#chains in the Genus database with same CATH homology
 3BW1 A;  5FU7 B;  3M59 A;  2BKD N;  4A53 A;  2KDS A;  1MGQ A;  4C92 A;  4PJO C;  2YHT A;  1VQ6 T;  2GQV A;  2MWP A;  4LDV A;  3QPH A;  2BUD A;  4JLI A;  4Y91 A;  3OYH A;  4JUV A;  4HT8 A;  3PGG A;  4C8Q F;  2DXU A;  3MEV A;  2FB7 A;  3CCV A;  1K9M U;  3RKX A;  4GY5 A;  3TRE A;  1NPP A;  2V8K A;  3P8D A;  3VUZ A;  1QP2 A;  3LGF A;  3JB9 H;  4OGE A;  1WQ7 A;  4HCB A;  2G3R A;  2LCL A;  1YHQ A;  4V2S A;  1IZ6 A;  1I5L A;  3NTH A;  3L2W A;  4NOY A;  3GPL A;  3I55 A;  4J6X A;  5D6W A;  5GAN 5;  3QYG B;  1N27 A;  4JRI A;  3HSB A;  4M7D C;  4HKE A;  2DXC A;  5C0M A;  4TVR A;  1KHI A;  4QVZ A;  4OB3 B;  4M75 B;  1K8A C;  1N9S A;  4C0G A;  4OMF B;  2MI6 A;  2ZZD A;  5GAO q;  3VUB A;  3M4Y A;  2XHC A;  1TH7 A;  4VUB A;  3JCM V;  3HPW A;  4II1 A;  3CC7 A;  4DOW A;  3F70 A;  3LLR A;  1Y96 A;  3L42 A;  4M77 B;  2DJZ A;  3OMC A;  4YTL A;  3OYF A;  3CCQ A;  3JAM E;  5CQX A;  1VQ8 T;  4J6Y A;  5GAN 4;  3CPW A;  5A0G A;  4M78 E;  3J80 E;  5CCA A;  1BI3 A;  4XTV A;  3LW5 E;  3MHX A;  4O5V A;  3SFM A;  5DM7 R;  3FC3 A;  2RM4 A;  3OW2 S;  2RK1 A;  5LJ5 g;  3MP6 A;  3CC4 A;  5CQY A;  1M1K U;  2QA4 A;  2KMT A;  3QKJ A;  3CMA A;  3MP1 A;  3G71 A;  4NS5 A;  3PIP A;  1ZQ1 A;  4M75 F;  3TEE A;  2OTL A;  3J81 E;  2WSC E;  4NL2 A;  2WSE E;  4OB2 B;  4M77 F;  4R56 A;  2DO3 A;  3C95 A;  3PIO A;  1LJO A;  1O75 A;  2DZ9 A;  5GMK j;  2I2L A;  1VQ7 T;  3FDR A;  4PJO B;  1YCY A;  1YJ9 T;  3CCM T;  1YBY A;  3MEU A;  2VGM A;  3QUI A;  3X25 B;  2L5Q A;  4HA8 A;  1PSF A;  5GAM f;  4RG2 A;  4J83 A;  4PNO A;  1W2B A;  4XTW A;  4A4F A;  3MET A;  2DK3 A;  2ZGW A;  3SD4 A;  2FYK A;  4BY6 C;  3OA6 A;  3SWN C;  5GAN f;  1KD1 U;  5CR2 A;  4Y28 E;  3DLM A;  5LL6 S;  3OS1 A;  2LTO A;  5DY9 A;  3WVD B;  5GAN h;  2RHY A;  3S3O A;  1PSE A;  3A8O B;  3URG A;  3GP8 A;  3CBP A;  2B8A A;  2YRV A;  1H64 1;  1YHQ T;  2RJE A;  4PJO D;  5CO7 A;  2RHX A;  3BY7 A;  5GAO r;  3UT1 A;  1VQ6 A;  5KE3 A;  2D0Q B;  3OS5 A;  2LC4 A;  4PJO F;  4RMO A;  4DA4 A;  1WQW A;  2DD5 