1UBCA

Structure of reca protein
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
326
structure length
303
Chain Sequence
APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGLQARLMSQALRKMTGALNNSGTTAIFINQTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RecA
publication title Crystal Structures of Mycobacterium smegmatis RecA and Its Nucleotide Complexes
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Recombination
total genus 87
structure length 303
sequence length 326
ec nomenclature
pdb deposition date 2003-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 1ubcA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ubcA01
1E1QD 4BFZA 4BEJA 4NTZA 1J99A 1BH2A 1E9FA 1SXJC 5B30A 1L2TA 2B7BA 3HDTA 4AYXA 1MABB 4B6FA 2VP0A 3LVRE 1R5NA 2ZRMA 4KYIB 4JLBA 5L3SB 3GFOA 4ZKDA 2OE2A 5JJKA 2ZRIA 2XNSA 2NGRA 1E32A 2O8DB 3BD9A 2JJ8A 3CO5A 3A37A 3WMGA 5GJBA 3QI2A 3Q7PA 3RDPA 5D3MB 2C5LA 4L16A 1QHIA 3UWKA 3IKJA 4DSOA 3ICEA 3RRNA 2HV8A 3D3QA 2O0HA 1QVRA 3PITA 4BFWA 4PZLA 4M1TA 4DXAA 1M1YE 1VG0B 1KK0A 2IS1A 2F6RA 1G8PA 3QKUA 3REGA 4C0KA 4FCWA 2HUPA 2XTNA 1G7SA 1N0VC 4OK6A 2G9NA 3R8CA 1Z28A 4V03A 1N0UA 2QAJA 4HATA 3GPLA 4ASUD 4EDHA 1S2MA 3DOFA 1OIXA 4B3FX 3WNBA 5BN5A 3GJ0A 3BK7A 2QSYA 4NU0A 3QF4A 3ZVLA 5ANRB 4UNNA 1U81A 1MT0A 4TYYA 4MRRA 5IK2D 2NO1A 2WIBA 3KKNA 4O0MA 2YVUA 1E2KA 3O8RA 1W4BA 4Q4HA 2ZRHA 1DG3A 3TVTA 5B2ZA 4HUQB 4F7WA 1TF5A 4RFSB 3GEHA 1XCMA 3B8HA 4N0EA 2VBCA 3EX7C 4Q4JA 4PZYA 2XJ4A 4MKFA 2F1JA 2Z0MA 1KI7A 3TLXA 3WMFA 3B1WA 4FD2A 4B3DA 3AVQA 2X2EA 2DFNA 4IDQA 1CJVC 1VKJA 1V43A 4O25A 4EKDA 3NH9A 5EP3A 4CRWB 2O8CA 2GESA 5HKKD 1A2KC 1COWA 4D0LB 4F4IA 2W83A 4DCSA 4TYNA 3W6OA 2JDIA 1LV7A 2JJ2D 2ZTSA 4DCUA 4URZR 1U8AA 3RS7A 2QRNA 3A8TA 1TL7C 3GLIB 3EIEA 3M6AA 1UF9A 1AIPA 5DIFA 4A8JA 4A9AA 1JNYA 3H84A 4PC2A 4US0R 3AUYA 4F38A 3WYGA 3THXA 3WY9A 3A4NA 4IEIA 3ZH9B 5LD2C 3TH5A 1GRRA 1BMFA 1JXMA 1ZYUA 4JVMA 2ZJ5A 5E7JA 1CBUA 4DBLC 5FL7A 2ZE7A 4Q4AB 4B2IA 1OXTA 2AD1A 2NPIA 2J3EA 1NLZA 2FJUA 3NWJA 3LXRA 3PV0A 4G01B 5A5GA 5KNBA 4GFDA 1MKYA 2YOHA 4CEHB 2BIFA 3EAQA 1Z8FA 1CJKC 3MMPA 1XZPA 2PMKA 2PX0A 3DMNA 4PC3A 3T61A 5JEDA 2HT1A 2WBLC 5C1BA 4MRNA 3EWSA 2C9YA 4TTRA 2QAGA 4KLZA 4PHFA 3AKCA 1GKUB 3FFAA 3KQNA 2ZYTX 4JLNA 4XTRA 3QKSA 3BE4A 4L15A 4DLVA 1AM4D 4IOLA 1A1VA 3AP3A 2XITA 4IFBA 3SQXA 2ODEA 4HLQB 4WZ6A 1XCPA 3TSOA 1N6KA 1BKDR 2ATVA 1Q0UA 2ZSDA 4KODA 4A1FA 4CGZA 1ZM7A 3I8XA 4FW9A 1OH6A 2ZQ5A 4PSVA 2BKEA 1TMKA 4KSCA 4IW3B 2WWFA 1VIYA 1OIWA 2IF2A 5CK5A 2QZ4A 1YU9A 4I99A 4K8OA 3ZZ0A 4KVGA 4W5JA 2B21A 3EC2A 4A6PA 4ABYA 3OIWA 4DLYA 1UBGA 2JA1A 4LJYA 5K8UA 3EARA 2LKDA 1KJYA 2ZSBA 4TL9A 4V0MA 2AWNA 3R9WA 1P2VA 1KJWA 2WJVA 3BXZA 3E1SA 1R4AA 3MRSA 1OXVA 5B64A 2NO6A 1GRNA 3E70C 3R7WA 2GZAA 2ZAMA 3B82A 1AK2A 4Q9KA 2GJ8A 4R71A 2ZS8A 2WM9B 1QRAA 4NYJQ 3EPHA 1DOAA 1IN8A 4K46A 5FBVB 4HI0E 3SFVA 3IEUA 3EZ2A 3U5ZB 1GWNA 1GL9B 1KHTA 1TQ6A 3C41J 5CM8B 2DCUA 4Z1MA 3CBQA 2N46A 4MYTA 3MJRA 4QBFA 2MSDB 3K70D 4OK5A 1YQTA 4V02A 3QJYA 2G1JA 1VPLA 5DI3A 3VX4A 1RE0A 1RKBA 3W8RA 1VG8A 1MO4A 2P65A 2W2VA 1SULA 3QQ5A 2G88A 3KQKA 2O8BA 4JT2A 1WBBA 2TMKA 2HJGA 1E9SA 2Z6VA 3EA5A 1ZIPA 3TQCA 4DB4A 1N6HA 2G6BA 2ZEJA 2HYDA 4YXWD 3CF6R 4LV5B 1KIMA 4BFUA 1AGPA 3VU9A 4URVR 4V0ME 4H1VA 2Z4RA 3ADBA 4M9ZA 3ZVMA 3SI7A 4DWJA 3PXGA 1G7TA 2V55B 4Q9IA 1VHLA 1DAMA 2H7VA 5HCNA 5KNDA 3HPRA 3AGPA 1US8B 4PAMA 1W47A 1KI1A 2JLXA 1I4TD 2JLRA 2ZRPA 4U02A 3I5YA 2ZYWX 1XTSA 3TR0A 5GJWC 3AF4A 1J2JA 3RS3A 2GAAA 4HAXA 1YHNA 2B8TA 2BM0A 3LBNA 1OE0A 2V54A 4WOPA 4TQAA 3LRPA 4DDVA 3HU1A 2J87A 2J0VA 4LWZA 1S9DA 2BJWA 4HLCA 3W9YA 1ZU5A 2QEQA 5M04A 2XAUA 3PUYA 2YZ2A 4GRAA 4TSFA 4NMMA 1P2UA 4AKEA 1XDBA 4DHEA 3IHWA 1VCNA 4ZCIA 1R2QA 3RHFA 2ZJ8A 2ZR7A 2J5XA 2FFBA 2LKCA 4DLRA 3FOZA 3QXSA 2WZQA 2ODWA 1P2SA 4JL6A 4EJSB 2ZI9A 2GK6A 3K0CA 4RD1A 2G83A 3QVUA 1GL6A 1QHGA 5A0FA 4M1SA 3U7EB 2AK3A 4OI4A 1OV4A 4FMDF 4RD6A 1E1RD 1FNMA 2BHRA 3ZD7A 1SVSA 1GILA 2QM7A 4URXR 4YLGA 2IC5A 2FFHA 3OEED 2A5JA 1T0JB 3ZGXA 4CIDA 2QROA 1F48A 2GVDC 1DAEA 2QG6A 3C8UA 2FFAA 3KFXA 4YQFA 1FFHA 2V7QA 1CP2A 2WPDA 3U3RA 2REBA 1GAJA 3KTAB 1PZNA 1N5JA 1QHHB 5SZKB 5FOWA 1AZSC 1G41A 1T4GA 2BBWA 2HCJB 1MO5A 2QORA 5L3RA 2ZU0C 2ZJAA 4MKHA 1J8YF 5C2JB 1YKSA 1WP9A 2Q9CA 4LHXA 1R0ZA 2E1RA 2HCBA 3TSZA 1IHUA 2NO7A 3UMSA 2DWPA 1KKMA 3LQRA 5J4KA 1E9AA 4PC1A 4QJ3A 3QXXA 1GNQA 3T35A 2QMHA 3I92A 1R6BX 3W3ZB 2YHSA 2H5EA 1IBRA 6Q21A 4AK9A 5FBLB 1F2UA 1NVUQ 4RKEA 1QHNA 1DVRA 5JZVA 2KB0A 1OSNA 3S1AB 421PA 3AH8A 3T06B 1W48A 2IF0A 4UJ5A 3LWNA 3EPLA 3D31A 5FUYA 4EQ6A 2FF7A 1N0WA 1J8MF 3ZQ6A 5E7MA 3W8NA 4BLTA 5KDLA 4L8GA 4ARZB 5AUOB 1KMHB 4IEEA 4GP6A 4LHYA 4C2UA 1N6PA 1SXJB 5AUQA 2AX4A 3LLMA 3NBXX 3K0FA 2YINC 4V0KA 3CNNA 4Q9JA 4DUGD 4HLUA 5KDOA 1ZM3A 3PUXA 1Z5ZA 2B7CA 4MQBA 2RGNC 3FKQA 3H2YA 3AUXA 3OIYA 4EPWA 1W4CA 2ECKA 4W5HA 4AG5A 1II8A 1I2MA 2FEOA 2OCBA 2VQSA 4B3XA 3KQLA 2Q6TA 5K8IA 4G5OA 1AKYA 1GUAA 3T1TA 1S9HA 2BMFA 2W00A 1R0YA 3AKDA 1XRJA 3BOSA 1UBFA 1UDXA 3ZQJA 4GZMA 3NKVA 2FPLA 1X6VA 3KDSE 1UM8A 2H92A 1KI3A 2CCJA 1PUJA 1XPOA 1MOZA 3U3KA 1TTTA 1SKYE 1H8HA 3EIQA 