1UB5B

Crystal structure of antibody 19g2 with hapten at 100k
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
214
structure length
214
Chain Sequence
DIVMTQAAFSNPVTLGTSASISCRSTKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPNRFSSSGSGTDFTLRISRVEAEDVGVYYCAQNLELPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNGYTCEATHKTSTSPIVKSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody 19G2, alpha chain
publication title Structure and Dynamics of Blue Fluorescent Antibody 19G2 at Blue and Violet Fluorescent Temperatures
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 42
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2003-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ub5B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ub5B01
3W5NA 1OAYH 1WLHA 2DQDL 3S36X 2OYPA 3T2PA 3QO1A 3C60D 5E8DH 1IGYB 4FNLH 3BKCL 4Z7QE 1JPTH 2PW2A 4X6DB 3UPRA 2AXGB 1P7KA 2VTFA 3LZFH 2Q7YB 1W0WB 5SX4H 4RFEB 5HDBE 3H8NA 2WBJD 2APTA 1FZKA 5JOEA 4M7ZC 1HHKB 1UB6B 4XVSL 1CGVA 4EI6B 1MCHA 4JFQA 4D2NA 1DBKH 2HJLA 4WO4C 3W0WB 4QXUL 5JORB 1PFCA 4KXZI 4KZEL 5DDHA 3RVUC 5BVJA 1FNFA 4XMPL 3QEUB 4QNPE 1FG2A 1A6VL 4XT1C 3C60C 3RPIB 1E6JL 3EFDL 2DL2A 3MLXH 3ZE2E 3ZE0F 1LO3L 2HLAA 4LK4A 5BRZA 3IETB 2NW3A 3TWCL 2XG4A 1GOGA 1YNLL 4IJ3C 1A4JA 1BFSA 5CWSA 1A7QH 1CFNA 4MA8L 1OB1A 2APVA 3LQAL 4RDQF 4JG0L 1QFWL 3V7AG 2QQNH 4P2CG 3IDJB 2I9LA 4PY8I 3I02A 2Q6WA 5TGBA 1ZT7A 5DVMA 2DQJH 5I71B 2BNUA 1GC1C 1RJCA 3AREA 1MRDL 4U1SB 5CSGA 3ZT5A 3TYFB 3O8XD 2VXSH 4G8FA 1FCGA 3D85B 3VWJA 4OLZL 3ULVL 4YDVB 2WLZA 1M7DA 2BCKA 1L4IA 2VUOA 2HH0L 1PG7L 4QHLA 3C5SB 3DOSA 2HKHL 2FB4L 3MJ7B 1GGUA 4QTIH 2PKDA 3S3JA 2DQIL 2CR3A 5T3ZH 1NGZB 3VJ6B 4X6EA 3ZE0E 4I3SH 1PJ9A 1M4KA 5GJSH 4HKXB 1BEYH 4H20L 1NEZG 5I8OH 3RIAK 3D3VE 3HG1B 1MLBB 4YDKL 2PO6A 2YD5A 1KTLB 3O8XC 4N0FA 3BXNB 4TUJA 5K9OA 4WFEE 1DN2A 2O61A 1Q9WA 2GJ6E 2R0ZL 1YDPB 5HPOA 2XZCL 4YIQA 4U1NB 4YXLL 3MRRB 5IG7B 4PRIB 1ZKAA 4F80A 5E2JA 3ILQD 3LMJL 3I6GA 4LSTH 3DUSA 1OAZH 3VXMD 1W72L 1JGDB 1T0NB 4MD0A 7CGTA 1M1SA 2CLRB 2ZUSA 4JPIB 4X4YB 2PYEB 3KPRE 2PNDA 4L5FH 3DX7A 1D5XB 2W60B 5EZIL 4NO2A 3C2AL 3L3HB 3O3DB 3GZKA 1GZQB 1KPUA 2V2XA 4IRJD 3ME0A 4YDIH 3U9UB 1EZVX 2W0KA 3CDYA 3INUL 3IDGB 3P4LA 5MEND 1WTGT 3WNLA 5C8JB 2E3VA 4XP6H 5CBEB 4RGNE 5L2JA 1H9VA 4P3CL 3D9AL 3C6LA 2AS5M 5DRZA 1JWMA 4CADA 3ILQC 5K9QG 2VITB 1F45A 4PGCA 4JPVH 3WS6A 3JXAA 3EJYC 4CAGA 1T21B 4BSJA 1RMFL 1AGDA 5BXFA 1IAIL 4XBEL 3WFEL 1DLFH 3QCVH 1QFPA 4IRJC 2PW1A 1AI1L 5KVGH 1TVBB 3QXDA 3O2WL 3C5JA 3WFCL 4JDZA 1CD9B 2IQ9L 4FQXA 1U2CA 3VGDA 4Q97A 4KU1A 4OFVA 3IF1B 1H15B 5BV7C 2VMFA 3RNKA 3K4DA 1CD1B 3PWPD 1E0OB 4F2MB 5HHQB 2DDQL 4DKEH 3TT3L 2OR9H 3RRQA 3O11A 4Y4FA 1TCRB 1DBJH 2ARJQ 2EIDA 5D1ZB 5C6TL 1LK3L 4P2QE 4IMKC 5ADOH 2YRPA 1RY7B 4OLVH 3CLFH 2A9NL 2C4XA 3VXRD 1ZHKB 5ISZE 5CUSL 1FPTH 5L2KE 2CKNA 1DFBH 5KN5A 4UIKH 4RMRA 2R8SL 4XBGB 5CJ8A 3DWTA 1RPQA 3RGVC 4LFHD 3WSQH 4GS7B 5DTFB 1VPOL 3QDJD 3BGMB 5EU6B 4Z9KB 3KWWA 3MLZL 3N85L 1W72A 2XY1A 4N8VA 3BPOB 5IQ9B 2D4DA 4RISH 1U3JA 3O41B 4C56B 1I1YB 2FWOA 3QUMB 3SGKA 3V9FA 2XN9D 2PR4H 3V4PL 3G9VA 1MSPA 5I1AA 1NUGA 1D9KC 1ZTXH 3UBXA 3F7YA 1ZHNA 5HGGS 5DSCA 4PJ5B 3QNZB 1OP3H 1S9WB 1QRNE 2Q8BH 5DD3L 1FZOB 4M62H 1RUPL 3BHBB 3NAAL 2CKBB 2CO6B 2VLRD 3CDGA 3GUTB 4ODTH 2B4CL 5BZDB 3VWKA 4TVPE 4I9WE 1D6EB 2JB5H 3GRWL 4Z7OF 4P57B 4POYA 3ZZ1A 5IVXB 1BF2A 4D94A 1HH6A 3Q48A 1C7TA 5D1QD 4WWID 5TE7H 2W0FA 1PQZB 1V7MH 3DMMB 3NFSL 3GSQA 3MREA 3PP4L 4NOBA 4F7EA 4XVJH 1KTRL 2X1QA 3L3OB 4JB9L 3H3PL 1KFAL 1Z9SA 2DQDH 3NCYP 5LWYL 2MMXA 4QRRD 1D5MB 2F5AL 1FJ1A 5MERA 2R2BA 2H32A 4V1DD 4Q6IB 4YZFE 3BKCH 4FQIH 2BNQD 2IANB 2HFFB 1R5WA 1X3DA 2IPUK 3TIEB 3VGHA 3DO7A 4DQOH 1ACYL 1FL5A 2PXYA 5D5MA 5E4EC 3MRFB 5ECJE 4WU5B 3AU1A 1I3RA 2NR6D 5D1QC 2NQCA 3DI2B 3O3AA 1RZGB 5SX4I 4JFZH 2B0SL 5AYQA 3MRNB 4GQ9L 4ACPA 5CEYB 2DQTH 4CW1A 4X98B 4MYWB 1FDLH 1P84K 3F7QA 1K8DA 4HS3A 2M2DA 2JIXA 3VFOB 3QPXL 2DD8H 1J05A 1LP9B 1F4HA 3CCHB 5FYKD 5FUOH 2X4RB 1MH5B 4MXVF 5E1HB 1WISA 3QUXD 3B8SA 1NCWL 3A6CH 5F7EH 4EN3D 1BD2D 3S96B 4M7LL 4ELME 3FQXB 4KV5F 1I7TA 1ORSB 1LO5A 1YNLH 2MSPA 1P4BL 1J1XL 1HK6A 2J3SA 2FO1A 2R4RL 3LQAH 5F1OB 2LTQB 4JG0H 4X80H 1QFWH 1JZ3A 1MFBH 2CLZB 4HWZA 1UGNA 4PD4K 1DR9A 3AY4C 4KJYA 4PB0H 3KNBB 1RK1B 3GM0A 4F37F 2Q76A 1RJZB 5FA3A 4EDWH 2Y07L 3P0VL 1MF2L 4OZHB 3QXAB 4M3JA 4OLZH 2Y7QB 4X8JB 3TJEL 3QUXC 1EO8H 1NFDA 5FGCE 3GRWA 2J6EL 5A3ID 5H37H 4PBWD 4HGWB 3NH7H 2HKHH 4YFEA 4GAYB 4OGYH 5M94B 4A6YH 3VFGL 4JFDA 1WZKA 4MXVE 2R56L 1XCQB 1CF8L 2DQIH 3N9GL 4TUKL 5TPWL 4X7TB 1S7QB 4XXDA 5HD8D 1U3ZA 3RGHA 4KV5E 5F3HB 2JB6B 4KMTL 4CUCA 3BMWA 4YFLI 2WAHA 4I48B 5DQDH 3QO0A 4XCNB 4NN6B 2GSGA 3DX6A 3RP1A 4LQ1A 1IGCL 1R3IL 2R0ZH 3MNWB 2XZCH 1K8IB 2ZWLT 5A3IC 3MOAL 4XXCA 1N3NA 2BX5A 3AS1A 4YXHL 5ESAB 3QFDB 5JQHC 5ESQB 1FFNA 1EK3A 3WUWB 1ND0B 1BX2A 1TENA 2IAMA 3NCMA 3MACL 5D6CA 1B0WA 3BP4A 5EZIH 4MQSB 3RWFB 2BERA 2XWTB 5HYQA 3S88L 3IKCA 4OCRH 2BVPA 2F8VA 1T1WB 2J7LA 3ES6A 1YQVH 3CMOL 3RL1B 2IFFL 4PJGA 4S1DD 3OZ9L 3BIKB 5ICYA 4U6VH 2AW2A 4BKLB 3WIIL 4AM0A 3CAFA 4NN5B 3HTLX 