A;  3PFS A;  4XU2 A;  4F7U E;  2K2V A;  3FEO A;  3PMI A;  3QII A;  1YJW T;  3OB9 A;  5FRO A;  1YIJ A;  5FRM A;  5HK0 A;  3CCU T;  1VQP A;  2YLB A;  5C6S A;  4MML A;  4M7A C;  1M90 C;  4HCC A;  1ZHI A;  2QXF A;  4IUR A;  3VU3 C;  4JLG A;  5GAM e;  2QQB A;  5J26 A;  1XNI A;  1BIA A;  2EKO A;  3QXE B;  1UEB A;  2RHU A;  3OS0 A;  2X4J A;  1VQ4 T;  4M7D D;  4LD9 K;  4C92 B;  2IVW A;  3MEW A;  3CC4 T;  3OSS C;  3RES A;  1N8R U;  4IUU A;  4XK8 E;  1H3Z A;  4ATO A;  4ELY C;  3HP9 A;  2K5L A;  4BI4 A;  1VQ8 A;  1JBM A;  4IUT A;  4EDU A;  2XDP A;  4A4G A;  1RI0 A;  1QVF S;  1X75 C;  4RKU E;  3RKW A;  5KH6 A;  3E9F A;  5IT9 E;  2OTL T;  3OSV A;  2RJD A;  4LDX A;  4C0D B;  3H8Z A;  5CVI A;  4BI3 A;  3OS2 A;  2A3L A;  2RI3 A;  5FU6 B;  1XQH A;  4J5Y A;  1VQK T;  2ZCF B;  2LVM A;  2X4Y A;  3A5Z B;  4PL6 A;  1K73 C;  1JJ2 S;  4MMK A;  2DKG A;  4C92 F;  2L8D A;  1X01 A;  4XU1 A;  3Q1J A;  4FL6 A;  4BY6 B;  3I56 A;  2JTF A;  4GLK A;  4JRQ A;  4R55 A;  3UPU A;  1Y96 B;  2RK2 A;  4JS4 A;  5HKC A;  1VQ7 A;  2EJF A;  1M1F A;  3JB9 G;  3BDL A;  4IUP A;  5EG2 A;  5GAO p;  4BAC A;  3BDU A;  1YJ9 A;  5FRN A;  3OBY A;  2CZ7 B;  5KE2 A;  3QJ6 A;  3CCM A;  2V8I A;  3HKS A;  5CAI A;  2QQA A;  3RER A;  3AHU A;  4M75 E;  3JRZ A;  3DB3 A;  1KC8 U;  3OW2 A;  2XI9 A;  4BUG A;  4BDY A;  3GIB A;  2QQ9 A;  3PMT A;  3JSC A;  5GAO l;  2AHJ B;  1LNX A;  2EYQ A;  4M77 E;  1ZBX A;  4C5E A;  3CD6 A;  4JRK A;  3A8G B;  1VQN T;  5IN1 A;  1G5V A;  2JOY A;  1YIJ T;  4PKC C;  2C06 A;  1VQP T;  4E7H A;  3CBM A;  1NJI U;  2L3R A;  1VIE A;  2V8J A;  5KCO A;  3CBO A;  3HL8 A;  2PU9 B;  4P5N A;  1S72 A;  3GF5 A;  2KSS A;  1KQS A;  1QVP A;  3JB9 I;  2RA2 A;  1YIT A;  4M78 C;  3G4S A;  4X34 A;  1Q82 U;  2MAM A;  5KCH A;  3SWN A;  4JS5 A;  1YJW A;  1Q7Y C;  2JUF A;  4OF1 A;  3CCU A;  4FU6 A;  3CC2 T;  4PLL A;  4M7A D;  3G6E T;  3QYH B;  1Q86 C;  2IG0 A;  3RMQ A;  3LWH A;  3JCM f;  2DIQ A;  5FLX E;  4C8Q G;  2XID A;  3RUX A;  1LOJ A;  3JCM h;  2LX9 A;  2EWN A;  3WVE B;  5GAN 3;  4PJO E;  1WPY A;  3H6Z A;  1VQ4 A;  3V7R