2F1RA 4G5GA 4B35A 3U3JA 1GZSA 4Q47A 3RNLA 1DO0A 4XVRA 3A1UA 2NZJA 4OJKA 3PUZA 3SJAA 2GXSA 2F9LA 1A7JA 1COWD 1FTNA 1XCGB 2GXQA 2JLQA 1KO4A 2QMEA 3C15C 3EZFA 5KU1A 2BEKA 3DEFA 4ASUA 4D0GA 3FMPB 3I4LA 1QBKC 4DC9A 1ZVQA 2QMOA 4KXFB 4L5BA 2AD5A 4LBVA 5JJIA 4LHWA 2GXUA 1OB5A 4YMVA 3IHLA 1XBTA 4IKEA 3NG1A 5IK2A 5F9FA 1YZKA 3CR7A 2RGXA 2GNOA 2QGNA 1AGRA 2QTHA 4KLNA 5LPNA 3MD0A 3X2SA 4JSYA 4JLJA 1D9ZA 2WSSD 3I72A 4EUNA 5JEEA 1LF5A 3IBYA 2XJ9A 1S1MA 2VHUA 2DY1A 1ZW6A 3MWJA 5FUXA 4YDSA 2H8KA 4LJ4A 2R2AA 1JEDA 2O8EA 4RVCA 1FTSA 4Z51A 5KUTA 1S3SA 2ZS7A 2GKSA 2ZRDA 2CJWA 5CJ2A 4MYHA 3I8SA 3DZDA 3M0EA 3VHXA 1E9RA 1T9HA 1U98A 2AR7A 3B13B 3KKOA 5KO2A 3ASYA 5SZHB 2XOKD 4CF7A 1HE1C 1FNNA 2OFXA 4CEIB 5K8LA 3WRXC 2I3BA 4PPNA 3ZYCA 2QM8A 3V4RA 4TZ6A 3R9XA 5FUWA 4OQNA 5J4LA 2N1BA 2JJ2A 3LXXA 4Q7LA 1LS6A 3VFDA 1GTVA 1NJGA 1ZD1A 3L0IB 2I1VB 1OYYA 2ZI5A 3IDQA 2G3YA 3B7GA 5FUVA 4OHYA 1ZM4A 4UNPA 4V0NA 4BFXA 1RJ9A 4C7OA 5BYKA 4JIMA 3DL0A 1KI6A 4IJMA 3FDIA 5LD2B 2A5DA 3JVUA 5G53C 4QHSA 2CVFA 2VEDA 4JBXA 3FB4A 2Q21A 1A4RA 3DO6A 4I1UA 3BFVA 1K5GA 1MRSA 3U7GA 1E2DA 1UJ2A 3OIUA 3VMFA 2D62A 2QQEA 1X3SA 2QTVB 1SVKA 4CW7A 1M34E 2JLWA 1UPTA 4ZKEA 3EIHA 1P62B 1KOFA 1MABA 2IYLD 4PAOA 1E2QA 1P3JA 3UWOA 1HEIA 3CF0A 3ZLJA 2BBSA 1WDTA 2YJTD 3AF2A 5FOXA 1ZINA 5EE1A 1AJEA 3M1IA 1DARA 1H8ED 1XMSA 4RZUA 4XWAA 1G3MA 2IYQA 4II7A 2HLDD 3ZZTA 1LF0A 3KJGA 2J0QA 5E3HA 1N6IA 4AC9A 2EQBA 2VP6A 1Z6TA 2G77B 2IUTA 1XMVA 4A2WA 1E9CA 1SQ5A 1TU4A 2O52A 4BLSA 3NC1C 3HYTA 3AVYA 5K8TA 3TK1A 4AKGA 4W7SA 1G8HA 4BZQA 1CR2A 4BFVA 1W0JA 4BRWA 2QENA 5AUPB 3NHAA 3HYRA 3QXCA 4F4JA 1GDDA 1NBMA 4P31A 1AQYA 2YYZA 2YWEA 4KFRA 2CLDX 1F5NA 2QP3A 1EFUA 3DMDA 5KSYA 1NRJB 5KPDA 1W2HA 1ESNA 5JS7A 1U0LA 3Q5EA 1G21E 3H1TA 4KI0A 2B8WA 1KI8A 2KBFA 2ZI6A 4UXHA 4BPBA 5FTLA 1GKIA 4CEJB 4GDFA 4BZPA 1T0HB 3ETLA 3B1YA 3FHCB 3PUVA 1WBDA 3C5HA 1M7GA 2KJQA 4KFUA 4B44A 1OXSC 2ZUBA 4X8HA 1IN5A 3K1JA 2JCSA 3ZIAD 2ZRBA 5P21A 1X1SA 2P0EA 4FMBB 4JVSB 4M9XA 1IXSB 4DLXA 1NMXA 5CM9C 2WWHA 4FIDA 2C78A 4Q19A 3GLGB 4YDHB 4A4DA 2QBYB 1T91A 2JIZD 1L7VC 3UK6A 1SVIA 3FKSA 4TL6A 4KSBA 5HTKA 1GRQA 1WA5A 3QPWA 1TQ4A 2XZPA 3AF3A 1P4SA 4YMWA 3A1WA 3U4QB 5FPTA 3P32A 2OCAA 2RKOA 1NBME 2A3RA 3GJ8A 2IL1A 4FWIB 3LX8A 1CJUC 1G16A 2JJ1D 2LWIA 4ERNA 4WZBE 3PFIA 4YXWA 1NP6A 4GL2A 3PENA 4G3XA 1IY0A 5BYJA 2YNMA 1KNXA 3KUCA 1WXQA 3WBKA 4LK2A 1U8YA 2MSCB 5TMPA 3QSYA 3AF0A 2RAPA 1P7CA 5AJYA 5KPJA 5JFGA 2NQ2C 1XB2A 1YZLA 1E98A 5JRJA 1NVXQ 1IJFA 3AQ4A 2WPDD 3GLIA 2K5UA 3N2EA 1G64A 3HPQA 1OXXK 2V6JA 5JECA 1JEEA 4I4LA 4ZV4A 1KDOA 3GD7A 1TEXA 2XNDA 4A8JC 3IPYA 4WAUA 3BS4A 1W46A 2FE4A 3T1QA 4M2LA 3NXSA 1KTVA 4EIWA 2QPTA 2QN6A 2OBMA 3EWAA 1HTWA 2NIPA 3SNHA 4M21A 2ZYUX 4Q4AA 2V4ZA 4XD7D 4UKDA 2DFLA 1AN0A 2IS6A 2ANBA 4M4SA 3I1FA 3THWB 1UBCA 4XIGS 2H1LA 4CEHA 2W0SA 2CBZA 3AM1A 3KL4A 4W9MC 4RD4A 2IYXA 1LW7A 2DR3A 4A0RA 4XVUA 2VSOA 3SU8A 3UMRA 2QAGC 5TARA 821PA 2HXYA 3AGQA 4FWTA 2WMNB 4MUBA 4V0LA 3OEEA 4UJ3A 2BMJA 2OG2A 1ZD9A 1GG2A 2IW3A 2PT5A 1UADA 1Q1BA 1BOFA 2FZLA 3WXMA 1BYUA 3EW9A 3ZVNA 1EESA 2ZR0A 1XTIA 3GLFA 3GJ6A 5DHAA 3GJ5A 1BYIA 4D2IA 3HR8A 4HB4A 1OYWA 2IT1A 1P5ZB 1G8YA 1LS1A 4RJLA 521PA 1O3YA 3ZD6A 3CX8A 1OT3A 2YC2C 2HF9A 2EFEB 4HEJA 4IDNA 4EFMA 1N25A 1KO5A 4PSKA 4NP6A 3VX3A 3U61B 3I62A 1NN3A 1SGWA 1R0WA 3IIJA 3UATA 1MV5A 1GL7A 2R6AA 1JALA 5H68A 4BE7B 1XXHA 5H70A 5G40A 1FL9A 3RSLA 2Q9BA 1MR3F 2OV2A 4JLPA 4QNMA 4CVNA 3QNUA 2GK7A 4B3CA 2Y8EA 4EPRA 1H8HD 4P4SB 1KAGA 4Q7MB 4KBGA 1G3RA 2ONJA 5JWRA 2BMEA 2GCPA 4POAA 4M1WA 2OCYC 3A1TA 4GT1A 3FVQA 4LDJA 4TYPA 2RGAA 1Z3IX 3IGFA 4R7ZA 4WW0A 4S2EA 2VH5R 3CZQA 3GLFE 3BB3A 2IYVA 4DUGA 1XTKA 2IS4A 3X1ZA 1IQPA 5JWOA 3BC1A 3NVAA 1NY5A 1XFAA 4RD0A 2XTMA 2FU5C 2P5TB 2W2XA 3ZJYA 5KTYA 5JS8A 4HDQB 4Q1DA 4B2LA 1W36D 1DO2A 3EASA 2YV5A 1EFHA 4GOXA 2IBMA 3EZ9A 1T6NA 3BAFA 1LVGA 4BUJA 3HU3A 1PV4A 4QKQA 3TAUA 1XXHE 2ATXA 4QOSA 1MH1A 2UZ3A 2FA9A 2D7DA 2NPFA 1ZUNB 4Q00A 4US1R 5KSOA 4AURA 1US8A 3KB2A 3AVPA 3U3MA 2KE5A 2GEUA 1EWRA 1KJZA 3U2QA 1ZU4A 2A5FA 3HWSA 3UG6A 4RCYA 4XSGA 5TVKA 4TQUS 2J59A 5HZKA 2ASEA 1DAFA 2ORWA 2AHOA 3SN6A 3V00A 1ZM2A 1YZUA 2R6CA 4HAZA 3LNCA 1T3HA 2D06A 4LPKA 2CHGA 1KKLA 3SBEA 5EP2A 5CITA 2JATA 721PA 4OI2A 4Q02A 3BFXA 1DAIA 1OIVA 2CXXA 2GCNA 1IAQA 4Q21A 3VNUA 4A0FA 1QHSA 2ZRAA 1J70A 1NKTA 1D8TA 3QXHA 1E4YA 2XGJA 1UKVY 3I61A 1UEIA 5DSZA 3VAAA 2UKDA 2ZI7A 5C46F 2EVWX 4NYMQ 1CXZA 1N2CE 2GCOB 2QU8A 4HYYA 4RD2A 1XEXB 1OFTA 3K0CC 4TMVA 2WSSA 1R5BA 3TRFA 3K09A 1KI9A 4GI7A 2J45A 3MSXA 3KQHA 1NN0A 5DI9A 1U94A 3O47A 3BGWA 3MCAA 5CYPA 2RCNA 5FBRB 1G3QA 3ADKA 4LJ6A 4B2PA 1DE0A 2GILA 3H4MA 1NG9A 5J5CA 3FMOB 3NC0C 3KTAA 3ICQB 4IVPA 2G0NA 2CCGA 2X77A 5FPHA 1E2PA 1QHHA 4ACAA 4AYWA 2QP4A 4B71A 1OH7A 3BH7A 2VHQA 4GMDA 5DGXA 4AKIA 4TL7A 2P5SA 2XOKA 4NH0A 1OKKA 1ZUHA 4QJ4A 1FUUA 1IN4A 2OZEA 3FYHA 4A82A 5FI0B 1P73A 3EA0A 4IOKA 1OFHA 2F7SA 2F1HA 1FMJA 1Z6GA 4YMSA 3W6NA 3AKYA 4DKXA 2IYYA 2P6UA 2VIIA 4MYUA 1EX7A 4E22A 1H65A 5J4VA 3S1AA 3O8BA 2YOGA 4JLKA 3QY0A 3C16C 1VMAA 5FPKA 1W0JD 4EPTA 4NL4H 1KDTA 3QBTA 1NBMD 2QNRA 2PH1A 4B32A 1YVDA 3LQQA 1CR4A 4ARZA 