2XRAH 4QWWD 1R0AL 4OZIB 3FT3A 4R4BA 1YYML 3H7BA 4IS6A 3WXVH 1JYNA 3G6AA 2QR0B 3W11D 3KYNB 4YBQD 2IADB 1IMHC 2Z35B 1TPXC 1IAIH 5HYJA 2J2ZA 5E9DB 3F7RA 5FAAA 5C0BA 1JV5A 4Z77B 1INEH 1AO7B 1IQWL 2X89D 2X4SB 1FYTD 1U36A 3M1BB 1R3JB 4Y2DA 4NGHH 4LDEB 2CR6A 2IQ9H 5KW9H 4E42B 1XIWA 3MCLH 1KCUL 2X1PA 2J6EA 1CT8B 1A3RL 1KLGB 2DDQH 4ZUSA 3CLEH 3BPLC 5HHPB 3MRHA 3JUZA 3LRGA 4QWWC 4OI7A 3K2UL 5K93A 5GRYA 1E4WL 3MV9A 3OKDB 4JDVB 2FJFB 3V95A 5C08E 3H2WA 1QO3A 1LK3H 3W11C 4QXGL 1UACL 3H42L 2EC9T 3ZLQC 4YBQC 1GGBL 1PKQE 5C86A 4OI8A 1QSFD 4JREB 3B9AA 3KYKL 4UIMA 2GQHA 4FQQB 3DRQA 1P69B 3CUPB 3W9EB 5CP3A 1ZHLA 1BOYA 4HFWA 1DVFD 3WE6B 3BD5A 2JJTA 5J57B 4LCWD 1T0MB 2Q87A 4E5XA 2E27H 3UROR 2AJYL 2EDOA 4HUWA 4X5LA 3N1QC 2Y25A 5HHXL 3ROOA 3JV6B 4HH9A 2Q86A 3MLZH 1HYSC 3L7FB 4PTUB 5D9SB 2D7OA 4K3JL 3PWUA 5IGXL 2X7LB 4UU9B 1R3HA 1OVZA 3V0VA 3ZL4L 3MC0A 4QY8B 3IXTB 4WW2A 3V4PH 3R1GH 5DJXB 4ORGA 5FOBA 3HZMB 4X6CF 3MYJB 4R3SB 3ULUF 3W82A 4LARL 3O81A 4G8IA 3T3PE 3X3GL 4OKDA 3T1FB 1I8KB 3BO8B 1RUPH 1YNTA 1T66D 4QLRA 2VLKA 1CFSB 1MIML 4UDTA 2NX5D 2QTEA 2WLYA 2HYMA 5D2NE 1BZ9B 4ZTOH 4WRLA 1DQQB 2W9DH 4EIGB 2G5BB 3GRWH 3WO3B 3IJSA 2C1OB 1HHJA 2X1XR 1BREA 1EFQA 5CINH 1SJVA 3K1DA 1IQDA 3NFSH 5DVLA 1FBIH 1QSEA 3BRGC 3UTPE 3FRUB 2VXUL 4OGXH 3IB4A 4HIJB 3WD5L 3F7VA 2VRAA 3ZKSD 4JB9H 1WFOA 1KFAH 4OIBA 4S11A 3SJVE 1I9RL 4G6KH 5CIPB 1RURL 1U91A 1CDGA 3BUYA 5C0AA 1A7RL 3ZKXB 1MHEB 4JKPL 1CS6A 4G8GD 1I7RB 1LK2B 2WWKT 3WN5A 4K3GA 1ZWIB 1T66C 1AKJB 3ARBA 4EKXA 2J8UA 1HHIA 5H8DA 5F9DC 3GMOA 3LD8B 4KJQC 1ACYH 5GGSB 2R1WA 1S7RA 2CO7B 1OTSD 4G8EB 4L4VE 5C0CB 2C3WA 2UVFA 1XH3B 4X6CE 3SE3A 3TNNB 4JHAH 3ULUE 3MROA 1BHGA 3QG6B 1JHTA 3V6FA 2MQ0A 3ECBA 1S7SB 2ZZUT 4RA3A 1S7VB 3RWIB 4OM1L 4DKFH 2NLJA 4WFGE 2LU4A 1PG7W 3T0EB 4F9LC 3U0TB 1A3QA 1CLYL 2WM0A 2X10A 3FZUD 4HXAH 1SJEA 4I13B 5SWQA 1T22A 1FGVH 4D9QE 5KSAB 1KCKA 3T0AA 4MMZC 4RAUA 1C1EH 4UAOC 1F11B 5DMKA 3DX9B 4P0DA 4LVHB 3HFMH 1FLRL 5C0EA 5JW4R 3B5HA 5B21A 1P4BH 1OTSC 2VL4A 3SCMD 4QT5B 4WJ5B 5TJWK 5GS2D 1ZSDB 4NBYB 3TJHC 1JWUA 1WCBB 2IMNA 4XNYL 1A6AB 5ALBH 3WLWD 3OKKA 1NC4D 1QFWI 5HTSA 1KIQB 1P7QB 5IEHA 2B39A 3TNMB 3P40A 4KK6D 3ZTJH 1KN4H 1P4LA 3FZUC 3MV11 2WINA 1HWGB 5E6YA 1QLFA 2XPGA 3P0VH 3RVVC 1MF2H 5A16B 4BZ2L 5T3XL 1T6WA 2VDML 1R24A 3GSUA 4NUJA 4OCSH 3TJEH 1MPAH 3HZVB 4HWBH 3HS0A 4KK5D 4HK0A 1Q72H 3VFGH 3O4LE 4MXWH 4KY1L 3SCMC 1I7ZB 4IRZL 5IT2L 2R56H 4I5BA 1CF8H 2R0KL 3N9GH 2NMSA 4TUKH 1YEJL 1QBBA 3I50L 5I15H 3CZFA 4ZO6A 1IM9B 4GKZB 4Z7VB 1HINH 1RUMH 2Q8AL 2NXYD 1ZGLB 3QFJE 1S7WB 1IBGL 4D9RD 3LY6A 1TJIH 5CP3H 4NM4H 1X6NA 3GBNH 3MRIB 4HCRH 2NY3D 2YMXL 4E41D 3T0BA 1A14L 3OKEB 2DRUA 4JZJC 1M05B 1MVUA 1IL1A 2Z8RA 2F58L 4KK5C 4ONGH 2AAVA 3TGXA 3B43A 4YJZL 5C0JA 2W92A 1NC2D 4I77L 4WIQA 4YXHH 1RHHB 3RFZC 5FM5M 4WY7H 3O3BA 3WMSA 2BOCB 1UJ3A 5HI3D 1EBAA 5F1IB 1E28B 1QFWM 2ENYA 5ID0A 4HUVB 1AC6A 5FUCC 2HFTA 2YD8A 3V6ZB 1CD0A 2NXYC 3B9KD 3MBED 2XNAA 3MV7E 5I16B 1PEWA 2VWEC 4OF8A 4FXKB 1A1MA 3O9WD 4MXQC 3WJJA 2IFFH 2XFXA 2H9GA 5DI8B 3OZ9H 3DROB 2NY3C 3FB8A 3UBXI 3IFPA 3ARFD 4J12A 3EYUL 5F6HJ 5CKAA 2R2HA 3ESVF 1AGBB 4JN1L 1YMHA 4NQUA 3ARGC 4JHWL 3D3VB 3T0WA 3N0PB 3RWGB 3M45A 3FJTA 1JNJA 1JNLH 1QLRA 2GJ6B 5HI3C 3S37X 2IGFH 1KYOK 1UZ8B 1GVIA 2JCCA 2Z93A 1ERNA 2JELH 3B9KC 3MBEC 5BVPH 5CGMA 1WEJL 2X09A 1IQWH 4UB0H 4U2YA 5C07E 5DGRA 4WUUA 3EDEA 3P11H 1IAII 4MD4A 3U7WH 1E6OH 3O9WC 3HE6D 1N6QL 1OP5H 1HSAA 1YMMD 3KPRB 4XMLL 3C09C 3ARFC 4LEXH 1WBYB 2R2EB 1NDMA 1NCUA 5JW5B 3IAQA 5L6YL 1CLZH 3MRLB 2I5YL 1V3KA 4NHCH 3K2UH 1BBJA 4HDIA 3T4YB 5L88L 3PUCA 1LO0H 5D7KE 4UT7L 4NOFA 1WWCA 3BZFA 5B3NA 1RZ7H 4HK3J 4YEFA 4MJIA 4RGNB 1UACH 3H42H 4HUXB 3CDCA 5A2IH 3I85A 3FFCA 4ZXBB 1JF1B 4NSKA 5D7JD 4ZQKA 2A6IA 5H35B 4U3XA 3QH3A 4U05A 5IEKA 1HKFA 1OD9A 3BP6A 3HE6C 1ZLUH 3TZVB 3X11B 3D6GA 4M4PA 1G7IB 1QBAA 3FQUA 3QNXA 5FM4A 4RX4D 4YLQT 5IB4B 3QIBB 4FA8A 1NBZA 3O4OC 3NFPA 4NUGH 5A40E 2LAGB 4EI5B 1KOAA 3RZCD 4L9LC 2B5IB 4OF7A 3ARDD 4FTVD 1JN6B 1A22B 5HHOA 3G5ZB 4LSUL 3CVIH 1IAIM 5E4IA 4S2SB 5D7JC 4MDIA 3OX8B 3X3GH 3VFSB 5E7FA 4MNQA 4BUGA 2F54D 3WLBB 1CBVL 4Y1AA 1MIMH 4CVZA 4P2QB 1KB9J 3BD4A 3C5ZB 4NQCA 2N7AA 3TCLA 1TLKA 2I60H 4CVWA 5ISZB 4EUPB 1I8IB 2VKWA 5L2KB 5E6IC 1J10A 2FJGA 3X3FH 2H45A 3RZCC 4OLXL 2VXUH 4U31A 1WIOA 2VQTA 5F9WC 1A47A 3ARDC 3MLYH 32C2A 1HHGA 5K59F 1I9RH 2QHRL 3QDHA 1RURH 5IROC 4L3CB 4XP1L 3JSSA 1JMZA 1YN6A 2RQ8A 4BQCA 4PGEA 1KIPA 4LSDA 4OZFA 2QQQA 3U6RA 3A67H 4M6NL 1EGJL 3CGTA 4JY4B 3QAZC 1NBQA 4HK3N 5EZLB 2X5PA 4LP5A 1QRNB 1BF8A 4U1GC 3F12B 4Y4HA 2BOBB 1WJ3A 1KG0A 4ZUTB 4BQ6A 2C3GA 2F74B 3BI9X 4OM1H 3ZYZA 3FT2A 3VFUB 4JPKH 3ZDYF 3D87B 3LEXB 1MQ8A 5T1LA 2NW2B 2EDKA 4FXGA 1T20B 3RQ3A 3BQUA 3IDIB 1CE1H 4OD2A 4NNXA 2CJUL 3LHPH 4MMXC 4P9ML 1X5YA 5EIIA 2QSQA 1BZ7B 4BELD 4W4OA 1FLRH 1R5IA 4CMMA 1ZMYA 1JNNH 5H2BA 3T2QA 4PJ9C 5ITBL 4S1SL 1FNEB 3NCJH 3PJSA 1J8HA 5J13B 5K59E 5IVNA 3FB5B 4U6HA 1FE8L 4PJ8B 4Z7UA 4DOHE 4Y5YB 3SKUD 3HC3H 1UEMA 1QEWA 2FCBA 3RUGF 3EO1A 3NZHH 5INCA 4WI6A 1WQVT 4ONHA 3SE8L 4X4ME 3KXFE 4FFVC 2B1HL 3E1F1 3HPJA 3PWVA 4BSWA 2ZJSH 1A6UH 2IPUG 3L5XH 2HVJB 