1UB4A

Crystal structure of mazef complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
110
structure length
103
Chain Sequence
b'VSRYVPDMGDLIWVDFDPGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MazF protein
publication title Crystal Structure of the MazE/MazF Complex. Molecular Bases of Antidote-Toxin Recognition
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 27
structure length 103
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ub4A00
5CO7A 1VUBA 3G7ZA 4MZPA 2MF2A 1M1FA 1NE8A 4ELZC 4VUBA 2VUBA 4HKEA 4MZMA 5DLOA 4OF1A 3JSCA 5CKFA 5CCAA 4ME7A 5CKHA 5CKBA 5CKEA 5CK9A 5HK3A 1X75C 5HK0A 5CQXA 3NFCA 3HPWA 3TCJA 2C06A 3JRZA 4ELYC 5HKCA 4MDXA 1UB4A 4MZTA 5CQYA 5CR2A 2KMTA 5CKDA 3VUBA
chains in the Genus database with same CATH superfamily
4MMLA 4C5EA 5KYUA 1KHCA 3PIOA 1YP5A 4N4IA 3L42A 2COYA 3TSZA 1PC0A 3UF4A 2CYZB 5GAMf 2E41A 2DRMA 1WIEA 2RD1A 2C0TA 5FU6C 4M7AA 1WXBA 2D1XA 1VQ9Q 5GAMe 1H641 5LJ3g 3CC2Q 2YT6A 4X9DA 2NUPB 3M4GA 4HCZA 3DLLA 1FMVA 3IQLA 4C8QD 4KULA 2DL5A 3QWYA 3JCMc 3G4ST 1HYOA 3OYBA 2KT8A 3QHSA 1HK9A 4KBMB 2A37A 3CQTA 2NUTA 2V8IA 4M7AE 1Q81R 2K5FA 4J6XA 4AG2C 2OTJA 4GBQA 1WQWA 1LJOA 4A4KA 4N0AA 4C8QB 4C0DB 3V8KA 2LJ0A 1GCQA 2RHYA 4J9CA 2EGAA 1ZUKA 2C06A 3H8ZA 5KYYA 2L3QA 1VQ8Q 1QVGS 1JJ2P 1WHHA 2YSQA 2COZA 2DJZA 5FU7B 1WPYA 4M7DE 3GIBA 2J6KA 2K79A 2GQIA 2DJQA 3DB4A 2DM1A 4JS5A 2K5LA 2O88A 1A0NB 2E6ZA 1BIAA 5GAOp 5FW9A 1VQ9A 4PLLA 2EAYA 2EQUA 1QKXA 1E6HA 1UUEA 1H92A 3CD6T 3FDRA 2KK4A 2P4TA 4C8QF 4QVCA 1RI0A 4QVZA 1BBZA 3CC7T 1ZHIA 5GANj 2EKHA 4F7UE 1AWOA 3VRZA 1VQKQ 4A4EA 3JCMf 2G3RA 1GRIA 1FWZA 4E47A 4D6WA 2VGMA 4QT7A 2RA2A 4GY5A 2FL7A 3JCMe 4XU3A 3ASKA 2CH4A 2DETA 1UG1A 3LWHA 3FB9A 2D8JA 2NWMA 4KGZB 2DEQA 1C6VX 1Q7YR 2RJCA 5L8RE 3AT1B 1VQ8A 5GANf 1QCFA 1LNXA 3G6ET 3TQ7P 3VJPA 3TSWA 3CPWA 1BYMA 3CPFA 5IXFA 1I1JA 1LOJA 3LH0A 4OMFB 2QGFB 4EMGA 1UJ0A 4QQ6A 2HSPA 3RNJA 1NZ9A 3H0IA 3P8BB 4F17A 1CSKA 2K4YA 2SRCA 4AFZC 3CMEQ 2ESWA 2NUPA 4EMHA 3CC4Q 2KQWA 2XMFA 5L23A 1YJNQ 4HKEA 4C92F 1RUWA 2DYBA 1WYXA 1BI3A 3CBPA 3CCRT 2LCLA 1VQKA 4XTVA 3S3OA 3UPUA 3LYIA 1PM3A 3OYHA 2RQVA 2FO0A 2M16A 3NGPA 5KCOA 1KQSS 1S72T 3A5ZB 2DD5A 3QYHB 2FB7A 2RQRA 3A8GB 5GAOm 2QQRA 4JPBW 4XAXB 1KIKA 4A53A 3JCMQ 1U3OA 3QJ6A 4C8QA 4ZGEB 4BI4A 2CKKA 1YIJT 3G4SQ 2ABLA 2D9TA 2JTEA 3MP1A 1MUZA 2CSIA 3GNGA 2XICA 2RHIA 2QDYB 1VYTA 2VXFA 2DVJA 2LQWA 1K9MC 1D1AA 2BTTA 2V8JA 1WQ7A 1IGQA 4J8OA 2B8AA 2RB6A 3JCMP 1NBEB 4JRQA 1MGQA 2DL4A 3GP8A 3FC3A 5KYNA 3CMEA 4NS5A 1WGSA 3MO8A 2VWFA 2YLCA 3E9FA 2JTMA 4EMKC 1I4K1 5A0DA 3JCMJ 3O5ZA 5GAN3 3OYFA 1K73C 1M8VA 4XU1A 2CZ1B 2DPPB 2KY9A 1YITT 2MMPA 2M0OA 5A0LA 1IGUA 2M9UA 3MJXA 1UEBA 2M1HA 1KD1U 1WJRA 2K7AA 2PVGB 1VQPT 4JRKA 2ZPEB 1Q82C 4M78E 4PFOA 1PD0A 2EPDA 2IG0A 3NPFA 4IUPA 4IUVA 3CD6Q 2LX9A 1WI7A 2QGGA 4KGVB 1ZSGA 3G4SA 1K8AR 4M75C 1QWFA 3CC7Q 3AHUA 2E3IA 1JB0E 3OYKA 2RM4A 1MNEA 3RIRA 2RJDA 1KK7A 1ZSZA 1RAGB 3M9QA 1JBMA 3OYDA 3QJYA 3RKYA 4D8DA 2XDPA 5IH2A 1M30A 1OQKA 4R55A 4P5NA 2HQHA 2DFUA 2E10A 1N8RU 4RKUE 4DEYA 1K4US 1ZUYA 3RKWA 1IO6A 2KI7A 2GBQA 1KQ2A 3RR6A 5IT9E 1VQ6T 1C0MA 2EYYA 3VS1A 1Y96B 5CCAA 3G6EQ 4M4ZA 4JUVA 3THKA 1MMGA 4CC3A 4C92G 4FIBA 1NYGA 3BFMA 2O31A 1UFFA 1NYFA 3GLXA 1U5SA 1D3BB 4ZGDB 1RAEB 2PUOB 5GAOn 4ZTJA 5DM7R 1OPLA 4E7ZA 1W1FA 3UT1A 1M1FA 4XTWA 4HVWA 3EG2A 1SKUB 2KGTA 4GLMA 4AG1C 3L1AA 4IURA 3CD6A 1WHGA 4R56A 4PJOE 3QZ9B 4ELYC 2DTIA 3CC7A 2HSEB 1KQSA 1ZQ1A 2LC4A 3EGDA 2PNIA 1YJWQ 1VQNT 1X43A 4RCCA 1EIFA 3LW5E 1X2KA 3QWXX 1UDLA 2RJFA 2QK0A 1YWPA 4KT0E 3MP8A 2P4RA 3X25B 3KUFA 3URGA 3MCAB 5KYXB 4A63B 3GNFB 1U1SA 4M7DD 1SRMA 5GAN7 2I0NA 2HQXA 1NJIC 1TUCA 1VQMT 2DK3A 3OBWA 5I2MA 2E4HA 3MKDA 1Y7XA 3M55A 4RMOA 3G6EA 2JOYA 3OYGA 5GMKm 4CC7A 3OYYA 1NM7A 4IKFA 2VGNA 3SDZA 3HPWA 1OULA 2F69A 4PNOA 5KE3A 2F2VA 4F14A 1YWOA 2DBMA 1I5LA 2J6OA 2DKGA 1KHIA 1OU9A 3PIPA 4M7DB 3QZ5B 2AZSA 3FJ5A 1TS9A 1SG5A 1ZUUA 4PJMA 2LNHB 3I9QA 5GMKe 3LGLA 3A1PA 1Y0MA 2RI3A 4FCYA 3J7AF 2X9HA 2PU9B 4M77C 2F5TX 4Z02A 1OZ2A 3FEOA 2GFAA 4M7AF 2VC8A 2ZAEA 1R0CB 1IZ6A 1M90U 3CCEQ 2EQIA 4WTOB 3CCVQ 2YRCA 2JXBA 2EQMA 1YITQ 2QI2A 3S6WA 1AT1B 1GFDA 4C0GA 4F7UB 1Y71A 2AHJB 1KSWA 5DLOA 3EFRA 5GAN4 1S72A 2X4YA 1JJ2S 1VQPQ 1RLPC 3ZFJA 2XI9A 1YN8A 2YRVA 2LP5A 4RTTA 1WJQA 2A0FB 4X1VA 4M7DF 2X4WA 4FSSA 3PGGA 4FW2A 2LTOA 3VYHB 1PSEA 3BDLA 1UHFA 1WHKA 3F70A 1Y96A 4J9EA 1ZX6A 2K57A 2H8HA 5HK0A 3JB9H 1WJSA 2JN0A 4LUEA 2K2MA 2RQUA 2XD0A 3JRZA 1B3QA 2CZ6B 5CAIA 2JVVA 1D3BA 3H41A 1K0SA 1EX4A 2VYTA 4PFPA 1M2VB 4F7UF 3KXTA 4E7JA 5FROA 1D0ZA 4Y92A 4AT1B 2L3SA 1D1CA 1TXQA 2CZ0B 5KYWB 5DLQE 2Y90A 2FYKA 1YNZA 2EFIA 1FYNA 1Q86U 2FRWA 3OB9A 1YITA 5GAMg 3ER0A 1MV3A 3A8LB 3A98A 1YI2T 5GAOq 1VQPA 2DE0X 2CP2A 4ZNXA 2KRSA 4ANJA 5IHIA 2JZ2A 2C0IA 2KVQG 5KYXA 1MNDA 5LJ3j 1NPRA 4ORZA 3BDUA 3VS7A 2K3BA 4TVRA 4KUIA 4J5YA 3JCMV 3BE3A 3V7CA 5KH6A 2KRMA 5GAOr 1VQNQ 1UGSB 5KCHA 5I11A 3M0TA 4DEXA 2RHUA 4Z89A 1X75C 1F1BB 5FWBA 5HKCA 3OYIA 2CDTA 1GL5A 2ZCFB 3A8OB 1ZA2B 3INZA 4OMMA 1Z9QA 3LLRA 4M7DA 2HQEA 1M3BA 1U06A 5LJ3f 5IXBA 2VUBA 4MDWA 1I0CA 4RUGA 2OJ2A 1VQMQ 4J9DA 3SHWA 4JJNK 2RK2A 1FXXA 2EVRA 5LJ3e 1VQ6A 5D6YA 4FU6A 5LL6S 4M78D 3TEEA 3HSBA 1X6OA 4M7AG 4B9XA 2ROLA 1RADB 3WVDB 2DMOA 3M56A 2QQ9A 2E5KA 1IHWA 1WXUA 1HD3A 3HFNA 4F7UA 1RL2A 1VYUA 1TG0A 4LXCA 3HRTA 1Q7YC 5CK9A 4JS4A 1N5ZA 2BE7D 2NUZA 3TCJA 2QAZA 1SPKA 2CUDA 1OU8A 2OTLT 1YCSB 2PQWA 2GTOA 4C5HA 4M78B 2OX7A 1C1AA 3L2ZA 1RACB 5C0MA 4OB1B 1JXMA 4MZPA 3H6ZA 1QW1A 2Y4XA 4J9FA 4M7DG 1VQNA 4KRTA 1V76A 1JJ2A 5CQXA 4J6YA 5AYFA 1KC8U 2E6NA 1VQLQ 2JW4A 2LVMA 3OS2A 2YWWA 2DLPA 2OAUA 1GFCA 2QEXT 2QTXA 3JB9G 2FEIA 3VS4A 3CCLT 1JEGA 1KFZA 2L0AA 2VASA 2YDLA 3T9NA 3SWNB 1M2VA 2DIQA 1VQMA 4PK4A 1G2BA 1H3ZA 1BCOA 3RBBB 2K9GA 1V29B 1E7OA 1KD1C 1NPPA 5KYWA 2LCSA 1SF9A 2PVDB 5FWCA 2YRDA 4M78F 3EG1A 3REAB 2KE9A 1LCKA 4V2SA 3FRNA 1M4ZA 1ZSZB 4PJOD 4Y91A 4OP0A 5GANe 5CIUA 2D8HA 3J80E 3OYAA 2LCCA 1ZLMA 2FZCB 3UATA 3PVLA 2E64A 4L5GA 9ATCB 5LJ5j 4AMCA 4PJLA 3M0UA 3SB2A 4X34A 2HL3A 3CMAT 3OYJA 1RAIB 5GAMd 1VIEA 2V8KA 3CCQT 2HZYA 2RI2A 2RPNA 2HDAA 3PMTA 4JDSA 1M1KU 2YHTA 4PJOB 4BY6C 2QG9B 2HKQB 3KBGA 3OSSC 1N8RC 3OW2P 2CREA 1W4SA 1VQLA 3RESA 4LDUA 4LD6A 2LJ3A 2XHCA 3PNWC 4OGCA 