1UBCA

Structure of reca protein
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
326
structure length
303
Chain Sequence
APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGLQARLMSQALRKMTGALNNSGTTAIFINQTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Mycobacterium smegmatis RecA and Its Nucleotide Complexes
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Recombination
molecule keywords RecA
total genus 87
structure length 303
sequence length 326
ec nomenclature
pdb deposition date 2003-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 1ubcA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ubcA01
2Q3MA 4JBXA 1CR0A 5LB4A 1W44A 3RLFA 4F93B 4PQFA 2FZ4A 5D3MA 2ZJAA 5DHFA 3AB3A 4C7OB 1XCMA 4AD8A 1L8QA 3W34A 1P73A 3KXLA 5GVRA 2CCJA 3CF6R 5EXTA 1B23P 3AF0A 4RD1A 2JA1A 1GNQA 2HT1A 3UG6A 1CP2A 3LBIA 2ZRKA 3GFTA 3SJBA 4LGMA 2ODEA 3X1ZA 3ZIAD 4HUTA 4ASUD 3QEJA 4KCGA 2GZAA 3UWKA 1XTIA 3C41J 5CM9C 5GJBA 1W5TA 4ASUA 3NWJA 4NMMA 4GRAA 1GNRA 2NOAA 5M04A 1DAKA 4EPYA 2OE2A 4B6EA 2C04A 2V7QA 3VQTA 2D74A 4ESVA 4FMCF 4XSHA 1KIMA 3QXCA 3UKDA 3HU1A 5HR5A 3U7GA 4WAUA 5HE8A 1XD8A 3DO6A 2NG1A 2WKRA 1EFUA 2QSYA 4ZDKA 3EA0A 3C4JA 2JATA 2FFQA 4PAOA 3WYGA 3EC1A 2WJIA 1KY2A 5CK5A 1N0WA 1VPLA 5AK0A 3C14C 3A1WA 3AV0B 1Q20A 1XEXB 4PSAA 1EXMA 3FMPB 3K1JA 4URYR 2WKPA 4OBEA 5C46F 1XD2A 3W6PA 2Q9CA 5AJWA 1E4VA 1PV4A 4U02A 3W6OA 4ZCLA 1P5ZB 4LYFA 1EX7A 3RNLA 4D4MA 5H8WA 1EFRA 3GFPA 2ZRLA 1KMHB 5LB2A 1KDTA 1G6OA 1TNDA 2ZTSA 2A2ZA 2CDNA 1ZCAA 5FTNA 1G9XA 2NPFA 5HCNA 1AM4D 2HLDA 2FSGA 2QY9A 3LXXA 4LHYA 2YWGA 5AJVB 3WHKA 3L2OB 4WZAE 3GJ8A 2JASA 2W2TA 3ZVMA 2GETA 1ZUIA 2EYUA 3IEVA 2J9RA 1P9RA 1J7KA 2EW1A 2ZI4A 2OAP1 2RH5A 3KUCA 2F1RA 2NTYC 3CX7A 3NBZC 1JB1A 1KY3A 2WBLC 3AP2A 2XSZD 5B30A 4EFNA 2VP4A 1T9HA 1FW6A 1U9IA 1UKEA 2J46A 1MO3A 4LYAA 4CDGA 3VR5A 2ZYTX 3KKQA 2Z6VA 2ZSAA 2Y8EA 2QL6A 5FUVA 1E96A 2LKDA 3A1VA 2A5GA 3T1OA 4C9BA 2XB4A 4KI0A 3L82B 1E1RD 2GCOA 3CRRA 3DKPA 5JJKA 1E2NA 3KFXA 2JJ2D 1E2HA 3CRMA 3NC0C 1YZKA 1P61B 5GJVC 1KK3A 4F4JA 1T6NA 4MDEA 3C5HA 3RANA 4D0GA 1ETUA 3FHOA 2VSXA 2ORWA 5DN6D 3PITA 1XTQA 1YU9A 4K81B 1OH8A 2X77A 4PX9A 2WAXA 4RZ3A 1LS1A 4R7ZA 4OK5A 4W7SA 4URVR 3DDCA 1KZ7B 4DSUA 5EP3A 1VECA 4IXNA 2VHJA 3EZFA 3CUEF 3L0IB 2REBA 4WXPA 4X8LA 3RRYA 2CBZA 1U99A 1H8EA 5KSPA 2IBMA 3MCAA 2ATVA 1Z22A 2XNDA 1D2NA 4Q1CA 1XRJA 2QEQA 4Q4AA 5CK4A 5CJ2A 4N3NA 1YR6A 4QBHA 2OCPA 2A3RA 4ZKEA 1E9BA 4BE7B 1SKYE 1J70A 3U3OA 1LY1A 1XMIA 4Q9KA 1R2QA 1KK1A 3I73A 3QJYA 4B2PA 4JBYA 2GJ8A 3BWDD 5FBWB 3CRQA 2IYZA 2GZHA 3MFYA 4MA4A 4NDZA 4NPHA 1KDRA 5EZ5A 3DVLA 5P21A 2WOOA 1E0SA 3GLFA 2GKSA 5JS7A 2VP5A 4LPKA 2H57A 4P33A 4M22A 4PO8A 2JCSA 4G5GA 4PZZA 3SU8A 2R65A 2H8KA 4QHYA 1RC8A 4W5WA 1ZM4A 2CNWA 4P4UA 1S0UA 5B2ZA 2ZIAA 4M53A 2Z43A 4US2R 4JLJA 3TSOA 4BLTA 3RS4A 2QTVB 3AKCA 1NN1A 3JZMA 3BH0A 2JLSA 3NHAA 1HY3A 2XJ4A 3PR1A 1HH4A 5AJXA 1N6KA 4EPRA 5DNYB 2BWJA 4MGIR 1CEEA 5C18A 4PZLA 3CPHA 5FI0B 5G41A 1I4LD 3FWYA 1BYIA 2IS1A 1SQ5A 1KO8A 1Z06A 1DAIA 3FE2A 3LAWA 1MABA 1T0JB 1ZW6A 1Z6XA 4BLQA 1AKEA 2OG2A 2DFTA 2DFNA 3AKYA 4GPTA 4KBFA 4CVNA 1VDZA 2PZGA 3LW7A 2QT0A 4PC2A 1L2TA 2VRWA 2PL3A 1XEFA 3CW2A 3I8SA 3EPHA 1NJGA 2O8DA 2FEOA 4KXFB 5TB5A 4OHYA 1XTJA 1O3YA 2PZEA 1DEKA 2XSZA 3IO3A 4LBVA 4OHWA 2C2HA 4A8JA 2ZI9A 4BRUA 2FX3A 3NKVA 4X8HA 1R0WA 1UPTA 3K8YA 3REFA 4C0KA 4BUJA 4UNPA 2C99A 1X6VA 1NLFA 4AG6A 1G1MA 1M6NA 5SZJA 4B2IA 2QT1A 4XD7D 1G7RA 3ZS9A 2IYWA 3GLFE 2AFIE 3NBFA 2J59A 1TPZA 5D3MB 1XZPA 3J81k 2NIPA 5FOVA 1E9CA 1DPFA 1XNJA 4O2RA 3BOSA 3SJZA 1F60A 4JS0A 1TU3A 4QM7A 3WNCA 1Z0IA 2GJSA 4IDPA 5DSZA 1KYIA 1KI9A 3U2QA 2AKAB 2P5TB 2ZSEA 4ZPXA 1U0JA 2PMDA 2RGDA 3MRSA 2WIBA 4KYIB 3H4MA 5AR1A 1J2JA 3RS5A 4URXR 1NBME 1OXSC 3ECCA 1UBFA 3GEIA 4QJ4A 1RYFA 3ADCA 1WXQA 5JHGB 2YYZA 4XWAA 1W5SA 5LBIA 3FOZA 1ANKA 3GLGB 1W46A 3TBKA 2MMCA 5CB8A 1TEVA 1FUUA 4QBFA 3PQCA 4WBSA 3R20A 2JLYA 5FOXA 1XCPA 3EA5A 4KVAA 4ACAA 2IS6A 3PEWA 3TH5A 1P60A 4DVGA 3QKRA 4ILEA 4DLYA 4Q18A 4RZ2A 3NIBA 3X2SA 3RC8A 4B48A 2ORIA 4QRHA 4NZYA 4LV8B 1TAGA 2GTPA 4C0SA 3BB1A 2QN6A 2YJTD 5BYKA 3NXSA 4JLOA 4C4PA 4MDFA 1FZQA 1I4TD 2A7QA 2VQSA 3VX3A 4TLEA 3ZZUA 3GLFB 4NH0A 3FGNA 2XJ9A 2HUPA 5JWHA 2Q6TA 4DJTA 2JEOA 3ADKA 4U5XA 2P65A 2Z83A 2BV3A 1K8RA 3AKEA 3FFAA 4XJXA 1W36D 1JNYA 2H16A 1VG0B 1HT1E 2XOKA 3JVVA 4QGFA 1J90A 1Z3IX 5FPHA 1NVWQ 2GJ9A 3RDPA 2EFHB 4ZIRB 3I5YA 5KTYA 1XPRA 1N6NA 3I8XA 3GLHA 2ZRGA 4JYCA 1UDWA 1M7GA 4JLNA 1OW3B 3AGPA 1AKYA 4Q7KA 1OFUX 2PX0A 4Z1MA 2JLXA 4FMDF 2QP9X 1IN7A 2IC5A 2ZROA 3TAHA 1JJVA 4US0R 1OFIA 2EWVA 1XXHA 2R2AA 2KSQA 1OYWA 1T5LA 1JEDA 1P62B 2QU8A 2WICA 2GCOB 3TGPA 2RGNC 3ZQ6A 4V03A 3DL0A 4UXIA 2B6HA 3KDSE 4QGGA 5JRZA 4UJ3A 1UFQA 3IDQA 2CVHA 2IUSA 2FSFA 5TDHA 3EIQA 1WCV1 3K0FB 1RIFA 4Q5IA 2QQEA 4KFSA 4LJ9A 2VPPA 4UXHA 2QAGC 3OEED 2DY1A 4E5UA 4H1VA 2O8EB 1SVMA 3VFDA 2DYKA 2JLZA 4DDWA 5IHPA 1Z63A 1KJZA 4TL8A 4GL2A 3VNUA 2G1JA 4BWYA 4XIGS 4LJ8A 3T06B 2GXAA 3VR2A 4CT5A 2FF7A 3AF3A 1R8QA 1QG4A 2FGKA 2ZUDA 3CO5A 3PUXA 4IJMA 4MRSA 3TQCA 3WHLA 4KFTA 2W6ID 4M1KA 3IBGA 1R5OA 4IOKA 2B7CA 4AWXA 4JSTA 3VNVA 