5SWSE 1Q0XH 2VDMH 2YBRA 4YDJB 1ZLWK 1MNUH 2YA1A 3QIUA 3JWDL 3VXRE 3IKKA 1ODAA 3ZDYE 4GKNB 4QHMB 4JM4H 1U6AH 4IRZH 3I3EA 5IT2H 1CIDA 2OJZL 3DSFH 4K55A 1F4WH 2ZNWA 4NKDB 1AFVH 2G75B 2Q8AH 4HKBB 4ELMB 3QI9D 4GRLA 4MDJA 3U46A 5CJOL 4KUZL 1F8TL 1U3HB 3CIQA 2F8OA 1IEAB 3T04D 1NUNB 1WAAF 3GMMB 1EGJA 3SDCD 3BZEB 1AGFB 2ZCHL 3QWOA 1UA6L 3BH8A 3GK8L 1VCAA 2ADIA 3LKNA 3RUGE 2XI9A 3DIFB 4I77H 5FO8B 3U82B 4H0IA 3VH8G 5D7IF 4OKVB 1DEDA 2YC1B 4P2RD 3MUY1 3HE7D 3QA3A 5E99H 1LDPH 1J1OL 5IW1A 4S0SD 3LB6D 3QCTH 3DGCR 4MZ2A 4X9HA 2NXZB 5FGCB 4FQJH 3VA6A 3QI9C 3DBXA 4G80B 3TC9A 4KK9D 1DQML 2AK1L 1NBVL 2A6DB 3IRPX 4NO0A 2FGWL 5D1XB 3VFMB 3ZKQD 2VC2H 5CJBA 3SDCC 1FFOB 4F9PC 3VW3L 1EEZB 2WIMA 1GXEA 4KQ3L 4QRRE 4U1IB 4V1DE 3E8UL 4XPAH 1LEIB 1U8PB 4X6DA 2AXGA 1HILB 2PN5A 4Z0BH 4J3VA 5I1KL 1W0WA 3BX7C 3SDYL 4Y19E 2ERJB 1RQ5A 3HE7C 5KTEL 2FL5B 1UB6A 1NUDA 2VE6B 4EI6A 4S0TD 1NAMH 4Y89A 5CP7B 3EZJB 3QDMD 3PE9A 2IH3B 3FN0L 4UTAL 3EO0B 3W0WA 1W8OA 5JORA 4KK9C 5D7IE 1JHKL 3PABB 5LAXB 1TNMA 3GHBH 4GRWE 3WXWH 4KI5F 1CGWA 1G1CA 4XVUC 5GS0D 3QEUA 5L6YH 2GITA 4U0QB 3CFBB 4LSQL 1XZ0B 5L88H 3SKNB 2BJML 3SY0B 4YPGB 3IETA 3PGCB 2H41A 1ZGLP 4HG4K 2O93L 2F53D 4WNQA 2OI9C 4LRIC 4ZFZB 1YN7B 1LO2L 2FX8H 2LU3A 4WW1B 1WZ1L 1IT9H 2XZZA 3DSNA 1KENL 1MJUL 3QDGD 5F8QC 3UJJL 2BVYA 3TVMB 3IDJA 3QEGH 3ULVF 3O2VL 4QOKD 3QWQB 1F4XL 5F71A 4U1SA 3TYFA 4PRHD 2ZUWA 3JZ7A 3S34L 5DVNA 3HPLB 3D85A 2ZPKH 5SWZD 4YDVA 1WICA 3O6ML 4K71C 5J9PB 5JUEL 3KLAA 5BZWB 3C8KA 3R06B 1OD7A 2HWZL 3C5SA 1LE9A 5IFAL 1MFDL 1SM3L 3MJ7A 2ZSWB 4JRYA 2ZUTA 4YHOL 4LSUH 3NTCL 2E9WA 5C09B 1NGZA 3MRMB 3VJ6A 4ZS7H 3MV8E 5ICZB 3QUKB 3SGJA 3HRZB 5C08B 4HKXA 3ZTNL 4Y7MA 1CBVH 1EFXD 5FYLE 4XPBL 1MLBA 1PKQB 2MPAL 2WSKA 4TQEL 3EFFB 3MGOB 2IBZX 1NL0L 5I18L 1YDPA 4FZEL 5F1SA 1F4YH 4OQ1A 4U1NA 1J5OL 5JIHA 5IG7A 4PRIA 4YBHA 1SEBA 3DVIA 2EKSA 4Y4KD 4KZDL 4TRPH 4HS8L 2QADD 4RMWA 3NFNB 1F5WA 2BXZA 1A6WL 1FRGL 3QDAA 5F9JB 5DC4B 5IBUG 1JGDA 5GGTL 1T0NA 1KACB 2CLRA 1S9YB 4I1NB 4JPIA 4OLUL 4X4YA 2QHRH 1J0YA 3SBWC 2PYEA 1HEZB 4XP1H 5HXMA 5IWLC 1D5XA 3BD3A 2W60A 4PRPD 1VADB 2DMCA 2UV3A 3QUML 4APQB 5T3ZD 2FIRT 3F58H 3L3HA 3O3DA 1GZQA 1IC1A 2ICWJ 4R0LC 5DJDB 4M6NH 5SX5H 3U9UA 5KSVB 3IDGA 1NAKH 35C8L 5C8JA 4I0PD 4FFZL 3QIWC 5CBEA 4U1HA 3SE4A 2CKBL 4NQXB 3MJ9L 4DN3H 1KXTB 2YKLH 5C71A 1CTOA 5DS8B 2WW8A 5F1KC 1X4XA 4UMGA 2QADC 4H25B 5D2NB 2VITA 2VDKL 5LXGH 1FNAA 7FABL 4PG2A 5E5RB 1B4JL 4UT9L 3GI8L 1T21A 3BMVA 4MQTB 4YC2C 2VLME 2VLLB 4JN2A 2OXHA 4XNQB 3EBAA 4H1LG 5IMLB 4JFXA 4I0PC 3H9ZA 3SJVB 4PJCA 5J1AB 4H5SB 2MKWA 3FMGL 3IF1A 1H15A 3KS0H 4L4TD 3PHOB 4LASL 1FE8H 4F2MA 5HHQA 1N5YL 3IGAB 4HUUA 3EO9H 4XNZC 3WJLC 3PQYE 5E24E 1TCRA 2GT9B 3TBVB 3WFHA 4L4VB 3SE8H 2BSSB 4DKAA 5IOPB 4X6CB 1YPZF 1QLEH 2A6JB 3DX8B 1N8ZA 1NLDL 4C59B 1CG9B 1ZHKA 3KVQA 1A6ZA 1C12A 5IKCA 1VA9A 4XCEB 3ZE1E 4OUUA 1RULH 4XBGA 5KZCB 1KTKE 2B1AL 1CICC 4GG6F 4R26L 1KIUA 2P24A 4U1MA 5DTFA 3BGMA 1MCRA 3GJEB 3T3MF 5GGTA 5IQ9A 3H9SE 1CLOL 2Q7NA 3MBXL 1XF2B 4ZUVB 5CJOH 3O41A 1BJ1H 4KUZH 1W0VB 1F8TH 4C56A 3L6FB 4UUJB 1I1YA 4CJ0A 2MNUA 3QUMA 1FP5A 2L0DA 4LKXB 4F8QA 4P5TC 1LD9A 3OPZH 1S9WA 1AC0A 2ZCHH 2CMRH 1FZOA 4KVNH 5I73C 3BHBA 3DARA 2CKBA 1F6LL 3RJDA 1HI6B 3MJ9A 4Z78B 3GUTA 4PJHF 4K2UH 5BZDA 2NX5E 3KG5A 1YPZE 1D6EA 4S1QH 4P57A 5IVXA 5EUKB 5BRZD 2ZOKB 4P9HL 4DEPC 1PQZA 4RAVB 3DMMA 3JV4B 4R2GD 1V05A 1II4E 1O7VA 3K3QA 3O4LB 5D7SH 2XZAH 3K7UA 5EBGA 1V5JA 4GG6E 1SY6H 3QXTA 3L3OA 4ZOEA 1AP2B 5MHSE 3IJYB 1D5MA 3QFJB 3ALWA 3T3ME 4NO5B 5TH2B 4MJ4A 5L7XL 3ARED 3VD3A 4XVTH 1N7MH 2IANA 4BA8A 2HFFA 2VERN 3TIEA 1MQKL 5TQ2L 5I1KH 5K9KB 1P5VA 3VWJD 3MRFA 2LVCA 3VFWB 4FQ2H 4HKZB 3BISA 3FOLB 5I8KH 1L0YA 4HSQA 1AE6H 3VD4A 2UZYB 3MRNA 1S5HB 3BSZL 4JO2L 2X4TB 4UTAH 1EEQA 4PJHE 2YD7A 3KPSE 4UOJA 3F6IA 1LP9A 3CCHA 5IHBA 2X4RA 4EXPX 4M7ZB 2VDPH 3GFUA 1NDGB 1Y6MR 3MV7B 4LSQH 1FGNH 1K6QL 2A1WL 1MWAB 1VDGA 5IMKB 4U6XA 2W59A 2KQMA 2OSLA 2PO6D 3S96A 1RZ8A 3FQXA 4R4NC 4WO4B 1ORSA 1OAXL 1SEQH 4PTTB 4X4XB 4UV7H 4ERSL 2GTZA 4KUCF 3FB6B 1I8MB 1CR9H 4OCWL 1WZ1H 1I3GH 1QHOA 2CLZA 43CAA 4XP4H 3C60B 4BFIB 2AXFA 1GOHA 2DBJA 4HULB 3O2VH 4AIZB 3GSWB 3EGSB 3KNBA 5KVFL 1RK1A 1F3JB 5CJXA 4KDTC 5TQ0L 4JR9H 1RJZA 4PP1D 5HGBB 3QXAA 5IESL 3SO5A 2Y7QA 2N56A 3MGTB 3IDUA 1MUJA 5C07B 2EYSB 2E7LA 4LDOB 2PO6C 2YOCA 2HWZH 3BKJH 5IFHH 4HGWA 4PP2B 4GAYA 1G6RB 1PVHA 1QUNA 4OCYH 1MFNA 3C6LD 3KYMB 3BW9B 1EMTL 3NTCH 3U79A 4QHUB 1S7QA 2CRYA 3TV3H 3DYPA 5FUCE 5CEZH 5JW4Q 1SBSL 1X7QB 1YY8B 3ZTNH 5F3HA 4JFOB 4ONFH 4N8CL 2YRLA 2VWEE 4HIHB 5CSBA 3J7HA 4NKOA 1KXQE 2W91A 2MPAH 5E8OB 2E6JA 4I48A 4TQEH 2DM2A 1FZMB 4XCNA 5BS0E 5I18H 1T89A 3MNWA 4FZEH 2VR5A 1TJHL 1K8IA 1J5OH 2VZVA 4FQXD 2OP4L 1NBYB 4KZDH 2ICWB 3E2HC 4HHAB 4UINL 3V79C 4K7PH 3LKPB 5ESAA 1FL6A 3QBTB 3QFDA 4PJDB 5GGTH 1J9CT 2VJXA 4OGAC 4LPXA 5ESQA 3L3DB 3WUWA 4LLMB 3LQAC 4UTBL 4Y4FD 3QUMH 4CBPA 1RIHL 3T2OA 2XWTA 3WS6C 4N0YH 5KOMC 3V7MA 4S10A 4UI2A 2VL5B 4YGVB 3OMZA 2D03H 3RL1A 4FFZH 5A2JH 3JV0A 2CKBH 3BIKA 3AXLB 2P5EE 3MJ9H 2HLFC 4BKLA 1U8KB 4YHNB 2DLFL 4EIZC 2AJ3B 2ZKHL 1MCSA 3F7PC 3P77B 2R1XB 5FDYA 3MA7B 2EDTA 1KELL 