1YI2Q 4M75E 2RQWA 1M3CA 4WCIA 1KD1R 5LJ5f 4E7LA 3E19A 1B7TA 4FYWB 4N0AC 4OF1A 3L2WA 1H3HA 1KQ1A 4FYXB 4J9HA 1G3YA 3HTRA 5IHNA 1T3SA 2VVKA 4XU2A 3M0SA 5LJ5e 1G5VA 1BI0A 5GAN6 3UWNA 3EGDB 3I35A 4RG8A 2KYMA 3BY7A 2JJ9A 4RG2A 3OW2A 4IUQA 1VQ4T 5GMKh 1XOVA 1J3TA 2RQTA 1YCYA 3M57A 1XTDA 2LT4A 4O6JA 2ZPFB 4OMQA 2J7IA 2R5AA 1PKSA 3HHTB 4PJOF 3RUXA 3NMZC 1MV0B 1K1ZA 3R6NA 1K8AC 1TTHB 1RI9A 2CT3A 4RTXA 2EBPA 4PFZA 2O4XB 2AKKA 4LDWA 3QIIA 1N8RR 1GBQA 3NTHA 1AVZC 3CCST 2HBWA 5FLXE 1OZ3A 3PFSA 4M78A 2L3RA 2OI3A 3REBB 4HVUA 3EFOB 4OGEA 1SHFA 3O8VA 1U1TA 1NEBA 2Z0WA 1OV3A 2D0QB 5FU6B 2E5QA 4RTWA 5ECAA 4C8QG 1VA7A 4OB2B 1YI2A 4BE2A 3EAEA 3C94A 4FL6A 2KRNA 4LN2A 1WLPB 1OX9A 2ED1A 1S1NA 3OSVA 1CKAA 1JU5C 2EGCA 4FM4B 3MPUB 4FT2A 3LWIA 3UA7A 3SWNA 3JCMd 2O9VA 3V7SA 2LQKA 2GF7A 5EC7A 3VS2A 3WXMB 2LJ1A 1BK2A 3I5RA 4FT4A 1QLYA 4J83A 1ZBJA 2PVOB 3H9NA 4JLIA 2RK1A 2HKNA 5D7UA 1KJWA 1VUBA 2HBPA 1NLOC 4J9IA 3NHNA 4ESRA 2LT1A 4M77A 2QEXQ 4PJNA 3OS1A 3CCLQ 5I22A 2O2OA 4MMKA 2AZVA 1IXDA 3CCUT 3X20B 3PTAA 3V8JA 3EG0A 5CR2A 4OMOA 5J39A 2DXTA 2KYBA 3C0CA 2ENMA 2EWNA 1D09B 1QVFP 4PJOA 1IRXA 1OPKA 4M77E 5J3BA 2X3XD 2J6FA 1MMDA 4QVDA 3L2QA 1YFNA 1OI1A 2KR3A 2DXUA 3X24B 5GAMh 1Y57A 3HP9A 3HL8A 1G3TA 4J7FA 4D8KA 3G7ZA 3U23A 2OTLA 2DZCA 2FZGB 2BKDN 4DBQA 5IAYA 3CMAQ 2LQNA 2DO3A 4C8QC 4E7KA 3CCQQ 4A4HA 2MI6A 4HCBA 2BZXA 5GAN5 1K9AA 1QVFA 1M90R 1HXDA 1JO8A 3JCMb 1YBYA 2D0NA 3CCRQ 1AWWA 3VUZA 2RHZA 2YUOA 2DA9A 4JLGA 1UGQB 1VQ5T 2QEXA 3OYLA 4LDXA 2BIVA 2QQSA 3JSCA 5FU7C 4E6RA 3CCLA 1S72Q 1TUDA 2LQ8A 3CC2T 2WACA 4CRIA 3M0PA 1K9MU 2EQKA 5EG2A 1FX7A 3TU4K 3SD4A 1N27A 2O4XA 3M4YA 2QDLA 1HJDA 3GPLA 3G1JA 5IN1A 1X01A 3JCMX 2LDMA 2JUFA 2LMJA 4BDZA 1QVPA 3EFOA 1AD5A 1YIJQ 2P84A 2MOXA 2V1QA 3C95A 2MWOA 1R8OB 1K0XA 2CH4W 5IHKA 3EH1A 2RJEA 4L59A 2KNBB 1K73U 4MDXA 4LDYA 2CP6A 3QSUA 3X26B 2J05A 1M27C 4UC4A 3FIFA 1QCOA 3VU3C 2EJ9A 4KH0B 1XQHA 4Q5WA 1MMAA 2RHXA 3CMAA 3CCSQ 1Q82U 1X6GA 4LE9A 3CCQA 2KT1A 5HK3A 1BKBA 1UE9A 4C92C 2DYIA 4ZTFA 4QQDA 2PTKA 2A36A 4XTXA 4NOYA 4OMPA 3CCRA 1Q86R 5FRMA 2O9SA 1H8KA 1K76A 1T0JA 3JCMh 5FRNA 4BD3A 4X9CA 3MEUA 2EYQA 1SSFA 5J26A 1AEYA 1VOMA 2E3HA 2I2LA 3P8DA 2HL5C 2MIOA 4OMNA 5D6XA 5HCKA 3OYCA 2QA4T 3A8MB 2MK5A 4AFSC 2DILA 3PT9A 2NYSA 1LPLA 2C0OA 2RO0A 3DB3A 1M3AA 2BZYA 1PWTA 3L2UA 2YXYA 3HKSA 5GANh 3CCJT 2MYSA 1DJ7B 2A3LA 3RKXA 1YIJA 3G71T 2RH2A 1VQ4A 2B86A 3E9GA 1VQ7T 2KEAA 4DOWA 2J06A 1JXOA 2GQVA 1OOTA 1JQQA 5CQYA 1PD1A 2P0QA 4JRPA 1P92A 1RAHB 3EG3A 3I55T 3EG9B 1ABOA 5I2SA 3EGXB 1AOJA 2DZ9A 4EMKB 3M59A 1PRLC 2AIRB 3CCUQ 1W2BP 2RI5A 3CCSA 1BU1A 2DRKA 4M75D 4GLKA 2WSFE 5GJVB 1VQ6Q 1PRMC 4QW2A 2DIGA 4PJJA 3OY9A 1WX6A 2QYZA 2R5MA 1X2QA 2XDBA 1WA7A 3FLGA 3FJPA 1W70A 3M53A 2E12A 4RTVA 4EDUA 2YUQA 5KE2A 2IPOB 2XDDA 1W2BA 2RF0A 4M75B 3META 3CC4T 1YJNT 3QUIA 2CGHA 2K3XA 2RN8A 3C12A 2L8DA 4WF2A 1AWXA 2GCXA 2DD4A 1NJIU 2CP5A 5AT1B 3JCMW 4R0KA 2L3PA 3MHXA 3VKIA 3VV0A 1ARKA 1BCMA 3H0FA 3MEVA 3PE0A 3DKMA 1VQ5Q 1KC8R 1QP3A 3GF5A 4E7IA 2FPEA 3P8HA 1M1KC 1O75A 3OW2S 2EYWA 5M9OA 1NE8A 1XNIA 2KSSA 3CCUA 2EKOA 4C5GA 3CCMT 4II1A 4Y28E 2M51A 2RMOA 4A54A 4N4HA 4M75F 1X6BA 1LVKA 2E65A 3JB9J 4RTYA 2JTFA 4BDYA 2MPXC 1T3LA 3SFMA 4QQGA 3OBYA 5CO7A 2DVEA 1R77A 4A4FA 4VUBA 4LUDA 1N9RA 2HNIA 2ZPHB 3CXCP 4HXJA 2QXFA 5GJWB 2HMAA 2IVWA 3SEMA 4ATOA 4E7HA 2BE9B 2ZPBB 1PCXA 4FYVB 3ZL7C 2L5QA 4FYYB 2QQAA 2PZ1A 1D0XA 4KGXB 1QP2A 3QG1A 1AZEA 3V8LA 4J9GA 1WHJA 4XTYA 1G3WA 3VRYA 4DA4A 4PKCC 2WSCE 1YJ9T 1M1KR 5CKBA 2NLUA 3JCMg 4J7IA 2CSQA 4HT9A 1VQ5A 4C5IA 2ROTA 3GBQA 1ZBXA 1BI1A 3CC2A 2H3EB 3CXCA 2QA4Q 2JMCA 2XK0A 3EG9A 4M77D 2MF2A 3EGXA 4C92D 2VB6A 3OA6A 4EMKA 3RMQA 2FHDA 2DTHA 1UGRB 5GAOl 2LX7A 2X4XA 2DXCA 2FVUA 3JB9I 1WNLA 2CUBA 5GANg 3CPWP 4F7UG 2K5IA 2DF6A 3CCJQ 4EIKA 3OYEA 3G71Q 1XJWB 3VS0A 1QMCA 1TWBA 1PHTA 4FW1A 1Q81U 1VQ7Q 1RAFB 2W0ZA 1SEMA 3M5AA 3HRUA 1NEGA 1W6XA 1QWEA 3MEWA 4M77B 1UTIA 4C92B 4JJCA 2L89A 3I55Q 4IUTA 2DERA 4XU0A 4BACA 1M9SA 3M0QA 2V26A 4RTUA 2L2PA 4CC2A 4BI3A 1VQOT 5A0GA 4AFQC 2X4JA 3OMGA 3ZBDA 4M75A 3RERA 2EYZA 3WVEB 4M7AC 2QASA 4EPCA 5CVIA 2PUKB 2K2VA 3PVQA 5A2QE 1TSFA 1G8XA 3N5BB 2ZPGB 2BZ8A 2COWA 3E2UA 2F2WA 2MWPA 4RTZA 4CC4B 3QBYA 5GMKi 1IHVA 2FPDA 2DL8A 2DAQA 4XTZA 3ME9A 1O9SA 1HSQA 2W10A 4OB0B 5LJ5g 2F1LA 3QO3A 1QVFS 2QA4A 5GAN2 4B6MA 2HEQA 5GAN8 3S3MA 1VIFA 4M7DC 4M77F 2BUDA 2VXEA 1TU0B 1OEBA 1X27A 2DTOA 5CKHA 4HVVA 1YJWT 2XIDA 1GCQC 2EQJA 3CCJA 3G71A 2FG0A 3S3NA 1QCNA 5LJ3d 1VQ7A 2GFUA 2EW3A 4M75G 1I81A 2EJFA 4C0FA 2CP0A 1YHQT 1ZA1B 4NL3A 5C6SA 4J9BA 1QVGP 3I55A 2CP3A 2D6FA 4ZGJB 1BIBA 3RDVA 4E7SA 1Q95G 3CCMQ 1Q7YU 1AHJB 4J6WA 1UB4A 2O01E 2X35A 3TVTA 2ZZDA 1UHCA 2JNGA 2DL3A 2SEMA 3LX7A 1TUGB 2AK5A 2CP7A 2CS7A 3QPHA 4C8QE 1FMWA 3NFCA 2KXCA 4Z88A 4K11A 1QVGA 2YLBA 2EGEA 3J81E 1WXTA 2CZ7B 1M1GA 6AT1B 3CC4A 2CT4A 3EHRA 3I56T 1YJNA 3NTKA 3CEYA 2JM8A 1GCPA 4BUGA 2OTLQ 3CCET 4MZMA 4YTLA 1U8RA 2X51A 3CCVT 2E70A 2GNCA 4Z8AA 1R0BG 2QQBA 2JS2A 1YJ9Q 4OB3B 3ULRB 1UGVA 3GOXA 1PSFA 3VYGA 3EH2A 1WZOA 3VUBA 1M5Q1 3ZEHA 2WSEE 2JS0A 1N6AA 1GBRA 2JMAA 4HA8A 1Y07A 1E6GA 4M78G 2EJGA 4C92A 4XK8E 3JAME 1M90C 5GANd 3CCMA 1K9MR 2ZGWA 4IIOA 2HCKA 7AT1B 4JJDA 4DOVA 4KUDK 1RAAB 3C4SA 4XTUA 2XU8A 1ACMB 2GTJA 1JRIA 3R6OA 3CBOA 2LRQA 2ECZA 5GMKl 2DEUA 1WHMA 4C92E 3D7SB 1D1BA 2OTJT 1K73R 4ZN3A 3OYMA 2DBKA 4IIMA 1MMNA 2YUNA 4QKUA 1VQOQ 4RCBA 4KH1B 3I5SA 1T0HA 3L2VA 2JT4A 2ED0A 4B9WA 3OS0A 2KROA 1KQSP 1TOVA 2KDSA 2V1RA 1Q82R 2VV5A 2FRYA 4M77G 3VS6A 4C0DC 3TREA 1VYVA 2AT1B 2F5KA 1B34B 2DL7A 2EYXA 5DY9A 5LJ5d 1YJ9A 2IIMA 2R57A 1IREB 4MZTA 1W2BS 3QYGB 1D0YA 2A08A 2KBTA 1EFNA 3UDCA 4XQ3A 2H3JA 3QKJA 3H0HA 1SSHA 1N9SA 3VS3A 1VQ9T 4M7AD 4BB7A 4FSXA 3KFVA 3MP6A 1KG1A 2KAFA 4LNPA 5LJ3h 2DNUA 4LD9K 8ATCB 4OVAA 1Q86C 3A8HB 3EHQA 4PJOG 1ABQA 1WHLA 4NL2A 1K8AU 4PLIA 1QKWA 4F16A 1RABB 4DBFA 2G6FX 4HT8A 5KYUB 3OYNA 2MAMA 4M78C 3BW1A 1RLQC 2MCNA 2VKNA 4DBHA 2OAWA 5GMKj 2M02A 2A28A 1OX8A 2DXBA 4ME7A 2ZPIB 2E1HA 3OQ5A 1VQ4Q 1PNJA 2YUPA 2GGRA 4M7AB 3RMSA 1YHQQ 4OMLA 1UJYA 3QXEB 3HFOA 2K6DA 4BE0A 4ZN1A 3MEAA 1VQOA 4F04B 4AFUC 4BY6B 5I21A 3EFSA 4DQ2A 5CKFA 2Y4YA 3EGUA 3JB9D 1VQ8T 3SWNC 8AT1B 1X69A 2NUTB 1NG2A 2AKLA 2FPFA 2LZ6B 5HY6A 4O5VA 5CKDA 3LH5A 3LGFA 3X28B 1WDXA 3M58A 3L2RA 1EZZB 1UGPB 1ZSZC 4LDVA 1QQJA 2F2XA 4JZ3A 2LNVA 3QDRB 1AZGB 4HCCA 3JV3A 1I07A 1IB8A 3I56Q 4IUUA 5KYYB 3NTIA 3E1SA 1YJWA 3OMCA 3V7RA 1G83A 1I8FA 1NLPC 2QTVA 3CXCS 1VQLT 1VQKT 1NJIR 1I5OB 1BB9A 4PL6A 1SHGA 2RNAA 3CBMA 4JZ4A 1YHQA 2P0KA 2HAXA 2K3YA 4PJOC 1FMKA 4JJBA 4JRIA 2EIFA 2KXDA 3HRSA 1G3SA 1TH7A 2A7YA 1GXIE 1BI2A 1V1CA 3VS5A 3M54A 3OS5A 3Q1JA 4DBRA 1SRLA 2X3WD 2JM9A 1KC8C 1MHNA 3QDFA 5CKEA 5D6WA 3JB9F 1Z9ZA 4HCKA 1M2OA 4BI8B 1UECA 2M0YA 2XG8D 1AWJA 2R58A 1B34A 2XKOC 1B07A 4E2FB 5GAMj 1PG5B 3CPWS 4ELZC 2ATCB 1CKBA 2OTJQ 2FZKB 1PKTA 3M0RA 4BE1A 4L6V5 4C0ZA 2HD0A 3PMIA 1OYXA 5LJ5h 3DLMA 4CI0C 2DX1A 3I56A 1Q81C 2P0PA 3CCEA 1WFWA 4A4GA 3CMET 4N4GA 3CCVA 2KMTA 3UA6A 1M8MA