4HAUA 3KX2A 4PSVA 5AUNB 2ZXUA 2QM8A 1RVDA 4GZMA 3TVDA 3QSYA 2D7DA 3R9XA 5JEEA 2LCFA 2NGRA 2DPXA 4S2EA 2VYFA 5CLLA 4TYNA 1GTVA 1GILA 2R8RA 4B74A 1IY0A 1OH5A 3Q72A 4LJ7A 1N5JA 4A2QA 1KDPA 4GOJA 3TRFA 4FCVA 2ZREA 1IY2A 3AEZA 3IIJA 2EFGA 5BN4A 2XB2A 1UJ2A 4BEJA 4C0LA 3FFBA 3FKSA 4LC1A 4W5HA 3K09A 1G4AE 1SVIA 3T1QA 3MWLA 4TTQA 3R8CA 4TZ0A 1EK0A 1CF4A 1MKYA 1TMKA 4TMTA 1MV5A 1AIPA 4DHEA 2ONKA 3OIYA 3CIOA 4L15A 1CJTC 1EFHA 4NCIA 4UQOA 4EAQA 3LBHA 2EYQA 4BGDA 4F91B 1OFHA 2OBNA 3AVPA 3ZGXA 1M7BA 3QUSA 2H1LA 1A1VA 1MH1A 3LH5A 3ONWA 1Z0FA 5FBVB 1Z0KA 1JR3D 4DSNA 3U3KA 4JJKA 1ZCBA 2ZR0A 4C3ZA 3H0KA 1KI6A 4QG7A 5HE9A 3VU9A 2DWQA 2NO0A 4ZO4A 2XAUA 1CJMA 5JBQA 3HYRA 2FU5C 4BFWA 4HATA 2F6RA 4BFZA 2IA5A 3MMPA 4JVSB 2IYTA 3A1TA 3O8DA 4HEJA 4BZXA 4TYPA 2YVUA 4EJSA 1NVUQ 1GL9B 1W36C 4A6PA 2FGJA 3B5JA 3K0AA 3TW8B 1XBTA 4DLSA 1K6MA 4DLRA 2HYDA 2WKQA 3AVWA 4M2LA 4A8JB 4DB4A 4CIDA 1ZD1A 4RKFA 4PC1A 4B3FX 1MO4A 5JECA 3U61B 4TMWA 2IYXA 2MMGA 4A9AA 1H8ED 1VG9B 1N6LA 2BEJA 3IILA 4GOXA 1FP7A 1OLOA 1VYTA 4RD2A 2XTNA 2OFWA 4TLDA 4KSBA 4PANA 5H70A 3GCGA 2GCNA 2JIZD 2BDTA 3P32A 4MGYR 2C96A 2AN9A 4TSFD 1X1SA 4EFLA 3U4QA 1Q12A 1GRNA 2WJJA 2A5FA 3SJAA 2CCGA 1KI8A 5E7JA 1XB2A 2V6IA 4GFDA 4Q03A 4TL7A 1P4SA 2O8FA 1E2KA 1YZQA 4DCUA 3DHWC 3IQWA 3QE0A 3FVQA 4MYHA 121PA 2FV8A 2QTHA 5JS8A 4HDCA 3SEAA 4AK9A 4HZUB 2WWFA 1KAGA 4DDUA 2ERYA 5JCPA 5ANRB 4YLGA 2ZE7A 1AGRA 1G7CA 4GZLA 1ZD9A 4I4LA 1II8A 3DOFA 4YDSA 2G88A 4NU0A 4ABYA 2YV5A 3THWA 5E7MA 1AA3A 1ZU4A 4IDNA 2PZFA 1R6BX 4TYYA 1NI3A 4EDHA 4QNMA 2IXEA 1F2TB 2V8OA 3GJ4A 1SVWA 3SYNA 2RAPA 1T3HA 2GHIA 2V1UA 1OIVA 3OF5A 3KTAB 4FI3C 4NL4H 1KK0A 1AK2A 2ODBA 4HZIA 2O0HA 4FWIB 3ZDQA 1E0JA 4PXAA 3CR8A 2E87A 3P26A 2ODWA 3IEUA 3IIMA 3P4XA 5J47A 2DWOA 3TAUA 4OHXA 4JT4A 3KQKA 3CR7A 4RD4A 1SXJE 4A2PA 1S9DA 4BFYA 1T8TA 1NVVQ 2ZRMA 1ZYUA 4N1AA 2GXQA 2QPOA 1LB1B 1Z2AA 4MUBA 3KQLA 4DLWA 4KBGA 4DLZA 3UANA 4DRZA 3SHWA 3PVSA 3THYB 4A2WA 4DCSA 2GESA 1TUIA 4HAZA 1T0HB 5DO9A 4DUGA 5DI3B 1DO2A 4PQRA 2ZRNA 1RRFA 3MG9A 4JLAA 3TQFA 3KJIA 1RFLA 3PIRA 3SYLA 4RD3A 1YZTA 1DADA 3AUXA 2J0UB 4QBIA 4TTRA 1OIWA 1ZVQA 2BC9A 2O0JA 3VR4A 2I3BA 1P2VA 3HR8A 1K5DA 1GUAA 4B75A 3H86A 3ZZTA 4B6FA 1ZJ6A 4RCYA 4TTPA 4ESHA 2GBLC 3NBXX 3BE4A 4NYIQ 1JBKA 3HWSA 4D4KA 4FIDA 3GLIA 3RS3A 4JT2A 1F6BA 1FX0A 4GP6A 3VKWA 3KKOA 2G83A 1F48A 2VP6A 2RGNA 1U9IC 1MO5A 1ZBDA 3LQQA 3OFNA 2CLDX 1NSTA 2NO6A 4LHWA 4UNNA 4KLZA 1Y63A 4MQBA 3M1IA 4HAYA 2J45A 3PEUA 2DWPA 1QG2A 1A2BA 2Q0HA 4MYTA 3I62A 4MGZR 3KQNA 3CONA 4C0HA 2NO9A 3BXZA 2O8DB 1XX6A 3KKPA 4M9ZA 1E1QD 1CRPA 1HURA 5L3VA 1Z2CA 1GVNB 4JJZA 4E03A 1E2JA 4AKIA 3IKJA 2B92A 4XSGA 3ZQJA 3AH8A 1SXJB 3N2IA 1FP6A 3QQ5A 1QHIA 4Q9LA 5B64A 4RFSA 3MJHA 3TE6A 4LWZA 1U8ZA 2ZRBA 2KB0A 4CEHA 1SXJC 3CRVA 3LLUA 1KI7A 1Z6YA 4TZ6A 1ZINA 3A8TA 2GWHA 3SDZA 1IN6A 4US1R 1GL7A 4FMCB 4HUQB 2G1KA 5FTJA 4TMKA 3VR3A 2HCJB 3EWSA 4OQNA 4LJ6A 2OCYC 4G0NA 4RJLA 1QF9A 1MRSA 4B44A 4G3XA 5JLJA 2ZR7A 2OILA 2F7SA 4BEBA 2ZQ5A 2W0MA 1ZIOA 4DSOA 3IHLA 4P0TA 3BJIC 1G5TA 2QMHA 2IX3A 4V02A 3RWOA 4DT1A 4JIMA 4KITB 4L9WA 3ADDA 1HA3A 1Q57A 1VKJA 2WWIA 5G3ZA 3BFXA 2WIAA 2BBTA 4TL9A 4TL6A 2IF0A 1AN0A 2GA8A 1W2HA 4ZDWA 2IEYA 1NG9A 1F3OA 3ZIAA 1AQYA 2BBOA 4PPFA 3M0EA 2PMKA 2PBRA 3HU2A 1WA5A 5FR1A 2QMEA 2C9CA 2F3RA 1VMAA 4ZDJA 3LWNA 4Q4JA 5FPYA 4W5JA 3SNHA 4Q9JA 1ZM3A 3CF0A 2G9NA 2VIIA 4DB2A 1NRJB 5FL3A 1XMVA 2WPDA 3GD7A 4LJAA 1X1RA 4PAMA 3I3SR 3U3RA 4F7WA 2EVWX 2F9MA 3LX8A 3T5DA 2LWIA 4KFUA 2GDJA 3L0OA 2W6JA 3WBKA 2IT1A 2QQ0A 1E1RA 1CJVC 4DCVA 2ZSBA 2HF9A 2ZRJA 1KMQA 1N6IA 2W0SA 3FDIA 4AY2A 3H2YA 4D4JA 1P72A 2WWYA 3KJHA 3OEEA 1GOTA 4M1MA 2J41A 4OK3A 1NN5A 2FPKA 1IAQA 1M1YE 1N5LA 4MRRA 1AZTA 1E2FA 4ARZA 1P2UA 2IHBA 1EFTA 3T1TA 1T8UA 1YQTA 4HB0A 3QXHA 5DISB 3LLMA 2QE7D 1PLKA 5KNCA 2V3CC 4D6PA 3B9QA 1KSFX 2KI5A 3SBDA 2VP9A 3Q8XB 1CR2A 4R71A 1CJKC 3L0PA 2EFEB 4HAVA 1FUKA 1RRPA 2GCPA 4GBMA 4OI2A 5FUYA 1JAHA 2PLRA 2CXXA 1E2LA 1IM2A 1YE8A 3LX5A 3VU9B 1LF5A 1DBSA 3VHLB 5HZKA 1Z6AA 3GJ7A 4U00A 2H5EA 1JI0A 1JR3A 2FH5B 3U5ZB 1ZRHA 5LD2C 3EARA 3LY5A 3R7WB 4JVMA 3AVYA 4YMWA 3WY9A 4G5SA 1KDOA 2ECKA 1Z0DA 3GPLA 3EPJA 4FMDB 1D6JA 3MSXA 2XEXA 3CNNA 2FFAA 4TT3A 1G5RA 3W8RA 1E69A 1Q22A 2PCJA 2HV8A 4QJ5A 4XVRA 5KNBA 2H7VA 2GJAA 4WW0A 1OE0A 2HJVA 3D31A 4L4UA 5FBQB 1VYUA 4B73A 2QG6A 1P6XA 3B6EA 3KQHA 1U8AA 3CH4B 1G64A 4AURA 1EWQA 4ERNA 2ZM5A 5SZIA 1UAAA 2BVNA 4NHOA 1W48A 4F4IA 2FOLA 5FOUA 3GJXC 2WPDD 3U4QB 5KPDA 2ZRAA 2QTFA 2IW3A 1PLJA 3QBVA 5AJYA 4YMTA 2CLCX 4M1SA 4BQSA 2FEMA 3REGA 4GOKA 221PA 3W5JA 2EFCB 3HU3A 3RWMB 4B33A 2R6DA 3GQBA 3SZRA 4IDQA 4KFRA 3T1VA 1QHXA 2GZDA 4DLVA 3SR0A 4LJ4A 3H84A 1U0HC 2A78A 1WP9A 3NVAA 2OFXA 1D9ZA 4JLPA 2AK3A 2YOHA 2RCNA 4YQFA 1KI3A 2VHTA 3VR6A 5CYPA 1G41A 3SHFA 3AP1A 2JLWA 1JECA 3ETLA 2AKYA 2QP4A 4BFSA 3JZAA 2GVDC 3IUYA 5DIFA 1G6HA 1L4YA 2R9VA 4IDOA 1XCGB 1KMHA 4B43A 4S35A 2ERXA 1XMJA 5EP1A 2AD1A 3KTAA 3WYFA 4LBWA 5F9HA 2AR7A 1LF0A 3A1UA 1Q21A 4AKGA 2PEYA 1AZSC 1HV8A 1ESMA 5IRCD 1TTTA 4A6XA 1NL3A 4G5OA 4XD7A 4YMVA 1HQCA 4LV5B 4EIWA 5FTLA 5SZHB 4X8MA 3M4YA 5UKDA 1G291 2HT6A 2YWFA 