7FABH 3TO4C 3KYNA 2D2OA 4UT9H 3WKMH 5ESVA 3UDWA 4C83B 3TCXA 3TBWA 1TCMA 1CFQB 2GY5A 2Z35A 4XNUL 5T5NG 4DCQA 1CDBA 1U8LB 4POUB 1CZ8H 4Z77A 4QCIA 2X4SA 3M1BA 1R3JA 4PV8B 3B6SB 4YWGH 3L5IA 4E42A 1QKZH 3BPNC 1KJVB 4P23B 3FMGH 2ED9A 4K7PX 5ALCL 1CT8A 4N5ED 5JXEC 1D5BB 2BY3A 1KLGA 1FN4B 4HIEB 4MB5A 4OLEA 4X7SL 1N5YH 1F6FB 5HHPA 1MCKA 3VWKD 4OSUL 3TBYB 4JDVA 3OKDA 2FJFA 3EUUA 2BXYA 4LVNB 1EAJA 4WFHD 3VE0A 5BV7B 2QQKL 2RCSH 4L29A 2XKNB 4AL8L 1NLDH 3CXDL 4LAQL 3B5GA 1NCAH 3CUPA 1BQLL 1SJXA 2Y6SD 3W9EA 5B38B 1BFOB 3SGKC 3QULA 3UTSA 3WE6A 5A2KH 3OGOE 1T0MA 1CTNA 3AAZB 5EBMB 5GZNC 4R26H 1BP3B 1MAML 1Y6NR 1EV2E 5DMJB 2NY6D 3B8YA 4YBLC 1BECA 3R4DA 1JCKA 3NZ8B 2PXYD 5D96C 4M8QB 3VWKC 3L7FA 4PTUA 2CXGA 2P8LB 3RKDD 3KLHD 1OGTB 1GZPB 1DBBH 1A7NL 1IAKA 2X7LA 4UU9A 5T1DH 4QY8A 3IXTA 4BFEA 3RGVB 1OW0C 4P49A 5DJXA 4DOHB 4N8PA 3HZMA 3MYZA 4U49A 4YPJA 2P7TB 2VNCA 3MYJA 1G7LB 4R3SA 1A6TA 3TH4T 1RVFL 4WV1C 2Y6SC 2JIXD 3T1FA 1I8KA 2VLJA 3BO8A 4KRPD 2VZ1A 3KXFB 1CXHA 1P9MC 5GRXG 3IVKB 4KRLB 3NBNA 1BZ9A 2E6PA 1DQQA 2YPLE 3DXAE 4JFFA 2G5BA 2C1OA 1D9KB 5DHVH 4JY6A 2NY6C 3EJZD 3VXRB 4P9HH 1ORQB 5DEFB 2Y9RT 1BBDL 2ESVE 1J86A 1HWHB 4PJAE 4R4FL 4XP5H 3RKDC 3KLHC 1TZHB 3FRUA 4G7VL 1QOKA 4Q58C 2HTLC 3DGGB 4WDIB 4RNRB 1OGAE 4ZFOL 3F65A 3MR9B 5CIPA 3G04B 3PWNB 5GGVY 1MHEA 2OLDA 5JA9A 1KEGL 4MQ7A 5L7XH 1I7RA 1LK2A 1ZWIA 3EYVB 1AKJA 4U7KA 3MCKB 1MQKH 4J3WA 1NMCB 1OSPL 5D72H 4OM0L 5GGSA 3RU8L 5FCUH 4H0GA 1HXYA 2X1WL 4NCC2 4G8EA 1OAKL 1J0JA 1XH3A 1R3LA 1RUAL 3SN6N 2D3VA 3PP3K 3OAYH 3QG6A 1VFMA 1QFOA 3RUGB 1NGQL 1JGEB 3BSZH 4JFDD 1S7VA 3RWIA 2KZWA 2GUOA 2OZ4L 2AEPL 5B39G 3T0EA 3U0TA 3T0DA 4CVXB 5E4EB 2DIBA 1YEEH 4JLRA 2EH8H 5KSAA 1K6QH 2A1WH 2NTFB 2VZOA 1F11A 3UMTA 3UTTE 1Z9MA 4GH7B 4XBPB 2I9TA 3UJTL 5DVOA 1HXMB 4PLKD 1FNHA 3LDBB 1KSRA 1DL7H 3MA9H 4DZ8B 4QT5A 5E95B 4WJ5A 1XGRB 2DAVA 4ZNEE 4G9FA 4QRRB 3QHZL 2MCPH 2NTSP 4V1DB 4WHTB 4K9EL 2XIDA 2DI7A 1WCBA 1C5BL 1S7XA 1U3YA 1X5XA 3JWOL 4G43B 1KIQA 2BVEA 1YJDL 4GJTB 3TNMA 2G5RA 2IAMD 1TZGL 2K7QA 5A16A 4NWUH 1EPFA 3HZVA 4M9PA 3STBA 1KIRB 5D7IB 5T5FH 2OS7A 4PLKC 4GRWB 4I0KA 1I8LC 1I7ZA 4JQIL 4N90D 5EZOL 1L0XA 3PGDB 1BQHB 1MCEA 2LFGA 5LKNA 4MA3A 4ZSOE 4GKZA 4JZNB 3VI3F 4ZFOA 2JTDA 1S7WA 1RJYB 3QRGL 5AZEH 4MNHB 5AUMB 4JO3L 2PCPB 3K8LA 4O9HL 2AJSH 4EJ1C 2C1PB 5JQ6H 1V3LA 2IAMC 4KUCD 5HYJD 1KPRB 1Q9LB 4NQEE 5C0IB 4YX2L 3NIGF 1EZVY 5C0BD 2W9EL 1NCTA 4K3DL 3OKEA 3MQIA 1M05A 1T3FB 4NYLB 3ZHKA 3WO4C 4Y2DD 4MAYB 4AY0A 5I1HH 1XIWD 1FC1A 1E27B 1RHHA 3LS5L 1Y18B 2H3NB 2X9XA 2BOCA 5E8NB 2NZ9D 5TE6L 3UX9B 2YZ8A 2X4UB 4OFYA 5F1IA 1E28A 5F88B 1I85A 1NGXB 1P2CB 4N8VG 4JRWA 4TULH 3WHXA 4HUVA 2OZ4A 1T5WB 3MV9D 2MHAB 4LOUC 3V6ZA 1AR1D 5I16A 1NGPH 3KPLB 3RKPA 4FXKA 5TFSL 4M43L 5GXBB 4NKMA 3BJ91 5LQBH 1PSKH 2Q3AA 5DI8A 1PGRB 2GW5A 5F9OL 3DROA 3S97C 5DLML 3MV8B 4XB8A 4CGTA 3P4NB 2V7HA 2VABA 5K9JH 3DRTB 4MLIA 3EYSH 2YD2A 4AJ0A 1AGBA 3E3QE 1C8PA 3TIDB 4P5KB 3OKLB 2Z31B 3D3VA 3GMPB 3ARPA 1MFEL 1KELH 3RWGA 2FATL 3MXVH 2NZ9C 1AXTH 2GJ6A 1A1OA 3NIGE 4OZ4B 1UZ8A 3R0MA 5TDNB 1CDUA 3HNSH 4XNUH 12E8L 1K85A 5CCKL 2YZ1A 3GO1H 1QG3A 2ZP0T 3GSOB 1JZ6A 5E2TH 1IC7L 3N1MC 1EVUA 2EKJA 1MRFH 1RZFL 2DL9A 3KPRA 1L9NA 2V2WB 2UUDH 1KNOB 1NJ9B 1WBYA 4QRSA 2R2EA 5JW5A 1TPXB 4HWEH 2VLKD 3MRLA 2VO5A 3T4YA 5EA0L 4N1HB 2FIKB 3NN8B 3MO1B 1EIBA 5D8JL 4NM8L 4HUXA 3U0PB 4XC3H 1LWRA 3P30L 5KSUA 1JI1A 1YEGL 5T1KA 1CXEA 1QSED 4TVPL 3AC0A 3TPUA 1JF1A 3BPLB 4KJWC 4K8RH 3REWB 4WW2C 3QZWB 3NIDF 5FGBA 5H35A 4M6MH 3IFLH 4Z7UF 3RAJL 5C0AD 3TZVA 3WNKA 1CU4L 1MAMH 4PRHE 3GMNB 3Q6GH 1YEIL 2XT1B 3ARBD 3QIBA 5IB4A 4P46A 4X7FC 3HR5A 4QGYA 4Z95L 5JPMB 4EI5A 1FYTB 1Z5LA 3SGEH 4NQSB 1RUKL 5J1SC 1WUNT 5C0DB 1PDKA 2R9HD 4DK3A 1JN6A 2AQ2A 3G5ZA 1ZVSB 4I18B 1DQJA 4YHPB 1FNSH 5MEOB 3P4MB 4S2SA 2OTUB 3HA0A 1RVFH 1UCBL 3OX8A 3PQYB 3VFSA 2EDLA 2NY1D 1MCPL 3WLBA 4XGZB 4P2QA 4DUXA 3C5ZA 1RAMA 1BIHA 4OLYL 1JUFB 3LH2L 4HAFA 5FYKH 1TETH 3ARBC 5ISZA 1I8IA 5L2KA 2Z8SA 8FABB 4Q6YA 4JRXE 3NIDE 3IDXH 1ZXQA 1IKFL 1CFVL 4G7VH 5C0GB 5JW4N 3SE3C 3MRGB 4JVUA 5EBWB 3CK0H 1GGIL 4H8WL 5HHME 2R9HC 5JIPA 5E03A 5T1MB 3KPMB 5CSZB 2IG2L 4L3CA 5F7DB 1ZANL 2R23B 2PETA 1SYSB 4NQDE 1OLLA 5T3ZE 4O51B 4DTGL 1BVKB 4UV4L 3MFFB 5EDXA 3FQRB 4IM8A 4JY4A 2HJKB 4X99A 1AXIB 3MODL 1RFDL 3ARUA 4N1EA 3I2CL 1UM6L 1KN2H 1F3RB 1P6FA 5EZLA 4HZLB 1RUAH 1QRNA 5J12B 3F12A 1V7NH 2BOBA 3HNVL 2CXKA 5J1TC 5JDJA 1U8IB 2F74A 2VIRA 1OQXA 2AEPH 3VFUA 1OT2A 2NX5B 4DVBB 1YPZB 2M1KA 3LEXA 4QGTA 3C8DA 4J4PA 5E2WH 5DEZA 2NW2A 3BYYA 4PY8J 2VQUA 3MRDB 1JL8A 1XR8B 4QRUB 1WFNA 2FBJH 4XP9H 5AAMA 1BZ7A 1G7JB 1HE7A 1TJGH 4J3XA 5BOZG 4M00A 3UJTH 4D0CB 4MX7B 4GG6B 1FNEA 2EIBA 1BVLB 1EUUA 4Y16C 3OGCB 5F97E 5DUPL 4HWNA 5F96L 4WI9A 1G7QA 5DJ6B 3TF7C 3LN9A 3FB5A 4RGOL 2DICA 4PJ8A 2DQUL 4L4TE 3Q1SL 1Q0YL 4Y5YA 3O6FB 4K9EH 3PWLA 1UH2A 3IAPA 5GS3A 1XGQB 1R3KB 3O0RH 4WFFD 2NY7L 3TT1L 1T03L 2R4SH 5EUOE 2AJUL 1QYGL 2FX7L 4XI5D 1UM5L 3HHRB 2V9RA 4RMQA 5IB3B 4KMLB 4OD3H 1IFHL 4BJLA 1G0DA 2YXFA 1JWSB 2YUXA 4PJHB 4GAJL 5IBTH 2QKIB 4ODXB 4GKNA 1BLNB 3OB0K 4QHMA 4HS6B 2D7QA 3KPOB 3U4BH 5DZNA 1NFIB 4WI4A 1JTOA 