A;  2WSF E;  4M7A G;  1GXI E;  3M54 A;  2PVD B;  2HNI A;  1XTD A;  4N4G A;  5LJ3 f;  3VJP A;  4IUV A;  3CPF A;  5GAM g;  1VQO T;  4C8Q A;  5LJ3 h;  2DPP B;  3INZ A;  2LQK A;  4ZGD B;  3JB9 J;  2QDY B;  3C4S A;  3L1A A;  1WJQ A;  2HQX A;  2XKO C;  5LJ3 g;  4M7A A;  1P92 A;  3OYB A;  4BI8 B;  3R6O A;  2EQM A;  3I56 T;  4J6W A;  4L5G A;  3GNF B;  4OB0 B;  4XAX B;  1KHC A;  2VXE A;  3NFC A;  5GAM j;  1BYM A;  2VC8 A;  1WJR A;  1U1S A;  4IUQ A;  2K57 A;  2XIC A;  2RI2 A;  2XD0 A;  3QJY A;  3OYL A;  2CKK A;  2DIG A;  4M7D E;  5GAN j;  4A4K A;  3JCM J;  2R58 A;  1K9M C;  3V8K A;  1VQK A;  3CCJ T;  3QSU A;  2QI2 A;  1UGS B;  3CCR T;  4B9X A;  2LQ8 A;  3CXC A;  4CRI A;  4QVD A;  4EMG A;  2PVG B;  4UC4 A;  2EJ9 A;  2P4T A;  4MDW A;  2RJC A;  4C5I A;  2VXF A;  3QZ9 B;  5IAY A;  2K3X A;  1G3Y A;  5I2M A;  2KY9 A;  3CD6 T;  2HD0 A;  2EQU A;  2K3Y A;  2QQR A;  1QVG S;  5CKE A;  2K4Y A;  2Y4X A;  3ASK A;  4ME7 A;  3QZ5 B;  3LX7 A;  5J39 A;  2E10 A;  4BE0 A;  2DEQ A;  4C92 E;  3C12 A;  2O4X A;  4ELZ C;  2D9T A;  2XDD A;  3OYC A;  2DD4 A;  4E7J A;  4M77 G;  4M7D B;  2Y90 A;  1S72 T;  4ZN3 A;  5GAO m;  4EPC A;  5LJ5 f;  5D6X A;  1YIT T;  4BE1 A;  1B34 A;  3O8V A;  2F69 A;  5CKF A;  4C8Q C;  3G4S T;  3CME A;  4C0Z A;  5LJ5 h;  1N6A A;  2ZPH B;  1Q81 U;  3DKM A;  3GLX A;  3M56 A;  1BI2 A;  4N4H A;  1VQN A;  1NE8 A;  3CPW S;  2DTH A;  3JCM b;  5I21 A;  4FSX A;  2HQE A;  1HXD A;  5GMK l;  3OYI A;  1K73 U;  3C94 A;  3JCM c;  1I4K 1;  4Z02 A;  5GMK h;  2JZ2 A;  2Y4Y A;  2E6Z A;  2DAQ A;  1KQ2 A;  3RMS A;  4XTU A;  3OYA A;  1K8A U;  2XU8 A;  4N0A C;  2M0O A;  2KK4 A;  2WAC A;  4M78 D;  2RD1 A;  3KUF A;  4J8O A;  5FU7 C;  5GAN e;  4M7D F;  3G7Z A;  5CKD A;  3CCE T;  3FLG A;  3GOX A;  1G3W A;  1KQ1 A;  3CC2 A;  1Y71 A;  2RHZ A;  1FXX A;  3QO3 A;  3G6E A;  4RCB A;  1EIF A;  2RO0 A;  3HRS A;  4M78 G;  2X35 A;  2XK0 A;  4KUL A;  4MZT A;  4DQ2 A;  3J7A F;  5DLO A;  4QQD A;  3M9Q A;  1UB4 A;  2FHD A;  2F5T X;  3X24 B;  2D6F A;  1FX7 A;  2ZPF B;  4EMK A;  2ZPB B;  3ZFJ A;  2EAY A;  2L89 A;  