2R65A 4L4UA 5FFMA 2X2FA 4ESVA 5LB4A 4I81A 3CWZA 1RVDA 3B85A 1XP8A 2QSZA 3CKLA 2QUZA 5IDVA 1DS6A 4PX9A 3K9GA 2WWIA 4OHZA 3QEJA 2C9CA 1E0AA 4Q18A 2H18A 4LV8B 1KK3A 2MSEB 4HLUC 1XD9A 4U7DA 4PO1A 1F2TA 1DG1G 2IXFA 1XNJA 3L43A 3E5HA 1OH5A 3IEVA 1G8GA 3LW8A 2ZS9A 2IYRA 3R9IA 3MJHA 1KNQA 1ZUIA 4NONA 1FX0B 1H8EA 2RGEA 3B9PA 2DBYA 2GJ9A 2J0SA 2HT6A 2HLDA 4RZXA 4TTPA 3ZS8A 4NYIR 4C3ZA 1XWIA 2GWHA 1M7BA 2ZVPX 3FKSD 3SFZA 1ZBDA 4E09A 1QZXA 2OBLA 2WKPA 3GP8A 2H16A 3NBFA 1Z06A 4R2HA 4XSHA 1XD2B 3AKEA 4FMDB 2VP5A 3TVDA 4AYTA 2GF9A 2ERXA 2C98A 2QMUA 4LJ7A 3VR3A 1FUKA 2JASA 4I1OA 2XX3A 2VHCA 3BFKA 1U0JA 3C5CA 3OFNA 4MYCA 5E95A 3LBIA 4FMCF 4LBWA 3VR5A 4LYHA 4XJXA 1XEWX 3OESA 3EZ7A 2BC9A 2WICA 3A1VA 1E94E 4XVQA 4DIEA 1XPUA 3PCRB 2DHRA 3ND9A 1KSGA 4I1SA 2CL6X 4QXAA 3NDPA 2WIAA 1JJ7A 4XTCS 1MO6A 5KDDA 1E69A 1HYQA 1F60A 1JPNA 1OHHD 4Z8YA 1XX6A 5G3YA 2XNDD 1L4UA 3ZIAA 4KVAA 5B58C 4YMUA 3QKTA 5JSZB 2G1KA 2BEJA 1RRGA 2J0UB 2OM2A 4W5WA 4C0AC 121PA 1IN6A 3THOA 4FXPA 2QE7A 2QPAA 3L0PA 2JIZA 2FDCA 5EXPA 1KSFX 5J40A 1ZCAA 1S1CA 1D9XA 2GJSA 2WAXA 4HDOB 1HQYE 1NSFA 5AJWA 1QDEA 4R9UC 2A7QA 2JJ1A 1Q1EA 2IXGA 1DELA 3M4YA 4U5XA 4YC7A 2EYQA 1IM2A 5TDHA 3SZRA 2O8CB 4PXAA 3E2IA 3FHOA 2IA5A 3LLUA 2WTUA 4ZDKA 1SVWA 1E2IA 2GF0A 2NZ8A 2D2EA 3WRYC 1CF4A 2ZRNA 3BB1A 3B1ZA 1AZTA 3KXIA 1SVOA 5TXGA 4IOMA 1FQKA 4N0DA 4H9GA 4I1VA 3CNOA 4TL8A 4A8JB 3RLFA 1W44A 2ORIA 3EXAA 2IUSA 4WXRA 4BLOA 3THXB 1S4QA 2VTKA 4LRWA 4PO8A 2QT1A 5H8WA 1EG7A 4Y0VA 1X1RA 1Z22A 5LB2A 1GNPA 2ZREA 3WMEA 1YE8A 2V8OA 4XD7A 1NMYA 3PEYA 4PTLA 1L8QA 2VPPA 2BDTA 4B48A 2EYUA 2V1UA 3W3AA 4L9WA 4V0OA 2PEYA 4HAYA 4D0NA 1AA3A 1RRFA 4P33A 2OBNA 2FSIA 5UKDA 3UKDA 2ORVA 1TPZA 2QAGB 3PEVA 1R8QA 2WJJA 3HJNA 4RKFA 1UEJA 2GBLA 4S35A 3SQWA 3IO3A 4BEBA 3D7MA 3PR1A 5EP4A 5L3QB 4LC0A 4D80A 4LJ5A 5J4YA 1WQ1R 3CM0A 4LSGA 4EFNA 3IQWA 3KQUA 2F43A 3C4JA 3GLHA 1W4RA 4PC6A 4D4LA 5FOSA 2IWHA 1G20E 3DDCA 1N3BA 3CRQA 3D6TB 3TW8B 1RYHA 1Q22A 3CW2A 3FE2A 2ZI4A 3CPJB 2V6IA 5CYOA 2VLIA 2NTYC 2R6GA 1CKEA 3DPUA 3RVBA 2EFDB 3EZ6A 2CE7A 3AP2A 4A0GA 4MITA 3IUYA 4MRSA 4QBHA 2V1XA 2OT3B 5CB6A 5EJEA 3BORA 4CEJA 4WA7A 1SVMA 2A2ZA 1T5LA 3DOEA 4A2PA 4C9BA 2VL7A 5IT5A 3RWMB 1T3SA 2OLKA 3BBPA 5BW8A 3LV8A 4FI3C 4Q9HA 3RANA 5FL3A 3IIKA 4TMXA 5EUMA 5H1YA 1XEWY 5JCPA 2FH5B 3U44B 4Q1EA 3I5XA 2W6IA 3ADDA 3KZ1E 4Z8XA 4DIDA 4PFSA 3NDBB 2VF7A 4KU4A 3TSWA 1DTSA 4KFSA 2CHQA 4A2QA 1EXMA 2Q3HA 2VYFA 1Z0DA 2VHTA 3CRRA 2XEXA 3GLHE 4EPYA 4LPSA 2WOJA 2P2LA 3A58B 5DI3B 5DISB 3K70C 5FPYA 5FOTA 4CZ2A 1D2NA 1XMJA 5CJPA 3U4QA 2IYUA 5LBIA 1YJ5A 2ZJOA 1Q1ZA 2QQ0A 1OLOA 3VR6A 2J7PA 4HDCA 3VU9B 2WMOB 1JAHA 2DYKA 3AP1A 1G6OA 4AY2A 1BIFA 2ZJZA 3CRVA 4NCKA 2Q3MA 3FTQA 4DJTA 2PZFA 2OXRA 1KZ7B 4E07A 1NVVR 3EC1A 4M1KA 1IXZA 2CHVA 1CS4C 4GSYA 1A82A 5EE5B 2ANCA 2GTPA 1I2DA 2FZ4A 1M6NA 2GAOA 4JJZA 2F55A 2VA8A 1IY2A 1EGAA 1IJEA 1Q21A 1UBEA 1FMLA 5F3WB 1W49A 4AI6A 4DB2A 2CNWA 4ILEA 1OKKD 4XOIA 3L2OB 3R20A 4G1UC 4JLDA 1O87A 1XTQA 4ZIRB 3X1YA 4QM7A 4FN5A 1SVLA 5FBWB 4HZUA 1GM5A 3GJ7A 3A4LA 5KSZA 4IDPA 2GZHA 4TLAA 1ODFA 2JEOA 5BWMA 2VO1A 1GKYA 4GZLA 5CIWA 3LD9A 3U6BA 3RWOA 1JR3D 2W6JD 4IDOA 3CLVA 2C99A 2QA5A 1DEKA 3RS5A 5LDDC 3GQBA 1U9IA 3G5UA 4R2IA 2SHKA 1Q3HA 2D4HA 1U99A 2VP2A 3CWQA 4JKYA 5FTNA 4MRPA 5FBQB 4AD8A 4OL0A 4EFLA 2OXCA 1JXOA 4NCHA 2IEZA 4NE2A 5FH9A 2XZOA 2ZSAA 2PZGA 1SXJD 2ZJYA 1RPZA 4Q4LA 4LYFA 1N5KA 3SBDA 1DAHA 2OSBA 4IVQA 3B1XA 3BB4A 1AS3A 4IDHA 5L3SA 3K9LA 2ZANA 5B57C 4KJZA 5JWHA 4Q1FA 2FOLA 4H1UA 3I3SR 4LYJA 2O8DA 2V9PA 3G0HA 4RZ3A 1CR0A 2OAQ1 3NHBA 5FPSA 2ZRGA 2YWFA 3MFYA 4RSGA 2ZETA 5D3MA 3AV0B 3VKGA 1Z83A 2DWOA 2KWIA 4BQSA 4HB3A 4QGFA 4A15A 1E3MA 3IO5A 2IYTA 2CLCX 1ETUA 5E7IA 2QTFA 1EFTA 3IPXA 2JGNA 1E9DA 3QIAA 4LV6A 4JKIA 5AR1A 1ZAKA 3BJIC 5EZ5A 2FFQA 4TYQA 1HT2E 1T8TA 1N6OA 3OE7A 4P4SA 1KSJA 5DYGA 4QBIA 1SKYB 3U6KA 3WHKA 5KYKA 4LHZA 1CR1A 1P60A 3PG5A 4IFEA 3OFND 4OI1A 4XWKA 8OHMA 2ZU6A 2CK3D 3K0FB 4NHOA 4US2R 1WB9A 4C0JA 4RZ2A 5HR5A 3A36A 1GP2A 1ELOA 2J41A 2HYIC 1VDZA 2CLSA 4RD3A 1DBSA 3KJEA 3MAAC 2FEMA 1D2MA 3RS2A 1X8JA 3KX2A 1TF7A 4LYAA 3BWDD 1CULC 2RGGA 1Q44A 3JZMA 4HUQA 3TGPA 1E2NA 4LBZA 2QE7D 3U60B 1Q3TA 5BXQC 3T34A 4RFSA 3TKLA 1SHKA 1YRAA 4OJQA 3UPUA 3OF5A 2EW1A 5FOUA 4D4JA 2XXAB 2Z83A 5FTKA 3TUZC 1Z0JA 2IHYA 1WMSA 3A4MA 2C2HA 2JLSA 4OHWA 5TV2A 3RS0A 4P4TA 4P4UA 1XZQA 2FN4A 4IOJA 2AXNA 1CJMA 4YONB 1CEEA 1B0UA 4M1MA 4C0SA 1C4OA 3H0KA 5HPYB 1JPJA 1CLUA 5DN6A 2ZRLA 3QE0A 4D4MA 2ZUCA 1Q12A 4RFVA 3PUWA 3UANA 5DH9A 1ESMA 4PHTA 2RGBA 3C14C 2QY9A 3F8TA 3EPJA 1RRPA 2R6DA 2D3WA 3CNLA 4X8LA 1K5DA 4ESHA 3VR1A 3SHWA 3RSOA 5TB5A 1EFRD 1OHHA 4B74A 1R5OA 1SZPA 5JLJA 1VYVA 3FHTA 3MWKA 1YZTA 4HB2A 4LBYA 1XEXA 3LFUA 5HZHA 4M53A 4TMTA 3DKVA 4PR0A 4MKGA 4UNSA 3BH6A 1GOTA 3EPKA 2IYSA 3K09C 1IONA 4OHXA 1XTJA 5DO9A 3SOPA 1ZIOA 1QG2A 3F0TA 4Z54A 1VTKA 1XJ0A 3QOFA 2WWWA 2ZRKA 2XSZA 3K8YA 1RFLA 4L9SA 3RC8A 3P26A 1ZMXA 1AKEA 2WOOA 3U7FB 2KBEA 3GMTA 5CLQA 2O5VA 3X1WA 4A92A 5KSPA 2A5GA 1Y63A 3MWYW 2HEIA 3B6EA 3N2IA 4ITRC 5G3ZA 1OH8A 1JQLB 2VRWA 5KNCA 1G5RA 4HUTA 3L82B 2NG1A 1T8UA 1KO1A 3TBKA 4JS0A 4BLRA 