1UBCA

Structure of reca protein
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
326
structure length
303
Chain Sequence
APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGLQARLMSQALRKMTGALNNSGTTAIFINQTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Mycobacterium smegmatis RecA and Its Nucleotide Complexes
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Recombination
molecule keywords RecA
total genus 87
structure length 303
sequence length 326
ec nomenclature
pdb deposition date 2003-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 1ubcA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ubcA01
3QXJA 4IVRA 5B58C 2QL6A 1E2QA 1RE0A 3CRRA 1O3YA 3TKLA 3MJRA 1F6BA 1P5ZB 2AN9A 5JJLA 4CEIA 4KYIB 2ZJAA 1MV5A 1OH6A 3U7GA 5L3VA 4AYXA 2GZHA 2J59A 2QGZA 3R9XA 4EDHA 2FFHA 4ZCIA 4OHYA 2OHFA 4PXAA 2A30A 3THXB 2Z5FA 1X3SA 2G83A 3G82C 4QG7A 4IXMA 1S9DA 4W5WA 4N0DA 1DAFA 1QF9A 2QRNA 1SKYB 2PZFA 3I3SR 3WNBA 5CK5A 1QVAA 3THWA 3BB3A 3AF0A 1DO2A 4OHWA 1Q3TA 4X8OA 4BWYA 1MH1A 1Z47A 2HUPA 2W0MA 3E1SA 2ZSBA 3AQ4A 5LPNA 1NKTA 3VTKA 1YVDA 4IOLA 2BMDA 2Y8EA 3PVSA 2YWHA 3LO5A 3RC3A 1NIJA 2QE7A 4Q01A 4LPKA 1NNEA 1EFTA 1ZAKA 1XZPA 3CRQA 1FNNA 1A2BA 2Q9CA 2REXB 5D3MB 1XX6A 3DM9B 4LGMA 1YHNA 3F8TA 1RRFA 2JLXA 2GCOA 4E22A 3PUXA 1M7GA 2GEUA 1CU1A 2FDCA 3NH6A 4IDPA 5FR2A 4BFZA 4NBSA 1T6NA 2Z43A 4US1R 3P27A 1P3JA 5GVSA 1D9ZA 3HPQA 1VMAA 2IL1A 2FPLA 5AUNB 1Q20A 2L0XA 1XEXB 2F43B 4HUTA 1PJRA 1RJ9A 4YXWD 1F2TB 1U8AA 1H65A 2ZRPA 3WY9A 5HKKA 2IYLD 3G0HA 5CB8A 4GDFA 2ZRDA 3QVUA 1NN0A 5JI3E 2OBLA 1FMLA 1KDOA 2XJ9A 3TAHA 1E2GA 3V00A 4BFWA 4DVGA 1GIAA 2I4IA 1IN6A 1CR2A 1U8ZA 3I32A 1NVVQ 4LBYA 1KY3A 1CP2A 1GRRA 1XTIA 1T9HA 1UJ2A 2Z83A 4I99A 1G7RA 1GKUB 5IRCD 4D0LB 1D9XA 1WB9A 4O3MA 4MYCA 4G01B 1ZD9A 2D06A 2CE7A 