4JDS A;  5I2S A;  1VQO A;  4M78 A;  5GAN 8;  3MO8 A;  4XU3 A;  3N5B B;  1W2B S;  3FJP A;  3JCM W;  2VV5 A;  4BB7 A;  3X28 B;  3OYN A;  1VQ9 A;  1UGQ B;  3JB9 D;  3NTI A;  3SWN B;  2M1H A;  2LT1 A;  2ZPE B;  2CZ0 B;  4OB1 B;  4FIB A;  4M75 C;  3S3M A;  5GAM d;  3QDR B;  1QW1 A;  3FIF A;  1M9S A;  5GAN 2;  2KVQ G;  2NLU A;  5CKB A;  1JRI A;  4LDU A;  4M77 C;  4XTX A;  5J3B A;  5GAN d;  5GAN 7;  2M9U A;  4LDW A;  4OGC A;  1UGP B;  3OYE A;  3CCJ A;  1Q7Y U;  3M55 A;  3CCR A;  4DOV A;  3L2V A;  5DLQ E;  3QG1 A;  2CZ1 B;  3S6W A;  2YLC A;  2RI5 A;  4QVC A;  1YJN T;  5GAO n;  3MP8 A;  2E70 A;  2X4X A;  4FT4 A;  3VYG A;  3M58 A;  4MDX A;  3CME T;  4M7A B;  1BI0 A;  2KAF A;  3ME9 A;  4KUD K;  1SSF A;  3CCS A;  4XTY A;  2P0Q A;  3E19 A;  3RIR A;  4XTZ A;  2JVV A;  1N8R C;  1OYX A;  3BFM A;  1YI2 A;  3V8L A;  4EMK C;  2HAX A;  3KXT A;  4IKF A;  2VYT A;  3LGL A;  4J7F A;  4F7U G;  3A8M B;  2ZPG B;  5L8R E;  3PTA A;  3OMG A;  3OY9 A;  3P8H A;  3JCM Q;  2XDB A;  2M16 A;  3MCA B;  4C8Q D;  5A0L A;  1DJ7 B;  3CCE A;  1U8R A;  2PQW A;  2KQW A;  3A8H B;  3FB9 A;  5HY6 A;  4JRP A;  3OQ5 A;  5LJ3 j;  3LH0 A;  2EQK A;  1D3B A;  2CGH A;  5GMK m;  4F7U A;  4RG8 A;  4QQ6 A;  3E9G A;  4A54 A;  1G3S A;  4N4I A;  2QEX A;  4M7A F;  2XG8 D;  3TCJ A;  2E64 A;  3UDC A;  4X9C A;  2R57 A;  2E5Q A;  1QVG A;  2E6N A;  2X4W A;  3TU4 K;  4EMH A;  4OP0 A;  4QW2 A;  2JN0 A;  2O4X B;  3WXM B;  1X6O A;  4ZN1 A;  3CCL T;  3EFS A;  4BD3 A;  3X20 B;  1M8V A;  3T9N A;  3OYG A;  1I8F A;  2VGN A;  1B34 B;  3LWI A;  2A7Y A;  3QHS A;  5GAN 6;  5GAN g;  1VQ9 T;  3VYH B;  2LNV A;  2MF2 A;  2GFU A;  3LYI A;  1IRE B;  1I81 A;  1OZ3 A;  3HFN A;  1Y07 A;  4OVA A;  5AYF A;  1N9R A;  1AHJ B;  1KC8 C;  4A4E A;  4D6W A;  5CIU A;  2CYZ B;  5CKH A;  3VV0 A;  5HK3 A;  4N0A A;  3PT9 A;  1O9S A;  2HBP A;  3P8B B;  2OTJ A;  2LCC A;  4L6V 5;  3V7C A;  2PUK B;  4Q5W A;  1VQL T;  3UWN A;  1M90 U;  3JCM e;  1W4S A;  3HRT A;  5A2Q E;  5D6Y A;  3VKI A;  4C92 C;  4M75 D;  1M4Z A;  1NJI C;  1FWZ A;  1MHN A;  3NTK A;  3SDZ A;  2EJG A;  