1KO8A 2V3CC 1KY3A 4DCNA 4LX0A 4DCTA 3TUIC 1UFQA 4R98A 1TQDA 4MGYR 3GLIE 2VSXA 1VYUA 2GETA 1JI0A 1GFIA 1OF1A 2ZJBA 4TLBA 3UXMA 2XB2A 4LOAA 2ZI3A 2D7CA 1JECA 4C7OB 1JJVA 1HY3A 3VR2A 2PJZA 4KO8A 1KSHA 4ACBA 2FX3A 4PO9A 2F9MA 1S8FA 4KAXA 1RZ3A 3SC3A 5JJLA 2JLZA 4Q5IA 1ANKA 2VHJA 1QF9A 2DB3A 4QGAA 3VTKA 2B92A 2O8FB 3KB1A 3AVVA 2VF8A 2CCKA 2R6FA 2MMGA 3SJZA 3B9QA 3LAWA 1II9A 4NYJR 1E2GA 2AK2A 3PQCA 1KDRA 2YOFA 2AWOA 2QPOA 1AS2A 5L8VA 1KYIA 3DZ8A 1CRPA 4B75A 2GDJA 1KAOA 3QUSA 3BIFA 3CB4A 2AL7A 3U3OA 3T15A 4DEYA 1SKQA 3CRW1 4BFSA 4DLSA 1G17A 3PEWA 1ZNZA 2X19A 4LUCA 2W6ID 2WAYA 1II0A 1GVNB 1WCV1 1XD8A 5JI3E 1FX0A 1E9BA 1Z6AA 2IX3A 1G5PA 2PCJA 2ZRCA 3NTUA 4LI0A 3SYKA 2ZVQX 4D4KA 5DE3A 3K0EA 4M1YA 2OAP1 1ZNWA 5FTJA 4B73A 1N6RA 1Z07A 4PC7A 1XD2A 4TMKA 4B76A 4JL8A 3HU2A 3L0OA 3REFA 1YR6A 2J7PD 1E2LA 4ZI3A 1XMIA 2C8VA 4BWYA 1NIPA 1LNZA 4HAWA 1XF9A 4MDEA 4Q9LA 1J7KA 4HB0A 2YWGA 4DT1B 3CRMA 1D5CA 3UG7A 2GXAA 2WWGA 4PQYA 2C96A 4JJKA 3UIEA 2OEPA 4BFTA 3CH5A 4BZXA 3GJ4A 4DVGA 1ZRHA 3GCGA 2XB4A 3QENA 4Q01A 3K0AB 1JQJC 2CNWD 5DLQC 5JSZA 5C18A 2J0UA 3NBYC 5FR1A 3K53A 3UMFA 4B47A 1JB1A 3ZDQA 3VKWA 1RC8A 3K70B 4M0LA 3B5JA 5C4MA 3BH0A 1E2HA 2GVZC 2QI9C 4F91B 4LJ9A 2C04A 1ZJ6A 3N5CA 4WVFA 4DRZA 1IOZA 1CIPA 3Q3JB 3X1DA 2PBRA 3QKRB 1WRBA 4ON9A 1W0KA 4DLWA 2RHDA 2BBTA 3B78A 4URUR 2A5YB 4EJSA 3QEOA 2WHXA 4XH9B 2R9VA 4KV9A 2QT0A 3OEHD 1NVWQ 1P61B 3DM9B 5EP1A 3AVWA 5GVRA 2VP9A 1QVAA 3OAAD 1VHTA 3RRMA 4Q1CA 3GJXC 4PANA 3KXKA 4OK3A 5HE9A 4NBSA 3DKPA 2O0KA 2ZUDA 1KK2A 4QHTA 1VCMA 4MGZR 4GOKA 5EZ6B 1PLLA 1E99A 4OHVA 1EX6A 4NKRA 1TF2A 2P3SA 4C0QC 3CX6A 5J4HA 3QG1A 1G19A 1QG4A 4OQLA 3SYLA 4JBYA 1NIJA 4NCIA 2E87A 1OW3B 2ZE5A 3THYB 3B2EA 3TW4A 4O2LA 3DHWC 1E79D 2FG5A 2FGJA 3Q7QA 4UXJA 4EPXA 2KI5A 1A2BA 1YR7A 4RCZA 2GJKA 1E6CA 1T3LA 4DSTA 4ZDIA 4P0TA 2OUKA 3OZXA 1JR3A 2W6JA 4J0QA 2WJIA 3CPHA 3JZAA 1V5WA 1XU4A 3OE7D 5ELXA 4MGKR 2YWHA 4OQXA 1NN5A 3L8ZA 2JAQA 4FMCB 3L8YA 221PA 4IRUB 4PZZA 2GBLC 2ZIAA 3LH5A 2Q9AA 3N70A 4JL5A 1M8PA 1ZD8A 4JYBA 4QNRA 1KMHA 4NCNA 1LTQA 1N5IA 1AS0A 2W58A 3TUJC 5L3QA 3QPVA 3AVTA 2DFTA 1SXJA 3QF7A 1TAGA 4TT3A 1E2FA 5EXTA 1EFCA 3VQTA 5KOYA 3LBHA 1NNEA 1RRCA 3GLFB 3RABA 3P20A 2WKRA 4TN1A 4KHZA 5AUNB 1NMZA 4G5QA 1KI2A 2N42A 4NDZA 2QP9X 2J46A 2I4IA 2REXB 2JLYA 2ZE8A 1ZNYA 1QHYA 4QJ5A 3I32A 2GRJA 5AJVB 2ZE6A 2OLJA 1VG1A 3CPEA 2PCLA 4TMWA 1ONBA 1G4AE 1XXHB 4Q7JB 4PPQA 2OCPA 2R44A 4BLQA 4PHGA 2FSHA 3CONA 3X1XA 4DDUA 1JR3E 1Z0IA 1G3IA 5EE9A 1KY2A 2D74A 4MH0R 4WZAE 2BOVA 4D82A 4JZKA 4LJ8A 4M9QA 2WV9A 4QRHA 1E2JA 4NZYA 3P4XA 4JLMA 1MRNA 3PJRA 2B6HA 3U44A 5IRCD 2EFHB 3SS8A 4DEXA 2IWRA 1SXJE 3ONWA 2RHMA 3ECCA 1G9XA 1G3UA 3LY5A 3GEIA 4N3NA 3W34A 5DN6D 2PJRA 1IXRC 1I4LD 4CDGA 2CK3A 5SZIA 1ZM9A 1PLKA 3AEZA 3QF4B 4NCJA 1KI4A 4JT4A 3ZVRA 1RYFA 1SHZA 3PIRA 2CDNA 5CB8A 4QC2A 1DAGA 4P32A 1C9KA 4G5SA 4LHVA 5FOVA 3SEAA 4GBMA 1W36C 2CVHA 4Q4HB 4DDTA 3NBZC 1ZNXA 1T5IA 5L3VA 1IN7A 3W6PA 2RMKA 5AJXA 1ZC3A 3VR4A 2PEZA 4OBEA 3AVUA 1NG1A 2FNAA 1I4DD 4AWXA 5IHPA 4Q4JB 2GZDA 3T1OA 2ODBA 3PVSA 4JBWA 2ZROA 1X8KA 2AN9A 2XSZD 5EXSA 3P1JA 2AFIE 2DWQA 2OFOA 2WJHA 1P9RA 1TX4B 2HF8A 2QGZA 1CU1A 2PLFA 4Q03A 1F6BA 4G5RA 2J7KA 1GNRA 1GIAA 4LY6A 4OI0A 4MDFA 1NY6A 4CEIA 3R8FA 1G1MA 2EWWA 3TJZA 3A6PC 1WF3A 3GEEA 3WYAA 4ZIRA 1KO7A 2ZYVX 4BECA 1OFUX 4DSNA 2DPXA 4URYR 4HAVA 2EWVA 1XPRA 4JLOA 2P6NA 4PHHA 2IUUA 2WJYA 2ZITA 2BBOA 2IEYA 1EFRA 1OXUA 2IHBA 3SHFA 3KXLA 4MKIA 3TAHA 1YZQA 3CUEF 4JYCA 1ZCBA 2ZM5A 4D26A 3ASZA 1U9IC 3P4YA 2I1QA 2FWRA 4KCGA 1JBKA 1U90A 3WP1B 4PSAA 1P9NA 4C4PA 3KKPA 2ZRJA 5J47A 3SJBA 2CEAA 3G82C 1MO3A 2Z43A 4IVRA 4LGMA 3CX7A 3VNVA 4TTQA 3CF2A 1XJCA 4PQRA 4ZO4A 3HP1A 2RH5A 3T5GA 2BMDA 1P9WA 1U8ZA 1YZNA 5F2EA 1TEVA 1UAAA 3TNFA 1LY1A 3QKSB 4WIAA 1M74A 1S0UA 5F98A 1FQJA 4TQ9A 2ZXUA 3IQXA 2CE2X 3TMKA 4QHYA 4EAQA 5GVSA 5CDFA 1YR8A 4OQFA 1LFDB 4DLUA 4D81A 5G41A 4XWOA 1HV8A 3NEJA 5BN4A 2P6RA 1W7AA 4D25A 1G8FA 2XZLA 3O8CA 2Z5FA 1E4VA 1M7HA 1X86B 2QL6A 3QPUA 1R8SA 2FMXA 3IILA 4IXNA 1KK1A 3LA6A 4BRUA 5SZJA 1XTRA 1PUIA 4DDWA 3SR0A 1D2EA 1FZQA 1K8RA 3K9NA 2NOAA 4LCBA 1VECA 2AFHE 1S96A 1FW6A 2P67A 1N5LA 4CT5A 1E2EA 4DCVA 1E1QA 1FP7A 2KSQA 3FWYA 4M9SA 3ZZUA 1G18A 3AB3A 3V9PA 2ZSEA 4ZCLA 3FGNA 3LVQE 2FSFA 3CH4B 3R7WB 3QXJA 1E96A 4M22A 2E9SA 3KKQA 1U0HC 4URWR 4OQMA 1N6NA 3WP0A 1QHXA 2GEDA 1F2TB 1VCOA 1NI3A 1YR9A 4B3BA 4IXMA 4G0NA 2FSGA 1R10A 1Z6YA 3U7HB 3FFBA 2F3TA 4AG6A 3GLGA 3Q8XB 5CDFE 1G7CA 3K0SA 3KUDA 2QBYA 4JLVA 4C0BA 4GP7A 3ADCA 3NIBA 1HURA 4PPGA 1GITA 3TQFA 2H57A 2WKQA 3BRWD 3NH6A 2ZAOA 3TE6A 1LB1B 2XXAA 1DADA 1NKSA 5JHHB 4AKHA 2O8BB 1G291 1AA9A 1W1WA 5C4GB 4AIIA 2BCJQ 2O0JA 3KJHA 1L4YA 4RY2A 1Z08A 2UVQA 2ZPTX 4NYIQ 5HE8A 1P75A 4B34A 1W0KD 3QG5A 4LC1A 4C30A 3P27A 5DNYB 4JVLA 3CIOA 3KKMA 2RB4A 4EPVA 2W2TA 4Q1AA 1KZGB 3WYFA 4CYMA 3MG9A 621PA 2J1LA 4JSTA 5FI1B 1Z2CA 2JDID 3KFVA 3EG5A 2C03A 1KDPA 4QGHA 4O2RA 5FR2A 1Z63A 3FMIA 2GJAA 2X8AA 2WWYA 3DVLA 1UKEA 4C2TA 2IXEA 2BKUA 1JAIA 1BS1A 3AVXA 2REOA 5GJCA 1W5TA 3GLGE 1HQCA 3PEUA 1NLYA 3HR7A 4JVNA 1OB2A 3FPAA 2HJVA 4WXPA 1BMFD 1AQUA 4DLTA 4QL3A 1VCIA 