4QGAA 1FFHA 2IYVA 1M74A 2HXYA 1AJEA 3AKDA 2W2VA 3KJEA 4PC3A 2F9LA 2Q3FA 4XTCS 1XJCA 4TMVA 2KE5A 5FUWA 4DCTA 4CZ2A 2WZQA 1W4AA 3OIWA 4PHFA 4TLCA 1H8HA 1N5KA 1YZLA 2QORA 3WRYC 2WM9B 3W3ZB 2C5LA 4I1OA 1Q1ZA 4NE2A 4HSEA 3RRNA 5TVKA 3EPLA 4LYHA 3GLHE 1PVOA 1E9FA 3OESA 3CNLA 3UMFA 1KO5A 4DLTA 2N46A 4CEIB 5K8UA 2XXAB 1S3SA 1ZNZA 2O8CB 3B82A 3O8CA 3D6TB 1TF2A 2OUKA 5AUQA 1VIYA 1UADA 3A6PC 1NBMA 3TJZA 1HT2E 3QG1A 3EWAA 2BMEA 4JKYA 3A58B 4R9UC 1G7SA 3BS4A 3W8NA 1BH2A 1M34E 1CLUA 5EJEA 3CH5A 4BLRA 2BEKA 2YWEA 4LHZA 3WYAA 3R8FA 1KO4A 2E9SA 2VP0A 1MRNA 2ZETA 1VIAA 2HYIC 2FE4A 4D0NA 2RB4A 1XEXA 2QRZA 3THXA 4A0GA 1BKDR 1ESNA 3A4MA 3BAFA 3ADBA 1E2DA 3WMEA 4FW9A 5TARA 4EKDA 3QKSA 1B0UA 4Y0VA 2ZS7A 4M21A 4M1YA 2XX3A 3CZQA 4LI0A 1E2QA 2R6CA 4A4DA 1CBUA 3NC1C 3K70D 1UKZA 4WA7A 2BBWA 2ZE6A 4WOPA 2CVFA 2XTZA 1ZP6A 3TKLA 4Q1FA 4B2LA 2IYSA 4P31A 5F2EA 4ZKDA 1LTQA 3RC3A 4MKIA 2VLIA 4MRPA 3THOA 5B57C 4W9MC 4V0KA 3VKHA 1HUQA 2XNDD 2VSFA 1Z47A 1E9SA 2RGXA 4HLUC 3V9PA 1DAMA 3X1XA 3KB1A 3QOFA 1DE0A 2F3TA 3N2EA 1NP6A 2C78A 3Q3JB 1OXTA 1UEIA 1NN3A 1NIJA 1KO1A 3UMRA 1SGWA 5J4VA 4AYTA 2X1VA 4PAQA 1MOZA 2J0QA 4JVLA 4OQFA 5BWMA 4RD6A 1FTNA 1DELA 2OAQ1 1QZXA 2QRNA 5EE1A 2FA9A 4EQ6B 1OSNA 2GEDA 2J7PD 1H8HD 4RSGA 1G3RA 2J0UA 1N6PA 3Q7PA 2VHQA 1DARA 3ICQB 1VCIA 2D06A 3HPQA 1JXMA 3B1XA 1NBMD 2RGBA 5JZVA 2PT5A 1U98A 4QKQA 1EWRA 2B21A 4NYMR 3RS7A 1S2MA 2VA8A 4JL5A 3LA6A 4LUCA 4TMZA 1KK2A 3VTKA 1II9A 4WZBE 3UATA 4BASA 4YMSA 1IN5A 1TQ4A 4Q4JB 3GLIB 1SZPA 4KJZA 4AYWA 3LVRE 1R4AA 2WWGA 5FI1B 5C4GB 1ZM9A 2FSIA 3WNBA 3AVTA 3QF4B 1BIFA 1NJFA 2NZ8A 1UBCA 1OJLA 3MUFA 3W9YA 4V0LA 5D3QA 1WBDA 2PEZA 4QBGB 3EZ9A 3OEHA 2LKCA 4Q1BA 3B8HA 3E70C 2P2LA 1D9XA 2CJWB 2CE2X 2HDNB 3U44A 1PUIA 3OE7D 2N1BA 4LK2A 1WRBA 3EZ7A 4R98A 421PA 3DPUA 1XWIA 1T91A 5FL7A 1P75A 5SZKB 1G16A 2FSHA 1BMFA 4A82A 1Z28A 3HR7A 5TMPA 5J4YA 5IDVA 3QKUA 2BBSA 1GG2A 4KYUA 4AIIA 4C0BA 3A4LA 3CWZA 1BMFD 2ZRDA 1EG7A 2JLRA 4ARZB 2CHVA 4Q4LA 3WMFA 4CEHB 2NO7A 3DM9B 4CEIA 721PA 2JGNA 3KXIA 4TMXA 4XH9B 3SJCA 3QXJA 1S8FA 3PUZA 4ZDIA 2ZE5A 4NCHA 4LZZA 5EUMA 4MUAA 3FMOB 4TLAA 5EE0A 2BMFA 1N3BA 1G8FA 3CB4A 3SN6A 1RE0A 3NDPA 5FTMA 1JR6A 5G40A 1T4GA 4LYJA 4WVFA 4RVCA 1KNQA 2W6IA 2G77B 2KJQA 2P6NA 1CULC 4OJQA 4ITRC 1XU4A 1VTKA 1M8PA 3SFZA 3EIHA 1E2IA 1ELOA 2CL0X 3P20A 4MRNA 2GVZC 3CZPA 3C5CA 3Q9LA 2FN4A 4Q1AA 3SFVA 4EPTA 1RPZA 3B1ZA 4IFEA 4MKFA 2IWRA 1TU4A 2J7PA 1ZIPA 2YINC 3BB4A 3DZDA 4HYYA 5L3RA 1V43A 2X8AA 1XZQA 1YR9A 2P0EA 3C16C 4ZI3A 4OQLA 3SOPA 1UBGA 2BKUA 2QGZA 2P67A 2OESA 1GKYA 3WXMA 5J4KA 1TF5A 2ZRPA 1G7TA 3EIEA 4AYXA 1FNNA 1S9HA 3K09C 4QXAA 3PEVA 5DGXA 3FPAA 1U2RA 3GLHB 4XWOA 4GMDA 2WV9A 1E94E 1OV4A 3EW9A 4HB4A 4MITA 4YC7A 2AHOA 4Z8XA 3T35A 5K8IA 2KBFA 1TADA 3I1FA 1US8B 1G5PA 4D4LA 2O8FB 2AWOA 3KKNA 4HAXA 2DR3A 3W3AA 1RKBA 3CWQA 2GEUA 3F3YA 4MYCA 1W49A 3DEFA 3BH7A 3QXSA 3OZXA 4K8OA 2RGEA 4RCZA 1G17A 2A30A 2HJGA 1XEWX 2BJWA 2QAJA 2XOKD 3PFIA 4JL8A 5EXSA 5FOSA 2G0NA 4EQ6A 2FWRA 4MYUA 2BCJQ 1WDTA 1E99A 1W0KA 2AL7A 1I2DA 4PHHA 2JAQA 1NNEA 3O8BA 3S1AB 5AUOB 3KL4A 1E9RA 3L43A 2J3EA 3I5XA 1HQYE 2PX3A 3EXAA 3HP1A 1RRCA 4DC9A 2J0VA 4PQYA 2J1LA 4QHTA 2QBYA 3K70B 4EFMA 2V7QD 2ZUCA 1A7JA 2FFHA 2WMOB 4A1FA 4QHSA 3AVUA 2QE7A 4IOMA 5EE9A 1DAEA 2QENA 1L7VC 4RZXA 2H92A 5A5GA 3BBPA 1YVDA 3ZD6A 1VG8A 4Z1MD 5LD2B 4DCNA 4P3YA 2PH1A 4LV6A 4Q66C 2C9YA 1KJYA 1YJ5A 1NG1A 5LDDC 4CT4B 3GJ3A 2F1HA 4DLXA 2P3SA 4M9QA 3EZ2A 4HLQB 1Z6GA 1WF3A 1BO6A 1YZNA 1L4UA 2GRJA 4O2LA 3LVQE 4PC7A 2OXCA 2XITA 2H17A 3FHTA 1UEJA 4PPQA 2D62A 4POAA 5H1YA 3UK6A 2BM1A 4A0RA 5EXXA 5JRJA 1JAIA 4TSFA 2VH5R 4GT1A 4Q7LA 3U7EB 1QHHB 2ZPTX 1G19A 2EQBA 1P7CA 3TK1A 4P32A 4NCKA 2OCBA 3KUDA 4IXMA 5FPSA 4DXAA 2I1QA 4IW3B 1QVRA 1RJ9B 2GK6A 5K8LA 2HCBA 2ZJOA 1Z0AA 1Q3HA 3PV0A 2DHRA 3I4LA 4ZV4A 4OI0A 4OHVA 4FCWA 4KHZA 3B13B 2REOA 2PJRA 2RGAA 5L8VA 1DAFA 1LNZA 4E22A 4C2UA 4KLNA 4V0NA 1FL9A 1YR8A 2WJYA 4L16A 3GLIE 4QNRA 1YRBA 1TQ6A 1N0VC 3LBNA 3QXXA 1BOFA 2IYLD 3GP8A 4CEJA 4D25A 5CM8B 2OBMA 4QJ3A 2AWNA 1XFAA 4B3GA 1JR3E 2OXRA 3P1JA 4G5QA 4Q47A 3LD9A 1W4RA 3QKSB 5DYIA 5JWOA 2ZRIA 2YKGA 1GITA 2F1JA 1NMXA 1DG3A 2OBLA 3FYHA 3K0EA 3W5IA 1OYYA 5FH9A 2E1RA 2A9KA 2QNRA 1KSHA 1ZD8A 2ZYUX 1IY1A 1OHHA 2O8BB 4NYJR 3DZ8A 2F43B 1XEWY 3PJRA 2BMDA 3ZVLA 4G1UC 4TYWA 3Q5EA 1U0LA 3QF4A 1OKKD 2WVJA 1W47A 2JDID 3U3JA 5KSYA 4OQMA 2MSEB 1ZM2A 3GMTA 4G01B 6Q21A 4AI6A 2WWXA 4YONB 2RMKA 3G0HA 1GKIA 1W0JA 1W1WA 4HUQA 1R0XA 5FBLB 1VCOA 2IXFA 4A0HA 4BFTA 1IXZA 2CHGA 5EE5B 621PA 5JFGA 2NO1A 1D8TA 3R9IA 3QVUA 4HDQB 4Q4HB 5JSZB 1VCMA 2I4IA 2RHDA 1GRQA 1XDBA 4B34A 5F9FA 2CNWD 1GNPA 2FMXA 4HZUA 1KI1A 2OHFA 3B78A 3MWJA 3BFVA 5KUTA 3IQXA 4M8NE 2QPAA 3B2EA 4BPBA 5CB6A 4CRWB 1AA9A 3T12A 4LHVA 1QVAA 2FJUA 1OFTA 1KSJA 1CR4A 1JALA 3TVTA 4DLUA 3RSLA 3FHCB 1C4OA 5E7IA 5CIQA 4B3CA 4B76A 1GDDA 3I32A 4LOAA 1KSGA 2KWIA 2QP3A 4JYBA 2ZSFA 2QUZA 1DVRA 2OV2A 1IBRA 1TQ2A 2OT3B 1DG1G 2X19A 2FPMA 1SKYB 5HKKA 2WSSA 2NPIA 2ZJ5A 4P4TA 4BFVA 4DEYA 4TN1A 2IXGA 1E0AA 4UNQA 2VHUA 1P3JA 1G3UA 3RRZA 4V0OA 4J0QA 1E79D 4Q00A 1ZAKA 5KPJA 2W58A 3K9NA 1LS6A 2MSDB 4JVNA 