3RKY A;  3OYK A;  3OBW A;  2RH2 A;  1VQM A;  5LJ5 j;  4M77 D;  5LJ3 e;  2OTJ T;  4MZM A;  3CCS T;  4M75 G;  1NPR A;  1QVF A;  1VQ5 T;  2RHI A;  3M53 A;  1KG1 A;  1Q82 C;  4EMK B;  2DTO A;  1KQS S;  1WNL A;  2K5I A;  3EFR A;  4C0D C;  2GFA A;  3CEY A;  4M78 B;  5A0D A;  1YI2 T;  1YJN A;  4MZP A;  2ZPI B;  2E1H A;  1QP3 A;  3JCM X;  1BKB A;  5GMK i;  5FU6 C;  2LDM A;  4M75 A;  1G3T A;  3L2R A;  1JJ2 A;  1NZ9 A;  5GAM h;  3SB2 A;  3HRU A;  1OZ2 A;  4M77 A;  1RL2 A;  4NL3 A;  3CCV T;  3HFO A;  4HT9 A;  4E7K A;  2QEX T;  1M1K C;  1V29 B;  4KBM B;  4LDY A;  3S3N A;  5M9O A;  3DLL A;  3JCM d;  3HHT B;  4FM4 B;  4LD6 A;  2DTI A;  2CZ6 B;  1BIB A;  2FL7 A;  3QBY A;  4KT0 E;  4M78 F;  4A4H A;  3M4G A;  3MEA A;  3ZBD A;  4CI0 C;  3I55 T;  1VUB A;  2EIF A;  4WF2 A;  5LJ3 d;  2MMP A;  3OYD A;  1JB0 E;  3V8J A;  2H3J A;  3FRN A;  2K5F A;  4PJO G;  4C5G A;  2R5M A;  2RB6 A;  3L2Z A;  4O6J A;  4C0F A;  3CC7 T;  1M5Q 1;  2DXT A;  2CS7 A;  3KBG A;  4RCC A;  3ZEH A;  1R8O B;  5LJ5 e;  3CCQ T;  4PLI A;  1M1G A;  2QTX A;  3CCL A;  2LRQ A;  2PVO B;  3CXC S;  4ZTF A;  4PJO A;  4C8Q E;  3A8L B;  1KD1 C;  2MWO A;  4XQ3 A;  4E47 A;  4ZGJ B;  5GMK e;  2OAU A;  3GNG A;  3DB4 A;  4M7A E;  2GF7 A;  2GCX A;  3X26 B;  2QA4 T;  1XOV A;  3CMA T;  2QQS A;  2E41 A;  4J7I A;  2VUB A;  3G71 T;  3JB9 F;  1Y7X A;  4BDZ A;  4M7D G;  1D3B B;  2E65 A;  3OYJ A;  4F7U B;  2RJF A;  3V7S A;  1VQM T;  3M5A A;  2JTM A;  3PNW C;  4E7I A;  4B9W A;  1VQL A;  2DVE A;  3OYY A;  4L59 A;  1Q81 C;  1WGS A;  1Q86 U;  1BI1 A;  2E12 A;  2DZC A;  2F5K A;  2P0K A;  4FT2 A;  4M7D A;  4C5H A;  4XU0 A;  4C92 D;  4C8Q B;  4KUI A;  5CK9 A;  4E7L A;  3L2Q A;  3E1S A;  2FVU A;  2PUO B;  2O01 E;  2DXB A;  4HCZ A;  3JCM g;  5LJ5 d;  3M57 A;  4ZTJ A;  1U1T A;  2R5A A;  1HK9 A;  4C92 G;  3L2U A;  4BE2 A;  3OYM A;  4JJN K;  1UGR B;  3ER0 A;  1VQ5 A;  2EFI A;  2P0P A;  2BIV A;  1WJS A;  4X9D A;  4F7U F;  3EAE A;  4QQG A;  1OI1 A;  4ZGE B;  2EQJ A;  2LT4 A;  3JCM P;  2JNG A;  1VIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...