2GK2A 5EZJB 2DMBA 4NKDA 2RIKA 4HPYL 1F3DJ 2C4FT 2G75A 1GHFL 4HKBA 1JRHH 4PR5A 3QRGH 4ELMA 2AABL 2JE8A 2JK5B 3IJHB 5D4QA 4O9HH 1U3HA 3MLRL 5C0FB 3HI5L 1J0HA 3SCMB 4XPGL 3GMMA 3MPCA 3RVTD 3OWEA 1CI5A 1S7TB 2W9EH 5KS9F 1EUTA 3KR3L 5FK9B 3BZEA 5KJRH 1AGFA 2RBLA 5EU3B 3HMXL 4WUUD 5T3XD 4LCUB 1FL3B 1SVZA 4YHZL 2EXWD 3WJJC 1GGTA 1BAFL 4HFUH 1MFAH 3SPVB 2Z8WC 4WTZA 3DIFA 2DOCA 4ZO8A 2BVQA 1VFBB 1DSFL 4OKVA 5I1JL 2PTVA 2YC1A 1ZEAL 4LVEA 1NEUA 4HC1L 4MJ6B 3C9NB 4JZJB 4AEIL 1W8NA 2WWMD 4MJID 4NWTH 2RGSA 2HT4D 4XH2B 5J6GB 4OFPA 1OQOA 4M43H 4FXLA 4KRMB 3FFCD 2A6DA 4M48L 1UQSA 3QUZB 5FIEA 5F9OH 5JW3H 3VFMA 3CVHB 4JHBA 1NPUA 3ABZA 3GMQB 4NQTA 3RWJB 1N0LA 1AQKL 5B3JF 4U1IA 1D7FA 5HHNB 1LEIA 1U8PA 1HILA 4JKMA 4PV9B 1MFEH 1D5ZB 2H6PB 1OTTD 1OLZA 3QQ9D 1FFPB 4K23L 5BS0B 1N64L 1T1XA 2NY3B 2XYCA 2FL5A 5JPNB 5KS9E 3VGBA 2VE6A 3STLB 3MMEA 5D93C 2WWMC 4GKSB 5CP7A 1I1CA 1YC7A 1JFQL 2IH3A 4FP8H 1F13A 4H0HB 3ARGB 2H2SD 3EO0A 4PJIF 5HHOD 3MRQB 3LQZB 4LSPL 1T7YA 1IC7H 2W65B 5E00B 3PABA 4QHKI 1ZT4A 3GGWB 2EYRB 3MV01 4MNQD 1G9NL 3CFBA 3HG1E 4Y1AD 1VGEH 3B9KB 4F33B 1XZ0A 5EA0H 6FABL 2A77H 3SKNA 3SY0A 4YPGA 2VAJA 4NQCD 4NCDA 4PRNB 1J18A 2HRPH 5ERWB 5ICXB 3NIFF 4ZFZA 2ADGB 1JYVA 5D8JH 3QQ9C 2P5EB 1YN7A 3P30H 4WW1A 1YEGH 5GRUL 1PAMA 3FQWB 3QUYC 5B3JE 3TVMA 4LQFL 3F5WB 1JGUH 5LBSL 1EAPA 3QEQE 1F02I 1QBLL 2H2SC 1N6VA 5IJKA 1UXSB 4Z8FL 4LGRB 3HMXA 3LKSB 3RAJH 1CU4H 3IDYC 4NZUH 3HPLA 5J3HD 2IH1B 4AYFA 1F6AB 2CIKB 2XA8H 2HAZA 5J9PA 4Z95H 5BZWA 3HC4L 3K46A 5CZVL 3A6BH 4OCMC 3CH8A 2YUWA 4HC1A 4PJIE 4FZ8L 4N68A 2NY2D 2ZSWA 4Y4HD 4RZCA 1G7HB 1MJ8H 4KJPD 4FQ1H 1DANT 1IC4H 3SGEI 2D9CA 3LS4L 3UYRL 4ZFGH 2CDEB 3MRMA 1I7UB 3L9RB 1VGKB 2NYYD 3QUKA 3O4OB 4NN7C 4PRBA 4WHCA 3HRZA 3ULUL 5C08A 5T1LD 5CD5D 2EDBA 4HZAA 1JGVL 4L9LB 3NIFE 3BQUD 1PKQA 1H3PH 4KFZC 3D39E 4LKCB 1J7VR 3MGOA 4NZDA 5J3HC 5MP6H 3GIZL 2GKIA 5D7JB 4YUEL 4GAGL 2QEJA 1ZVHA 3GI9L 1J8HD 5IBLD 1G9ML 3NFNA 2Y06L 2WWKO 5F9JA 1JHLL 4H8WH 4Q0XL 2OMBA 3V5KB 5IIEB 1S9YA 1DQDL 1HEZA 3IAGC 1R5VB 1ZANH 5CS7A 2AKRA 5E6IB 1VADA 1UKSA 4APQA 5GS2H 5DEGB 5C92A 1EERB 5DJDA 5KSVA 4DTGH 5GSVA 4UV4H 1XR9A 1NFKA 3IFOB 3IU4H 4FQCL 1WFTA 1I1AA 1KV3A 3BQUC 4U7MA 2Y36H 1ZT1B 3MODH 5EN2B 1UM6H 4JVPA 4JZOB 3QIUD 4R7NB 3OXRA 2EO9A 4NJAL 4Y5XC 1FQ9C 5DS8A 5DHYB 1HCVA 4HUNB 5DD1L 1CGYA 5D2NA 5IBLC 3O2DA 5EU6E 3GSRB 2YPLB 3DXAB 3QAZB 2BY2A 4GRLD 4U1GB 2VLLA 4Y5VC 2ESVB 3P4OB 3VXSE 3BZDA 4OIIH 4PJAB 4DN4H 3U9PH 4XNQA 4HIIB 3GKZA 1OGAB 4PJ5E 3TBTB 5CEXB 3SJVA 2A0LD 3GSNB 5J1AA 4H5SA 1DZBA 1IAMA 5F96H 3QIUC 1A5FH 2QQLH 2ZG2A 1AH1A 3PHOA 1H3VA 2WUCH 1B3JA 1IGTB 3Q1SH 3IGAA 1HQ4B 4LCCC 1KYOJ 4Q2ZB 1T83A 4TTDD 1I4FB 4IEFB 2NY7H 3DV4B 2GT9A 3TBVA 4C54A 4PJ9B 1QYGH 1EX0A 4L4VA 2BSSA 2GK0A 1UM5H 1LHZA 5IOPA 4X6CA 4HBCH 5L0QC 1CK0L 2A6JA 3DX8A 4GXVL 4GRLC 1WBXB 4XPTH 4XPHH 1CG9A 3FCTB 2NY5H 4G3YL 3ZT7A 4RMUA 2V17L 1ZE3C 4P2OB 4NJ9L 4GAJH 4NO0D 3RBSA 1MJ7L 4NZTL 6CGTA 5FV2A 3SDXE 4MAUH 1NSNH 4M5YL 4JCMA 4EVNB 2A0LC 1MWAL 3Q3GB 4F7PA 1UYWL 3KJ6H 3E6HB 3DVNB 4YXKH 4O5LL 4MB3A 4HPYH 3GJEA 5HHVL 3UTTB 1A8JH 4ZG1A 1AR2A 2WBKA 3KPPB 3V52L 1FNGA 5BO1H 5AZ2L 4ZUVA 1XF2A 4OZHF 2DTMH 1W0VA 3L6FA 4UUJA 3MLRH 5I30H 1JRHI 3HI5H 5J11C 2QL1A 4Q9BA 3OAYK 4LKXA 4OBRA 4IIQA 2VQ1B 1FCCA 3KR3H 4XAKE 1QSVA 1WT5C 1U2HA 3FO0L 3LEYL 3W0WD 2RB8A 2XTJE 5KSBB 4MWFB 4NQVB 1HI6A 3WHE0 4FFYL 1XGYH 4LCYB 3W81A 5JTWA 3VCLA 5DC9B 5E2UL 5EUKA 1S9XA 4P4KB 1G6RL 1G6VK 2R0WL 3EDFA 3MNVB 4RAVA 3JV4A 4MNGB 4ODHH 1LO4H 3UEZA 4AG4H 3O4LA 3G5VB 4WTXA 5IW6B 5DJYB 1CGUA 2DQEH 3V0WH 1HYRC 1AP2A 1EO7A 5EFIB 4ZSOB 3IJYA 2CRZA 3D2UB 3QFJA 4QRQB 1AQKH 4NO5A 3CDFA 1HOCB 4QXWA 3QG7H 4HPOH 4NP4L 1EJOL 4TOYL 3DV6B 4OZHE 3JWDC 1OTUD 3L1OL 1BMGA 4K94L 2FR4B 5K9KA 3D85D 5JOPD 4NQEB 3VFWA 3H3BC 4K23H 4U2ZA 3FOLA 3JVGA 4N0RA 4Q9QL 1S5HA 2ZCKH 5FHBL 3BKYH 2X4TA 5BJTB 2DIJA 4JRYD 2ATKA 5CILH 2YD9A 3MJ6A 5HDLA 2J4WH 4ZOAA 3X12B 1KJ3L 5E5UB 4JM2D 5IW3A 4OZIF 4MLSA 3BOVA 4GUPA 1NDGA 4OZFG 4ALAH 4XCCL 5CGTA 1O5DT 3MV7A 1G9NH 2ZCLL 3K81A 3RDTB 3E0GA 1MWAA 5IMKA 1ED3B 1HH9B 3I75B 2YPKB 1OTUC 4KKLD 2HKFL 4WO4A 5E6ZA 2FD6L 1U93B 3BAEL 4X4XA 4LPYA 5D7LE 3WV0A 1HKLL 3JWNC 1FFRA 3FB6A 1I8MA 4K3EH 5F7FA 3D0LB 4TNWF 4MQXC 4YNYB 2NY4C 3O2DH 4PRID 3QEHB 3HZKB 4BFIA 3C60A 5GRUH 2DLIA 3TH2T 4NZJA 4EQ3A 1QFHA 2CGRL 4AIZA 1T04B 4LPWA 3GSWA 3BE1L 5FF6B 1MCLA 2P44B 3EGSA 3K4ZA 2ZUYA 3UTOA 1F3JA 4Z8FH 2OI9B 2PYED 5B22A 4X5WB 5HGBA 4JM2C 3SGJC 1OM3L 1J11A 1MHPL 1NCBL 2APBA 3GSVB 5C07A 1GH7A 2EYSA 1RZIB 3HC4H 5CZVH 1U95B 2PYFB 1L7TH 4PP2A 1G6RA 4FZ8H 3KYMA 3BW9A 4QHUA 5JHDE 5TDOA 4AENB 4K71B 5BV7L 4OLWL 1X7QA 1G7PB 1YY8A 4JFOA 3I9GL 1FORH 2CLVB 1ZLSL 1IILE 2JJVA 4HIHA 1MCWM 2O26U 1EEYB 4OD1L 1MAKA 1Z6JT 1XT5A 1SJHB 5E8OA 5IJVB 1FZMA 2AJZB 1DBML 4PREB 2IF7A 5A2LH 5IHZB 4RAHA 4AEEA 3NCYS 4X5XB 2Y4SA 1NBYA 5DURD 2ICWA 3SE4C 5F1NB 2DMKA 2DWEB 3LKPA 4WWKB 1L7IH 3KYOA 1KGCD 1L6XA 1UWGL 2K7PA 2MFNA 1CL7L 4PRHB 4XAWH 2OL3A 5I6XC 5E5MB 4LNRB 3L3DA 4LLMA 3UO1L 1YQ2A 2VXVL 3OG6B 4PS4H 5FEBA 1MCFA 4R9HA 2DM7A 5DWUH 3H9YA 5EO0A 4PB9L 2VL5A 1IGFL 2AJXL 4XHQA 3V4VL 2A6KA 4YDLB 