2CJWA 3LRPA 2XZPA 3THXB 3FMFA 4L9SA 4V0MA 2DCUA 4R2IA 4R2HA 3CPEA 821PA 2HXSA 1YRAA 4L8GA 5FFMA 5KSOA 2BHRA 1SXJA 1E6CA 1X8JA 1ZU5A 2WWWA 3K9LA 3NEYA 1OH7A 3SQWA 4Q21A 3TMKA 4NTZA 2OEPA 1N2CE 1MT0A 1CR1A 4RY2A 3O8RA 3C7KA 2VF7A 4F92B 3GEHA 1F2UA 1NY6A 1SVSA 2ZANA 3E5HA 1C9KA 5GJCA 1VG1A 2V54A 3VAAA 1J99A 3TLXA 5EE3A 3CKLA 2R6FA 3ZVRA 3V4RA 3MWYW 1Y3AA 2DBYA 1ZC4A 2ZI5A 2D3WA 3SYKA 1V5WA 5EP2A 1GM5A 3IHWA 5J5CA 1XP8A 2PJZA 1RYHA 4BZQA 1COWA 4D80A 3LFUA 3CNOA 4JKIA 5F98A 2Q3HA 2IYYA 2VO1A 2NZJA 1UDXA 3K0CA 2ZSDA 1H65A 1IHUA 3EG5A 5CJPA 3EAQA 4TLBA 4Q01A 3D3QA 4X8OA 4IDHA 5IK2A 4ZI2A 3MD0A 4EPVA 4XVUA 5GVSA 2Z4SA 2W83A 5CITA 1GFIA 4A15A 4NYJQ 1G8GA 3A36A 4DSTA 1CXZA 3ZJYA 3KB2A 1A4RA 4M4SA 4PFSA 2HLDD 3DKVA 1Q1QA 3DM5A 1KI2A 3E2IA 4TQUS 2ZVPX 5BW8A 2O8BA 5KOYA 4QFMA 5JI3E 5BQ5A 4IEEA 4Z54A 1EFRD 2UKDA 3DMNA 2ZS9A 3BORA 4HB3A 1FMJA 2IWHA 5IT5A 4URUR 1HYQA 4ZCMA 1XMSA 5JHHB 3MAAC 2G6BA 1NF3A 2HF8A 1Z0JA 1AGPA 1AQUA 2IYQA 4C2TA 1FOEB 2IEZA 3N70A 5KU1A 1G8YA 5A0FA 4B3DA 3W6NA 3U44B 1GRRA 2OO7A 3MLEA 3JVUA 3L0SA 1DAGA 2QPTA 4Q4HA 5JSZA 1IJEA 3PUWA 1YZUA 1TEXA 1JPJA 4WXRA 3V00A 1Z07A 2ANBA 1NVVR 5B58C 4JZKA 1XTKA 3DOEA 2P6RA 1Z83A 3KKMA 2VEDA 4FINA 1UM8A 4OQXA 3FKSD 1D5CA 3B1YA 1GIAA 5L3QA 2D7CA 2X2EA 2YC4C 3S1AA 2NQ2C 2QGNA 4OK6A 1ZNWA 1W4BA 2V9PA 1GSIA 3P27A 3FKQA 4I99A 2ZAOA 4D0LB 2WOJA 3U7HB 1RJ9A 2FDCA 3D7MA 2O5VA 2ZEJA 5KYKA 1COWD 1Q1BA 5KSZA 5AUPB 3GJ5A 3LV8A 4JBWA 4LRWA 1P9WA 4Q4AB 1GKUB 4C0JA 3GLGE 1JPNA 4NYIR 1IXRC 5IK2D 2YOGA 4M9SA 2O52A 2KBEA 1P2TA 3G82C 3R7WA 3AVXA 1IXSB 4B47A 2IUUA 3F0TA 5FOWA 1XPUA 2GBLA 5G53C 3KZ1E 2XTMA 5TY0A 2B8WA 1X86B 3AVVA 2NMVA 1UKVY 3AM1A 3EC2A 4UJ5A 1S3GA 2ZE8A 2ANCA 3RS0A 2G0TA 2IK8A 1HE8B 3LXRA 4FCTA 4DUGD 1E3MA 2YNMA 3K0SA 2ZRFA 2P6UA 2G3YA 2VBCA 3MWKA 4RFSB 3LDAA 3A1SA 1A82A 5E4FA 3NTUA 4JLDA 4Q1DA 4ZIRA 3SS8A 3WNDA 1E9DA 2ZJZA 4B35A 4MH0R 1U81A 2J0SA 4DIDA 1WBBA 1NIPA 2MSCB 2IYUA 4Y0AA 8OHMA 4B3BA 1G8PA 4FMBB 2D2FA 3H1TA 3GFOA 4OI4A 3B1WA 3QPUA 1KKLA 3Q5DA 2WSSD 1US8A 2CMKA 1QHSA 4UNRA 2CL6X 2I1VB 1CKEA 2TMKA 1C1YA 2ONJA 4BFXA 2WHXA 4KODA 3TIFA 4BLOA 4NCNA 2EU8A 3K9GA 4H1UA 2VL7A 3BFKA 5DE3A 3OAAA 1W36B 1N0UA 3QVVA 4RFVA 3TSZA 4CEJB 2YHSA 1KNXA 4NCJA 1N5IA 2ZJBA 3L8ZA 4XWKA 4D82A 2ZUBA 4QC2A 1HTWA 2QM7A 2V1XA 3PUVA 2B8TA 5AJZA 3TUIC 1VHLA 1MO6A 1KOFA 3AUYA 4JSYA 2ZYWX 1E98A 1ODFA 1PJRA 1QRAA 2CHQA 2ODNA 1Q3TA 2IHYA 3NG1A 5DHAA 5EP4A 2VTKA 4BLSA 1T3LA 4XOIA 2OFOA 4TWZA 1PUJA 4G5RA 5HPYB 2J5XA 3RYTC 2DB3A 1OXUA 1GWNA 4HLCA 1AS3A 1R0ZA 3CF2A 4TT3D 1GZSA 5FTKA 3SC3A 3SBEA 1IN8A 1Z5ZA 3AVOA 3BH6A 3K70C 5J40A 1HE1C 4IRUB 2GNOA 4NBSA 4II7A 2J87A 5JJIA 5CIWA 3BD9A 4FWTA 3TR0A 3RVBA 5KNDA 4IVQA 3N5CA 1CRQA 5DYGA 1DAHA 4UNSA 5HTKA 3QF7A 3UMSA 5G3YA 4PR0A 3ZYCA 3B60A 4JLVA 4LC0A 5DI9A 4WZ6A 4PHGA 4CF7A 2VF8A 4URWR 4CGZA 1CU1A 2PLFA 3IGFA 1SHZA 4YXWA 3FTQA 4Z51A 2CLSA 5HZHA 2AX4A 3RHFA 3ND8A 1W7AA 2RGCA 3ASYA 5EQTA 4YXWD 2WJVA 5BN5A 3CBQA 1QDEA 2O0KA 4XVQA 1S1MA 3QY0A 4OI1A 4UXJA 4JLMA 2XZLA 3UWOA 1EGAA 3U7FB 2UZIR 1U8YA 4IHQA 2UVQA 1M7HA 1G3MA 3QI2A 2ZS8A 5CDFE 2R6AA 3CX6A 3IO5A 1OXVA 3NHBA 1E32A 5FBRB 4DEXA 5KDDA 3NDBB 1Q1EA 3OAAD 2ZITA 4GMXA 5JI2E 2OLKA 1G3IA 1G18A 3F5FA 4HI0E 4DWJA 3HDTA 4OKSA 4PPGA 1T5IA 5CYOA 3AF2A 5HCIA 4BLPA 1SULA 1OH6A 3D8BA 3PCRB 3QPVA 1X3SA 2UZ3A 3K0FA 2W6JD 4AG5A 3LW8A 2GAAA 3C8UA 2D2EA 1N6HA 4A0FA 1JQLB 5L3SB 1R10A 2BIFA 2ZYVX 2ATXA 4HB2A 2YWHA 5EXPA 5EZ6B 1KKMA 1IQPA 1E4YA 2ZRHA 2QMOA 4EJSC 4ACBA 2V55B 4TQAA 5FPKA 5JEDA 3VHXA 3ASZA 2ZJ2A 4RKEA 4A8JC 4B32A 1LV7A 2ORVA 1CJUC 4LHXA 2WJGA 1FQJA 4BRWA 2O8CA 5BYJA 1NSFA 4LJ5A 4U7DA 5FUXA 3EASA 3I61A 3GEEA 2FFBA 1DTSA 4UKDA 1KO7A 2ZAMA 4Q9HA 1G8HA 1NLYA 3UPUA 1M2OB 3T34A 3VMFA 1LW7A 3SI7A 1SKQA 3A4NA 2GF0A 4D26A 2A5YB 3P4YA 1AS2A 4YDHB 1QHYA 3RABA 1XXHB 3EPKA 3NEJA 4HDOB 4LX0A 1P9NA 4HLUA 4I1VA 4O25A 4QOSA 5JWRA 1SHKA 4GI7A 2C98A 4PHTA 2XZOA 1KJWA 5L3QB 1II8B 5H68A 3THWB 1XD2B 4PO1A 2F1IA 2W00A 1D2MA 1NMZA 2Z4RA 4E09A 4F4CA 1MR3F 4MRVA 4TQ9A 4LSGA 3A37A 2PCLA 4IOLA 1BYUA 1A5TA 2R44A 3OIVA 4M1TA 1Z29A 2IUTA 2YZ2A 1XPOA 4QM6A 1LVGA 2YC2C 3GLGA 2FNAA 3EZ6A 4PZYA 1NY5A 3PUYA 2JLVA 3BRWD 2D4HA 4N0DA 4PC6A 4HLDA 3ICEA 4KO8A 4IFBA 2GJKA 2ZJ8A 2Q9AA 4MKGA 3AF4A 3L8YA 2ZU0C 3QKRB 3TUJC 3IIKA 2VHCA 1GAJA 4V0ME 5DH9A 3LNCA 5FL7D 5CLQA 1IJFA 1S1CA 4BFUA 4EJSB 4HAWA 1ZNXA 3AP3A 1ZC3A 3K0AB 4ZCIA 2GXSA 2X2FA 1XD9A 4I1UA 3X1DA 3BB3A 3OE7A 1YR7A 4QL3A 1XTRA 3PXGA 1E2GA 2FPLA 5C4MA 1KAOA 1Q0UA 1W2GA 4QGHA 1GP2A 1EFCA 2RGGA 5IF9A 1RZ3A 3IPXA 5GADl 2R62A 1R7RA 2A5DA 5GJWC 2CL7X 3X1YA 5J4HA 5KO2A 3B1VA 2CEAA 2OZEA 2JJ1A 4DIEA 5C1BA 3WRXC 4NONA 1F2UB 1J8YF 2XXAA 3NBYC 1CIPA 3ZS8A 3TW4A 4KV9A 1NLZA 1E0KA 1NKSA 3BC1A 1XJQA 2RKOA 1OT3A 1W0JD 2ZRCA 4IOJA 4O3MA 2WTUA 4DDTA 5KHOC 2IL1A 1S96A 3SE0A 2BOVA 3QIAA 2GAOA 1DS6A 1SVOA 3K9HA 3KQUA 1N25A 1UKYA 1QBKC 1VYVA 1XTSA 2P5SA 3BERA 4BZPA 4PTLA 3Q85A 4FN5A 2HEIA 3NH9A 2W2XA 4LBYA 1EX6A 1YKSA 4NKRA 2ZJYA 3W90A 4B3XA 1E2EA 2XGJA 2BJVA 1I4DD 3T61A 2V6JA 3OFND 1G3QA 2QAGA 3O47A 4KAXA 4C30A 4C0QC 4BECA 1N6OA 2DFLA 4IKEA 3QNUA 