2O8EA 4CRWB 1ETUA 3T1QA 3DEFA 4ZCMA 2F3TA 1H8EA 3B7GA 3U6BA 1J8MF 1L2TA 3ZDQA 5EP3A 1KO1A 1W47A 2FOLA 4HZUA 3I61A 1OYWA 2AWOA 5FPSA 1S1MA 4UJ3A 3EXAA 2BIFA 1UBEA 4AK9A 2ZJ5A 1ZW6A 2E9SA 5HE9A 4O0MA 4AKHA 1YKSA 5CDFE 1V5WA 4AIIA 3BAFA 3I8XA 1UKEA 1DS6A 1NF3A 1SXJD 2FFAA 1DAKA 3TW4A 4TYYA 4RCZA 1JJVA 2QA5A 2I1QA 1E0KA 2VHUA 1CLUA 1IXRC 5KSZA 3IILA 3T34A 2QMEA 5CIQA 1OH8A 3THYA 4EKDA 3Q85A 1E9DA 2G0NA 3SBEA 1IOZA 5KPJA 3NC1C 3TRFA 2JIZA 2GAAA 3AGPA 3GFOA 4PAMA 3SDZA 1CRPA 2GF9A 4M9SA 4LJ9A 2C8VA 4H1VA 2PJRA 1II9A 4LJAA 4AURA 4D0GA 4BFUA 4KU4A 1P9RA 4BEJA 3UWOA 5JRJA 2W6IA 3AF4A 1ZU4A 1FQKA 4P0TA 4S2EA 2J0VA 4DLYA 5F9FA 4RD3A 3TQFA 2ZRJA 1XEWX 4WZBE 3VKHA 3TK1A 2NO0A 3A1UA 1OYYA 1XJ0A 4IJMA 4MRVA 4TWZA 2ZROA 4OHXA 1Z8FA 2Q21A 4M1TA 3NBZC 5E7JA 5M04A 4IOKA 3CO5A 2QU8A 2R8RA 3ZIAA 4C7OA 3A1TA 1UFQA 2QGNA 2R6CA 2V8OA 3T5DA 3PXGA 3W8RA 3ZVNA 1E9AA 1DELA 3RDPA 4C7OB 2VHCA 5SZHB 3VFDA 5SZJA 5BN4A 1NY5A 2BWJA 1G21E 2GRJA 5J4LA 1S2MA 1CJMA 4UNRA 3HR7A 5EXSA 4KSBA 1NMZA 1DAIA 2C96A 4PQRA 2R62A 4O25A 4HATA 5JZVA 2BMFA 3DMNA 5CYOA 3U3JA 4AI6A 4IDHA 2IYZA 4ESVA 4DCTA 4EIWA 1YR6A 1L4UA 3K09A 3KTAA 2QG6A 4FI3C 3TMKA 5J4VA 3QXSA 1IY2A 2FX3A 4UXJA 4B71A 1W36B 2IHBA 1NVUQ 3CX6A 3L0IB 2ERYA 1BYIA 1KI6B 2HV8A 1X1RA 3QKUA 3KZ1E 2YINC 1JNYA 2VQSA 2WMNB 1A4RA 2CCKA 3IBGA 1J7KA 2NGRA 4C0HA 2IYQA 3AUXA 1Z29A 1YQTA 1OFTA 5F9HA 1GITA 5KNCA 1Z6YA 3QSYA 5JHGB 2CLCX 4DBLC 1T0JB 5KDOA 1Y63A 1ZU5A 2GBLC 1E0AA 4XVRA 1W0JD 2KSQA 2TMKA 2XZOA 3LA6A 3GFPA 4BPBA 1ZUHA 1QHIA 1FTNA 2J7PD 3Q9LA 2OAP1 2WWXA 1OT3A 2ZI5A 3EA5A 4DHEA 4JLAA 3TBKA 1ZNXA 2ZSAA 2JJ1D 3F5FA 2P67A 2BMJA 3X1DA 3I92A 3LW7A 1ZRHA 4B44A 3N70A 3JVVA 3RS5A 1HV8A 4NCHA 2F1JA 1W4RA 2N46A 2J41A 1E6CA 1UKVY 2IW3A 2QM7A 1DAMA 1P60A 3KJIA 2VP4A 3QUSA 1D5CA 2WWGA 4POAA 2CL6X 