3P9LB 1M71B 3NACL 1GGCH 5GZOD 3AXLA 1U8KA 4YHNA 3UAJD 3AVEA 4NJAH 3PXHA 5ETUB 1K3ZA 2AJ3A 2C3XA 2H2PD 3CFJB 3GBML 2R69H 1ZV5A 5JZ7D 4R0LB 3P77A 2R1XA 2VISA 3QR2A 3MA7A 5TE4L 3FONA 4H1LH 3B9EA 4Y2OA 3D25B 3QIWB 3I6LD 3C87A 3WNMA 5I1EL 1CFQA 4ZAKC 4JRXB 4B41A 4C56D 3H9HA 3FQNB 3PDOB 5HHMB 3W9DB 4PV8A 3B6SA 2VAAB 5KVEL 3P0GB 1KJVA 4P23A 3VI4F 4DW2H 1KCRH 2AI0L 4YC2B 4Z0XB 1LILA 3ZKND 3MX0A 4EDXB 1D5BA 2DM4A 5CZKA 3UAJC 1FN4A 4HIEA 1U42A 4NQDB 5C7XH 4HUKB 2H2PC 5D70H 3A0OA 5JZ7C 5ANME 3V4UH 4L4JA 1A0QL 1ZHBB 4TSAH 3RHWK 3TN0B 3ULSB 4CU8A 5CZXD 4U6TA 3FTGB 1XCTB 2YD4A 3DMMD 2XKNA 5EOCL 1UCTA 3NABL 2V17H 4NJ9H 3WIHL 5F7LB 1BFOA 2DJ4A 1CN4A 4ZTPH 4J23A 4R96B 1GAFL 1UADC 1GIGL 3LKRB 4M5YH 2BHZA 3AAZA 4XC1H 1E4XL 1UYWH 3ZKNC 4KWUA 4E9LA 5I1GL 2IAND 1Z3GH 3MNZB 4HQQL 5DA4A 5C0CE 1F00I 3EKCA 4M8QA 3GIVB 2P8LA 4G5ZH 1OGTA 1GZPA 5CHNB 3RVXD 4NFDA 4PRDA 2AXHA 1CICB 2XTLA 4Y8AA 5CZXC 3VI4E 3KJ4B 1AD9B 5GHWH 3RGVA 2V5MA 5KVDH 5DD0H 4L4TB 3SDDC 4AEHH 1YEKH 2P7TA 1G7LA 3PV6A 1S5IH 2ED7A 3FO0H 3LEYH 4DAGL 5MEQB 5EUOB 4UOW0 5JW4M 4GLRH 4X4MA 3KXFA 3IS1X 3IVKA 1UJTA 3O6KH 2XV6B 4Z7VF 2AK4E 2RFXB 4RFNB 2V5TA 3LPFA 5SWSA 2Q20A 1D9KA 4P5TB 3MFGB 5HVHC 1WWBX 4OIAA 3UC0H 4HT1H 3SO3C 4MA7H 5GS0H 3NA4A 1ORQA 2R0WH 4LRNH 1BWWA 1V3JA 3TYGH 5I73B 1ACZA 2B20A 1RSFA 2O5YL 3OAUH 1KLFA 3AM8C 3MXWH 4RQQB 3DGGA 1X5IA 4WDIA 4J3SA 4ZFFB 1EBPA 3LN5A 2QLVB 4ENED 4QO1A 4M6OH 2X4PB 1XGTB 2PW2B 4ODVH 1OPGL 2APWA 2P8PB 4OCLC 3G04A 3PWNA 3SQOH 3RVWD 2WUBH 1JZ5A 3SHSA 3NCEB 3EYVA 1EJOH 3PWJB 5HYFA 4P4RB 5CAYB 4K94H 3O3EB 4PUBH 1DUYB 4OUOA 5KAQF 4JFQB 3ZT6A 1S8DA 2KBGA 3THML 3QQ3B 3ZMRA 2F8XC 3RUGA 2EIEA 2OL3H 4CDGC 2Q3ZA 4D9LH 4N1CA 1I3UA 4CN4A 4M03A 2LTQC 3HUJE 4Z7VE 4CVXA 3U83A 3SKJL 3ARXA 3FO9A 4OB5H 4ENEC 3WIHA 3LKOB 1KT2A 1OP9A 3BGFB 3RVWC 2ZCLH 4YHYC 2WBJC 2NTFA 5CJXC 5JXAH 1KJ2B 5FB8B 5CWSB 1CDIA 3CX2A 4XBPA 2FD6H 3BAEH 1HXMA 5I1IH 5LGHL 3R0NA 2OTWB 4POZD 1QD0A 4DZ8A 2I9LB 2IPKA 5FYLL 1XGRA 5I1CL 4WUKL 3Q6FB 1ZT7B 2E7LC 2VSCA 4WHTA 2BNUB 3DHMA 4KI1A 4WEMB 1QNZH 4P9HC 1FO0H 3P73B 3M8OH 3BE1H 2YUZA 4G43A 3CXHJ 4KROD 4Y19A 1WAAA 5AAWA 3S7GA 5KS9B 1U8JB 3DECA 5L9DL 1N4XL 2HFEB 3OQ3B 5FGRA 3GHEH 1T2JA 5EOTB 5JHLL 3GMLB 3LIZL 1KIRA 3HB3D 5D7IA 4JY5L 5DK0B 1BFTA 2IBZY 2B2XH 3BYTA 4M1GL 4MB4A 1Y0LB 3MLPA 4LPTA 1MHHB 2VZTA 4X6EB 5HYSB 3PGDA 3U0WL 1CCZA 1BQHA 5EC2A 3SKMB 1KPVB 1B2WH 5I2IB 1RJYA 4MNHA 4OLWH 5EORH 1MI5E 5I74B 1DQLH 2J88L 3FQTB 2PCPA 1ZLSH 1P53A 4KROC 4WCYL 4YIQB 1T7VA 1Q9LA 5C0IA 1AXSB 3U36B 4WEBL 2E5EA 2DIAA 3EZ8A 2FO4B 3ARZA 1T3FA 4NYLA 4ELKB 5B39A 3QEQB 2XQBL 4MAYA 4KK8D 3VXTA 4NRYB 1E27A 4LLVB 3ZYOA 1Y18A 2H3NA 1UWGH 1CL7H 1YNKH 5E8NA 1D5IL 2X4UA 5F88A 1NGXA 1P2CA 3CX5J 4ETQB 3OAZK 1T5WA 4TSBH 2D7TL 2MHAA 3UO1H 1W2KT 4UILL 4PJIB 3KPLA 2VH5H 4HJJH 1Q38A 3V4VH 3MGAA 5L2JB 1OAQH 5CJQL 3WNNA 2EIZB 3NPSC 3MV8A 3UTSD 3HZYB 3P4NA 3DRTA 1AD0B 4KK8C 3NCCB 3VD7A 1AQDB 3OKLA 2Z31A 3GMPA 4LMQI 2AEQL 1H3GA 3DVGB 3HNTH 4K07A 3D39B 2CH8A 1BVZA 2MWCA 1MCQA 5FO7B 1NGWB 4OZ4A 5I1EH 5TDNA 4YHML 2QSTA 4JDZB 3MLVH 3KLSA 1MREH 4DJMA 3GSOA 4JREC 5KVEH 4A6YB 4QRTB 3TO4B 1Q9KA 4BUHA 2V2WA 2AI0H 1ZAGA 1KNOA 1NJ9A 2FZ3B 2VLJD 3NOIA 2H8PB 4JDTL 3VG9C 5JLZB 3MUZ1 2DQCH 3AFLA 1WIUA 3BT2H 4JCLA 4JFFD 4YHLH 5DZLA 3MO1A 1ETZB 4YE4H 4N0UE 5I0ZA 1VENA 5M95B 2R39A 2D0GA 3BPNB 4MSWA 3U0PA 4MCYB 3X14A 5EOCH 4RWYL 1UM4L 1MFCL 3O45B 3NABH 4FQLL 1U8HB 3REWA 1JYWA 1GAFH 3CSYB 1GIGH 4YZFF 3V5DB 4LVOC 4PLNC 2XY2A 4BZ1H 3S35H 4CNIB 1JK8B 4ZYKA 1AKJD 4X6FB 3VXSB 5E08H 4HQQH 5JPMA 1C7SA 4LL9A 3NVQA 4NQSA 1G7MA 1H3UA 4AT6B 1BWMA 5C0DA 3UBXB 4RMVA 3I84A 3OV6A 3QHFL 5DO2D 2EXYD 1IC5H 1O7SA 1ZVSA 1L6ZA 4I18A 3WFBH 4YHPA 4OT1L 5MEOA 1H0DB 2ZSVB 4NC1C 3P4MA 1I9IL 1RUQH 4YBLB 2NY0B 2OTUA 3T0ED 3PQYA 2H26B 5DMIH 3VXPA 4DAGH 3N1FC 4KKBD 4K8RD 3BESR 3BJLA 5D2LF 3ZKXC 2EE9A 4KQ4H 5KSAD 1I9JL 2W0FB 1ZLWH 1JUFA 4ELMF 4GLRI 1WTLA 4HAGA 3GSQB 3HLAB 3REVB 4FABL 4ZS6D 5C0ND 4WV1B 4GMSL 1DQTA 3SDXB 2DTSA 4DK6A 5C0GA 4BQ8A 1DN0B 3QNYB 4LLDB 3MRGA 4G9FD 5EBWA 2R1YB 1BM3L 2EXYC 3RNQA 4CJ1A 2V5YA 2UYLB 4PJBF 3KPMA 5CSZA 1Q1JL 4U1JB 5F7DA 3H9SA 4XHJD 3S35X 2R23A 2Z91A 2G2RB 4LPCA 2GSIB 4XVSH 4KKBC 4O51A 4K8RC 1BVKA 3MFFA 3AU1B 1UXWB 4OJFL 5F9AC 5DUBB 2HJKA 2EDXA 5IVZB 4F37K 3O3AB 5KSAC 4QXUH 4ODUB 4HZLA 4KZEH 4ZS6C 1A64A 2HFGL 2XTJB 5C0NC 5C9KA 4J7RA 3BGAA 4XMPH 1IAOA 1A6VH 1U8IA 3LRHA 5DA0B 1E6JH 3EFDH 3CC5B 2QSCL 4HX1B 4DVBA 1LO3H 1YPZA 5D2LE 5ILTL 3WUWG 4HD9A 3BP5A 1FIGL 1A6PA 4ZPTA 3TWCH 3MRDA 4QRUA 1XR8A 3KHOA 2ZG1A 4MA8H 3VFVB 1CVRA 4TVSa 4PGJA 2NR6C 1JTPA 2K3TA 1G7JA 2P4AB 3CVHL 4GG6A 4D0CA 3JV5A 2E9BA 1BVLA 1PBYA 1WZMA 3OGCA 4PJBE 1MRDH 3B9DA 4KJYB 2P5WE 3O6FA 3GSXB 4OQTL 1B90A 2CUIA 2Q76B 1XGQA 1R3KA 2LABA 5IP4A 3L3IA 3ULVH 4L8SA 4OFYD 5J6HB 2V9QA 3VGFA 2HH0H 1PG7H 4AH2B 4EN3C 1NGYB 5IB3A 3UPAA 2HT3D 2FB4H 1NFDB 1N4XH 2I26N 3V6OC 1VKXB 3QISA 1JWSA 1HQRB 4LHUB 3SGDH 4PJHA 1JBJA 3KPSA 2QKIA 4JY5H 1BLNA 4LGSB 4M1GH 1AGCB 4HS6A 5ENWA 1KC5L 3KPOA 4H20H 4MGXA 4XXDB 4M4RA 4IOIB 1NFIA 5EZJA 4EXKA 3U0WH 4QRPE 4YDKH 1UKTA 4W70A 3D3VD 2P48B 4LEOB 5J7CC 