chains in the Genus database with same CATH topology
2HQXA 3M5AA 1NJIC 3HRUA 1VQMT 2DK3A 3OSVA 3OBWA 4MMLA 4C5EA 1KHCA 3PIOA 5I2MA 4FM4B 3MEWA 1Y7XA 4FT2A 3L42A 4M77B 4N4IA 3M55A 4RMOA 4C92B 3LWIA 2L89A 3SWNA 2JOYA 3G6EA 3JCMd 4IUTA 3OYGA 2CYZB 4XU0A 2E41A 5GAMf 1M9SA 3OYYA 5GMKm 3V7SA 4BACA 2LQKA 2GF7A 2RD1A 3WXMB 2VGNA 4IKFA 4BI3A 3SDZA 3HPWA 2F69A 1VQOT 5A0GA 4PNOA 5FU6C 5KE3A 4M7AA 4FT4A 2X4JA 3OMGA 3ZBDA 4M75A 3RERA 1I5LA 4J83A 3WVEB 4M7AC 2DKGA 1KHIA 4EPCA 2PVOB 5GAMe 1H641 5CVIA 2PUKB 5LJ3g 4JLIA 2K2VA 3PIPA 4X9DA 4M7DB 2RK1A 5A2QE 3M4GA 3QZ5B 4HCZA 1VUBA 2HBPA 3N5BB 4C8QD 2ZPGB 3DLLA 4KULA 5GMKe 2LT1A 3LGLA 4M77A 3JCMc 2RI3A 3J7AF 2MWPA 2PU9B 4M77C 2F5TX 3G4ST 3OYBA 3OS1A 3QBYA 4Z02A 3QHSA 1HK9A 4KBMB 1OZ2A 3FEOA 5GMKi 2GFAA 4MMKA 4M7AF 2DAQA 2VC8A 4XTZA 1IZ6A 3ME9A 1O9SA 1M90U 4OB0B 5LJ5g 3CCUT 3X20B 3PTAA 3V8JA 2V8IA 3QO3A 5CR2A 4M7AE 1QVFS 2QA4A 5GAN2 2K5FA 5J39A 5GAN8 2EQMA 4J6XA 2DXTA 3S3MA 2OTJA 1VIFA 2QI2A 4M7DC 1WQWA 1LJOA 4M77F 3S6WA 2EWNA 4C0GA 4A4KA 4F7UB 1Y71A 2BUDA 4N0AA 2AHJB 2VXEA 4C0DB 4C8QB 5DLOA 3EFRA 3V8KA 5GAN4 1S72A 2DTOA 5CKHA 1YJWT 2RHYA 2X4YA 1JJ2S 4PJOA 4M77E 5J3BA 2XIDA 3ZFJA 2EQJA 3CCJA 4QVDA 3L2QA 1OI1A 2C06A 2XI9A 3G71A 3S3NA 3X24B 2DXUA 3H8ZA 5GAMh 2YRVA 3HP9A 1WJQA 3HL8A 5LJ3d 1QVGS 1VQ7A 2GFUA 1G3TA 4M7DF 2X4WA 1I81A 2EJFA 4M75G 4J7FA 4C0FA 2DJZA 3G7ZA 1YHQT 5FU7B 2OTLA 2DZCA 1WPYA 3PGGA 4M7DE 3GIBA 4NL3A 2LTOA 3VYHB 1PSEA 5C6SA 2BKDN 3BDLA 3I55A 5IAYA 2D6FA 4ZGJB 1BIBA 3DB4A 3F70A 1Y96A 2DO3A 4C8QC 2K57A 4E7KA 4JS5A 5HK0A 3JB9H 4A4HA 1WJSA 2MI6A 2JN0A 2K5LA 4HCBA 5GAN5 2E6ZA 1BIAA 1Q7YU 3JRZA 1AHJB 2XD0A 5GAOp 1VQ9A 4J6WA 1QVFA 2CZ6B 5CAIA 1HXDA 1UB4A 4PLLA 2O01E 2EAYA 2EQUA 2JVVA 1YBYA 2X35A 3JCMb 2ZZDA 1D3BA 3VUZA 3FDRA 3CD6T 2KK4A 2JNGA 2RHZA 2VYTA 3LX7A 2P4TA 4JLGA 4F7UF 3KXTA 1UGQB 4C8QF 4QVCA 1VQ5T 1RI0A 2QEXA 4QVZA 4E7JA 3OYLA 4LDXA 2BIVA 2QQSA 3JSCA 5FU7C 5FROA 2CS7A 3CC7T 1ZHIA 3QPHA 5GANj 3CCLA 2LQ8A 4F7UE 2WACA 4CRIA 3CC2T 4C8QE 3NFCA 1K9MU 2CZ0B 5DLQE 2EQKA 2Y90A 4A4EA 5EG2A 1QVGA 1FX7A 2G3RA 2YLBA 3JCMf 1FWZA 3TU4K 3SD4A 2FYKA 1N27A 4E47A 2O4XA 3M4YA 2EFIA 4D6WA 3J81E 2VGMA 1Q86U 2RA2A 3GPLA 4GY5A 2CZ7B 1M1GA 3OB9A 1YITA 2FL7A 5IN1A 1X01A 3ER0A 3JCMX 5GAMg 3CC4A 3I56T 2LDMA 2JUFA 1YJNA 3NTKA 3CEYA 3JCMe 3A8LB 4BDZA 1QVPA 4BUGA 3CCET 4MZMA 3C95A 4XU3A 2MWOA 1R8OB 3ASKA 4YTLA 1YI2T 5GAOq 1U8RA 1VQPA 3CCVT 3LWHA 2E70A 3FB9A 2DEQA 2RJEA 4L59A 2QQBA 2JZ2A 2RJCA 5L8RE 1K73U 2KVQG 4MDXA 4LDYA 4OB3B 5LJ3j 5GANf 1VQ8A 1NPRA 3GOXA 1PSFA 3VYGA 3QSUA 3BDUA 3VUBA 1LNXA 3X26B 1M5Q1 3ZEHA 2WSEE 3VJPA 3G6ET 3CPWA 1BYMA 3CPFA 1N6AA 4TVRA 4KUIA 4HA8A 1LOJA 4UC4A 3FIFA 4J5YA 3LH0A 3VU3C 4OMFB 3JCMV 3V7CA 2EJ9A 5KH6A 1Y07A 1XQHA 4Q5WA 2RHXA 4M78G 1UGSB 4EMGA 3CMAA 5GAOr 5KCHA 2EJGA 4C92A 1Q82U 4XK8E 3JAME 2RHUA 3CCQA 1M90C 5HK3A 1X75C 1BKBA 5GANd 4C92C 3CCMA 4QQ6A 2ZGWA 5HKCA 3OYIA 1NZ9A 4ZTFA 4DOVA 3P8BB 4QQDA 4KUDK 3C4SA 4XTXA 4NOYA 2K4YA 2ZCFB 4XTUA 3CCRA 5FRMA 3A8OB 3INZA 3JCMh 2XU8A 3LLRA 4M7DA 5FRNA 4BD3A 2HQEA 4EMHA 1JRIA 5LJ3f 2KQWA 2VUBA 4X9CA 4MDWA 3MEUA 3R6OA 2EYQA 1SSFA 4HKEA 5J26A 3CBOA 3P8DA 2I2LA 4C92F 2LRQA 5D6XA 3OYCA 1BI3A 3CBPA 3CCRT 2LCLA 5GMKl 2QA4T 3A8MB 2RK2A 4JJNK 1VQKA 4C92E 1FXXA 5LJ3e 1VQ6A 5D6YA 4XTVA 3S3OA 3UPUA 3LYIA 4FU6A 3PT9A 3OYHA 2OTJT 5LL6S 4M78D 3TEEA 4ZN3A 2M16A 1X6OA 3HSBA 3OYMA 2RO0A 3DB3A 4M7AG 5KCOA 4B9XA 1KQSS 1S72T 3A5ZB 3L2UA 2DD5A 3QYHB 4RCBA 2FB7A 3WVDB 3A8GB 3HKSA 3L2VA 5GANh 2QQRA 5GAOm 4XAXB 3M56A 2QQ9A 3CCJT 1YIJA 1DJ7B 2A3LA 3RKXA 4B9WA 4A53A 3JCMQ 3G71T 3HFNA 4F7UA 2RH2A 1RL2A 3QJ6A 3OS0A 4C8QA 1VQ4A 3E9GA 3HRTA 2KDSA 1Q7YC 2VV5A 4ZGEB 1VQ7T 5CK9A 4DOWA 4C0DC 4M77G 3TREA 4JS4A 4BI4A 2GQVA 3TCJA 2F5KA 2CKKA 1B34B 1YJ9A 5DY9A 5LJ5d 1W2BS 2OTLT 2R57A 1IREB 4MZTA 5CQYA 2P0QA 4JRPA 1YIJT 2PQWA 1P92A 2D9TA 4C5HA 3I55T 4M78B 3MP1A 3QYGB 3L2ZA 5I2SA 3GNGA 2XICA 5C0MA 4OB1B 2RHIA 4MZPA 2DZ9A 4EMKB 3M59A 3H6ZA 1QW1A 3UDCA 2QDYB 2VXFA 2RI5A 2Y4XA 4XQ3A 3CCSA 1VQNA 4M7DG 2H3JA 3QKJA 1JJ2A 1N9SA 1VQ9T 1K9MC 4M7AD 4BB7A 4FSXA 3MP6A 4M75D 1KG1A 2KAFA 4GLKA 2WSFE 5LJ3h 4LD9K 4OVAA 2V8JA 4J6YA 5CQXA 5AYFA 1KC8U 2E6NA 1WQ7A 4J8OA 1Q86C 3A8HB 2LVMA 4PJOG 3OS2A 4NL2A 1K8AU 4PLIA 4QW2A 2DIGA 2OAUA 2B8AA 2RB6A 2QEXT 4JRQA 3JCMP 1MGQA 2QTXA 3JB9G 3OY9A 2R5MA 3GP8A 2XDBA 3FC3A 4HT8A 3CCLT 3FLGA 3OYNA 3CMEA 2MAMA 4NS5A 3BW1A 1WGSA 3MO8A 3FJPA 4M78C 2YLCA 3E9FA 3T9NA 3SWNB 2JTMA 3M53A 2E12A 5GMKj 2DIQA 4EMKC 1I4K1 2DXBA 4ME7A 5A0DA 1VQMA 3JCMJ 2ZPIB 4EDUA 2E1HA 3OQ5A 5KE2A 5GAN3 3OYFA 1H3ZA 1K73C 1M8VA 4XU1A 2CZ1B 2DPPB 4M7AB 2KY9A 3RMSA 2XDDA 1W2BA 1V29B 4M75B 1YITT 1KD1C 3META 1NPPA 2MMPA 3CC4T 2M0OA 3QXEB 2PVDB 5A0LA 1YJNT 3QUIA 2CGHA 2M9UA 2K3XA 3C12A 3HFOA 1UEBA 4M78F 4BE0A 2M1HA 1KD1U 4ZN1A 1WJRA 2PVGB 3MEAA 2L8DA 1VQOA 1VQPT 4WF2A 4V2SA 3FRNA 1M4ZA 4JRKA 2ZPEB 2GCXA 1Q82C 2DD4A 4M78E 1NJIU 4PJOD 4BY6B 5I21A 4Y91A 3EFSA 4DQ2A 4OP0A 2IG0A 4IUPA 5CKFA 5CIUA 2Y4YA 3MHXA 5GANe 3JCMW 3JB9D 1VQ8T 3SWNC 3VKIA 3VV0A 4IUVA 3J80E 3OYAA 2LX9A 2LCCA 3MEVA 3DKMA 2E64A 1QP3A 4L5GA 3GF5A 5LJ5j 5HY6A 3G4SA 3AHUA 4M75C 4E7IA 3SB2A 4X34A 1JB0E 4O5VA 5CKDA 3OYKA 2RM4A 3CMAT 3LGFA 3P8HA 3RIRA 2RJDA 3X28B 3OYJA 1M1KC 1O75A 3OW2S 5GAMd 1VIEA 2V8KA 5M9OA 3CCQT 1NE8A 1XNIA 3M9QA 2KSSA 1JBMA 3CCUA 2EKOA 3M58A 4C5GA 3L2RA 2RI2A 3CCMT 1UGPB 4II1A 3OYDA 3QJYA 4LDVA 3RKYA 3PMTA 4JDSA 1M1KU 2YHTA 4PJOB 4Y28E 2XDPA 4BY6C 3KBGA 3OSSC 2LNVA 3QDRB 4R55A 1N8RC 4A54A 