4CT4B 2G0TA 2EFCB 4NPHA 5FL7D 4DLZA 4QGGA 1FPMA 4ZCMA 1OPXA 3Q85A 3V4FA 5JI2E 3THWA 1UDWA 2C95A 2BWJA 4B6EA 5E4FA 4FINA 1D6JA 4BFYA 5GADl 4LZZA 1RIFA 2H17A 4PQFA 1S3GA 2NO9A 1HE8B 3F5FA 3GFTA 3T5DA 3W5JA 1HT1E 5JRZA 4TYWA 3K9HA 1OJLA 3T1VA 2HDNB 4D6PA 3AF1A 3OEHA 5HKKA 3SYNA 2F1IA 1E9EA 2Q3FA 4C0LA 3B60A 1YZGA 3OAAA 4P3YA 4Y0AA 3B1VA 1VYTA 1DPFA 1NN1A 5D3QA 3W5IA 4ZI2A 3QBVA 1J90A 3H86A 1E0JA 2Q0HA 4UNRA 2YKGA 4A36A 1NJFA 3IBGA 4KFTA 4M1OA 4TT3D 4JLAA 2JLUA 3WHLA 2IYZA 1RW4A 1YRBA 1G7RA 4KITB 2YC4C 2LCFA 2QRZA 2ZRFA 4Q1BA 1UKYA 5TY0A 2OO7A 1KGDA 1HH4A 3MWLA 3Q72A 1CTQA 2OHFA 2AXPA 4TMZA 4BLPA 5EE0A 3AVOA 2W0MA 3WBJA 5JBQA 2ZSFA 2AKAB 4HSEA 2O8FA 5FTMA 3Q9LA 4BASA 1E79A 4Q7KA 3WNDA 1Z0AA 3NEYA 1EK0A 1Z47A 2EFGA 5IF9A 4B3GA 2PT7A 4GPTA 4QG7A 3W90A 5BQ5A 1F2UB 5AWFC 2A78A 3MLEA 1R7RA 1GSIA 3C7KA 2MMCA 2AKYA 2BJVA 1FP6A 2FPKA 1CRQA 3VKHA 1G5TA 1R0XA 4TLDA 4A6XA 4UXIA 4ZPXA 4EQ6B 1P6XA 3SDZA 1KMQA 2OILA 4DZZA 4Z1MD 2R8RA 4KBFA 3J81k 2ZR9A 1NL3A 3RC3A 3FMFA 3OIVA 2Z4SA 3RRYA 1JR6A 3CZPA 1EWQA 2F43B 4LJAA 3GLHB 2WSMA 2NO0A 4DSUA 5HCIA 1ZP6A 1NF3A 2RGNA 1N6LA 2IYWA 1Y3AA 4HAUA 4MGIR 4U00A 2CL0X 2RGCA 3GJ3A 1UKZA 3SE0A 1NSTA 2D2FA 2WWXA 4F92B 3KJIA 4TZ0A 1II8B 4E03A 3DM5A 2PLRA 2IK8A 1VG9B 3LO5A 4A0HA 4IHQA 4C0HA 4K81B 3RYTC 4X8OA 3ZS9A 1M2OB 4Q48A 2PX3A 1Z29A 1X8LA 3IIMA 3ND8A 4GNKA 5DHFA 4DT1A 2BM1A 1HA3A 4N1AA 2DFKB 1TUEA 1W2GA 3O8DA 1DAKA 3Q5DA 2EU8A 4QM6A 2GA8A 3MGCA 4BGDA 5CLLA 2VP4A 3TIFA 3OHMA 4YMTA 3RS4A 5JHGB 2WVJA 2PMDA 3QVVA 3K0AA 3D8BA 1PVOA 4HZIA 5F9HA 2ERYA 1C1YA 2BV3A 2VSFA 5EQTA 4FCTA 3LX5A 1W5SA 4UNQA 2PZEA 5AJZA 2XTZA 4QBGB 1Q1QA 5JMTA 4OYHA 2C77A 4GMXA 4NYMR 4FCVA 4TSFD 5CK4A 2ZJ2A 5A4JA 1U2RA 4PAQA 4WBSA 1F3OA 5BN3A 1E0KA 3QKRA 4JMPA 3F3YA 2A30A 2J9RA 2FPMA 2X1VA 1W36B 3LDAA 4TLCA 2GCOA 2IS2A 2BCGY 2FV8A 1P2TA 3L0SA 1FOEB 2NMVA 1G6HA 1ZC4A 1W4AA 4EJSC 2OFWA 4MUAA 1WE2A 1G4UR 1TADA 2GEVA 4O3MA 1Z0FA 1TNDA 1E2MA 2FGKA 1BO6A 1Z0KA 4Q66C 4UQOA 5JCZA 1TUIA 1XEFA 5CIQA 3WNCA 1IY1A 4OKSA 2V7QD 2O8EB 3JVVA 4F93B 1A5TA 1E0SA 2GHIA 1Z2AA 2CJWB 2ODNA 1CJTC 1P72A 1Q20A 3A1SA 3RRZA 2CMKA 1NVVQ 2ONKA 5DYIA 1B23P 4B33A 3I73A 5GJVC 2HXSA 3TR5A 3RAPR 2WJGA 3BERA 2A9KA 3LW7A 1OFIA 5EE3A 2R62A 3THYA 4QFMA 2F3RA 2CL7X 3T12A 5EUQB 3VHLB 4HZUB 4PPFA 5AK0A 4MRVA 3SJCA 2C9OA 5EXXA 1XJQA 4M8NE 4E5UA 4TLEA 1PLJA 1HUQA 5KHOC 1K6MA 1RJ9B 3MUFA 2PL3A 4ZDWA 4F4CA 1KI6B 1PJRA 3CR8A 4KYUA 4B43A 2OESA 2RGDA 1TQ2A 1Z6XA 4HLDA 4X8MA 3GFPA 1NLFA 2UZIR 1E1RA 2JLVA 2BVNA 4GOJA 4MA4A 4ZDJA 4TWZA 2L0XA 1Q57A 1TU3A 1VIAA
chains in the Genus database with same CATH superfamily
5GONB 4GC9A 4YRQA 5C80A 1H23A 1CVLA 3GL9A 1K66A 4KV7A 4C21A 5JJLA 1J99A 2LDYA 4DR4B 5J5AA 1KEWA 4AYXA 3HDTA 4HVLA 5FKJA 2X3FA 4ZC1A 4M38A 4HWPA 1N77A 2V4MA 1INLA 2QZZA 4PZPA 2VP0A 3LVRE 2YZGA 4UDXX 1EA7A 3HB9A 4BNNA 4BP8A 5BQOA 3UUGA 3R09A 4DZTA 2ZRIA 1FJHA 3M3PA 4L07A 2XNSA 1H2BA 3GGOA 2NZYA 1XU9A 1KF0A 1VLZA 2BSAA 3AI7A 3PHBE 1T3ZA 3WYDA 4PSCA 4C4XA 3L84A 3LHDA 5B3AA 2JPDA 1YL5A 3E2MA 13PKA 1Q3KA 1RPAA 5D3KA 5D3MB 4C2BA 3BTUA 4E3WA 4RACA 1XAIA 4XZ3A 3IKJA 4R5MA 3VZSA 4DSOA 5C5DA 2RG7A 2AKEA 2O0HA 3EGWA 4E4RA 4RTOA 4Z5XA 2WZCA 1EGQA 4BFWA 4NABA 5HBGA 4X00A 1EESA 1AXRA 4M1TA 1TVMA 2IELA 3T3IA 4INZA 5A5FA 1G8PA 1EZ1A 4YRKA 3T1YB 3REGA 3U49A 1Z4OA 1TRHA 4Q39A 2FWPA 3NBKA 4XDGA 3MIIA 1Z28A 2HU7A 1ZSVA 2G67A 3PPXA 2NXNA 1CE8A 1DRKA 1NW8A 1UBOS 4HATA 1FU4A 4ASUD 3O91A 4TTAA 2R1VB 5E6UB 4QG3A 2VXBA 3RQIA 3AIKA 4FILA 3DBLB 3EGCA 3GJ0A 3TJMA 4MVJE 1BKSB 2WMDA 3BK7A 3D7NA 1MQ8B 2WD7B 3QF4A 3FR8A 1L4HA 4LOHA 2AMJA 3ZNQA 2RSLA 4LI3X 4MRRA 1QFSA 2OFPA 5LDGA 5JTUA 4M9CA 1QP0A 5LZ7A 3KKNA 5FUBA 2J3JA 1J8DA 3DL2A 4O0MA 1KYXA 2I2AA 3KR2A 2LDBA 3O8RA 2WT4A 5B2FA 2ZRHA 4MRMA 4YX9A 4IGKA 4HUQB 3KQOA 4LDZA 3T3MB 3OP1A 4GNRA 1RI3A 2BEUB 1PGQA 3L18A 4RFSB 1OUMA 1QGAA 2H3HA 4LKOA 1NQAO 4KUHA 4Q4JA 1C7JA 1R8XA 4PZYA 4XPIB 5JJ5A 4MKFA 1VGRA 2Z0MA 2JGFA 3VSDA 1R0BA 1EM8A 4NESA 3WMFA 2Q2NA 5ALIA 4B3DA 2JHAA 1TJNA 4J9UE 2W6PA 2ZYDA 4RQUA 4EKDA 3NH9A 3EQ2A 2JLCA 5EIWA 5EP3A 1T1EA 4CR7A 2O8CA 2GESA 3M81A 4BBPA 1GCIA 2PR2A 5MHTA 1JHZA 1A2KC 3M82A 4MJ3A 4D0LB 4UCXA 4DCSA 3VAYA 1D1PA 1YS9A 1N2EA 2JJ2D 2R11A 4MQLA 2Z08A 4B31A 4B8WA 4YAJA 3I52A 2COKA 4KPUA 2WFZA 1A3CA 4TUYB 1SUFA 2QRNA 3ANXA 3L1KA 1Y7LA 2BGUA 3M6AA 1CB7A 2BFCA 4OLAA 3CU5A 3PQDA 4YCNA 4DL9A 4DDMA 1UPCA 5DIFA 3S7TA 4XM0A 3B12A 4YPVA 1SUDA 1JILA 1NJSA 3AUYA 3HFRA 1H4SA 1P91A 2AZTA 3FWPA 3WYGA 1RQXA 4F38A 3A2KA 5HJ2A 3KG2A 4J29A 5DM0A 1GRRA 1ZYUA 4BO3A 2ZJ5A 3L4EA 2FPOA 2VN8A 3ADOA 3IMFA 2EQ5A 5FL7A 2ZE7A 4Q4AB 1RLIA 1Y9DA 1OXTA 4M7PA 3G2IA 2Q1WA 4S1VA 1XOIA 3HGTA 3TRHA 4G01B 3LXRA 5A5GA 1CZRA 1QHEA 4F3NA 4MV7A 3IUEA 1MKYA 3AERB 3H5VA 3MWDA 4R9VA 1REQA 2PUCA 4JLSA 2FW9A 4CLRA 2L17A 1CJKC 2DHQA 1XZPA 1M2VA 2M1ZA 4I08A 4JFRA 4MQFA 3T61A 5JEDA 3EJ6A 4MYRA 1KXJA 5BMOA 1PFQA 5DLPA 1HYHA 5BMVF 1JU3A 3AKCA 3DC2A 2ONZA 1XU7A 3FFAA 3JD3A 4I1YA 3G23A 1NDUA 2MTBA 3JCZA 3QKSA 3K9CA 4L15A 4YRBA 1RJWA 2HZBA 2VATA 1LLCA 3IVRA 1FLNA 4HLQB 2VDLB 4RTPA 2J4CA 1VSQA 4PLHA 1SKUA 3EF1A 3LL4A 