1YYLL 4OCXL 4WFED 5D7LB 3IJHA 2GJ6D 1U58B 5J8OA 4YXLH 1I85C 5AWNL 4J6RL 3DX6B 5C0FA 5F7WC 2HT3C 2ORBL 1KTDA 2BVUA 1VEMA 3LMJH 4OV5B 2YPVL 4M7LT 4WEBH 5KOVC 1W72H 4O2EB 5FK9A 1YEFL 5EU3A 5EU5B 5JO5B 4Y8DC 4W68A 3MZTA 1FL3A 4H88L 4C57C 3VXUE 3SPVA 3KPRD 4G6ML 5HD8C 5IB5B 3C2AH 1RZKL 1VFBA 3HR6A 3INUH 1D5IH 1S78D 2YS4A 5CD3A 3HI6L 4YR6B 3L5JA 4L8BA 4GBXB 5E2VL 1PG7X 4KHXL 4MJ6A 5I1DA 1JZ7A 2D7TH 5BQ7B 4PJXE 5I75C 1CL7I 3WO4B 4K9EC 4DGYL 4XH2A 4RGND 5J6GA 4P3CH 3D9AH 4BSVB 1FV1B 5T1KD 4X9BA 3QUZA 1YJDC 3MRKB 2R0LL 4LSRL 4KVCL 1A3LL 5JHDB 2D4FA 3CVHA 2YD1A 5EO1A 2VDQL 5AD0B 5F7UA 3GMQA 1DTUA 4IS6B 4YGAB 3RWJA 4LSSL 5HHNA 4KTDL 1RMFH 3TZVD 1Q8MA 4K7PY 1H3XA 5EBLB 4XBEH 3WFEH 2GTWB 1D5ZA 2H6PA 5H94A 3CFEB 2F19L 3QIBD 1AI1H 4P46D 5FA4B 1FFPA 3Q5OA 5BS0A 4L3EE 3O2WH 2VB5A 3WFCH 5JPNA 2CDGA 2H32H 5FGSA 2WK2A 4S1DC 4EI5D 3PDDA 3STLA 4TPRL 4ODWB 1MIEL 4GKSA 3IFNL 3T65B 3ARVA 4CN6A 2ZNXA 1ES0B 3DO3A 3OHXB 3ARGA 5IK3A 5DFTA 5C09E 3LQZA 3T3PF 3TT3H 3VFRB 2W65A 5E00A 2C3VB 4HXBL 4UQ3A 3GGWA 4XX1G 2EYRA 5C6TH 3MUGB 5FYJE 1HZHL 5FGBC 1ROWA 4F33A 4P2QD 3TLRA 2VDNL 3TZVC 3C5ZD 4PRNA 2A9NH 4BFBD 5CUSH 5ERWA 2MJWA 5ICXA 1FYHB 2ADGA 2O5XL 3QIBC 5ISZD 4P46C 2P5EA 3VFTB 4QEGA 5L2KD 4JANB 2R8SH 4D0BB 4BH8B 4RIRB 1D3CA 3UXFA 4RMSA 3FQWA 1MFCH 1CFBA 3W2DL 2O5ZL 2YEZB 2OTPA 1CXLA 2B5IC 1IKNA 3F5WA 1N5AB 3IS0X 1VPOH 4JE4B 1XGUA 1MRCL 2E7MA 1UXSA 3BN9D 3N85H 1L0QA 4HKJA 5E8EA 3LKSA 2Q86B 2MQ3A 1QRKA 3C08L 2IH1A 3L5WB 3OB8A 4ODSL 4RFOL 1F6AA 2CIKA 3GSNL 1E4XI 5D71L 4DGIL 2GHWB 3C5ZC 2JJSC 1AJ7L 4DFIA 5DD3H 1QRND 1DVFC 2ZUVA 3NAAH 4TSCL 1G7HA 2GJZB 1PZ5B 1TXKA 2B4CH 3VXOB 2CDEA 1GPOL 2VLKB 1I7UA 1G1YA 1VGKA 5ANMB 1H8SA 4U0RC 4TVPD 4I9WD 2M8XA 2PF6A 4DGVL 4J4PD 1UWEL 3GNML 4LU5L 1XFPA 1KCVL 1I9JH 3PP4H 3P9MB 4G6JL 4NNYB 4LKCA 4PBXA 1RJLB 3H3PH 4DZBA 2Z9TA 2XQYK 5LWYH 4GMSH 2F5AH 2BSTB 1U91B 3CNKA 5C0AB 2D31B 4XWOD 4PJ8D 2LQRA 3V5KA 5IIEA 3CH1B 3ARBB 1I1RA 2J8UB 2YN5A 1R5VA 5E6IA 3GMOB 4JG1L 5DEGA 2QJDA 4J4PC 3ET9F 4LBEB 3QXUA 2B0SH 1FG9C 5CEZE 5EWIL 3IFOA 3NCBB 4GQ9H 4OJFH 4U7SA 5MI0C 3MROB 1FVCB 1INDL 2D0HA 1ZT1A 3KDMB 5EN2A 3ECBB 4JZOA 4JJ5B 3QPXH 1MEXL 3PNWB 2NLJB 1K3IA 5IMOB 3UPCA 5DHYA 4YH6A 4ZDHB 5J13C 1URLA 4BH7B 2AK4B 3GSRA 2YPLA 3DXAA 1NCWH 5DRNB 5HBBA 4M7LH 4HEME 4Y5YC 4EOWL 1FH5L 2DQFA 1X4ZA 1YECL 5E8PB 3QJHB 1NH6A 5FCSH 1J1XH 2ESVA 1DCLA 3ZHDA 3P4OA 1U3HD 2R4RH 4PJAA 5IUSA 4WI5A 3ARQA 4HIIA 4F15C 4OI9A 3SDAA 1OGAA 2WBWB 3B9VA 3TBTA 1SYVB 5CEXA 5GRJL 2I24N 3GSNA 4P5MB 3QT2A 1QR1B 1XEDA 3C8HA 4CU6A 3CFDB 3P2TA 3PHSA 1IGTA 1QZ1A 2BY1A 5IEHB 2Y07H 2OBGA 4Q2ZA 3LAFA 2GCYB 1I4FA 4RDQG 2J5LC 3DV4A 1IGJA 1T7ZA 3QYCA 4PJ9A 2JJUA 3RTQA 1MY5A 4X0KB 2I25N 2J6EH 3GSUB 2EC9U 4Y16B 4YHKL 5GIRB 1PX4A 2VDRL 5BW7A 1F90L 1HSBB 2NXZD 3FT4B 4H8WC 3B2VL 5C9JB 1WBXA 2NCMA 4HK0B 3S36L 4Y88A 5TPWH 4P2OA 3MUJA 2DQGL 3HUJB 4I5BB 1FZJA 1U9KA 4GAFB 2VN4A 2FNBA 1ITBB 2X6MA 5I19L 3SGDI 3WLWC 4XNXL 5FKAB 2Y5TA 2RJMA 3Q3GA 4KMTH 4JQXC 3E6HA 3DVNA 4JFEE 4KK6C 4LF3B 1IZKA 3CFIC 4L9DA 3T4AB 3UTZA 1YYLH 3UTTA 4HW6A 1IGCH 1R3IH 1Z0NA 1KBGL 4R90L 3ESUF 3WEXB 4GSDL 3MOAH 1YEDB 1H3TA 4HH8A 1MVUB 4ZNEA 5KVMC 5GGVL 2VXQL 1SBBA 2YPVH 5HGDA 2VQ1A 1I1FB 1CGXA 3VDBA 1EH9A 4H88H 4MWFA 4NQVA 1CXKA 4G6MH 5LGJB 3MACH 1A9BB 3J8F7 4LCYA 1RZKH 3T77B 2DLGA 1UG9A 2BNRE 2XNAB 3HI6H 5E2VH 3VD5A 2EICA 4KHXH 1KB5B 2J8OA 3CMOH 4LGPB 4P4KA 1EHLL 3MNVA 3S4SB 2Z4QB 3U2SB 1TMCB 5HDOA 5EIQA 3HMWL 3DI3B 3WIIH 1OAYL 3FOMB 3G5VA 1MHCB 5DJYA 1R0AH 1YYMH 4WI8A 1H5BC 2R0LH 5E8DL 3TVMD 2ZOLB 5EFIA 4OGZA 4YK4C 4ZSOA 1JPTL 3KPNA 1C08B 3LV3B 3D2UA 4QRQA 5BMFL 1OAUL 5HY9B 1MI5B 4PJDF 1HOCA 2NY5C 1Q94A 4IRSB 3S9DB 3DV6A 1QLRB 1PEZA 3BEWB 1B9ZA 2FR4A 2E9IA 4NQEA 2FYYB 2L7UA 4EUPG 1U8MB 1WWAX 5DHXB 4F9PA 3KS0J 3G08B 1KCUH 4TPRH 3IFNH 1A3RH 1G0XA 3ARYA 3C6SB 1DJSA 2BFVL 3OF6A 5BJTA 3ARWA 3X12A 1E4WH 4HXBH 3G5XB 3MLXL 3TVMC 5IHLB 1YY9D 5C08D 3U1SL 4QXGH 3RDTA 1GGBH 4MJIB 3LKQB 5EC1B 5J06A 1ED3A 1OCWL 1HH9A 3KYKH 3I75A 2YPKA 2VZSA 1U93A 2O5XH 2QQNL 5JMRA 3D0LA 4M61B 1WC7A 4ZQKB 2P47B 3QEHA 2AJYH 4PJDE 2O5ZH 3QH3B 5IEKB 5HHXH 1T04A 2BVOA 2VXSL 2HN7B 3VMPA 1BJ1J 3B2UD 1JPGB 4LRIA 1IEBB 5F7YC 2AEIT 2YHGA 2DLEA 1NBZB 3C08H 1KCLA 3NFPB 4K3JH 4KKAD 4APQD 5IGXH 1YY9C 3ZL4H 3QUYB 5MEPA 1I1AD 5D71H 4QTIL 3BZ4B 2PYFA 2A83B 4LARH 1TDQA 5ACZB 4XNMB 1AJ7H 4XMKL 2QV2A 1NQBA 2F15A 5T3ZL 2KUTA 1MELA 3IDYB 3BN3B 4I3SL 2ARJB 5GJSL 4AENA 5JNYB 1J0IA 1GPOH 1IEHA 2BSED 2L7JA 3NGBB 3S3SA 5I8OL 3PF2A 4V2CB 4PGBA 1G7PA 4N0UB 5FO9B 2CLVA 3B2UC 4LU5H 1A21A 1ONQB 1EEYA 1SJHA 4G6JH 4KKAC 2FJGB 3WD5H 5IJVA 3UTPD 2AJZA 4PREA 5IHZA 3VXME 4LSTL 4Q74A 4NN7B 1A9EB 1G9NC 1I1AC 1OAZL 1SQ2N 5DGQA 1NAMB 3SJVD 3V6BR 1A7RH 5E56A 5GRVL 32C2B 1MCBA 3TH3T 4JKPH 5F1NA 2DWEA 1J88A 4WWKA 1MLCA 1YN6B 3PIQB 2EDYA 3H3KA 5D6DA 4LNRA 2RR3A 4JQVA 5MENE 4C4KT 5J0BA 2AP2A 4JG1H 4BK4A 4L4VD 1EEUA 2AV1A 3S6CA 4NCC1 4FFWD 3ULUD 4NNPL 5FECA 3P9LA 1M71A 5I8EB 1INDH 2YN3A 5ADPL 5JMOC 1W0YT 5HVGB 3SBWA 4WFGD 5IWLA 1CLYH 4WTZG 5ETUA 3CFJA 4JPVL 5KG9B 4R0LA 5T1LB 1HDMB 2GY7B 4O2FB 5DQ9B 5F89B 4JGMA 4OD2B 4FG6D 