4P5NA 4HCCA 1W4SA 4N4HA 4M75F 4IUUA 1VQLA 3RESA 4LDUA 3NTIA 4LD6A 2E10A 2E65A 3E1SA 3JB9J 1N8RU 2XHCA 4RKUE 3PNWC 2JTFA 1YJWA 4OGCA 3RKWA 3OMCA 4M75E 3V7RA 4BDYA 1I8FA 3SFMA 4QQGA 3OBYA 5CO7A 2DVEA 5LJ5f 3CXCS 4E7LA 3E19A 4A4FA 1VQLT 1KQ2A 1VQKT 5IT9E 4VUBA 1VQ6T 4N0AC 4OF1A 1Y96B 4PL6A 5CCAA 1KQ1A 3L2WA 1N9RA 2HNIA 1G3YA 3CBMA 4JUVA 4XU2A 1YHQA 2P0KA 2ZPHB 2HAXA 2K3YA 5LJ5e 4PJOC 2QXFA 1G5VA 1BI0A 2IVWA 4JRIA 4C92G 5GAN6 4FIBA 3BFMA 4ATOA 3UWNA 4E7HA 3GLXA 4RG8A 2EIFA 2ZPBB 3BY7A 4RG2A 1D3BB 3HRSA 3OW2A 1G3SA 4IUQA 4ZGDB 1VQ4T 2PUOB 5GMKh 5GAOn 1XOVA 1TH7A 2A7YA 5DM7R 4ZTJA 2L5QA 2QQAA 1BI2A 1M1FA 1QP2A 3QG1A 4XTWA 3UT1A 1GXIE 3V8LA 4XTYA 1YCYA 1G3WA 3M57A 3M54A 4DA4A 1XTDA 2LT4A 3OS5A 2ZPFB 3Q1JA 4O6JA 2R5AA 3HHTB 4PKCC 2WSCE 4PJOF 1YJ9T 1KC8C 3RUXA 5CKBA 3L1AA 2NLUA 4IURA 1MHNA 3JCMg 5CKEA 5D6WA 3CD6A 4R56A 3JB9F 1K8AC 4J7IA 4HT9A 1VQ5A 4PJOE 4BI8B 3QZ9B 4C5IA 2O4XB 4ELYC 4LDWA 1ZBXA 2DTIA 3QIIA 2XG8D 3CC7A 1BI1A 2R58A 1KQSA 1B34A 1ZQ1A 2LC4A 3CC2A 2XKOC 3NTHA 3CCST 1VQNT 5FLXE 3CXCA 1OZ3A 3PFSA 4RCCA 1EIFA 5GAMj 3LW5E 2XK0A 2L3RA 4M77D 4M78A 2MF2A 3CPWS 4ELZC 2RJFA 4C92D 4OGEA 3OA6A 3O8VA 4EMKA 3RMQA 2FHDA 2DTHA 1UGRB 5GAOl 1U1TA 4BE1A 4KT0E 3MP8A 4L6V5 4C0ZA 2X4XA 2HD0A 3PMIA 1OYXA 5LJ5h 3X25B 2D0QB 5FU6B 2DXCA 2FVUA 3DLMA 4CI0C 3JB9I 1WNLA 2E5QA 3KUFA 5GANg 3I56A 4F7UG 1Q81C 3URGA 2P0PA 3MCAB 2K5IA 4C8QG 3CCEA 4A4GA 3CMET 3OYEA 3GNFB 4N4GA 1U1SA 4OB2B 1YI2A 4BE2A 3EAEA 4M7DD 3CCVA 2KMTA 1Q81U 3C94A 5GAN7 4FL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CO7 A;  1VUB A;  3G7Z A;  4MZP A;  2MF2 A;  1M1F A;  1NE8 A;  4ELZ C;  4VUB A;  2VUB A;  4HKE A;  4MZM A;  5DLO A;  4OF1 A;  3JSC A;  5CKF A;  5CCA A;  4ME7 A;  5CKH A;  5CKB A;  5CKE A;  5CK9 A;  5HK3 A;  1X75 C;  5HK0 A;  5CQX A;  3NFC A;  3HPW A;  3TCJ A;  2C06 A;  3JRZ A;  4ELY C;  5HKC A;  4MDX A;  1UB4 A;  4MZT A;  5CQY A;  5CR2 A;  2KMT A;  5CKD A;  3VUB A; 
#chains in the Genus database with same CATH topology
 4MML A;  4C5E A;  5KYU A;  1KHC A;  3PIO A;  1YP5 A;  4N4I A;  3L42 A;  2COY A;  3TSZ A;  1PC0 A;  3UF4 A;  2CYZ B;  5GAM f;  2E41 A;  2DRM A;  1WIE A;  2RD1 A;  2C0T A;  5FU6 C;  4M7A A;  1WXB A;  2D1X A;  1VQ9 Q;  5GAM e;  1H64 1;  5LJ3 g;  3CC2 Q;  2YT6 A;  4X9D A;  2NUP B;  3M4G A;  4HCZ A;  3DLL A;  1FMV A;  3IQL A;  4C8Q D;  4KUL A;  2DL5 A;  3QWY A;  3JCM c;  3G4S T;  1HYO A;  3OYB A;  2KT8 A;  3QHS A;  1HK9 A;  4KBM B;  2A37 A;  3CQT A;  2NUT A;  2V8I A;  4M7A E;  1Q81 R;  2K5F A;  4J6X A;  4AG2 C;  2OTJ A;  4GBQ A;  1WQW A;  1LJO A;  4A4K A;  4N0A A;  4C8Q B;  4C0D B;  3V8K A;  2LJ0 A;  1GCQ A;  2RHY A;  4J9C A;  2EGA A;  1ZUK A;  2C06 A;  3H8Z A;  5KYY A;  2L3Q A;  1VQ8 Q;  1QVG S;  1JJ2 P;  1WHH A;  2YSQ A;  2COZ A;  2DJZ A;  5FU7 B;  1WPY A;  4M7D E;  3GIB A;  2J6K A;  2K79 A;  2GQI A;  2DJQ A;  3DB4 A;  2DM1 A;  4JS5 A;  2K5L A;  2O88 A;  1A0N B;  2E6Z A;  1BIA A;  5GAO p;  5FW9 A;  1VQ9 A;  4PLL A;  2EAY A;  2EQU A;  1QKX A;  1E6H A;  1UUE A;  1H92 A;  3CD6 T;  3FDR A;  2KK4 A;  2P4T A;  4C8Q F;  4QVC A;  1RI0 A;  4QVZ A;  1BBZ A;  3CC7 T;  1ZHI A;  5GAN j;  2EKH A;  4F7U E;  1AWO A;  3VRZ A;  1VQK Q;  4A4E A;  3JCM f;  2G3R A;  1GRI A;  1FWZ A;  4E47 A;  4D6W A;  2VGM A;  4QT7 A;  2RA2 A;  4GY5 A;  2FL7 A;  3JCM e;  4XU3 A;  3ASK A;  2CH4 A;  2DET A;  1UG1 A;  3LWH A;  3FB9 A;  2D8J A;  2NWM A;  4KGZ B;  2DEQ A;  1C6V X;  1Q7Y R;  2RJC A;  5L8R E;  3AT1 B;  1VQ8 A;  5GAN f;  1QCF A;  1LNX A;  3G6E T;  3TQ7 P;  3VJP A;  3TSW A;  3CPW A;  1BYM A;  3CPF A;  5IXF A;  1I1J A;  1LOJ A;  3LH0 A;  4OMF B;  2QGF B;  4EMG A;  1UJ0 A;  4QQ6 A;  2HSP A;  3RNJ A;  1NZ9 A;  3H0I A;  3P8B B;  4F17 A;  1CSK A;  2K4Y A;  2SRC A;  4AFZ C;  3CME Q;  2ESW A;  2NUP A;  4EMH A;  3CC4 Q;  2KQW A;  2XMF A;  5L23 A;  1YJN Q;  4HKE A;  4C92 F;  1RUW A;  2DYB A;  1WYX A;  1BI3 A;  3CBP A;  3CCR T;  2LCL A;  1VQK A;  4XTV A;  3S3O A;  3UPU A;  3LYI A;  1PM3 A;  3OYH A;  2RQV A;  2FO0 A;  2M16 A;  3NGP A;  5KCO A;  1KQS S;  1S72 T;  3A5Z B;  2DD5 A;  3QYH B;  2FB7 A;  2RQR A;  3A8G B;  5GAO m;  2QQR A;  4JPB W;  4XAX B;  1KIK A;  4A53 A;  3JCM Q;  1U3O A;  3QJ6 A;  4C8Q A;  4ZGE B;  4BI4 A;  2CKK A;  1YIJ T;  3G4S Q;  2ABL A;  2D9T A;  2JTE A;  3MP1 A;  1MUZ A;  2CSI A;  3GNG A;  2XIC A;  2RHI A;  2QDY B;  1VYT A;  2VXF A;  2DVJ A;  2LQW A;  1K9M C;  1D1A A;  2BTT A;  2V8J A;  1WQ7 A;  1IGQ A;  4J8O A;  2B8A A;  2RB6 A;  3JCM P;  1NBE B;  4JRQ A;  1MGQ A;  2DL4 A;  3GP8 A;  3FC3 A;  5KYN A;  3CME A;  4NS5 A;  1WGS A;  3MO8 A;  2VWF A;  2YLC A;  3E9F A;  2JTM A;  4EMK C;  1I4K 1;  5A0D A;  3JCM J;  3O5Z A;  5GAN 3;  3OYF A;  1K73 C;  1M8V A;  4XU1 A;  2CZ1 B;  2DPP B;  2KY9 A;  1YIT T;  2MMP A;  2M0O A;  5A0L A;  1IGU A;  2M9U A;  3MJX A;  1UEB A;  2M1H A;  1KD1 U;  1WJR A;  2K7A A;  2PVG B;  1VQP T;  4JRK A;  2ZPE B;  1Q82 C;  4M78 E;  4PFO A;  1PD0 A;  2EPD A;  2IG0 A;  3NPF A;  4IUP A;  4IUV A;  3CD6 Q;  2LX9 A;  1WI7 A;  2QGG A;  4KGV B;  1ZSG A;  3G4S A;  1K8A R;  4M75 C;  1QWF A;  3CC7 Q;  3AHU A;  2E3I A;  1JB0 E;  3OYK A;  2RM4 A;  1MNE A;  3RIR A;  2RJD A;  1KK7 A;  1ZSZ A;  1RAG B;  3M9Q A;  1JBM A;  3OYD A;  3QJY A;  3RKY A;  4D8D A;  2XDP A;  5IH2 A;  1M30 A;  1OQK A;  4R55 A;  4P5N A;  2HQH A;  2DFU A;  2E10 A;  1N8R U;  4RKU E;  4DEY A;  1K4U S;  1ZUY A;  3RKW A;  1IO6 A;  2KI7 A;  2GBQ A;  1KQ2 A;  3RR6 A;  5IT9 E;  1VQ6 T;  1C0M A;  2EYY A;  3VS1 A;  1Y96 B;  5CCA A;  3G6E Q;  4M4Z A;  4JUV A;  3THK A;  1MMG A;  4CC3 A;  4C92 G;  4FIB A;  1NYG A;  3BFM A;  2O31 A;  1UFF A;  1NYF A;  3GLX A;  1U5S A;  1D3B B;  4ZGD B;  1RAE B;  2PUO B;  5GAO n;  4ZTJ A;  5DM7 R;  1OPL A;  4E7Z A;  1W1F A;  3UT1 A;  1M1F A;  4XTW A;  4HVW A;  3EG2 A;  1SKU B;  2KGT A;  4GLM A;  4AG1 C;  3L1A A;  4IUR A;  3CD6 A;  1WHG A;  4R56 A;  4PJO E;  3QZ9 B;  4ELY C;  2DTI A;  3CC7 A;  2HSE B;  1KQS A;  1ZQ1 A;  2LC4 A;  3EGD A;  2PNI A;  1YJW Q;  1VQN T;  1X43 A;  4RCC A;  1EIF A;  3LW5 E;  1X2K A;  3QWX X;  1UDL A;  2RJF A;  2QK0 A;  1YWP A;  4KT0 E;  3MP8 A;  2P4R A;  3X25 B;  3KUF A;  3URG A;  3MCA B;  5KYX B;  4A63 B;  3GNF B;  