3RSOA 3MJRA 4KU4A 4KVGA 3T15A 3WP1B 2DFKB 2QI9C 3BK7A 3AGQA 1QHNA 4GNKA 3GJ0A 3HJNA 1WB9A 3ZZ0A 4OL0A 1OF1A 1LFDB 2VSOA 3EX7C 1PZNA 4IVRA 4FD2A 5DN6A 2YOFA 3ZH9B 5E95A 1N6RA 2ZI6A 3PENA 1JXOA 1OB5A 1AS0A 4PPNA 1RRGA 1ZUNB 3K53A 4OYHA 1VHTA 3WP0A 5A4JA 5HKKD 1I2MA 1E1QA 3TSWA 3QPWA 1HEIA 3THYA 2JIZA 1PLLA 3OHMA 1W4CA 2F55A 2GEVA 4PSKA 1XF9A 5FPTA 2AD5A 5DI3A 2PT7A 3MGCA 4GP7A 4RZUA 1NKTA 1WMSA 2C03A 3E1SA 1R0YA 2Q21A 2GXUA 2XNSA 4A36A 1FNMA 1K5GA 3B85A 1KZGB 2FG5A 3R9WA 1RW4A 1EESA 1FQKA 1R5NA 2EFDB 4LY6A 5JCZA 3OEHD 3PG5A 3ZD7A 3TR5A 1U94A 5ELXA 2OLJA 4E07A 4N0EA 4GDFA 1NN0A 1JEEA 3RRMA 3AF1A 2C77A 1G20E 3F8TA 1F2TA 2ASEA 1O87A 5CDFA 3X1WA 2AXPA 3I72A 3TNFA 2WSMA 4D81A 5AWFC 521PA 1DOAA 1JQJC 3QENA 2K5UA 1FTSA 3C15C 3IPYA 2F43A 2C95A 2JJ1D 1KI6B 2WJHA 1R5BA 1E2MA 1OXXK 1TF7A 3CPJB 3HPRA 3AVQA 4YMUA 1SXJD 3NH6A 2Q9BA 1II0A 2OM2A 4AKHA 4P4SA 1JJ7A 3U6BA 2JDIA 4EPXA 3BIFA 3ZVNA 2A5JA 1U90A 2L0XA 4URZR 2BMJA 3DMDA 3FB4A 3Q7QA 3WBJA 4C7OA 1Z8FA 4I1SA 4LPSA 5TV2A 3LQRA 3QEOA 4O0MA 1NVXQ 2SHKA 4IEIA 3CX8A 4KSCA 3ZLJA 3QG5A 2H18A 2WMNB 5KDOA 2V4ZA 5FR2A 4LJYA 2GILA 2N42A 2ZU6A 2AK2A 4CW7A 1BS1A 2R6GA 3G5UA 1KI4A 3WMGA 5F3WB 1X8LA 2Z5FA 3RAPR 4OJKA 2QROA 1TL7C 4GSYA 3QBTA 4B71A 3KXKA 1QHHA 2BKEA 4PO9A 5E3HA 1R8SA 3VX4A 5LPNA 4NP6A 4EUNA 2OSBA 4MGKR 5C2JB 1SVLA 3TUZC 3U60B 2QBYB 3V4FA 4DZZA 1XXHE 1P2SA 1UF9A 4JMPA 1D2EA 1NMYA 1QHGA 3CRW1 4IVPA 4A92A 1KTVA 2REXB 1J8MF 1FX0B 3HYTA 1OIXA 3UXMA 4F38A 3B9PA 4AC9A 2WWHA 5DLQC 1YZGA 2IF2A 2Z0MA 4Q02A 1ZM7A 4DT1B 1G4UR 1IONA 1E79A 3I92A 4L5BA 1SVKA 1WE2A 3LO5A 1OPXA 3OIUA 3ND9A 4I81A 4Q48A 1A2KC 2AXNA 1KHTA 4LCBA 2QAGB 3CLVA 4M1OA 4JL6A 4M1WA 5EUQB 4M0LA 1T3SA 2GF9A 2JLUA 2B7BA 2JJ2A 5K8TA 1IOZA 2ZI3A 1DO0A 3PEYA 3K0CC 1OKKA 4WIAA 4Q9IA 5JMTA 2JLQA 5L3SA 4D2IA 1X8KA 4AKEA 1VCNA 2QZ4A 2CE7A 2CK3D 4FXPA 1E2PA 3UG7A 1E9EA 1OHHD 1KGDA 1ZNYA 2BCGY 1ZMXA 3CM0A 1WQ1R 5JJLA 2JJ8A 2CK3A 3IBYA 4TYQA 1S4QA 4OHZA 1FMLA 4XTRA 1CTQA 2IYRA 4M9XA 1TQDA 4CYMA 1TX4B 3SQXA 1FPMA 4DBLC 2WAYA 2ZR9A 2VP2A 2EWWA 4LDJA 4Q19A 1G21E 4EPWA 3RS2A 1XJ0A 2CCKA 3T5GA 4JLKA 1E9AA 2GK7A 1Z08A 3QKTA 4DKXA 4Q1EA 1Z6TA 1MABB 4LBZA 1ONBA 3VKGA 2OCAA 5KDLA 2C9OA 3M6AA 2AFHE 4MKHA 2ZI7A 2FZLA 2RHMA 2ZVQX 3GJ6A 4JLBA 4Q7JB 5FOTA 2IS4A 4Q7MB 3VR1A 4ON9A 4DDVA 2QMUA 1TUEA 4K46A 2C8VA 4RD0A 3U3MA 2O8EA 1IN4A 5J4LA 1YHNA 3U6KA 2IS2A 1ZUHA 1Q44A 3KFVA 3B7GA 4Z8YA 4C0AC 5BXQC 1OB2A 5TXGA 3AQ4A 2QSZA 1UBEA 2BM0A 3KJGA 4H9GA 5BN3A 3FMIA 1F5NA 2J7KA 3BGWA 3UIEA 2QA5A 1CS4C 1GL6A 1W0KD 4NYMQ 4P4SB
chains in the Genus database with same CATH superfamily
2HD4A 1EK6A 1R6VA 1T15A 4DADA 4D8UA 1ZW1A 4PQFA 2WD9A 1KYTA 2BRUC 4JI7B 3AW8A 2J4FA 2ZJAA 1DUVG 4AD8A 1NV8A 1PJZA 1AK1A 2YBDA 3TIIA 1PJ2A 1P0PA 3EEYA 3E3NA 3GPDG 3N74A 1S89A 4K6KA 5GVRA 4DS3A 4U2BA 3CF6R 5JAMA 1T2DA 2V7UA 3AF0A 2JLBA 1AKTA 2JA1A 3LBIA 1SIOA 3GFTA 4LGMA 4HUTA 2H48A 1RIIA 5JYDA 1QIFA 4ASUD 5H16A 4E2XA 1ES9A 1I6MA 2Z6AA 1XTIA 2H5IA 4JR2A 4LRTB 4CT0A 3L7AA 5BPFA 2HIGA 2NU6B 2QYOA 3P9XA 1VRCA 4NMMA 4PG7A 4GRAA 3LT0A 3UT6A 3STTA 4HLUC 1I7PA 1VL0A 2NOAA 3DCYA 2OE2A 1JQAA 4AJNA 4F6RA 2ZXFA 1FVXA 1NBIA 2Q1TA 1D3AA 2V7QA 1Z17A 4QG3A 2EX4A 1C1XB 4X44A 2OY0A 4OSEA 5LP6F 2BLNA 3AR3A 3HU1A 4CN9A 3U7GA 3WKBA 3DO6A 2HHJA 5I7WA 3HJHA 3DUWA 1Z2PX 2YJ4A 2FYTA 2QSYA 4ZDKA 2Q3DA 1BMTA 1LDNA 3O8LA 4M3NA 2FMHA 4IQ8A 3JYNA 1JLKA 4IDGA 4WXMA 5BUQA 1G60A 2PIAA 4IIXA 4YREA 2WJIA 5IMBA 4B31A 1U0BB 1MZPA 1J8QA 1LBSA 2PHZA 3MWDB 2PRKA 3BREA 4QRIA 2QZZA 4EUFA 4RTMA 4BVHA 2AZ4A 2O07A 2HWKA 3QY9A 1LBQA 1HDYA 4ROTA 4QJBA 4URYR 3K1JA 4PBSA 2WKPA 1DLJA 4IFTA 2Y71A 3I12A 3RK1A 4BNHA 1IZ9A 2Q9CA 4WOJA 4EZBA 1G6KA 1PV4A 3KE8A 4ZVQA 1Q50A 1A0OA 1OZHA 3RNLA 4ZU1X 1RYBA 4D4MA 3FGOA 1E64A 1EVYA 4M88A 3RR2A 3HI6A 3GD5A 3GFPA 4PYLA 4ENVA 1HE5A 2ZRLA 3CUUA 4NOLA 4UTOA 4B80A 1ID8A 1KDTA 1XLTC 1TNDA 1L7DA 2QJOA 2A2ZA 1HDZA 4NMLA 1ZCAA 5LXTF 5FTNA 4DCGA 2YHAA 3H2BA 4RESA 5IM4A 3UBTA 2VYCA 2R6HA 2FOIA 3LXXA 4NOJA 2GN8A 3ABSB 1Y4DE 4CQMB 4OLAA 1IFXA 1E58A 1F2DA 2R7LA 3GJ8A 3H05A 2JASA 3PC7A 2CMDA 3C7CB 4WZAE 3ZVMA 2EYUA 1CZKA 3VC2A 2PUDA 1KGSA 1P9RA 1J7KA 2HCRA 2PX8A 4ZIRA 3CX7A 2ZR8A 2Q8NA 1KY3A 3AP2A 1PO7A 3BXGA 1CY2A 3HY6A 2O9JA 4DMHA 1U9IA 1UKEA 4OD0A 4YRBA 5ALRA 3UUFA 3Q7TA 3K0KA 2YX1A 4EG0A 4LYAA 4CDGA 3VR5A 2ZYTX 1OFVA 4HRVA 4I1PA 2PUAA 3KV1A 1PWZA 2VJBA 2PSJA 2Y8EA 4RSHA 2ZUWA 3E9QA 1E96A 2JZNA 4NG5A 5DOZA 1MX3A 4KI0A 1UOOA 1YAJA 3L82B 5LBUA 3HVJA 3DKPA 3EAFA 4EY5A 1BX0A 2IEAA 2JJ2D 3Q41A 2B6NA 4D8WA 2VYND 4PEVA 1P61B 3IP3A 1KK3A 2ZRQA 5GJVC 5GP1A 2OXFA 3C5HA 1T1JA 3B7WA 4MJXA 3RANA 1EIWA 5JS1A 1U2DA 1YJQA 1YU9A 2VNSA 2JFZA 5TE9A 2PSDA 4LE1A 4QVGA 4IZ6A 3F7TA 4O08A 1AUOA 1B6SA 4R7ZA 4C78A 5KYXB 1TW3A 1J6UA 3DDCA 5EP3A 5F4BA 1VECA 1JTVA 3WIOA 5HG0A 1YSCA 3CUEF 3RT7A 4PGAA 2DH6A 4X54A 1ZLYA 1KAHA 4BPRA 3CJTA 4IGEA 3DC7A 5KSPA 1LSJA 2IBMA 1XMPA 1M66A 1POWA 4OYYA 5AP9A 5COBA 2Q50A 4M76B 3B7PA 3JAKA 4Y2GA 2ZBQA 4ZV7A 2PBFA 1YR6A 2P9QA 2P9FA 4BV3A 5U4XA 1N7HA 1LD3A 3R3SA 4AMUA 3ZZ1A 3W77A 4XEHA 1LY1A 1LDMA 1R2QA 3I73A 3ZXUB 2X3UA 2GJ8A 