3QIWA 2FLRT 3OKOB 1T83C 1YECH 4ZUWB 3RWCB 4YFDB 5KVGL 4G42B 1TQCC 4Y5XB 5H2BB 3STZB 4JRXA 1F97A 3BP7B 3FQNA 3PJSB 3MOQA 4F8TA 3PWPE 2X9YA 3LPGA 2VAAA 4XNYH 3RI5F 1KEML 1BZQK 4Z5RB 2OR9L 4Z0XA 4EDXA 1B0GA 1I9EA 3MRBB 4Y5VB 4NQDA 2UZIL 3OXSA 3WBDA 4BZ2H 5T3XH 4RGMC 5ADOL 3EDDA 5E1AB 2AERT 1ZHBA 4FG6C 3TN0A 3ULSA 3PP3H 3CLFL 3L3GA 4YHKH 5DFWH 3FTGA 3ZDXF 1BPVA 3T0VA 1AHWC 4UIKL 2DBLL 4MJ5B 5HJ3B 4KY1H 3O4LD 4LPUA 1Y6KR 1N2RB 2EH7L 2R0KH 4LCCB 4CRPA 1YEJH 3I50H 5A1AA 5D2LB 2P8MA 3QDJE 5FUZL 3WSQL 4R96A 5GRWA 2IALB 4DFHA 4IIQC 5DMYA 3RWHB 1IBGH 2VR9A 4HWUA 5I19H 3QFJD 5L0QB 1KJ2L 4HV8B 5FDWB 5AYUL 4RISL 4P59L 3MNZA 1U8OB 2XN9E 2YMXH 1X5KA 1A14H 1AIFA 2PR4L 1F2XK 5B8CB 5CHNA 1M7XA 4R90H 1ZTXL 1CICA 3DYOA 4PJBB 2F58H 2OJEB 1B6UA 2Q8BL 1AD9A 2VLRE 1H8NA 4M62L 2P5WB 3LKNB 4NPYB 4GRWF 4ODTL 4ETYA 5I66B 4X7DC 4DKDC 2JB5L 3QA3B 5GGUB 4JFHD 5DR5L 2CQVA 5EPMB 3MV7D 5HVFB 5J11B 2RFXA 5TE7L 3ZDXE 3GM8A 1CYGA 4LLYA 3WS3B 2A73B 4P5TA 5DC0A 3PL6B 3JTTB 5IHUL 2R15A 4WO4D 5DT1L 4XVJL 3KPTA 3EYUH 3HMWH 5HI4D 3FL7A 3RVUD 1IGYA 4RQQA 3JVGC 4JN1H 4G9FE 4JHWH 4ZFFA 2X1OA 2BNQE 4QRPB 2Q7YA 2X4PA 1XGTA 2DYPB 4FQIL 2P8PA 1J0ZA 4RFEA 5BMFH 1OAUH 1HCFX 4DQOL 1HHKA 3LB6C 4P48A 4HJ0D 2WANA 3PWJA 4P4RA 3UZQA 2ITCB 3RJQB 3O3EA 4M3KB 1WEJH 3EOTL 1NANH 4JFZL 1DUYA 2DQTL 5C07D 4GXUM 3QQ3A 1FDLL 4OZFH 1N6QH 4XMLH 3VXUB 5FYKE 4S1RL 2DD8L 5HI4C 2BFVH 1YA5A 5FUOL 3RPIA 4OZGF 2I5YH 1WIPA 2GITB 4UT7H 4M5ZL 1J12A 2UWEF 1BD2E 1EO5A 3GEWB 3LKOA 5D7KD 4BK5A 5DJCB 3A6CL 4PJXB 5F7EL 1LQSR 3U1SH 3K2MC 2MOVA 3V6OE 4WNQB 2EEAA 4KKCD 1KJ2A 1OCWH 4HJ0C 2V9TA 5FB8A 5GGRY 4B50A 5CKGA 2EDEA 5E94B 4X80L 4ZNCD 1MFBL 2OTWA 3DJ9A 1XAUA 2BMKB 3BIAX 3Q6FA 4HJGB 2VDLL 2DLHA 4PB0L 4L1DA 3DURB 4GO6B 5GS0C 3P73A 4EDWL 4KTEL 2FEEL 4GW5B 4L3EB 3AS0A 4NHUB 4LLQB 5KS9A 1U8JA 1EO8L 3KLAB 3C8KB 2NY4B 1FVEB 2HFEA 1LE9B 3NH7L 2G9HB 4OGYL 4KKCC 4A6YL 5EOTA 2X41A 3GMLA 5JOFB 4JRYB 4OZGE 5DK0A 3CFKB 4PRAB 5IM7B 4XMKH 2DN7A 4KDTA 1Y0LA 4IHOB 4GMTL 4K94C 3X13B 5JIKA 1MHHA 2UWEE 2UZXB 4JM2B 1P1ZB 5HYSA 1QHPA 2YD3A 5DF0A 3HG1A 4D8PB 3SKMA 1KTLA 1KPVA 3BXNA 5I2IA 4XCYB 4P3WA 3S8WA 5DQDL 3FQTA 4RSVA 2A2QT 3MRRA 4PYGA 4CL7A 1ZA6B 2RAMA 2IWGA 4OLXH 4GOSA 1AXSA 3U36A 1SEBB 4ZMAT 2EKSB 4AEFA 2FO4A 5SV4A 4ELKA 3QEQA 2ITDB 5GS1B 4I3RL 5IB2B 4P23D 3EJYD 4NRYA 5EOQL 4D3CL 4LLVA 1WZLA 2E9JA 1TTGA 4MZ3A 1EGJH 4RBPK 5F8RC 4ETQA 4OCRL 1JF6A 1E4KC 1JJUA 3IXAB 2IC2A 3TFKD 2OR7A 4BQ9A 3CU1A 5CMAB 1XF3B 4PJIA 1YQVL 2A9ML 2XWBB 3G5YB 4U1HB 2E7HA 2X40A 3D18B 4U6VL 2MQCA 3RIAF 4JO1L 4NNPH 4UNUA 4M7JL 4Y4KC 3ZE1F 2EIZA 4JO4L 5ADPH 5I6XB 3TO2B 2XRAL 1JGLL 2EDWA 4KDVA 2Q1EA 3HZYA 3WXVL 2EDFA 4UDUB 4CVUA 1XF4B 4LAJH 1AD0A 4P23C 3G6JF 1AQDA 2QSVA 2CJUH 4P9MH 4M6AA 3DVGA 5J4MA 3QXWA 3D39A 5FO7A 4JN2B 3OR7B 1TVBA 5DJ0B 1NGWA 5ITBH 1FYTE 4S1SH 1INEL 2GFBB 3P0YL 3W5MA 3TFKC 4LVNC 1GCFA 4NGHL 4JFXB 1M7IB 3MJ8B 4PJCB 5KW9L 1CD1A 5DURB 3MCLL 5EO9B 3RGVD 3U30C 4A6YA 1NEZB 4QRTA 1KEMH 2XQYG 3TO4A 3CLEL 5D1ZA 4HUUB 5CLWA 2FZ3A 2H8PA 5JLZA 4ZAKB 4WU7B 4MVBD 3KXFD 2B1HH 3WFHB 2UZIH 3GB7B 5TF0A 4B0MM 1QSFE 5FXCH 5SWSD 1N8ZB 1ETZA 4L8CB 1D9KD 3JWDH 4J1UB 5EULV 4MCYA 4NZRL 1A6ZB 1C12B 2A74B 5IKCB 1JPFB 3LRSB 5JXEA 1UVQB 4LCWE 2DBLH 3O45A 1EHAA 4OUUB 2AVGA 2EH7H 2C5DC 1GJIA 2E27L 2OJZH 1U8HA 3G6JE 1VERA 1PZUB 5EU6A 1X5JA 5FUZH 2P24B 4U1MB 3CSYA 5I8CB 3D0VB 3V5DA 4H26B 1KJ2H 3VGEA 2WP3T 5FYJU 4CNIA 2KL6A 1JK8A 5AYUH 4P59H 3AS2A 4X6FA 2DJUA 4MVBC 3VXSA 2VSDA 4PJFF 1XGPB 3VFNB 1J8KA 4PJ5A 3WUZA 3BVNB 3QNZA 3R1GL 2VOTA 4KPHL 1UA6H 1LD9B 1WVZA 3GK8H 4AT6A 5HVWA 4R97C 1UWXK 2X2YA 4QYOB 4MA1C 3AB0C 4OF6A 2WQ8A 2GJJA 1T1YB 1H0DA 2ZSVA 1HIML 1J1OH 2H26A 4ZTOL 1FSKC 2W9DL 5F7HA 4NBXB 3DYMA 5DR5H 1SVCP 3L7EB 1OW0A 1X5ZA 3TA3B 5CINL 2Y5EA 3SDDB 1DQMH 1FBIL 3HLAA 2AK1H 1NBVH 3REVA 1RK0B 2CIIB 2FGWH 5IHUH 1JIBA 4OGXL 5DT1H 4WV1A 3OB0H 1NMCC 4W6YB 3X17A 3QQ4B 3VW3H 3SDXA 3MZGB 4KQ3H 1P9MA 4G6KL 1DN0A 3QNYA 4LLDA 4Q6IA 5CJ5A 1JZ4A 3DUUB 3E8UH 2R1YA 4G8GE 4JFEB 2UYLA 5HVHB 4U1JA 3SDYH 3SO3B 4PJFE 2G2RA 5KTEH 4Y19D 4NT6B 1DEEB 4WU5A 2GSIA 4QHKJ 1RZGA 4JHAL 1UXWA 4R2GC 3EOTH 5CEYA 5DUBA 1IZJA 4X98A 3LOWA 5IVZA 3FN0H 3MTRA 5F7KC 4ODUA 3VFOA 1JHKH 3M17B 4DKFL 1NANI 1MH5A 3LDBC 4S1RH 2YWYA 3OKNB 2KPNA 4L1HA 1IGIL 4Z7OE 3CC5A 2PTTB 5TF1L 4HXAL 4LLAA 5DK3A 4HX1A 2HG5B 3AREC 2BNRB 1FGVL 2BJMH 3DUHA 4M5ZH 1C1EL 1P7HL 1G0YR 4U6XB 1C5DB 3VWJC 2OSLB 3HFML 1RZ8B 1LO2H 3VFVA 2GTZB 2ZUQC 2Z0BA 1KENH 1MJUH 3UJJH 5I17B 1NKRA 1F4XH 3BDYL 43CAB 2AXFB 1Z9OA 3IU3B 3FB7B 5LGKA 4MAYD 3N1GC 5KANI 4IJ3B 5ALBL 2VDLH 4YHYB 2WBJB 3GSXA 3S34H 4OZHA 1MAJA 1KN4L 1DP0A 4X8JA 5AEAA 2XXCB 3O6MH 2YA2A 5J6HA 1G9EA 5JUEH 4KTEH 2W9LA 4AH2A 5FOJA 1NGYA 4OCSL 1MUJB 1MPAL 5IFAH 1MFDH 2SEBB 1SM3H 4HWBL 3RBGA 2KKQA 1OOAA 3K4AA 1VKXA 3RPKA 1UT9A 5DHVB 3MCG1 1HQRA 1Q72L 1XCQA 4YHOH 4LHUA 3R8QA 5I1LB 4KI5D 4X7TA 2EC8A 4MXWL 2IMMA 1CDYA 1AGCA 3MV8D 4GMTH 5I15L 1EJ6A 1HINL 4D9RE 1RUML 2JB6A 4IOIA 4O2CB 4MAYC 4XPBH 5FYLD 4PP1C 3MRJB 2X05A 3UYOD 2Z31D 4LEOA 1TJIL 3HAEG 3S37L 4NKOB 1NL0H 3FO1B 5ITFB 4E41E 4NM4L 5D7LA 3GBNL 1U58A 4HCRL 3GJFK <