1U1S A;  4M7D D;  1SRM A;  5GAN 7;  2I0N A;  2HQX A;  1NJI C;  1TUC A;  1VQM T;  2DK3 A;  3OBW A;  5I2M A;  2E4H A;  3MKD A;  1Y7X A;  3M55 A;  4RMO A;  3G6E A;  2JOY A;  3OYG A;  5GMK m;  4CC7 A;  3OYY A;  1NM7 A;  4IKF A;  2VGN A;  3SDZ A;  3HPW A;  1OUL A;  2F69 A;  4PNO A;  5KE3 A;  2F2V A;  4F14 A;  1YWO A;  2DBM A;  1I5L A;  2J6O A;  2DKG A;  1KHI A;  1OU9 A;  3PIP A;  4M7D B;  3QZ5 B;  2AZS A;  3FJ5 A;  1TS9 A;  1SG5 A;  1ZUU A;  4PJM A;  2LNH B;  3I9Q A;  5GMK e;  3LGL A;  3A1P A;  1Y0M A;  2RI3 A;  4FCY A;  3J7A F;  2X9H A;  2PU9 B;  4M77 C;  2F5T X;  4Z02 A;  1OZ2 A;  3FEO A;  2GFA A;  4M7A F;  2VC8 A;  2ZAE A;  1R0C B;  1IZ6 A;  1M90 U;  3CCE Q;  2EQI A;  4WTO B;  3CCV Q;  2YRC A;  2JXB A;  2EQM A;  1YIT Q;  2QI2 A;  3S6W A;  1AT1 B;  1GFD A;  4C0G A;  4F7U B;  1Y71 A;  2AHJ B;  1KSW A;  5DLO A;  3EFR A;  5GAN 4;  1S72 A;  2X4Y A;  1JJ2 S;  1VQP Q;  1RLP C;  3ZFJ A;  2XI9 A;  1YN8 A;  2YRV A;  2LP5 A;  4RTT A;  1WJQ A;  2A0F B;  4X1V A;  4M7D F;  2X4W A;  4FSS A;  3PGG A;  4FW2 A;  2LTO A;  3VYH B;  1PSE A;  3BDL A;  1UHF A;  1WHK A;  3F70 A;  1Y96 A;  4J9E A;  1ZX6 A;  2K57 A;  2H8H A;  5HK0 A;  3JB9 H;  1WJS A;  2JN0 A;  4LUE A;  2K2M A;  2RQU A;  2XD0 A;  3JRZ A;  1B3Q A;  2CZ6 B;  5CAI A;  2JVV A;  1D3B A;  3H41 A;  1K0S A;  1EX4 A;  2VYT A;  4PFP A;  1M2V B;  4F7U F;  3KXT A;  4E7J A;  5FRO A;  1D0Z A;  4Y92 A;  4AT1 B;  2L3S A;  1D1C A;  1TXQ A;  2CZ0 B;  5KYW B;  5DLQ E;  2Y90 A;  2FYK A;  1YNZ A;  2EFI A;  1FYN A;  1Q86 U;  2FRW A;  3OB9 A;  1YIT A;  5GAM g;  3ER0 A;  1MV3 A;  3A8L B;  3A98 A;  1YI2 T;  5GAO q;  1VQP A;  2DE0 X;  2CP2 A;  4ZNX A;  2KRS A;  4ANJ A;  5IHI A;  2JZ2 A;  2C0I A;  2KVQ G;  5KYX A;  1MND A;  5LJ3 j;  1NPR A;  4ORZ A;  3BDU A;  3VS7 A;  2K3B A;  4TVR A;  4KUI A;  4J5Y A;  3JCM V;  3BE3 A;  3V7C A;  5KH6 A;  2KRM A;  5GAO r;  1VQN Q;  1UGS B;  5KCH A;  5I11 A;  3M0T A;  4DEX A;  2RHU A;  4Z89 A;  1X75 C;  1F1B B;  5FWB A;  5HKC A;  3OYI A;  2CDT A;  1GL5 A;  2ZCF B;  3A8O B;  1ZA2 B;  3INZ A;  4OMM A;  1Z9Q A;  3LLR A;  4M7D A;  2HQE A;  1M3B A;  1U06 A;  5LJ3 f;  5IXB A;  2VUB A;  4MDW A;  1I0C A;  4RUG A;  2OJ2 A;  1VQM Q;  4J9D A;  3SHW A;  4JJN K;  2RK2 A;  1FXX A;  2EVR A;  5LJ3 e;  1VQ6 A;  5D6Y A;  4FU6 A;  5LL6 S;  4M78 D;  3TEE A;  3HSB A;  1X6O A;  4M7A G;  4B9X A;  2ROL A;  1RAD B;  3WVD B;  2DMO A;  3M56 A;  2QQ9 A;  2E5K A;  1IHW A;  1WXU A;  1HD3 A;  3HFN A;  4F7U A;  1RL2 A;  1VYU A;  1TG0 A;  4LXC A;  3HRT A;  1Q7Y C;  5CK9 A;  4JS4 A;  1N5Z A;  2BE7 D;  2NUZ A;  3TCJ A;  2QAZ A;  1SPK A;  2CUD A;  1OU8 A;  2OTL T;  1YCS B;  2PQW A;  2GTO A;  4C5H A;  4M78 B;  2OX7 A;  1C1A A;  3L2Z A;  1RAC B;  5C0M A;  4OB1 B;  1JXM A;  4MZP A;  3H6Z A;  1QW1 A;  2Y4X A;  4J9F A;  4M7D G;  1VQN A;  4KRT A;  1V76 A;  1JJ2 A;  5CQX A;  4J6Y A;  5AYF A;  1KC8 U;  2E6N A;  1VQL Q;  2JW4 A;  2LVM A;  3OS2 A;  2YWW A;  2DLP A;  2OAU A;  1GFC A;  2QEX T;  2QTX A;  3JB9 G;  2FEI A;  3VS4 A;  3CCL T;  1JEG A;  1KFZ A;  2L0A A;  2VAS A;  2YDL A;  3T9N A;  3SWN B;  1M2V A;  2DIQ A;  1VQM A;  4PK4 A;  1G2B A;  1H3Z A;  1BCO A;  3RBB B;  2K9G A;  1V29 B;  1E7O A;  1KD1 C;  1NPP A;  5KYW A;  2LCS A;  1SF9 A;  2PVD B;  5FWC A;  2YRD A;  4M78 F;  3EG1 A;  3REA B;  2KE9 A;  1LCK A;  4V2S A;  3FRN A;  1M4Z A;  1ZSZ B;  4PJO D;  4Y91 A;  4OP0 A;  5GAN e;  5CIU A;  2D8H A;  3J80 E;  3OYA A;  2LCC A;  1ZLM A;  2FZC B;  3UAT A;  3PVL A;  2E64 A;  4L5G A;  9ATC B;  5LJ5 j;  4AMC A;  4PJL A;  3M0U A;  3SB2 A;  4X34 A;  2HL3 A;  3CMA T;  3OYJ A;  1RAI B;  5GAM d;  1VIE A;  2V8K A;  3CCQ T;  2HZY A;  2RI2 A;  2RPN A;  2HDA A;  3PMT A;  4JDS A;  1M1K U;  2YHT A;  4PJO B;  4BY6 C;  2QG9 B;  2HKQ B;  3KBG A;  3OSS C;  1N8R C;  3OW2 P;  2CRE A;  1W4S A;  1VQL A;  3RES A;  4LDU A;  4LD6 A;  2LJ3 A;  2XHC A;  3PNW C;  4OGC A;  1YI2 Q;  4M75 E;  2RQW A;  1M3C A;  4WCI A;  1KD1 R;  5LJ5 f;  4E7L A;  3E19 A;  1B7T A;  4FYW B;  4N0A C;  4OF1 A;  3L2W A;  1H3H A;  1KQ1 A;  4FYX B;  4J9H A;  1G3Y A;  3HTR A;  5IHN A;  1T3S A;  2VVK A;  4XU2 A;  3M0S A;  5LJ5 e;  1G5V A;  1BI0 A;  5GAN 6;  3UWN A;  3EGD B;  3I35 A;  4RG8 A;  2KYM A;  3BY7 A;  2JJ9 A;  4RG2 A;  3OW2 A;  4IUQ A;  1VQ4 T;  5GMK h;  1XOV A;  1J3T A;  2RQT A;  1YCY A;  3M57 A;  1XTD A;  2LT4 A;  4O6J A;  2ZPF B;  4OMQ A;  2J7I A;  2R5A A;  1PKS A;  3HHT B;  4PJO F;  3RUX A;  3NMZ C;  1MV0 B;  1K1Z A;  3R6N A;  1K8A C;  1TTH B;  1RI9 A;  2CT3 A;  4RTX A;  2EBP A;  4PFZ A;  2O4X B;  2AKK A;  4LDW A;  3QII A;  1N8R R;  1GBQ A;  3NTH A;  1AVZ C;  3CCS T;  2HBW A;  5FLX E;  1OZ3 A;  3PFS A;  4M78 A;  2L3R A;  2OI3 A;  3REB B;  4HVU A;  3EFO B;  4OGE A;  1SHF A;  3O8V A;  1U1T A;  1NEB A;  2Z0W A;  1OV3 A;  2D0Q B;  5FU6 B;  2E5Q A;  4RTW A;  5ECA A;  4C8Q G;  1VA7 A;  4OB2 B;  1YI2 A;  4BE2 A;  3EAE A;  3C94 A;  4FL6 A;  2KRN A;  4LN2 A;  1WLP B;  1OX9 A;  2ED1 A;  1S1N A;  3OSV A;  1CKA A;  1JU5 C;  2EGC A;  4FM4 B;  3MPU B;  4FT2 A;  3LWI A;  3UA7 A;  3SWN A;  3JCM d;  2O9V A;  3V7S A;  2LQK A;  2GF7 A;  5EC7 A;  3VS2 A;  3WXM B;  2LJ1 A;  1BK2 A;  3I5R A;  4FT4 A;  1QLY A;  4J83 A;  1ZBJ A;  2PVO B;  3H9N A;  4JLI A;  2RK1 A;  2HKN A;  5D7U A;  1KJW A;  1VUB A;  2HBP A;  1NLO C;  4J9I A;  3NHN A;  4ESR A;  2LT1 A;  4M77 A;  2QEX Q;  4PJN A;  3OS1 A;  3CCL Q;  5I22 A;  2O2O A;  4MMK A;  2AZV A;  1IXD A;  3CCU T;  3X20 B;  3PTA A;  3V8J A;  3EG0 A;  5CR2 A;  4OMO A;  5J39 A;  2DXT A;  2KYB A;  3C0C A;  2ENM A;  2EWN A;  1D09 B;  1QVF P;  4PJO A;  1IRX A;  1OPK A;  4M77 E;  5J3B A;  2X3X D;  2J6F A;  1MMD A;  4QVD A;  3L2Q A;  1YFN A;  1OI1 A;  2KR3 A;  2DXU A;  3X24 B;  5GAM h;  1Y57 A;  3HP9 A;  3HL8 A;  1G3T A;  4J7F A;  4D8K A;  3G7Z A;  3U23 A;  2OTL A;  2DZC A;  2FZG B;  2BKD N;  4DBQ A;  5IAY A;  3CMA Q;  2LQN A;  2DO3 A;  4C8Q C;  4E7K A;  3CCQ Q;  4A4H A;  2MI6 A;  4HCB A;  2BZX A;  5GAN 5;  1K9A A;  1QVF A;  1M90 R;  1HXD A;  1JO8 A;  3JCM b;  1YBY A;  2D0N A;  3CCR Q;  1AWW A;  3VUZ A;  2RHZ A;  2YUO A;  2DA9 A;  4JLG A;  1UGQ B;  1VQ5 T;  2QEX A;  3OYL A;  4LDX A;  2BIV A;  2QQS A;  3JSC A;  5FU7 C;  4E6R