4A1FA 3O38A 1E8DA 1EFKA 3I8XA 3M9LA 1RI2A 2ZQ5A 4PSVA 1T9DA 1MA3A 3C97A 4DMLA 4KSCA 4WBNF 1RM5A 2C4VA 3PI7A 2JRBA 3TFOA 1UBTS 3LUPA 4IV0A 2IEDA 1YU9A 2QZ4A 3Q5GA 4K5QA 4TZTA 4UPVA 3ZC3A 3ZZ0A 3I42A 4C03A 1AQJA 1UPFA 3CVWA 1ZK2A 1MV8A 2HA3A 4YIKA 4ABYA 2XCRB 3ESXA 1WOYA 4CTKA 1UBGA 1N5RA 2JA1A 3CB2A 3CSUA 3DQPA 4LJYA 5DOZA 4F5DA 4F60A 5K8UA 1XGKA 3REOA 1KJYA 2EZ9A 1LKZA 3S4YA 1UP4A 1S8NA 2TECE 1AD2A 5D1HA 3SHVA 3R9WA 1P2VA 3RKRA 1KJWA 3BXZA 1O6BA 3E9RA 4I55B 5B64A 2D5CA 3G1WA 3R7WA 1J8QA 2DPGA 2GZAA 2ZAMA 1I7PA 4Q9KA 4ZOLF 5F33A 4R71A 2DHCA 3GX1A 2ZS8A 1R5JA 1QRAA 4KQ9A 3Q1KA 3SLKA 1RAEA 3CY6A 4BCBA 2WWVD 4ZREA 3EOAI 4YIHA 4N41A 1IN8A 3ZTWA 4YRFA 1W93A 1A9OA 1EB9A 1G4HA 2ZQZA 3LIIA 3IEUA 4HI0E 4X24A 2VYCA 3EZ2A 3VUEA 5EIEA 2A1TR 5DM70 2XMPA 3C41J 5CM8B 3UGJA 4QBTA 1XTUA 5EWJA 3CLKA 1V9SA 4C20A 2R1UA 3F2VA 4I7EA 5KQMA 3HB1A 3IQEA 3AEQB 3AM5A 3AR2A 2G07A 4B7UA 1ZN8A 2PYIA 4MR8B 3S70A 3RF7A 4JUCA 1VL6A 3VX4A 4EUKA 4L8WB 2W2VA 1ENPA 3QQ5A 3ECSA 3WV5A 4Q9DA 4CUKA 4X54A 5BV8A 2TMKA 1E9SA 2AQHA 4BGUA 4W5QA 1ZIPA 3TQCA 2NV2B 1CHNA 2CHFA 2SNIE 5JCXA 3RVLA 2YMQA 1LI7A 4BNDB 4DJAA 2HYDA 3CF6R 1KIMA 1RKQA 4WXHA 3R77A 3VU9A 2CNBA 5LP1A 2RJOA 3ADBA 1NBIA 5SV2A 2O7QA 1I94B 1G7TA 1PFVA 1XNGA 2W2KB 4Q9IA 1F8YA 4J49A 4DJDC 2A86A 1RACA 3HHPA 1US8B 4ZT7A 3HO8A 1KI1A 2Q6VA 3EUWA 3FW1A 5DGCA 5C31A 3AEXA 2V7PA 1GRVA 4YALA 3T7KA 3MZ0A 5CH3A 5LA6A 4F0JA 4V3CA 1JR4A 2W6CX 4RTSA 4B8ZA 1OGYA 3Q9UA 3MJVA 4CLHA 2GAAA 2X41A 3H6GA 4PINA 4TXJA 1YHNA 2GX6A 2BMAA 3VPFA 3ZWKA 1I3MA 5IMSA 3LRPA 3IE1A 4YGXB 5C7LO 4DDVA 1MD9A 3A11A 2VH2A 5G4LA 2CNOA 4JP8A 4KQFA 3G8YA 3I58A 5KU7A 2XAUA 5IAJA 3DFIA 3D8RA 2B8NA 1P2UA 4WFJA 1L5HA 1RCUA 3X1KA 1QH8A 3KJNA 4Z7QB 2G5PA 1Z17A 3EIOA 3RHFA 1ZVKA 3LVBA 5U4XA 1DUIA 1Q2XA 1Y5NA 2V5AA 2FFBA 2LKCA 3L4BA 4PR3A 3COJA 3A6FA 2X4DA 1U2EA 3IP5A 4MJ7A 2GPBA 1U8CB 1HYBA 4Y6LA 4RD1A 1GL6A 1QHGA 1YI0A 4M1SA 4EKEA 3UJ3X 1ECGA 5KINB 5J2UA 3G49A 5ELLA 4ROSA 3GD5A 2ILTA 4OGWA 3WBBA 1SVSA 2X8JA 1N2XA 1X38A 3ILSA 4CIDA 2VPZA 1NI5A 1XTBA 2FFAA 4TS4A 1V8DA 5DTRA 1CY4A 1FFHA 3SBOA 4ZJUA 1QPGA 4GQIA 3LECA 4BYGA 4U2CA 1T5BA 4JEUA 5DRYA 3RFCA 5LP6B 2G71A 2REBA 1V4NA 4M9UA 5JYDA 3VNSA 2CFRA 4Y30A 4MZDA 5SZKB 4B3RB 2GOYA 1AZSC 2BBWA 2QORA 4RHFA 4JOSA 1CV2A 4GKKB 1XDWA 3OM8A 3FCYA 2QUJA 1J8YF 3MMSA 3PCXA 1GLGA 4WN9B 4LHXA 3W1VA 3S8YA 1R0ZA 2HCBA 3JD4A 1T29A 1DIHA 2UYHA 2VZLA 1FYXA 1KKMA 2X42A 4TWRA 5E9AA 1J1UA 4QJ3A 3IMCA 4MYSA 1MMFB 3MOSA 4MQEA 1R6BX 2YHSA 3PC8A 6Q21A 1ZBQA 5E1MA 1F2UA 4GG1A 1DVRA 3VU1A 4XFJA 2V0GA 3AH8A 3NM4A 3RBVA 1BVRA 4HR7A 3LWNA 1ZD3A 1TO1E 1CUEA 1D09A 1HDOA 1NLMA 1K4MA 3ID6C 4HMOA 2WUEA 4R8KA 1C7ZA 1DBVO 3VU8A 3OD5A 2FF7A 1N0WA 1QYIA 4ZZ2A 3RC9A 4CMGA 4P4NA 4X90A 5K4HA 3FWHA 4FQ8A 3GH1A 5KDLA 1XRSB 2J4FA 2JJMA 3F5QA 2CXRA 4I46A 4WY8A 2H1HA 1KJJA 1QJ4A 5L53A 1TK9A 2BGNA 2AX4A 3ELUA 3LLMA 1O9HA 2EKLA 3JARB 4O0LA 1FSSA 4ZTBA 3DDSA 5JALA 3LPCA 4HLUA 1P74A 4OF4A 1JFFB 1Z5ZA 2B7CA 1E59A 1F0PA 2RGNC 2QVBA 4MQBA 3AUXA 3OIYA 4J75A 3TTUA 1CDEA 1IZ7A 1II8A 5CFNA 2OCBA 2GSWA 3PPVA 1UMKA 4BP1A 1U1GA 3LY9A 4G5OA 2CDCA 1GUAA 2YH2A 2ZCVA 1R0YA 3AKDA 4IWXA 3CE6A 1VHQA 3EAFA 4HJRA 3WFJA 3BGIA 3VZDA 1ZVVA 2H0QA 1B0ZA 1HOXA 1XK7A 5EIBD 1HT0A 1QK5A 4BO8A 1UH5A 3BMQA 4HGZA 4G9GA 3UMJA 4DNXA 2Z09A 4PYJA 2JA2A 5F23A 1PHPA 4FS3A 4EYSA 5KYUA 5HBRA 1MOZA 1YS6A 4GBJA 4F46A 4XWGA 1PJ8A 2AOTB 1E3LA 1RLUA 2QUAA 5EIXA 4DC0A 3H11B 2CDBA 2PTHA 3K2QA 1H8HA 3X44A 5AI6A 3Q7SA 2VHXA 3CH6A 3RNLA 4Q47A 1C0KA 3UGTA 5JC1A 2VHWA 3E35A 4R8SA 3PUZA 3WYEA 3JQRA 5AW2A 2CVZA 1COWD 2GXQA 3DOEA 1XCGB 1XVVA 3C15C 4YJ2B 5KU1A 4FFLA 4G1EB 2BEKA 4KDEA 2AOVA 1PS0A 5AKXA 4ASUA 7GPBA 3AY6A 1QBKC 3OX3A 3IAAA 1SBCA 3RIHA 3MGAA 5AKGA 2QMOA 2R8BA 5TRTA 3QE4A 3ZBQA 3LMKA 2GH1A 4NLLA 4PONA 3WI7A 1ECCA 4BP3A 4EB3A 2GXUA 4M88A 1PWXA 1K5HA 2FSUA 5LN1A 1OB5A 3IHLA 3GELA 3WYCA 3H16A 2VNKA 3M9XA 4MZXA 2RH8A 5JATA 1QZ3A 5FF9A 4PWZA 4JENA 4BOYA 5FUQA 10MHA 1KBOA 3CC8A 3HKEB 4KLNA 3V33A 3MD0A 4CKYA 4F21A 1UC9A 3TMYA 4BX0A 5B6JA 1LF5A 3IBYA 1E2UA 1GGVA 1QXSA 5ALSA 2BELA 5JH7F 4BQEA 3L93A 4EX7A 5CD1A 3SLRA 2ZAIA 4C06A 2DY1A 1T2DA 1FDWA 4KN8A 4RMIA 3EXIB 5MGBA 1SD2A 3D1VA 1TZ2A 1C7IA 5EMNA 2GYWA 1BE0A 1FTSA 3MINA 4PSDA 4WEQA 3CXRA 1E4EA 2XBMA 2ZS7A 3S8MA 2P0AA 4ID9A 4L0CA 5CJ2A 5EPEA 4MYHA 1OPRA 4XLZA 2Z9DA 3M0EA 3ZTTA 2EJWA 1T9HA 4WDRA 4KPFC 4HGRA 2BGKA 1U0EA 1YQXA 3NI2A 1EU1A 3ASYA 4PLYA 4XYGA 4CF7A 1FNNA 3AF5A 3TM5A 3RUHA 1N7GA 1U3FA 1H0KA 1XA3A 2I3BA 2VJBA 2XQJA 3FNEA 4N6GA 4PU0A 3WRYA 5LLTA 4E94A 5KJCA 3QEAZ 4X60A 4W1RA 2RHLA 4OQNA 3LC2O 1W75A 1UXJA 3UWPA 2JJ2A 1LS6A 1LXCA 1U80A 1GTVA 3JZIA 2QYTA 1NJGA 4CGYA 2I1VB 3N8HA 2G3YA 4DCPA 4J3FA 3QOXA 3QBJA 1J23A 3IOYA 5FUVA 1DKUA 1XTZA 3DHYA 3F3SA 4M0MA 1H2HA 4UNPA 4F8EA 4C7OA 4L8LA 3OFVA 4JIMA 3SZLA 3DL0A 1NZFA 1KI6A 1ODIA 2ZDGA 2TRSB 4NMWA 1LNSA 5LYYA 2F1OA 3DDZX 3WGOA 1WCXA 1OFUA 1IOLA 3AESB 3JVUA 5G53C 4C7XA 3STXA 3D2BA 1RFGE 2QIOA 2ZTVA 4WNYA 3V32A 1A4RA 4D56A 1H2YA 2EKZA 4I1UA 2OV1A 4MVXA 3UF0A 2GZ3A 2I2FA 1E2DA 1P4AA 1UJ2A 2EKBA 3Q88A 4Q15A 5DZSA 2JAWA 3OIUA 3GDOA 