3BWDD 3GUYA 3L6UA 5JAIA 1WDLA 1KEUA 3OLXA 2IYZA 2IUEA 2D2IA 2GZHA 3FBTA 4MA4A 4Q3OA 2QTBA 4ZPJA 1SFRA 3HA3A 4JN6B 3SMQA 1LUAA 2OBFA 3D6NB 5P21A 1SU7A 1QX4A 2IV7A 3SSAA 2RHHA 5JS7A 4M1ZA 2RONA 1JN0A 4PO8A 5KOIA 1I5RA 1PT6A 2OGZA 4KJXA 2QX6A 1ZGBA 4QHYA 1ZG3A 3GCDA 4W5WA 3OLWA 1ZM4A 4DA4A 2A1TR 2CZCA 2VDWA 1HDCA 2O5RA 1NYQA 8LDHA 3QITA 2B3DA 3ZTTA 4LDNA 4US2R 5K3FA 3COWA 4DA6A 4WD3A 1CPYA 4BLTA 3TSOA 4M99A 3ZWWA 4ZQBA 1NN1A 3BH0A 1ADCA 3L0DA 1LDGA 4QELA 3EISA 3NHAA 4AL4A 1HY3A 1BCRB 2XZTA 3PR1A 4JKOA 3SX4A 2QQGA 1NBEA 3A6LA 3RAEC 1LCIA 5JNTA 3F9CA 3KAKA 3CPHA 4PZLA 4UHDA 2Q49A 2X7XA 2R7KA 2FEWB 4NPCA 2QJFA 4YP5A 4PX2A 1T6YA 4JDUA 5TGDA 2IS1A 2IUYA 2Q3CA 2XV1A 3FE2A 3LVBA 3TE7A 1MABA 1P5HA 2X58A 2OG2A 2DFTA 2DFNA 4GPTA 4PFJA 1J1ZA 1VDZA 3EXHA 2AN5A 5GOTA 3T7DA 1M6WA 2I2AA 3R9KA 3ABIA 5K0NA 2QT0A 4O3FA 1HNNA 1KPGA 1L2TA 2GBGA 2M2IA 1OX4A 2G4VA 2VRWA 3CW2A 3H16A 3I8SA 3OZDA 4H3KB 4LK2A 3W5AA 4UCXA 1KORA 2R7NA 1M3SA 3A26A 3BFJA 3K9FC 4EVSA 5EMKA 1TYCA 3IO3A 1ECLA 5JOQA 2VUTA 1OI3A 4PRZA 5LXTA 5IEJA 1JVNA 1D07A 1YB1A 4BRUA 1G5FA 4DCCA 4ANFA 3T3MB 1Z5VA 4YYEA 1N9ZA 4OHOA 2ZSKA 4G8JA 5AKZA 3WV4A 3QSGA 3C85A 2P35A 3IIIA 3BSFA 4UNPA 3ABQB 1X6VA 2PLAA 1TJ3A 3BWCA 1C7EA 1M6NA 4B2IA 1BJTA 3HCRA 4R41A 4XD7D 4ZO8A 3OO0A 1TCBA 3OWXA 1AKMA 5C8VA 3U80A 3H3JA 1PNVA 4E4TA 3GLFE 1PVVA 3HDHA 1YR1A 1NLUA 3EE6A 4ZRDA 3GRAA 1TPZA 5D3MB 3JQBA 4A6EA 2ABWA 2IXBA 3OZUA 1XZBA 1E9CA 3VTZA 1DTWA 1XNJA 3IDFA 2CHEA 4O2RA 4W5QA 1X70A 1DIHA 4HQLA 4KO3S 1T2EA 1UZNA 2PO5A 2WD7B 4M89A 4E3WA 4NZZA 5COQA 5D3ZA 3BWYA 4QM7A 4BNNA 2J3KA 1VZ3A 4MI6A 3WNCA 3H42B 2H1SA 2IPAB 1KYIA 2QYTA 5IYZA 2EWMA 4N48A 4Q3BA 4ZPXA 3ULKA 2PMDA 4EVRA 4H7PA 3K8QA 4MPPA 3AHEA 4AP9A 4D7AA 4KYIB 4CTOA 1QV6A 4URXR 4P80A 3QVSA 1OXSC 4JJGA 4QJ4A 1RYFA 3ANLA 4KX3A 2YVKA 5CP8A 3H6KA 1UJBA 2YYZA 3HGMA 4G86A 1PEYA 4DF3A 1G8KA 2Q9UA 3CF4A 2WTXA 4KZKA 5LBIA 3GLGB 3TBKA 5CB8A 3DB2A 3S2ZA 1QFMA 3QOYA 4DWVA 1X2BA 1Y37A 2G8NA 4QBFA 1E5TA 3R20A 2J3DA 2Z4TA 2ADOA 4FNGA 3JPYA 4KVAA 2OL4A 3ILSA 4AZ0A 4UPVA 2QG4A 3TH5A 2UZ4A 3N58A 4J03A 4ZGGA 4WA8A 1PRYA 3GGOA 4ODIA 3NIBA 3X2SA 10MHA 1WU8A 2ORIA 3DUFB 5JTUA 4QRHA 1EEHA 1QK3A 4P5DA 1Y8CA 3G59A 4NZYA 3S81A 3LPNA 5EWLB 1IZ7A 4W1SA 1VIDA 3ID6C 4FDLA 4ALNA 3CINA 3D0RA 4KXWA 3NXSA 3L8FA 4B3SB 5TQ2B 1PSWA 1BXRB 1FZQA 1I4TD 2VQSA 2GT1A 1K89A 3HNOA 4G2TA 3L7DA 4W82A 1P2BA 3I5MA 2PMEA 4HH3C 4IUYA 5KX5A 4E51A 1RWMA 1OXMA 3W8FA 2EL9A 2FR8C 2OQ2A 2ZCVA 3SEZA 3T9EA 5L45A 4AP5A 1JKMA 2XUQA 1K8RA 4CETA 1Y98A 4GSKA 3FFAA 4XJXA 1PR0A 5FYDA 2JZOA 3BD7A 1IC6A 2CLOB 2IEGA 3OUZA 1CCWA 2XOKA 3FCAA 4H59A 1HMYA 4OGKA 1OLXB 1J90A 1XJWA 5KMGA 1KP2A 1NVWQ 1XLWA 3K5IA 4IXDA 5LA6F 4DV7B 4XA8A 3I5YA 5KTYA 4Z6KA 4I50A 3T41A 2JGIA 3MT8A 4UREA 3QU5A 5GGXA 1J23A 1FFDA 4JLNA 4ER6A 2AFHB 2PTHA 1B0PA 3MPOA 3KUXA 4ZCTA 4UZSA 4Z1MA 1L5VA 2LBPA 3H5LA 4H6PA 2O50A 5DK4A 4AJJA 2C7PA 2ZROA 3KUUA 4LXIA 3WS7A 3IUJA 1OFIA 2EWVA 1XXHA 1Z88A 4K1XA 3ZCQA 1W4LA 3QV1A 3TGPA 1JEDA 1KE1A 2PBZA 1P6UA 2GCOB 2Y99A 1Y8AA 3Q1KA 3GNQA 3IUEA 3RE1A 3RTBA 3DL0A 4KP7A 5BPHA 3WADA 1XGKA 4QO7A 4TUYA 4BTLA 5BQXA 5JRZA 1EUYA 4XE5A 5HCUA 1UBMS 2FSFA 4CMEA 2R8OA 4DCMA 5ARBA 1A9QA 2WPNA 3A2MA 3KXPA 3TLKA 3OPYB 1RIFA 5HM8A 1CT9A 4KFSA 2O4CA 2V0NA 2Q5HA 3FPHA 2O8EB 7AT1A 4F3CA 3VFDA 1GPUA 4DIBA 1H93A 5IHPA 3ELBA 3UB4A 1VLHA 3IR7A 1PFGA 1KJZA 3PC3A 4TL8A 5EWMA 4DA7A 4GL2A 3VNUA 2G7ZA 3GOQA 3VR2A 2FF7A 4ID9A 3RNOA 1REQB 3CO5A 4MRSA 1DP4A 5D84A 4KMMA 4E46A 1R5OA 1U9ZA 4CR7A 4JSTA 4CF6A 5AUNB 3QSYA 5H02A 1WWKA 5JEEA 3N59A 2CJYA 1HRDA 2VYFA 4FBLA 5CLLA 4N9WA 3O4HA 4WT7A 5H7XA 4B74A 3Q2IA 3TKYA 4LJ7A 1H2EA 2XIJA 3D3JA 3A6EA 3DKRA 2ZW9A 3HMQA 5T7BA 5C3MA 4GOJA 3EF3A 1Z2DA 4FCVA 1OI7A 3VM6A 3AEZA 1DB3A 1M2HA 2VATA 3OCUA 4KXLA 3M2TA 1OWPA 5DGIA 3DSRA 2WFZA 1G2QA 1GQOA 3D8RA 4MIYA 4BEJA 4GGOA 3LCUA 4W5HA 4WOCA 1JHQA 1L7MA 4QWMA 1EP1B 4BQRA 5ED4A 3SQWA 3FNRA 5KCMA 1CY8A 4TTQA 3R8CA 1NJ2A 1CF4A 1ULSA 3BULA 3OVMA 1L4EA 1AIPA 4E5DA 1LX6A 3RBAA 3PD0A 2E48A 1P0QA 2Q8QA 3O4VA 2DGDA 3DH0A 4PW0A 1N2SA 5JNRA 5IUKC 3RO7A 2EYQA 3I5UA 4LY9A 1OFHA 3SQOA 3H9GA 4PNZA 5FQOA 1EHIA 1MH1A 3GPCA 3LH5A 2VHWA 4GU5A 4JHLA 4QDUA 5ALNA 1JR3D 3FUXA 3U3KA 2I3DA 4JJKA 4DSNA 3O3MB 4C3ZA 3PGVA 3H0KA 5A05A 1VSQA 5LMCA 2OQVA 3WLNA 3ON5A 1JAXA 2IHKA 3D4OA 1CY6A 1OBVA 2JLCA 4ZO4A 4EL0A 4AIRA 4KNVA 4XM1A 1QIGA 3DQPA 4JP2A 2FU5C 4XCVA 4XUGB 5F33A 5JDCA 4X71A 3J80A 3UK2A 2XXBA 2OAEA 3F6YA 3LL7A 1X74A 1YC2A 3L46A 1WNTA 3RFXA 3O8DA 4QPPA 4HEJA 4U2EA 4TYPA 5JE8A 1CDOA 2YVUA 3L4EA 1AMNA 1JSRA 5ELLA 5AHRA 5H82A 2FGJA 3ZE2B 2GCEA 2YY7A 1HORA 2I80A 4A6PA 3UAXA 4HF7A 5TVGA 2GMWA 3KPJA 3H9CA 1NOJA 4DLRA 5KC8A 3NHLA 4FNAA 1X19A 3AVWA 4M2LA 1P0IA 4A8JB 4DB4A 4CIDA 3BHJA 4F0JA 4B3FX 1MO4A 3HCNA 1N2OA 1J9ZA 1DO8A 5JVDF 4JX8A 4KRFA 4L4RA 3HN7A 4CE6A 5CT6A 1TMGE 3IOMA 2P2DA 2HWXA 3EVFA 1N1DA 4CIWA 5DB4A 1JDZA 4EATA 2UVPA 2OGWA 4B4DA 4RD2A 3AETA 3A4VA 1PSDA 2OO3A 1KQFA 4G5HA 2GCNA 1OVGA 3TNDA 2C96A 2V65A 3HKBB 5F35A 3G68A 4IO0A 4PG8A 3IA7A 1DINA 3PNVA 4G85A 1N3LA 3ZQ4A 3U4QA 3ZOZA 3ZWDA 4TMYA 2H1HA 1T5OA 1JSCA 