A;  3CCL A;  1S72 Q;  1TUD A;  2LQ8 A;  3CC2 T;  2WAC A;  4CRI A;  3M0P A;  1K9M U;  2EQK A;  5EG2 A;  1FX7 A;  3TU4 K;  3SD4 A;  1N27 A;  2O4X A;  3M4Y A;  2QDL A;  1HJD A;  3GPL A;  3G1J A;  5IN1 A;  1X01 A;  3JCM X;  2LDM A;  2JUF A;  2LMJ A;  4BDZ A;  1QVP A;  3EFO A;  1AD5 A;  1YIJ Q;  2P84 A;  2MOX A;  2V1Q A;  3C95 A;  2MWO A;  1R8O B;  1K0X A;  2CH4 W;  5IHK A;  3EH1 A;  2RJE A;  4L59 A;  2KNB B;  1K73 U;  4MDX A;  4LDY A;  2CP6 A;  3QSU A;  3X26 B;  2J05 A;  1M27 C;  4UC4 A;  3FIF A;  1QCO A;  3VU3 C;  2EJ9 A;  4KH0 B;  1XQH A;  4Q5W A;  1MMA A;  2RHX A;  3CMA A;  3CCS Q;  1Q82 U;  1X6G A;  4LE9 A;  3CCQ A;  2KT1 A;  5HK3 A;  1BKB A;  1UE9 A;  4C92 C;  2DYI A;  4ZTF A;  4QQD A;  2PTK A;  2A36 A;  4XTX A;  4NOY A;  4OMP A;  3CCR A;  1Q86 R;  5FRM A;  2O9S A;  1H8K A;  1K76 A;  1T0J A;  3JCM h;  5FRN A;  4BD3 A;  4X9C A;  3MEU A;  2EYQ A;  1SSF A;  5J26 A;  1AEY A;  1VOM A;  2E3H A;  2I2L A;  3P8D A;  2HL5 C;  2MIO A;  4OMN A;  5D6X A;  5HCK A;  3OYC A;  2QA4 T;  3A8M B;  2MK5 A;  4AFS C;  2DIL A;  3PT9 A;  2NYS A;  1LPL A;  2C0O A;  2RO0 A;  3DB3 A;  1M3A A;  2BZY A;  1PWT A;  3L2U A;  2YXY A;  3HKS A;  5GAN h;  3CCJ T;  2MYS A;  1DJ7 B;  2A3L A;  3RKX A;  1YIJ A;  3G71 T;  2RH2 A;  1VQ4 A;  2B86 A;  3E9G A;  1VQ7 T;  2KEA A;  4DOW A;  2J06 A;  1JXO A;  2GQV A;  1OOT A;  1JQQ A;  5CQY A;  1PD1 A;  2P0Q A;  4JRP A;  1P92 A;  1RAH B;  3EG3 A;  3I55 T;  3EG9 B;  1ABO A;  5I2S A;  3EGX B;  1AOJ A;  2DZ9 A;  4EMK B;  3M59 A;  1PRL C;  2AIR B;  3CCU Q;  1W2B P;  2RI5 A;  3CCS A;  1BU1 A;  2DRK A;  4M75 D;  4GLK A;  2WSF E;  5GJV B;  1VQ6 Q;  1PRM C;  4QW2 A;  2DIG A;  4PJJ A;  3OY9 A;  1WX6 A;  2QYZ A;  2R5M A;  1X2Q A;  2XDB A;  1WA7 A;  3FLG A;  3FJP A;  1W70 A;  3M53 A;  2E12 A;  4RTV A;  4EDU A;  2YUQ A;  5KE2 A;  2IPO B;  2XDD A;  1W2B A;  2RF0 A;  4M75 B;  3MET A;  3CC4 T;  1YJN T;  3QUI A;  2CGH A;  2K3X A;  2RN8 A;  3C12 A;  2L8D A;  4WF2 A;  1AWX A;  2GCX A;  2DD4 A;  1NJI U;  2CP5 A;  5AT1 B;  3JCM W;  4R0K A;  2L3P A;  3MHX A;  3VKI A;  3VV0 A;  1ARK A;  1BCM A;  3H0F A;  3MEV A;  3PE0 A;  3DKM A;  1VQ5 Q;  1KC8 R;  1QP3 A;  3GF5 A;  4E7I A;  2FPE A;  3P8H A;  1M1K C;  1O75 A;  3OW2 S;  2EYW A;  5M9O A;  1NE8 A;  1XNI A;  2KSS A;  3CCU A;  2EKO A;  4C5G A;  3CCM T;  4II1 A;  4Y28 E;  2M51 A;  2RMO A;  4A54 A;  4N4H A;  4M75 F;  1X6B A;  1LVK A;  2E65 A;  3JB9 J;  4RTY A;  2JTF A;  4BDY A;  2MPX C;  1T3L A;  3SFM A;  4QQG A;  3OBY A;  5CO7 A;  2DVE A;  1R77 A;  4A4F A;  4VUB A;  4LUD A;  1N9R A;  2HNI A;  2ZPH B;  3CXC P;  4HXJ A;  2QXF A;  5GJW B;  2HMA A;  2IVW A;  3SEM A;  4ATO A;  4E7H A;  2BE9 B;  2ZPB B;  1PCX A;  4FYV B;  3ZL7 C;  2L5Q A;  4FYY B;  2QQA A;  2PZ1 A;  1D0X A;  4KGX B;  1QP2 A;  3QG1 A;  1AZE A;  3V8L A;  4J9G A;  1WHJ A;  4XTY A;  1G3W A;  3VRY A;  4DA4 A;  4PKC C;  2WSC E;  1YJ9 T;  1M1K R;  5CKB A;  2NLU A;  3JCM g;  4J7I A;  2CSQ A;  4HT9 A;  1VQ5 A;  4C5I A;  2ROT A;  3GBQ A;  1ZBX A;  1BI1 A;  3CC2 A;  2H3E B;  3CXC A;  2QA4 Q;  2JMC A;  2XK0 A;  3EG9 A;  4M77 D;  2MF2 A;  3EGX A;  4C92 D;  2VB6 A;  3OA6 A;  4EMK A;  3RMQ A;  2FHD A;  2DTH A;  1UGR B;  5GAO l;  2LX7 A;  2X4X A;  2DXC A;  2FVU A;  3JB9 I;  1WNL A;  2CUB A;  5GAN g;  3CPW P;  4F7U G;  2K5I A;  2DF6 A;  3CCJ Q;  4EIK A;  3OYE A;  3G71 Q;  1XJW B;  3VS0 A;  1QMC A;  1TWB A;  1PHT A;  4FW1 A;  1Q81 U;  1VQ7 Q;  1RAF B;  2W0Z A;  1SEM A;  3M5A A;  3HRU A;  1NEG A;  1W6X A;  1QWE A;  3MEW A;  4M77 B;  1UTI A;  4C92 B;  4JJC A;  2L89 A;  3I55 Q;  4IUT A;  2DER A;  4XU0 A;  4BAC A;  1M9S A;  3M0Q A;  2V26 A;  4RTU A;  2L2P A;  4CC2 A;  4BI3 A;  1VQO T;  5A0G A;  4AFQ C;  2X4J A;  3OMG A;  3ZBD A;  4M75 A;  3RER A;  2EYZ A;  3WVE B;  4M7A C;  2QAS A;  4EPC A;  5CVI A;  2PUK B;  2K2V A;  3PVQ A;  5A2Q E;  1TSF A;  1G8X A;  3N5B B;  2ZPG B;  2BZ8 A;  2COW A;  3E2U A;  2F2W A;  2MWP A;  4RTZ A;  4CC4 B;  3QBY A;  5GMK i;  1IHV A;  2FPD A;  2DL8 A;  2DAQ A;  4XTZ A;  3ME9 A;  1O9S A;  1HSQ A;  2W10 A;  4OB0 B;  5LJ5 g;  2F1L A;  3QO3 A;  1QVF S;  2QA4 A;  5GAN 2;  4B6M A;  2HEQ A;  5GAN 8;  3S3M A;  1VIF A;  4M7D C;  4M77 F;  2BUD A;  2VXE A;  1TU0 B;  1OEB A;  1X27 A;  2DTO A;  5CKH A;  4HVV A;  1YJW T;  2XID A;  1GCQ C;  2EQJ A;  3CCJ A;  3G71 A;  2FG0 A;  3S3N A;  1QCN A;  5LJ3 d;  1VQ7 A;  2GFU A;  2EW3 A;  4M75 G;  1I81 A;  2EJF A;  4C0F A;  2CP0 A;  1YHQ T;  1ZA1 B;  4NL3 A;  5C6S A;  4J9B A;  1QVG P;  3I55 A;  2CP3 A;  2D6F A;  4ZGJ B;  1BIB A;  3RDV A;  4E7S A;  1Q95 G;  3CCM Q;  1Q7Y U;  1AHJ B;  4J6W A;  1UB4 A;  2O01 E;  2X35 A;  3TVT A;  2ZZD A;  1UHC A;  2JNG A;  2DL3 A;  2SEM A;  3LX7 A;  1TUG B;  2AK5 A;  2CP7 A;  2CS7 A;  3QPH A;  4C8Q E;  1FMW A;  3NFC A;  2KXC A;  4Z88 A;  4K11 A;  1QVG A;  2YLB A;  2EGE A;  3J81 E;  1WXT A;  2CZ7 B;  1M1G A;  6AT1 B;  3CC4 A;  2CT4 A;  3EHR A;  3I56 T;  1YJN A;  3NTK A;  3CEY A;  2JM8 A;  1GCP A;  4BUG A;  2OTL Q;  3CCE T;  4MZM A;  4YTL A;  1U8R A;  2X51 A;  3CCV T;  2E70 A;  2GNC A;  4Z8A A;  1R0B G;  2QQB A;  2JS2 A;  1YJ9 Q;  4OB3 B;  3ULR B;  1UGV A;  3GOX A;  1PSF A;  3VYG A;  3EH2 A;  1WZO A;  3VUB A;  1M5Q 1;  3ZEH A;  2WSE E;  2JS0 A;  1N6A A;  1GBR A;  2JMA A;  4HA8 A;  1Y07 A;  1E6G A;  4M78 G;  2EJG A;  4C92 A;  4XK8 E;  3JAM E;  1M90 C;  5GAN d;  3CCM A;  1K9M R;  2ZGW A;  4IIO A;  2HCK A;  7AT1 B;  4JJD A;  4DOV A;  4KUD K;  1RAA B;  3C4S A;  4XTU A;  2XU8 A;  1ACM B;  2GTJ A;  1JRI A;  3R6O A;  3CBO A;  2LRQ A;  2ECZ A;  5GMK l;  2DEU A;  1WHM A;  4C92 E;  3D7S B;  1D1B A;  2OTJ T;  1K73 R;  4ZN3 A;  3OYM A;  2DBK A;  4IIM A;  1MMN A;  2YUN A;  4QKU A;  1VQO Q;  4RCB A;  4KH1 B;  3I5S A;  1T0H A;  3L2V A;  2JT4 A;  2ED0 A;  4B9W A;  3OS0 A;  2KRO A;  1KQS P;  1TOV A;  2KDS A;  2V1R A;  1Q82 R;  2VV5 A;  2FRY A;  4M77 G;  3VS6 A;  4C0D C;  3TRE A;  1VYV A;  2AT1 B;  2F5K A;  1B34 B;  2DL7 A;  2EYX A;  5DY9 A;  5LJ5 d;  1YJ9 A;  2IIM A;  2R57 A;  1IRE B;  4MZT A;  1W2B S;  3QYG B;  1D0Y A;  2A08 A;  2KBT A;  1EFN A;  3UDC A;  4XQ3 A;  2H3J A;  3QKJ A;  3H0H A;  1SSH A;  1N9S A;  3VS3 A;  1VQ9 T;  4M7A D;  4BB7 A;  4FSX A;  3KFV