4E2YA 1U0NA 2R8EA 3PTAA 2QLTA 2ZVDA 1WHTB 1RYEA 4QOGA 3NBUA 1PR9A 2QTVB 4YV0A 5HUHA 3FSGD 3HE3A 2H51A 1CFJA 1HTBA 2PMCA 4J7XA 1Y6ZA 3V8PA 3KYCA 4UTRA 4D9EA 3NGLA 1MABA 4XGQA 2Q5FA 1E2QA 3AK4A 4HNAB 4LY9A 1HEIA 5KWIA 5DWDA 5IJXA 2BBSA 2HB6A 2UVPB 4YRMA 1G55A 2WHYA 1O9GA 4KAAA 3AF2A 4HYEA 5FOXA 1AJEA 5H7XA 3HVIA 1H8ED 3GFFA 3H6KA 2ZWPA 2A0WA 2IYQA 1MGOA 2ARKA 3HP4A 2JG3A 2O54A 1LF0A 3KJGA 1QK3A 2X8BA 1YSCA 4OPMA 3C3JA 2VBFA 1Z6TA 4DNQA 4I36A 1CVRA 1QIJA 5JPIA 1L5LA 1IB6A 4A2WA 1E9CA 5FULA 1EZ4A 2GMWA 1E63A 4WTOA 4YRAA 2JRLA 2ZBDA 4BO7A 1P4RA 2ZOSA 1XMPA 4M99A 5CA0B 2XXBA 4YN3A 3TK1A 1QRTA 3P9ZA 4W7SA 1G8HA 1HX7A 2XDQB 1GEEA 2V0CA 5EQDA 3KR1A 3EZNA 2QENA 2EZUA 5AUPB 3QXCA 4P31A 1GN9A 3EG9A 4GR4A 4K6FA 1C7FA 1JZQA 3OSUA 1FDVA 2YWEA 4MR9A 4CM8A 1D6SA 1LDNA 2BW0A 2J5QA 2QP3A 1W5AA 2QX6A 2VPIA 2XKKA 1EGHA 2V9CA 3DQQA 5E1OA 2FR8A 1ZJWA 3H1TA 2ZI6A 1QTNA 1B8PA 3ROFA 2H1IA 4JB0A 4CEJB 2Q07A 3OQHA 4MW1A 4ALKA 3HRHA 1CZUA 3C87A 3OI7A 4DM7A 4ML3A 1GPJA 4JD5A 5DTIA 3B1YA 2JH9A 3PUVA 3GGDA 1O8CA 3C5HA 1M7GA 2RDMA 4GKVA 1SAYA 4Q0MA 4ZAFA 2BR4A 2JCSA 4DA8A 1M66A 2ZRBA 1ZY2A 2QZPA 5T3UA 3TZQA 2P0EA 4ZAXA 2GA9A 1NMXA 4FKBA 1ILWA 3SCZA 5JARA 1OGIA 2RKWA 4E5SA 1JBQA 2QBYB 4KGZA 2QTBA 3FRIA 1L7VC 4BNLA 4EOGA 1JNXX 3I6YA 2AOUA 4IJ6A 2JI8A 1IM8A 1GRQA 1I2BA 1WA5A 2RK3A 4G4IA 1NW7A 2XZPA 4KR3A 1P2DA 2EW8A 1P4SA 5KC8A 1CNFA 3OQJA 3U4QB 1SURA 2H7XA 4GYWA 4MVCA 2VWHA 1W88A 3G2QA 2A3RA 3OA2A 1QIEA 4FWIB 3HTXA 3QFTA 2K7FA 4CCYA 1ENYA 2WRZA 4HS9A 4EW1A 3INTA 3UV3A 1HDEA 5HRCA 1IQUA 1IY0A 1EAYA 2Z3ZA 3O93A 1KPGA 1SMKA 4KFCA 4IIJA 3ANMA 4GPAA 5EKSA 3KTFA 1QR2A 1ACMA 3IMGA 1F1BA 3OP4A 3ABSB 4U1RA 5C3MA 2NQ2C 1XB2A 1YZLA 1Z82A 4KE6A 5I9LA 4DG8A 3AHFA 4QQKA 5C8YF 1NVXQ 1IJFA 2ZWMA 4O1MA 1E7QA 3VMMA 3GLIA 3K9QO 3N2EA 1G64A 3IELA 4K9LA 1XTTA 1JJBA 3FPFA 1V3QE 5TC4A 3OQMA 5JECA 1JEEA 1Z12A 3GLKA 4DUYB 4EEXA 5C7OO 2FE4A 3U0BA 3T1QA 3D8HA 1Q1AA 3CF4G 4OLJA 1KTVA 4EIWA 2QPTA 4U39A 2QN6A 5AH0A 4LK3A 3DR3A 2HL6A 2OQIA 1R8JA 1OZHA 2MT9A 3FGOA 4K9RA 3L3BA 2PHZA 5BORA 4MW2A 2ZYUX 4LXXA 2V4ZA 3ZLTA 4UKDA 1AN0A 1Z5NA 1YS4A 3DGFC 3QY9A 5ADUS 2CV2A 2FUCA 1FLVA 2XUOA 2AFRA 3I1FA 4I9UA 4B0OA 2UUCB 4A0QA 1TFRA 2H5JA 5HMMA 2W0SA 1PJ4A 3PE6A 3BWVA 1TYZA 1CUGA 3GRAA 3OC0A 4JT9A 1BEUB 2IYXA 4RD4A 4FDAA 2CJPA 3DOHA 4XVUA 2VPWA 2VSOA 3WGNA 5C4IA 4A8HA 2DECA 1NX6A 4R3NA 5FWXB 5DW0A 3MM4A 3KVNA 1A9XA 1Z45A 3AGQA 5JMOA 3MBOA 2J9FA 2B36A 4MUBA 4FWTA 4MQ5A 2OZKA 4MWEA 1JHUA 3PKJA 4UJ3A 5TPZA 2R68A 2XTJA 3A26A 3KE8A 1QLJA 1WDMA 2PT5A 3H5TA 2DHEA 1Q1BA 5ESWA 2FZLA 4QQ8A 5KVCA 1BYUA 5EZYA 3EW9A 4NCBA 1DU4A 1UMDB 4F7DA 4L4ZA 4UCQA 4WLNA 4BMDA 5LOVA 4D5GA 4BLUA 3GJ6A 1PZMA 3T9DA 3GJ5A 5I3ZA 3AIOA 3IDSA 4H4DA 1DOHA 5KTSA 2IT1A 1G8YA 4L9AA 3TAXA 3D59A 2AZXA 2VRCD 3LDUA 4URFA 1O3YA 3ZD6A 4H18A 3FVVA 3LGAA 1X80A 2AMYA 2AJBA 5A7FA 3AXSA 4NP6A 4PSKA 3U61B 4JI5B 1ZSYA 4RKQA 3VYSB 1LU9A 5HTOA 1R0WA 3UATA 2R47A 5FXMA 3W7BA 4B87A 1X7XA 4O8CA 1NDQA 5G40A 1FL9A 3LDHA 2P2SA 3RSLA 3VU3A 2R4UA 3SEFA 3HSKA 3HXOA 3QITA 2OV2A 3WJ7A 1YR1A 1F0YA 1QH1B 1NW9B 5DK4A 4JC8A 4ZJZA 4B3CA 3PLNA 2JHGA 3FVRA 4P93A 4QU5A 4Q7MB 1UDRA 2LW7A 5CPFA 3IXQA 4KG7A 3IP9A 5H59A 2ONJA 2IPNA 1BWSA 3W5UA 3GJQA 3FHJA 3Q8KA 4M1WA 1R16A 3I0MA 4FGLA 5ALJA 2ZIEA 4GT1A 3URKA 2AE1A 5DLYA 4TTSA 2RGAA 1Z3IX 3KQYA 4RHEA 1N3LA 1ZJ4A 2ZP1A 4R7ZA 4IHJF 2VH5R 3TNLA 3ZDZB 5CEJA 2IS4A 1XTKA 4N7RA 5ER9A 1SN7A 4MS3A 1CQPA 3H5NA 5JXJA 1C0EA 4FB5A 2ID7A 1V4VA 1NW5A 1SH7A 5LZ2A 1AA6A 2P5TB 2R3SA 3RYFA 2W2XA 2GPAA 1C81A 5JS8A 4Q1DA 3RVRA 3JATA 3UZUA 3GNSA 1Y6JA 2C2BA 1EFAA 1P0IA 1T6NA 4KKVA 1GZ3A 3BAFA 3U56A 1YRYE 2O5RA 3HU3A 4E13A 4JBLA 1Z5WA 3DSRA 4RBNA 2WINI 4QOSA 3R0QA 5I7UA 3KOXA 3HKDA 1FP1D 3IKMB 4DJEC 3U7QA 1LWOA 1ZK3A 5U1PA 1FDRA 3I2YX 1JDVA 3X3HA 4D8TA 3JQ6A 3U3MA 2KE5A 3OFSA 2GEUA 1EWRA 1KJZA 3CR3C 5DBEX 2HHLA 1TKRA 1DTEA 4XSGA 5BMVB 1JG2A 3EHDA 2A3NA 3F6BX 2AQIA 2ZUTA 2J59A 1S2GA 1DAFA 3DMPA 1JHAA 3V00A 1BG6A 1X87A 4QEZA 3ZHZA 2D06A 2CHGA 3LPAA 1KKLA 1QIMA 4L72A 3BFXA 2YN4A 2BONA 3K20A 4IO1A 4DLPA 4KXQA 5HILA 5D7BA 4Q21A 4O2BF 3PC7A 1IBLB 2QLLA 1J70A 1NKTA 3NX4A 4C78A 1E4YA 4TXMA 4WBNB 5LM3A 2AQKA 3ELYA 4O02B 5IXJA 4FM9A 2IEGA 3OEYA 4BVHA 3BGVA 2EJBA 3N2ZB 5DSZA 1JDBC 5ALVA 1RTTA 1QG6A 3OPMA 2I3ZA 1GGMA 1AE1A 5C46F 4PFKA 2EVWX 3L4BC 4JI3B 1NW4A 4KHPB 2WA2A 3HK2A 1EWTA 1POXA 2NUPB 3CZAA 4RD2A 3ZEAA 2VHEA 4BNJA 4NQZA 4C4RA 1JB9A 4C7JA 1OFTA 1DLIA 1G0NA 2BEWB 1R5BA 3FMGA 4N5DA 4MVYA 2POQX 3ZE1B 1AY0A 4G26A 2GEBA 1PIWA 4G24A 1ADYA 3A6GA 3C8ZA 3MCAA 4ZOLB 3L6OO 5ADHA 1RHQA 1RM3A 4OV6B 5HX7A 2GILA 4TZKA 1NG9A 2I4TA 3GRVA 1NURA 2PPVA 3L7AA 3NC0C 2I4LA 4RPHA 2UYOA 1JFTA 3RJMA 1GR0A 3ICQB 3CVVA 2FOIA 4IVPA 5FPHA 4ACAA 1B14A 4YQYA 3ZQKA 4B81A 4B71A 1MZVA 3AIMA 4H7HA 2XCTB 2VHQA 2BTQB 4I19A 1DT5A 4DAOA 4TL7A 1PFWA 1OKKA 3LCJA 1VC2A 1ZUHA 3KR0A 2F8SA 4D3FA 1EFVA 4POOA 5JBNA 5CYFA 4B3JA 1Y1KE 4A82A 1MTZA 1QM5A 2HWYA 3M3HA 1P73A 3ZHYA 1A1SA 3V8QA 2FZKA 1OFHA 4HQKA 1ONOA 2BHTA 3OT1B 4M1EA 1Z6GA 2X5OA 2H2IA 4OD0A 4IDAA 5F1KA 3MWEB 3W6NA 2PVSA 2ZIVB 3B6ZA 1RAHA 3ZW7A 2P6UA 3N0RA 