3DF9A 3MS4A 4WRRA 4Q03A 1X2EA 4TL7A 4C7XA 3R1IA 2O19A 4OUKX 4OB8A 1TGYA 2OB1A 1YIAA 3V1LA 3DHWC 3GRKA 1PL8A 3IQWA 3QE0A 5HEKA 4RHEA 2WIGA 2FV8A 3T3IA 3IMFA 4HZUB 2HX1A 1MW9X 3BX1A 4FYKA 4RTQA 3GZ4A 2G7MC 4GZLA 1VCHA 5BQ3A 3S5JA 3EQ8A 4AT1A 2G88A 1FDTA 4NU0A 2YV5A 9ABPA 3L7MA 4RMNA 3FPEA 4WUTA 1AA3A 1ZU4A 2O2DA 2PWPA 3PQ3A 3SZGA 2Q7DA 4CKCB 2YXPX 2JGKA 2PZFA 2HQ1A 1N1EA 1BRTA 1NI3A 2HBYA 3KTDA 4BXOA 1V5IA 1VI6A 2I6TA 1G59A 1KJIA 1TC2A 1WTCA 4AY6A 1Z8HA 2XAAA 16PKA 1DDGA 1VGVA 4HGNA 1OIVA 1Z37A 3IQGX 3R3ZA 2JD2A 3GFFA 3KTAB 1MW8X 2E85A 2GM3A 1AK2A 2CUNA 4BFZA 4RS3A 4DVJA 5IZ4A 3AWIA 3ZDQA 5LQJA 4NCAA 4OHBA 1U0OC 1JEJA 1Y3CE 5JT1A 2V1UA 3P26A 3S2IA 3L1KA 3IEUA 3IIMA 3A14A 3TQOA 5J47A 3ORHA 5K99A 5CFOA 2RGRA 2CZGA 5I8ZA 4IMPA 4JT4A 5LQCA 1ZO8A 3DVAA 3LQ2A 2QRJA 4CM8B 1FMFA 2YJZA 3VPHA 1SXJE 3FG9A 1T8TA 2H3EA 3F3MA 1NVVQ 1I14A 1DTWB 2GXQA 1JB9A 3E3MA 4XDGA 4I5FA 3KQLA 1V8PA 1O9HA 5HS4A 1UIMA 2I4TA 3OLZA 2WD7A 1I13A 4DRZA 5CXQA 3W5CA 3THYB 1XC7A 3VTAA 4RMGA 1GSOA 2VDNB 3H11A 1TUIA 5ICEA 1N7IA 2FZWA 1T0HB 4HAZA 4JEIA 4N8DA 5GOZA 2CF6A 3CUVA 1DO2A 4B3HA 4EQZA 4OP2A 1GTSA 1RRFA 3F4BA 5DWDA 4EF4A 2DR2A 3TQFA 1B8OA 1GXSA 1RFLA 2B61A 3C70A 3KYDB 4RBNA 1TTQB 4EA8A 1U4NA 3AUXA 4Z49A 1T9CA 2VK8A 1GCAA 1ZVQA 5KNDH 3VR4A 2NU7A 3EOAI 1IUPA 1NF8A 5A5DA 1ML4A 1P2VA 1GUAA 2XUPA 3PE4A 2MJLA 5HFJA 1MXFA 5FLKA 4P58A 1E5XA 4Y30A 1GPAA 3EWNA 4U7WA 2Q41A 4ZI7B 3EXHC 5FUMA 1YL6A 3G7NA 1PDOA 3NBXX 4FR5A 1RBMA 5K0TA 4B4VA 4WK2B 4D4KA 3ZYZA 3RS3A 4JT2A 4D8XA 3PEEA 1C0IA 4AZ0B 3VPAA 2V74B 1GYPA 1F48A 2G83A 3EXEB 3OFNA 4NCJA 4R3WA 2GDZA 4YACA 4YJHA 4OJNA 4LHWA 2R5NA 1N9GB 3LC2O 4MQBA 4XUDA 5LC1A 3Q2KA 4TRNA 2FZVA 3FYUC 2VJDA 1UPAA 4XB6B 4ZT3A 2RG7A 4YCBA 4MYTA 4DQLA 3LHIA 3PRYA 4MGZR 1FFXB 2AS0A 3ROPA 1BTOA 2P40A 2JHFA 5HIIA 4U2FA 4CM3A 2CSXA 2NO9A 3BXZA 4FWBA 2W2NA 1U1FA 3KKPA 4M9ZA 3ZZNA 3D64A 3TL3A 2BM8A 1P9OA 3FFTA 2Q7XA 2JIQA 1Z2CA 4JJZA 4W1RA 2C9BA 4BEVA 3IKJA 2B92A 5IEBA 4DL9A 2Q4EA 3EQ7A 1VXRA 1VJ0A 3N2IA 1ZA2A 2R7MA 3OCVA 4FFBA 1YB7A 4RLQA 3T9CA 3WK6A 5HX7A 3ES9A 4O4HA 2H2FA 3VISA 4YB8A 2XI4A 4Z0HO 3E1GA 3ETHA 4PLHA 1KS9A 2D1SA 1U8ZA 2ZRBA 2JBHA 2YMMA 3DHVA 4LWZA 4MMZB 3AUSA 4GXQA 1KZ9A 4O4HF 1KI7A 1BJKA 1Z6YA 2O3RA 3UCXA 3ZY5A 4ZZ1A 4TZ6A 2FWBA 2PRSA 3A8TA 4AQ7A 3NNSA 4K88A 4OGLA 1TVCA 3UENA 1EFVB 2ET6A 1LC0A 1RR6A 3FSEA 4US1R 2BSQA 4FMCB 2IIPA 3DAFA 1RNLA 3IDZA 1ZJZA 1QGYA 5IKOA 1RWOA 1BN6A 1C4WA 4O1HA 4YIKA 3E84A 5F7ZA 3UJ7A 3SEQA 1G63A 5TX7A 2VH1A 2OCYC 1LPBB 1V4NA 4RH0A 4RJLA 1QF9A 5JLJA 2ZR7A 2QQFA 1NXWA 3U3XA 4I8IA 3NYWA 3O0TA 1EVLA 2ZQ5A 4YHHB 3NGXA 1H2RS 3IHLA 3UFXB 4P0TA 4R2JA 3SVZA 2VXYA 4V02A 2W4IA 3V33A 4YASA 1X1DA 3R7DA 4DXHA 3O8NA 4YUAA 1QQBA 4L9WA 2WHPA 1ZITA 3CRZA 3KZKA 4EZIA 5EIBC 2I9KA 1VKJA 5C81A 3DE7X 3Q15C 4TL6A 2IF0A 5E6RB 1D09A 2JGLA 3C3EA 1Z16A 1JF8A 5FEMA 1LDYA 3BBLA 4Y9TA 3RVNA 3ZIAA 2QXUA 5CVVA 4NZPA 1XHEA 1C80A 2QMEA 2A0WA 2HSJA 3HBNA 3P71T 3TRHA 1VMAA 4NV1A 4W8OA 3C6MA 2XNJA 4KLAA 3E6AA 3EODA 3RYCA 2H9IA 3JX9A 4LQCA 4DB2A 1WEHA 3DW1X 4GSLA 4D57A 1ZZGA 1QPZA 2XWBF 4JI3B 2B4KA 4OJYA 4LJAA 2WPDA 4IUBS 4F7WA 3GVXA 1SCUA 4JFAA 4PAMA 4RAQA 5G1NA 4EHKA 2H0QA 3PXCX 1ULAA 1VLZA 1E8MA 2GDJA 4HP8A 4RDCA 3ZW8A 1Z0SA 4M7OA 1FUYB 1TB4A 4FFOA 2Z2ZA 1LH0A 5FJIA 4YWHA 4ZYVA 1E1RA 2AXQA 4UVGA 2HF9A 2ZRJA 1KMQA 1N6IA 1YV9A 3FMGA 2GEJA 3GN2A 2N9UA 3H2IA 5CLIA 1GQRA 2WVAA 3AM5A 3IH5A 3NAGA 3PJFA 4KYVA 4N7RA 2WWYA 1D1QA 3EGXA 3QP9A 2ID4A 3HJBA 3ZX5A 4D3DA 4YT8A 2YV4A 1JAZA 3FCYA 3LBFA 4ND2A 5D6OA 3ZZMA 2PA0A 1N5LA 1SUEA 3B3JA 4XFJA 3A1CA 3ZE7A 2GPTA 1AKQA 1J39A 1L5OA 3AXTA 3SQDA 3T1TA 1C9DB 5IVHA 2E82A 3LP5A 4RHFA 3K15A 3AL2A 3VGPA 2BFDA 4G9GA 4FX5A 1A4UA 1ZKMA 3B9QA 2R1VA 4BJHB 2BR3A 4D6PA 2V3CC 3R76A 4ND8A 3SBDA 3KQOA 1HETA 2AHRA 3BZUA 1GEEA 3Q8XB 1CR2A 4IAOA 4D9NA 1R37A 4R71A 4E94A 3L0PA 2EFEB 1MDFA 1K7SN 1Y4ZA 2GCPA 1RRPA 1OQAA 2NUBA 2WUEA 3DWFA 2HPHA 1NAHA 1HF3A 5FUYA 4AICA 1NOIA 1WKVA 3HB5X 1MC4A 4CL3A 5JS6A 1E2LA 1U9YA 4KIJA 1UWLA 1XZDA 4CODB 3G8AA 1JMVA 3R3VA 1MC5A 1YE3A 3U48A 4Y1RA 4U00A 2C3MA 4HRYA 4DY4A 2FH5B 2G1AA 2WNIA 3Q1LA 4RVFA 4ZVTA 1T25A 4HK4A 5LD2C 3EARA 3I4FA 3LHDA 3R7WB 4CMHA 2J09A 1L3BA 3KE9A 4LDAA 3QZUA 1DGQA 4WY8A 4UZEA 3AVYA 1UXHA 2I65A 4X1KB 1D03A 1KEZA 1H2XA 3NHUA 4G5SA 4YMWA 1H6DA 3I1JA 1JHXA 2ATEA 3FSRA 1XQVA 3MSXA 1T4CA 1YDFA 1NRWA 3CNNA 1VL6A 2FFAA 4TT3A 5BSHA 3W8RA 2PCJA 1AKVA 4FEYA 3DZIA 1T24A 1XQYA 3F5DA 2BP7B 2CC2A 4WW0A 3SKVA 2HJVA 2HEGA 3D31A 2DM6A 1VYUA 5EHQA 1KU0A 5TQ0B 4FE4A 1RHJA 2R1UA 4M6WA 2JFOA 1GGNA 1A8UA 3W2HA 2O3SA 5JAPA 4PINA 1AA6A 4F71A 1IEXA 3OC0A 2CVQA 2P75A 3OEYA 4EL5A 1QIHA 2WEKA 4AROA 4F11A 5I9MA 1EXWA 3RFCA 4NHOA 2I1LA 3Q3CA 1A8HA 1SK9A 3CYFA 1QUFA 1O9BA 2FOLA 2VBIA 2QVBA 1A71A 1N57A 1JUDA 2WPDD 2Z04A 3U4QB 2NP6A 5KPDA 3NWBA 2Y2UA 2ZRAA 3NU1A 5DASA 4HBZA 5ER9A 3Q11A 3WLEA 3HKCA 5AJYA 2E37A 3WV5A 4AB1A 2CLCX 3BZWA 5B2FA 1CQJB 3W2TA 2EFCB 3HU3A 4Y6SA 3EYAA 1GFSA 3CWCA 3G2LA 4Y6LA 1JQKA 4IDQA 5BV7A 5BN4B 2N47A 3EVCA 2YJ5A 2Z1DA 2XUDA 4BNVA 3CA8A 5K8CA 2UYHA 4B17A 1F7VA 4KGDA 1NE7A 4L73A 4ZVUA 2BH9A 