A;  3MP6 A;  1KG1 A;  2KAF A;  4LNP A;  5LJ3 h;  2DNU A;  4LD9 K;  8ATC B;  4OVA A;  1Q86 C;  3A8H B;  3EHQ A;  4PJO G;  1ABQ A;  1WHL A;  4NL2 A;  1K8A U;  4PLI A;  1QKW A;  4F16 A;  1RAB B;  4DBF A;  2G6F X;  4HT8 A;  5KYU B;  3OYN A;  2MAM A;  4M78 C;  3BW1 A;  1RLQ C;  2MCN A;  2VKN A;  4DBH A;  2OAW A;  5GMK j;  2M02 A;  2A28 A;  1OX8 A;  2DXB A;  4ME7 A;  2ZPI B;  2E1H A;  3OQ5 A;  1VQ4 Q;  1PNJ A;  2YUP A;  2GGR A;  4M7A B;  3RMS A;  1YHQ Q;  4OML A;  1UJY A;  3QXE B;  3HFO A;  2K6D A;  4BE0 A;  4ZN1 A;  3MEA A;  1VQO A;  4F04 B;  4AFU C;  4BY6 B;  5I21 A;  3EFS A;  4DQ2 A;  5CKF A;  2Y4Y A;  3EGU A;  3JB9 D;  1VQ8 T;  3SWN C;  8AT1 B;  1X69 A;  2NUT B;  1NG2 A;  2AKL A;  2FPF A;  2LZ6 B;  5HY6 A;  4O5V A;  5CKD A;  3LH5 A;  3LGF A;  3X28 B;  1WDX A;  3M58 A;  3L2R A;  1EZZ B;  1UGP B;  1ZSZ C;  4LDV A;  1QQJ A;  2F2X A;  4JZ3 A;  2LNV A;  3QDR B;  1AZG B;  4HCC A;  3JV3 A;  1I07 A;  1IB8 A;  3I56 Q;  4IUU A;  5KYY B;  3NTI A;  3E1S A;  1YJW A;  3OMC A;  3V7R A;  1G83 A;  1I8F A;  1NLP C;  2QTV A;  3CXC S;  1VQL T;  1VQK T;  1NJI R;  1I5O B;  1BB9 A;  4PL6 A;  1SHG A;  2RNA A;  3CBM A;  4JZ4 A;  1YHQ A;  2P0K A;  2HAX A;  2K3Y A;  4PJO C;  1FMK A;  4JJB A;  4JRI A;  2EIF A;  2KXD A;  3HRS A;  1G3S A;  1TH7 A;  2A7Y A;  1GXI E;  1BI2 A;  1V1C A;  3VS5 A;  3M54 A;  3OS5 A;  3Q1J A;  4DBR A;  1SRL A;  2X3W D;  2JM9 A;  1KC8 C;  1MHN A;  3QDF A;  5CKE A;  5D6W A;  3JB9 F;  1Z9Z A;  4HCK A;  1M2O A;  4BI8 B;  1UEC A;  2M0Y A;  2XG8 D;  1AWJ A;  2R58 A;  1B34 A;  2XKO C;  1B07 A;  4E2F B;  5GAM j;  1PG5 B;  3CPW S;  4ELZ C;  2ATC B;  1CKB A;  2OTJ Q;  2FZK B;  1PKT A;  3M0R A;  4BE1 A;  4L6V 5;  4C0Z A;  2HD0 A;  3PMI A;  1OYX A;  5LJ5 h;  3DLM A;  4CI0 C;  2DX1 A;  3I56 A;  1Q81 C;  2P0P A;  3CCE A;  1WFW A;  4A4G A;  3CME T;  4N4G A;  3CCV A;  2KMT A;  3UA6 A;  1M8M A; 
#chains in the Genus database with same CATH homology
 2HQX A;  3M5A A;  1NJI C;  3HRU A;  1VQM T;  2DK3 A;  3OSV A;  3OBW A;  4MML A;  4C5E A;  1KHC A;  3PIO A;  5I2M A;  4FM4 B;  3MEW A;  1Y7X A;  4FT2 A;  3L42 A;  4M77 B;  4N4I A;  3M55 A;  4RMO A;  4C92 B;  3LWI A;  2L89 A;  3SWN A;  2JOY A;  3G6E A;  3JCM d;  4IUT A;  3OYG A;  2CYZ B;  4XU0 A;  2E41 A;  5GAM f;  1M9S A;  3OYY A;  5GMK m;  3V7S A;  4BAC A;  2LQK A;  2GF7 A;  2RD1 A;  3WXM B;  2VGN A;  4IKF A;  4BI3 A;  3SDZ A;  3HPW A;  2F69 A;  1VQO T;  5A0G A;  4PNO A;  5FU6 C;  5KE3 A;  4M7A A;  4FT4 A;  2X4J A;  3OMG A;  3ZBD A;  4M75 A;  3RER A;  1I5L A;  4J83 A;  3WVE B;  4M7A C;  2DKG A;  1KHI A;  4EPC A;  2PVO B;  5GAM e;  1H64 1;  5CVI A;  2PUK B;  5LJ3 g;  4JLI A;  2K2V A;  3PIP A;  4X9D A;  4M7D B;  2RK1 A;  5A2Q E;  3M4G A;  3QZ5 B;  4HCZ A;  1VUB A;  2HBP A;  3N5B B;  4C8Q D;  2ZPG B;  3DLL A;  4KUL A;  5GMK e;  2LT1 A;  3LGL A;  4M77 A;  3JCM c;  2RI3 A;  3J7A F;  2MWP A;  2PU9 B;  4M77 C;  2F5T X;  3G4S T;  3OYB A;  3OS1 A;  3QBY A;  4Z02 A;  3QHS A;  1HK9 A;  4KBM B;  1OZ2 A;  3FEO A;  5GMK i;  2GFA A;  4MMK A;  4M7A F;  2DAQ A;  2VC8 A;  4XTZ A;  1IZ6 A;  3ME9 A;  1O9S A;  1M90 U;  4OB0 B;  5LJ5 g;  3CCU T;  3X20 B;  3PTA A;  3V8J A;  2V8I A;  3QO3 A;  5CR2 A;  4M7A E;  1QVF S;  2QA4 A;  5GAN 2;  2K5F A;  5J39 A;  5GAN 8;  2EQM A;  4J6X A;  2DXT A;  3S3M A;  2OTJ A;  1VIF A;  2QI2 A;  4M7D C;  1WQW A;  1LJO A;  4M77 F;  3S6W A;  2EWN A;  4C0G A;  4A4K A;  4F7U B;  1Y71 A;  2BUD A;  4N0A A;  2AHJ B;  2VXE A;  4C0D B;  4C8Q B;  5DLO A;  3EFR A;  3V8K A;  5GAN 4;  1S72 A;  2DTO A;  5CKH A;  1YJW T;  2RHY A;  2X4Y A;  1JJ2 S;  4PJO A;  4M77 E;  5J3B A;  2XID A;  3ZFJ A;  2EQJ A;  3CCJ A;  4QVD A;  3L2Q A;  1OI1 A;  2C06 A;  2XI9 A;  3G71 A;  3S3N A;  3X24 B;  2DXU A;  3H8Z A;  5GAM h;  2YRV A;  3HP9 A;  1WJQ A;  3HL8 A;  5LJ3 d;  1QVG S;  1VQ7 A;  2GFU A;  1G3T A;  4M7D F;  2X4W A;  1I81 A;  2EJF A;  4M75 G;  4J7F A;  4C0F A;  2DJZ A;  3G7Z A;  1YHQ T;  5FU7 B;  2OTL A;  2DZC A;  1WPY A;  3PGG A;  4M7D E;  3GIB A;  4NL3 A;  2LTO A;  3VYH B;  1PSE A;  5C6S A;  2BKD N;  3BDL A;  3I55 A;  5IAY A;  2D6F A;  4ZGJ B;  1BIB A;  3DB4 A;  3F70 A;  1Y96 A;  2DO3 A;  4C8Q C;  2K57 A;  4E7K A;  4JS5 A;  5HK0 A;  3JB9 H;  4A4H A;  1WJS A;  2MI6 A;  2JN0 A;  2K5L A;  4HCB A;  5GAN 5;  2E6Z A;  1BIA A;  1Q7Y U;  3JRZ A;  1AHJ B;  2XD0 A;  5GAO p;  1VQ9 A;  4J6W A;  1QVF A;  2CZ6 B;  5CAI A;  1HXD A;  1UB4 A;  4PLL A;  2O01 E;  2EAY A;  2EQU A;  2JVV A;  1YBY A;  2X35 A;  3JCM b;  2ZZD A;  1D3B A;  3VUZ A;  3FDR A;  3CD6 T;  2KK4 A;  2JNG A;  2RHZ A;  2VYT A;  3LX7 A;  2P4T A;  4JLG A;  4F7U F;  3KXT A;  1UGQ B;  4C8Q F;  4QVC A;  1VQ5 T;  1RI0 A;  2QEX A;  4QVZ A;  4E7J A;  3OYL A;  4LDX A;  2BIV A;  2QQS A;  3JSC A;  5FU7 C;  5FRO A;  2CS7 A;  3CC7 T;  1ZHI A;  3QPH A;  5GAN j;  3CCL A;  2LQ8 A;  4F7U E;  2WAC A;  4CRI A;  3CC2 T;  4C8Q E;  3NFC A;  1K9M U;  2CZ0 B;  5DLQ E;  2EQK A;  2Y90 A;  4A4E A;  5EG2 A;  1QVG A;  1FX7 A;  2G3R A;  2YLB A;  3JCM f;  1FWZ A;  3TU4 K;  3SD4 A;  2FYK A;  1N27 A;  4E47 A;  2O4X A;  3M4Y A;  2EFI A;  4D6W A;  3J81 E;  2VGM A;  1Q86 U;  2RA2 A;  3GPL A;  4GY5 A;  2CZ7 B;  1M1G A;  3OB9 A;  1YIT A;  2FL7 A;  5IN1 A;  1X01 A;  3ER0 A;  3JCM X;  5GAM g;  3CC4 A;  3I56 T;  2LDM A;  2JUF A;  1YJN A;  3NTK A;  3CEY A;  3JCM e;  3A8L B;  4BDZ A;  1QVP A;  4BUG A;  3CCE T;  4MZM A;  3C95 A;  4XU3 A;  2MWO A;  1R8O B;  3ASK A;  4YTL A;  1YI2 T;  5GAO q;  1U8R A;  1VQP A;  3CCV T;  3LWH A;  2E70 A;  3FB9 A;  2DEQ A;  2RJE A;  4L59 A;  2QQB A;  2JZ2 A;  2RJC A;  5L8R E;  1K73 U;  2KVQ G;  4MDX A;  4LDY A;  4OB3 B;  5LJ3 j;  5GAN f;  1VQ8 A;  1NPR A;  3GOX A;  1PSF A;  3VYG A;  3QSU A;  3BDU A;  3VUB A;  1LNX A;  3X26 B;  1M5Q 1;  3ZEH A;  2WSE E;  3VJP A;  3G6E T;  3CPW A;  1BYM A;  3CPF A;  1N6A A;  4TVR A;  4KUI A;  4HA8 A;  1LOJ A;  4UC4 A;  3FIF A;  4J5Y A;  3LH0 A;  3VU3 C;  4OMF B;  3JCM V;  3V7C A;  2EJ9 A;  5KH6 A;  1Y07 A;  1XQH A;  4Q5W A;  2RHX A;  4M78 G;  1UGS B;  4EMG A;  3CMA A;  5GAO r;  5KCH A;  2EJG A;  4C92 A;  1Q82 U;  4XK8 E;  3JAM E;  2RHU A;  3CCQ A;  1M90 C;  5HK3 A;  1X75 C;  1BKB A;  5GAN d;  4C92 C;  3CCM A;  