3GNLA 4JUBA 3PC8C 1WMFA 1K4YA 1ND5A 3S1AA 2O2IA 3V8MA 3QY0A 4HDSA 4BV8A 1W1UA 4L0QA 4WZAA 2MJLA 4MUIA 4ZMRA 1ZJ5A 1KH1A 3UH1A 2C9DA 1NBMD 3UGQA 4D97A 5CFOA 2DSNA 3SQOA 2Z56A 2ZUWA 2BAGA 2R6JA 3LQQA 4BO2A 2Y1OA 4GYJA 1DJPA 1JFVA 3PR2B 2P68A 1GA4A 1RVDA 4DY6A 5IDWA 3SYMA 1XP8A 2QSZA 1RQGA 2VTBB 4O29A 4YAUA 1OX4A 1GUZA 4RX1A 3C3CA 1PW5A 4ENSA 1DS6A 4O33A 3RS8A 2AF3C 5AQ1A 3VPCA 4OHZA 3QEJA 2JIQA 3ZCXA 1I2AA 4F1KA 2A0XA 2H18A 2PMWB 1RBMA 4LV8B 4JI4B 4HLUC 5THKA 1XD9A 3KYIB 1N4DA 4U7DA 4AWBA 5BN1A 3L43A 3KAPA 5DNDA 1QAQA 3IEVA 3DGEC 2J07A 3WLRA 4BE4A 3T5BA 5JISA 3FVTA 2YMLA 5AW9A 2PD3A 1ORTA 1F3LA 1H8EA 2ZBFA 3B9PA 2DBYA 3G0DA 3K96A 2NUTA 4G37A 3BILA 1SG9A 3HFGA 3MTAA 4TTPA 5COAA 1JG7A 3V3KA 4PLFA 4BNGA 1XWIA 2R66A 4IH9A 3G17A 3FKSD 3O5AA 4F71A 3SFZA 2HU8A 4ZI7A 1SU6A 3AFNA 1ZBDA 3OCYA 5AM0A 2OBLA 3OLQA 3TPFA 3GP8A 1Q0TA 3LS2A 3NBFA 1CS0A 1Z06A 3GEGA 1X94A 4FWBA 4BKQA 1A9YA 2DP4E 2AFIA 5GM1A 4RK1A 2VP5A 4LGYA 4BWFB 1S2LA 4EI7A 5F2NA 4AYTA 2GF9A 3JZDA 1A4IA 2E49A 4IG4A 4B3MB 5I45A 3UT5A 3O2SB 4IJVA 2O05A 3BFKA 3ABQB 3EBOA 2B7LA 4FMCF 4X6YA 3ZXYA 2FHSA 1SUBA 2QVLA 4XJXA 1NQTA 1T9ZA 3PDUA 4M87A 3TB6A 3FY4A 4RAOA 3BL6A 1CDOA 1CUCA 4UU8A 1E94E 2ZYHA 2JFOA 1XPUA 1KRXA 3NLLA 3K1TA 4I1SA 1TUGA 3EVCA 5EJ9A 4MV4A 4QXAA 1L7BA 3OZBA 4OSOA 1FVXA 3BIJA 5D3ZA 1MO6A 1UJNA 4FYVA 5KDDA 1HYQA 1JPNA 5DYTA 2OZLB 2R79A 5B58C 3H2JA 4KVAA 1R50A 4MVJF 1EVYA 1YQ9A 1RRGA 2J0UB 2O3SA 2OM2A 2WU1A 3GOQA 3QUCA 2GN2A 4W5WA 4YRGA 1P3DA 4FX5A 4BUZA 3F9IA 1R0SA 3HJBA 3I0ZA 1QCCA 1IVNA 1MC4A 4AZTA 4B84A 1CY7A 4CIYA 1NPTO 2IY7A 3L9XA 1E1KA 1RP1A 1CERA 2G25A 2R7NA 4IGAA 1B1AA 4ZVOA 1SC6A 1RQNA 2AUMA 4OBBA 1GQQA 1U8XX 5IAKA 1TC1A 1W581 3FYUA 4OMDA 1D9XA 4UVIA 5AFSA 1DL5A 2TSYB 5BSWA 3Q8MA 1RZRA 1WF6A 5KQPA 1QDEA 3IV9A 1ILEA 4TWAA 3U13A 3FRHA 2WQ6A 1Q1EA 3DAGA 1UOOA 1FRZA 1Y33E 2J09A 1SIOA 1Z68A 3M4YA 2EJVA 2XE8A 5DHTA 2EYQA 5TDHA 3TFWA 4EP1A 3ELBA 4R1MA 3LLUA 3RI3A 4ETIA 5DBHX 3PJEA 4ZDKA 2EBUA 1V5EA 1L1EA 2D2EA 3DL7A 3WRYC 3RUFA 1UBRS 5D1NA 3DE6X 1QMPA 2ZBPA 4PLVA 2FPWA 4X7PA 3KXIA 1HTTA 3QVKA 5TXGA 2HO4A 1QV9A 2OBXA 4IUCS 3ETCA 3H9BA 3DKKA 1KZ1A 3VNRA 2CVOA 4TL8A 3VR2D 1RP7A 1W2WB 3TCXB 3RLFA 1ZISA 3WNQA 4A8JB 3RR2A 4X6LA 3EXAA 1FIUA 4BLOA 3UNXA 1URPA 3ZU4A 3ORSA 4R2JA 3PUKA 3WJ1A 1EG7A 3FNFA 5C8XA 4Y0VA 3RJ5A 1T1GA 5LB2A 4Z1OA 1E5TA 4M8KA 4EEKA 1RADA 1RE1A 2H2FA 3INYA 3GPIA 3M89A 4CF3A 3EE6A 4F12A 4CMBA 3PEYA 2O1WA 3DLCA 4QOFA 1QZTA 4BB5A 4K0RA 2QB5A 1B0PA 1P1BA 2BDTA 1Q83A 3HCPA 3P8ZA 2X0EA 2V1UA 3IX7A 1DIBA 3CTPA 1P2FA 3FWZA 3G79A 1AA3A 5HJ7A 2P1ZA 3FB1A 3GUZA 2ZK7A 3O6VA 1CYDA 3T95A 1TPZA 1SUIA 4RLHA 4LECA 1NGSA 1R8QA 4JHXA 4OKNA 4UDOA 3HMKA 3T6KA 1YDMA 4QUEA 3E0XA 2ES4A 3ZHQA 4YCBA 3RBAA 1W52X 2H0AA 3H4TA 1I4WA 5KOIA 5DYWA 2BFDB 4PM4A 1Y3FE 4BN0A 1O2DA 4H2DA 5IAGA 5D6NA 1E1CB 3D7MA 4FLEA 1YIDA 1UMBA 3Q3HA 4UBKA 4QUJA 5J43A 3ZE7A 5K2OA 3M49A 3OJCA 3IQWA 2F43A 4PC6A 1W4RA 2ALJA 2PFKA 5DHPA 1LC0A 1NJ8A 4MPJA 2CNKA 1S8AA 3DDCA 3UICA 3AUAA 1ETHA 5A0TA 3D6TB 1ZXLA 1RYHA 1RVV1 3JQ9A 3KSUA 3ZK7A 2VRCA 1TJYA 2DR0A 2M6KA 5JH7B 1QQ6A 1M76A 4R40A 1KH3A 3W2TA 1GPUA 3NKFA 3PSHA 1IWBB 4A8PA 1TIPA 4K2AA 1PD1A 4R1PA 1Y3CE 2UZ0A 2EFDB 3R6WA 4DARA 1ZK4A 3AP2A 4A0GA 2FETA 4EUHA 2V03A 4MITA 4QYTA 2OB2A 1KQPA 2FR8C 2A4MA 4QTYA 5CB6A 3BORA 4GICA 2JCBA 1SVMA 4Y2RA 2DUJA 4I5IA 4A2PA 1GGFA 5JDIC 2E3JA 3BJEA 2FXVA 5M7EA 1CZKA 1NWCA 2H2HA 4J07A 3VO2A 1T36A 3ZJ4A 2JAUA 2ORED 3LV8A 1SBYA 5BW8A 3V1NA 2UXCB 3AJAA 2AYYA 3IIKA 5KTMA 3WZLA 1Z4QA 3NC4A 5JCPA 2FH5B 4J0EA 4ZEXA 5FJIA 3U44B 5IUNC 2HA4A 3I5XA 3ADDA 3BMCA 3NBAA 3ND7A 4G0YA 4IGFA 1SC1A 3TSWA 4KU4A 1DTSA 4FOOA 2ACVA 4KFSA 2Q3HA 3A3OA 1F6DA 3ZWWA 4EPYA 5A5EA 1J2UA 1U0RA 3L9WA 3LUHA 3QHAA 4OB7A 3MYRA 2UUBB 2XF2A 2IPMA 4QU8A 1RZUA 1USGA 1D2NA 3ZQ4A 2VAVA 1MC8A 3OOHA 4RA6B 5IH3A 3IIEA 3U4HA 4L74A 3BXFA 1U31A 4LW8A 4FN4A 3ZY4A 1N2BA 1OLOA 3GZTB 3LTNC 1E2BA 1H0SA 1LQ2A 2YICA 4QTTB 1TT5B 3BTOA 3KSRA 1VMDA 2WMOB 3UKJA 1JAHA 2C7OA 3LSTA 3AP1A 3B2NA 1BIFA 3CLUC 3L7OA 5ENVA 1B15A 2AB0A 2VUTA 6LDHA 4RJKA 4K88A 4OG2A 1DBQA 2OXRA 2FPIA 4WI1A 3TLAA 5JBIA 3QFFA 5EKUA 4M1KA 4LTMA 4KLAA 2D8AA 1YCDA 3OJ0A 4M7OA 1J25A 3FCXA 3JTEA 3BAZA 2OORA 4GSYA 4BLWA 5DP1A 5JQWA 3ST7A 2E21A 5AW6A 2OENG 4IS2A 1JE0A 4RSHA 1M6NA 3GFQA 1IY2A 4MUFA 4BCDA 3I1JA 4P92A 3OBBA 2ZWVA 1ADJA 5CT6A 1QKJA 2X76A 3AHJA 3K15A 1PS8A 3LTEA 1MFZA 4M60A 4ZCQA 2CEKA 1NOIA 3L2OB 4G1UC 4L02A 4HSGA 3UT0A 1O87A 2JJQA 3CUWA 3H9UA 3X1YA 5JMWA 4RV4A 4MUNA 1P18A 5JSQA 1CP3A 2BR5A 3I2GA 4IDPA 4H0FA 1NUQA 3UJ6A 1QGUB 1ODFA 1RSZA 1T25A 5TR9A 1GKYA 1AV7A 2IKQA 2D5AA 2RAFA 1KYYA 3D6MA 4KQCA 3LD9A 2YYYA 3FOBA 1JV2B 3RWOA 2GAFA 4DR6B 2XI4A 1JAZA 2EX4A 2PUBA 1NULA 4Z0TA 3VJLA 1JR3D 3V4SA 4IDOA 1ENOA 3CLVA 2E4VA 1QR6A 2E0IA 2YJ6A 4LJSA 3GQBA 3MCVA 2HLHA 2P9YA 1FVFA 3EPPA 4R5HA 1AMNA 4OA5A 1Q3HA 2D4HA 2VP2A 1B8UA 2HK6A 1NVAA 2FMKA 3CZ9A 3WB0A 2E4AA 1FFBA 2OXCA 4NCHA 1ZL2A 3EZXA 2I55A 4GBGA 3MRTA 4DCCA 1WETA 2Q2WA 4RHXA 3ROXA 4BWGA 2EP5A 3QW4B 2PZGA 4IXTA 1SXJD 3L0YA 1NF9A 3C6KA 1OX6A 3U9TA 1OMOA 4DYHA 1B42A 1BH6A 2VOEA 2NSHA