1KQNA 3SXUA 5JMOA 1WP9A 3BWMA 4CU2A 1PFUA 4KR3A 1JDBC 2X8JA 3TX6A 4JYAB 3D3NA 1F12A 3IT1A 2JCBA 4LC9A 4MW0A 2I6XA 4F7DA 5IKPA 1KI3A 2J33A 4EO9A 3F73A 5KTKA 2I8LA 1G41A 1Y6JA 3AP1A 1YQ9A 1PGPA 3ETLA 2XKJE 4CM4B 2QLBA 3D8UA 4Y6PA 5FEUA 2FLWA 1I4EB 2FQWA 3JZAA 4O4LB 1U2DC 4P7KA 3UM9A 4C7BA 1G6HA 1JWBB 3ESDA 4AECA 5B53A 4X1YB 4DDMA 1KMHA 3GEMA 3FCUB 3V8PA 2AE1A 2AD1A 3KTAA 4LBWA 5F9HA 3G79A 3DDNA 3I6IA 1LF0A 3RU7A 2V6MA 4JI5B 1FYVA 1RZRD 3FH0A 4RA6B 1ECGA 1B2RA 1LJLA 4BVJA 4QEKA 5B1HA 3C3PA 2YWRA 1TTTA 4A6XA 1NL3A 1Q0PA 3D7NA 3NZEA 1Z6QA 6NULA 5FA5A 4I5DA 1F8FA 1G291 1H5UA 2HT6A 1T26A 3I2HA 1I1QB 4YO7A 3NHRA 3SS9X 1Y1RA 1BWRA 4UU0A 4Z9BA 3R4VA 4JJIA 2WJPA 2PGAA 2Q3FA 5FUWA 5CT9A 4TMVA 4C21A 4GRDA 5IM4F 3C2QA 3QNMA 2WZQA 1K8XB 1E1CB 3OIWA 2BFWA 4WGFA 1MQ9A 3WQRA 1LX7A 1H8HA 1NW8A 4GLOA 2IEDA 3MXTA 2WM9B 3LZCA 4IBOA 4MUEA 2PZBA 3LNTA 3RSSA 1ZEMA 1DHTA 4I1OA 1Q1ZA 1V1RB 1O95A 1V25A 2VZLA 2BI7A 3ASUA 1UPUA 3CG0A 3NONA 3PU6A 5ICFA 4EQ6B 4F3TA 4KQFA 5A6SA 5EMMA 2Q45A 1PVOA 1MD9A 3OU6A 1JILA 4R05A 2L82A 4YDQA 5JQWA 5LQNA 4PLWA 1XRMA 2P3OA 2N46A 3GWZA 4G65A 3UJAA 2WW8A 3INRA 4DLTA 3NYIA 3B82A 1YVRA 4MWCA 4PG4A 5AUQA 3TTWA 3FPBA 1DX9A 4OPMA 3U9LA 4D43A 3TJZA 3OKCA 2A8YA 4JKYA 4AJ1A 2IY8A 1Y9AA 2E18A 1M34E 2O2XA 2X5OA 4GZ3A 2GPSA 5EJEA 4I19A 2P9CA 3LWBA 2V5UA 1QGDA 1VKNA 2V4UA 3CH5A 3DE1X 4I4IA 3TZKA 4BJ5A 1KO4A 3EXEA 3CVOA 4EY6A 4Y2QA 5CVTA 2PUGA 4RIHA 4DG9A 4QGSA 1KJ9A 1HSOA 3CX3A 1I7DA 3WDMA 2JRCA 1R3UA 2YFQA 3UMBA 4DUYB 2NZ2A 1VIMA 3MW8A 3WSTA 3I8OA 3SNKA 1E5LA 2GSWA 2X76A 1LBEA 1EAYA 1F0YA 2X4IA 4G4JA 3A4MA 2BGKA 3G88A 1TD1A 1IZ8A 1YUNA 1XQWA 1LPSA 2PMBA 2XGGA 1G5IA 1R88A 2X9NA 4XLLA 4D02A 3L04A 1E2DA 5G0SA 4CKZA 1DJLA 2Q8PA 3B51X 5TARA 5CX1A 1E66A 2W6QA 1B0UA 3THRA 1DKPA 2H2DA 3G2OA 1M83A 2FSPA 1SVUA 2ZS7A 3D54D 2H2WA 4IZOA 2Q5JA 4QOIA 2O2EA 1SU4A 2GARA 2QV7A 4LI0A 1G2IA 4O1IA 2FMIA 1CBUA 4F2HA 4ZGWA 4L74A 4O2BF 4CL2A 3LY7A 5I6DA 2WP0A 4Y6QA 3L0ZA 4C20A 1QIEA 3H4TA 5E9AA 4INJA 1ZP6A 1BSVA 4ZANA 3TKLA 4QWWA 4W8HA 4YT4A 1P4GA 5F2EA 3NMUF 1E20A 4RM2A 4TRJA 1R8XA 3OICA 4MQ4A 4WKNA 3THOA 5JR3A 2WU3A 4PR3A 2OK7A 2BFFB 1Z47A 1E9SA 2RGXA 2R1TA 2XMBA 1CUGA 1DAMA 1GCIA 2WJ3A 3L7BA 3KB1A 2F3TA 2HNBA 1RP1A 3N2EA 5IPFA 1OXTA 4IMIB 4BMCA 1L1RA 5EQJB 3M6IA 2PV0A 5IAEA 1NIJA 1ZJWA 4PQEA 3P2YA 1GPH1 4AYTA 1AD2A 1ZH8A 1K3TA 1SQ0A 3ZDEA 5A04A 4OQFA 5BWMA 4ZOQI 1L3CA 4MQEB 4RD6A 4RULA 3MQFA 1Z5WA 2OAQ1 2BISA 4URFA 2FA9A 2H1WA 2IY9A 1GGVA 3D5QA 3UMCA 3VU8A 4C4OA 3T7JA 1IWPB 1H8HD 1AHPA 1W96A 1AXRA 4EHDA 1OTYA 4FKZA 4E88A 1TK3A 3ORQA 3Q7PA 3AEQB 4MVJH 4R81A 1VCIA 1FJ2A 2AYYA 3BMOA 3B1XA 2PRYA 3H9UA 1JFFB 1LTKA 1HQKA 2MSWA 2RGBA 2HK8A 3BXOA 2IH2A 1CVRA 3EEBA 4FFWA 3OJOA 3K9WA 2VA8A 5ERGB 3DDZX 3SHOA 3QVMA 3DZCA 3R23A 4WZBE 3UATA 3HRKA 1GCUA 4DTCA 1KH1A 3GA7A 5EYPB 1IYZA 1RQGA 1T9ZA 1HDGO 1BRMA 2X8BA 3EH1A 2ZYDA 2DP4E 5FI1B 5C4GB 5HDQA 4Z4QA 3N6XA 3D2CA 4MRMB 3MFQA 3E3LA 2JH8A 3QF4B 2NZ8A 5FAXA 3M6FA 1L5GB 5D3QA 3TNYA 4YP0A 4C3VA 2D2VA 5EQDA 5HGXA 3SMVA 4QBGB 1WBDA 3EZ9A 1ZGJA 3E70C 3COJA 2P2LA 2D1YA 2IFTA 2CE2X 1Z0UA 4YBZA 3FN4A 4F4DA 4UUPA 4WK4B 3E22B 4Y1FA 4BLWA 2VQDA 4O4IB 1JDPA 3ZN2A 3WA6A 5F5LA 3EZ7A 1Z74A 421PA 2CLHB 3W7VA 1AHHA 1E4OA 2F1OA 4A0QA 3BE8A 2CXPA 3M4JA 3HR7A 1PN3A 4IIUA 3IR6A 4XFKA 2OFFA 1U5CA 2AEEA 3QKUA 1J8VA 5IDVA 2O7VA 2VWGA 3D4NA 4C0BA 4FI3F 5DBFA 2BMVA 1JJAA 2ZRDA 3UMYA 4ZAGA 5B12A 3DVQX 4IGAA 1SRQA 3B89A 3CSSA 3M6VA 4BMXA 4HUJA 4CEHB 2NO7A 5F23A 2JGNA 2OHIA 5IANA 2IYAA 2X0IA 1P29A 4LRUA 2ILVA 3PUZA 2IZ6A 3OZGA 4NCHA 1KETA 4LFAB 3F7OA 4W8GA 4YROA 2GH1A 4MUMA 3RSGA 5KBYA 1VPTA 5EUMA 4MUAA 2GPWA 2IE0A 2H9AA 3VO9A 4R69A 1ZWKA 4C87A 3EVBA 3KKKA 2WKWA 1Y34E 3CLTC 4NEGA 1U04A 2QI9F 4R2KA 4JC5A 4O33A 1JIVA 5B2EA 4N0QA 4A5SA 2P6NA 2H1RA 2AG6A 2PX2A 3IAXA 4UUAA 3DOHA 2C3PA 3NI2A 1SH7A 1XU4A 2J48A 2DPHA 4G4GA 4ITRC 4NU8X 4OJQA 4CIAA 4WFIA 3IVCA 3SFZA 1DC8A 2CL0X 4UFNA 2JLAA 1ZXLA 2FN4A 3HB0A 2HIAA 4IXWA 1QAQA 3SFVA 3B1ZA 1GPKA 3VZQA 2O6HA 4MKFA 2IWRA 1TU4A 4JAVC 4K9KA 1UCFA 4Z53A 3DZDA 1SM4A 5LUBA 1KVUA 1R4NA 1B2LA 1V8BA 2X2OA 4XLZA 1BW9A 2RJ3A 3D4PA 3TMAA 1HMPA 3ZPXA 1RLTA 5D5QA 2UV8A 2QTTA 1NW9B 1KAQA 2ZIEA 4X1IB 3PQ5A 1CZRA 1O95C 2X0KA 5JSFA 3L49A 3PZBA 2Z57A 3D1LA 2GD2A 1WDWB 1Q0HA 2NUPB 3G2IA 3LUGA 1O95D 4IYJA 4E1AA 3IE0A 3M5PA 2VDPB 3GIWA 1YASA 1S9HA 1W29A 4QXAA 5DGXA 5G0VA 5I7AA 2C3YA 1ZJJA 4A03A 4DRXA 4A10A 4GQAA 4AU1A 3B52X 4NESA 1N2CA 4MITA 1OV4A 2NW6A 1NQUA 1V3VA 4YC7A 4E12A 7GPBA 2KBFA 2RBEA 3B8EA 5EPOA 3DL7A 1KY4A 5CA0A 4FYMA 5CBPA 2O8FB 3KKNA 4PYRA 1WSWA 1LV8A 3FWPA 4BQIA 4PYJA 3F3YA 3KHSA 4MYRA 4N5LA 2GYWA 2EGGA 1WXEA 2KX7A 3TCXB 4EEZA 2RGEA 4MB6A 1IG0A 4KWHA 2QAJA 4R01A 1XEWX 2CF5A 4WBXC 2G28A 5EXSA 4EI8A 5LDGA 1YRWA 1IK4A 2ZFUA 2G0NA 4YRKA 3H3XA 4JYMA 4OH1A 2GA9A 1QB8A 2LCIA 3OE5A 1RM3A 2ECOA 1XKXA 1Q19A 1ZRNA 3A9RA 4ID3A 4PHHA 4AUKA 4YRMA 3C45A 3RJ9A 5AUOB 1E9RA 3L43A 2R85A 1TUBA 3OX2A 1GFZA 4R6XA 3ZG6A 1BFKA 5LJIA 3FJYA 3EDRA 3PF8A 3OOJA 2ACKA 2WUVA 3MUOA 1SHJA 1M2FA 2J0VA 4PQYA 1BG6A 2J1LA 3M89A 4JGGA 5JCOA 3ND6A 3RVSA 1FRVA 3HDVA 4MAFA