4QQ6 A;  2ZGW A;  5HKC A;  3OYI A;  1NZ9 A;  4ZTF A;  4DOV A;  3P8B B;  4QQD A;  4KUD K;  3C4S A;  4XTX A;  4NOY A;  2K4Y A;  2ZCF B;  4XTU A;  3CCR A;  5FRM A;  3A8O B;  3INZ A;  3JCM h;  2XU8 A;  3LLR A;  4M7D A;  5FRN A;  4BD3 A;  2HQE A;  4EMH A;  1JRI A;  5LJ3 f;  2KQW A;  2VUB A;  4X9C A;  4MDW A;  3MEU A;  3R6O A;  2EYQ A;  1SSF A;  4HKE A;  5J26 A;  3CBO A;  3P8D A;  2I2L A;  4C92 F;  2LRQ A;  5D6X A;  3OYC A;  1BI3 A;  3CBP A;  3CCR T;  2LCL A;  5GMK l;  2QA4 T;  3A8M B;  2RK2 A;  4JJN K;  1VQK A;  4C92 E;  1FXX A;  5LJ3 e;  1VQ6 A;  5D6Y A;  4XTV A;  3S3O A;  3UPU A;  3LYI A;  4FU6 A;  3PT9 A;  3OYH A;  2OTJ T;  5LL6 S;  4M78 D;  3TEE A;  4ZN3 A;  2M16 A;  1X6O A;  3HSB A;  3OYM A;  2RO0 A;  3DB3 A;  4M7A G;  5KCO A;  4B9X A;  1KQS S;  1S72 T;  3A5Z B;  3L2U A;  2DD5 A;  3QYH B;  4RCB A;  2FB7 A;  3WVD B;  3A8G B;  3HKS A;  3L2V A;  5GAN h;  2QQR A;  5GAO m;  4XAX B;  3M56 A;  2QQ9 A;  3CCJ T;  1YIJ A;  1DJ7 B;  2A3L A;  3RKX A;  4B9W A;  4A53 A;  3JCM Q;  3G71 T;  3HFN A;  4F7U A;  2RH2 A;  1RL2 A;  3QJ6 A;  3OS0 A;  4C8Q A;  1VQ4 A;  3E9G A;  3HRT A;  2KDS A;  1Q7Y C;  2VV5 A;  4ZGE B;  1VQ7 T;  5CK9 A;  4DOW A;  4C0D C;  4M77 G;  3TRE A;  4JS4 A;  4BI4 A;  2GQV A;  3TCJ A;  2F5K A;  2CKK A;  1B34 B;  1YJ9 A;  5DY9 A;  5LJ5 d;  1W2B S;  2OTL T;  2R57 A;  1IRE B;  4MZT A;  5CQY A;  2P0Q A;  4JRP A;  1YIJ T;  2PQW A;  1P92 A;  2D9T A;  4C5H A;  3I55 T;  4M78 B;  3MP1 A;  3QYG B;  3L2Z A;  5I2S A;  3GNG A;  2XIC A;  5C0M A;  4OB1 B;  2RHI A;  4MZP A;  2DZ9 A;  4EMK B;  3M59 A;  3H6Z A;  1QW1 A;  3UDC A;  2QDY B;  2VXF A;  2RI5 A;  2Y4X A;  4XQ3 A;  3CCS A;  1VQN A;  4M7D G;  2H3J A;  3QKJ A;  1JJ2 A;  1N9S A;  1VQ9 T;  1K9M C;  4M7A D;  4BB7 A;  4FSX A;  3MP6 A;  4M75 D;  1KG1 A;  2KAF A;  4GLK A;  2WSF E;  5LJ3 h;  4LD9 K;  4OVA A;  2V8J A;  4J6Y A;  5CQX A;  5AYF A;  1KC8 U;  2E6N A;  1WQ7 A;  4J8O A;  1Q86 C;  3A8H B;  2LVM A;  4PJO G;  3OS2 A;  4NL2 A;  1K8A U;  4PLI A;  4QW2 A;  2DIG A;  2OAU A;  2B8A A;  2RB6 A;  2QEX T;  4JRQ A;  3JCM P;  1MGQ A;  2QTX A;  3JB9 G;  3OY9 A;  2R5M A;  3GP8 A;  2XDB A;  3FC3 A;  4HT8 A;  3CCL T;  3FLG A;  3OYN A;  3CME A;  2MAM A;  4NS5 A;  3BW1 A;  1WGS A;  3MO8 A;  3FJP A;  4M78 C;  2YLC A;  3E9F A;  3T9N A;  3SWN B;  2JTM A;  3M53 A;  2E12 A;  5GMK j;  2DIQ A;  4EMK C;  1I4K 1;  2DXB A;  4ME7 A;  5A0D A;  1VQM A;  3JCM J;  2ZPI B;  4EDU A;  2E1H A;  3OQ5 A;  5KE2 A;  5GAN 3;  3OYF A;  1H3Z A;  1K73 C;  1M8V A;  4XU1 A;  2CZ1 B;  2DPP B;  4M7A B;  2KY9 A;  3RMS A;  2XDD A;  1W2B A;  1V29 B;  4M75 B;  1YIT T;  1KD1 C;  3MET A;  1NPP A;  2MMP A;  3CC4 T;  2M0O A;  3QXE B;  2PVD B;  5A0L A;  1YJN T;  3QUI A;  2CGH A;  2M9U A;  2K3X A;  3C12 A;  3HFO A;  1UEB A;  4M78 F;  4BE0 A;  2M1H A;  1KD1 U;  4ZN1 A;  1WJR A;  2PVG B;  3MEA A;  2L8D A;  1VQO A;  1VQP T;  4WF2 A;  4V2S A;  3FRN A;  1M4Z A;  4JRK A;  2ZPE B;  2GCX A;  1Q82 C;  2DD4 A;  4M78 E;  1NJI U;  4PJO D;  4BY6 B;  5I21 A;  4Y91 A;  3EFS A;  4DQ2 A;  4OP0 A;  2IG0 A;  4IUP A;  5CKF A;  5CIU A;  2Y4Y A;  3MHX A;  5GAN e;  3JCM W;  3JB9 D;  1VQ8 T;  3SWN C;  3VKI A;  3VV0 A;  4IUV A;  3J80 E;  3OYA A;  2LX9 A;  2LCC A;  3MEV A;  3DKM A;  2E64 A;  1QP3 A;  4L5G A;  3GF5 A;  5LJ5 j;  5HY6 A;  3G4S A;  3AHU A;  4M75 C;  4E7I A;  3SB2 A;  4X34 A;  1JB0 E;  4O5V A;  5CKD A;  3OYK A;  2RM4 A;  3CMA T;  3LGF A;  3P8H A;  3RIR A;  2RJD A;  3X28 B;  3OYJ A;  1M1K C;  1O75 A;  3OW2 S;  5GAM d;  1VIE A;  2V8K A;  5M9O A;  3CCQ T;  1NE8 A;  1XNI A;  3M9Q A;  2KSS A;  1JBM A;  3CCU A;  2EKO A;  3M58 A;  4C5G A;  3L2R A;  2RI2 A;  3CCM T;  1UGP B;  4II1 A;  3OYD A;  3QJY A;  4LDV A;  3RKY A;  3PMT A;  4JDS A;  1M1K U;  2YHT A;  4PJO B;  4Y28 E;  2XDP A;  4BY6 C;  3KBG A;  3OSS C;  2LNV A;  3QDR B;  4R55 A;  1N8R C;  4A54 A;  4P5N A;  4HCC A;  1W4S A;  4N4H A;  4M75 F;  4IUU A;  1VQL A;  3RES A;  4LDU A;  3NTI A;  4LD6 A;  2E10 A;  2E65 A;  3E1S A;  3JB9 J;  1N8R U;  2XHC A;  4RKU E;  3PNW C;  2JTF A;  1YJW A;  4OGC A;  3RKW A;  3OMC A;  4M75 E;  3V7R A;  4BDY A;  1I8F A;  3SFM A;  4QQG A;  3OBY A;  5CO7 A;  2DVE A;  5LJ5 f;  3CXC S;  4E7L A;  3E19 A;  4A4F A;  1VQL T;  1KQ2 A;  1VQK T;  5IT9 E;  4VUB A;  1VQ6 T;  4N0A C;  4OF1 A;  1Y96 B;  4PL6 A;  5CCA A;  1KQ1 A;  3L2W A;  1N9R A;  2HNI A;  1G3Y A;  3CBM A;  4JUV A;  4XU2 A;  1YHQ A;  2P0K A;  2ZPH B;  2HAX A;  2K3Y A;  5LJ5 e;  4PJO C;  2QXF A;  1G5V A;  1BI0 A;  2IVW A;  4JRI A;  4C92 G;  5GAN 6;  4FIB A;  3BFM A;  4ATO A;  3UWN A;  4E7H A;  3GLX A;  4RG8 A;  2EIF A;  2ZPB B;  3BY7 A;  4RG2 A;  1D3B B;  3HRS A;  3OW2 A;  1G3S A;  4IUQ A;  4ZGD B;  1VQ4 T;  2PUO B;  5GMK h;  5GAO n;  1XOV A;  1TH7 A;  2A7Y A;  5DM7 R;  4ZTJ A;  2L5Q A;  2QQA A;  1BI2 A;  1M1F A;  1QP2 A;  3QG1 A;  4XTW A;  3UT1 A;  1GXI E;  3V8L A;  4XTY A;  1YCY A;  1G3W A;  3M57 A;  3M54 A;  4DA4 A;  1XTD A;  2LT4 A;  3OS5 A;  2ZPF B;  3Q1J A;  4O6J A;  2R5A A;  3HHT B;  4PKC C;  2WSC E;  4PJO F;  1YJ9 T;  1KC8 C;  3RUX A;  5CKB A;  3L1A A;  2NLU A;  4IUR A;  1MHN A;  3JCM g;  5CKE A;  5D6W A;  3CD6 A;  4R56 A;  3JB9 F;  1K8A C;  4J7I A;  4HT9 A;  1VQ5 A;  4PJO E;  4BI8 B;  3QZ9 B;  4C5I A;  2O4X B;  4ELY C;  4LDW A;  1ZBX A;  2DTI A;  3QII A;  2XG8 D;  3CC7 A;  1BI1 A;  2R58 A;  1KQS A;  1B34 A;  1ZQ1 A;  2LC4 A;  3CC2 A;  2XKO C;  3NTH A;  3CCS T;  1VQN T;  5FLX E;  3CXC A;  1OZ3 A;  3PFS A;  4RCC A;  1EIF A;  5GAM j;  3LW5 E;  2XK0 A;  2L3R A;  4M77 D;  4M78 A;  2MF2 A;  3CPW S;  4ELZ C;  2RJF A;  4C92 D;  4OGE A;  3OA6 A;  3O8V A;  4EMK A;  3RMQ A;  2FHD A;  2DTH A;  1UGR B;  5GAO l;  1U1T A;  4BE1 A;  4KT0 E;  3MP8 A;  4L6V 5;  4C0Z A;  2X4X A;  2HD0 A;  3PMI A;  1OYX A;  5LJ5 h;  3X25 B;  2D0Q B;  5FU6 B;  2DXC A;  2FVU A;  3DLM A;  4CI0 C;  3JB9 I;  1WNL A;  2E5Q A;  3KUF A;  5GAN g;  3I56 A;  4F7U G;  1Q81 C;  3URG A;  2P0P A;  3MCA B;  2K5I A;  4C8Q G;  3CCE A;  4A4G A;  3CME T;  3OYE A;  3GNF B;  4N4G A;  1U1S A;  4OB2 B;  1YI2 A;  4BE2 A;  3EAE A;  4M7D D;  3CCV A;  2KMT A;  1Q81 U;  3C94 A;  5GAN 7;  4FL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...