4KCGA 1XD9A 3KJEA 4C2TA 1GWNA 1OB5A 3PQCA 4E07A 4JZKA 2VP6A 1AN0A 1X6VA 3BD9A 3SR0A 4PR0A 3B60A 4RD6A 1RZ3A 4JKYA 4BZQA 4ZDIA 5GJWC 3WNCA 1UKZA 4W7SA 1Q1QA 1GAJA 3QENA 4URXR 1VG1A 3CWQA 4TMTA 4AD8A 3CB4A 5UKDA 2NO7A 5J4KA 4EPXA 2J9RA 4PFSA 2EVWX 4PPFA 2OFWA 2ZU0C 2CHVA 3EC1A 5KYKA 4GOKA 1E2MA 1W0KD 4OQXA 2EU8A 5C2JB 2JIZD 4JLMA 4D82A 1W7AA 2FA9A 4Q1AA 5TMPA 4JYCA 2XNDA 3TSOA 5H8WA 3PCRB 1P62B 5FL7A 4CT4B 2IF2A 2PLFA 2FSHA 3X1YA 3UG6A 2HXYA 3KKPA 4HAYA 2ZE5A 3GLIA 3QKRA 2W6ID 1W44A 2WJYA 4EQ6A 4QGAA 2Q6TA 2G3YA 3ZQJA 1HTWA 1GKYA 4A0FA 4C0KA 1LVGA 3TIFA 1G7CA 3LNCA 4EUNA 4MDFA 3FHCB 2VA8A 1D2MA 4NYMQ 2FH5B 2GJKA 5G3ZA 1CULC 2H16A 4Q4LA 3IPXA 2QE7D 4HAUA 4AC9A 3AVPA 2K5UA 4MRNA 4V0LA 2F43A 1ZMXA 1CR4A 1G8YA 3GJXC 3ADDA 4FMBB 1OF1A 5IT5A 1P6XA 3AVUA 5JBQA 1II8B 4PAOA 4HUQB 1WF3A 3QQ5A 4XH9B 4A0GA 4YMTA 5BQ5A 2RGNA 4HZIA 1U99A 4UKDA 2O8DA 4TYQA 4FMCF 4NU0A 2CK3A 3EIQA 2DYKA 5EXPA 1BS1A 4YXWA 4OI0A 1TL7C 3TVTA 1MABA 2DPXA 2V4ZA 1EFRA 3EZFA 4JLDA 1U9IC 4QBFA 3VR2A 4F91B 2JASA 4CYMA 3I73A 3MLEA 2Z4RA 5JWHA 3FTQA 1RRGA 5FPYA 4TZ0A 1XCGB 2HF8A 2J5XA 2QUZA 3P4YA 4I4LA 4ZIRA 1NBME 3KUCA 3LBIA 1TU4A 4QHSA 3P4XA 4WIAA 1P2SA 4FCTA 1ZC3A 4JVSB 2O8FB 3JZAA 2DFLA 4LJYA 1AS3A 5FTMA 5KNBA 1A5TA 3VR1A 4BLPA 2J7KA 5DN6A 1JECA 2AWNA 3MWLA 3I1FA 1UAAA 2F1HA 3BGWA 3EA0A 1OXUA 3WMEA 5EE0A 4US2R 3B8HA 2OAQ1 2C03A 4NCJA 4UNPA 2B21A 4TSFA 1ZC4A 1WRBA 5FL3A 5CITA 1PVOA 2PH1A 4JIMA 2BVNA 3A1VA 1HA3A 2Q3FA 1EESA 3AP2A 2F7SA 1GOTA 4PC3A 3WMFA 1SXJA 1IONA 1JBKA 3WHKA 1FW6A 5FPKA 3AF2A 3RAPR 1T4GA 4L9SA 1E32A 3AVYA 1GDDA 1IY0A 4YMUA 5KSYA 2QENA 1S3GA 1TF5A 3MG9A 3RRNA 4B34A 5GJCA 3DZDA 2IHYA 2OILA 5KSPA 2ZRBA 1QHXA 4BFYA 1TQDA 2R2AA 3A4NA 2D7DA 3A6PC 3A1SA 3C15C 1WXQA 2QQ0A 1OE0A 1VHLA 2P6UA 3RS3A 1N6RA 3LBNA 3GCGA 3CRVA 4JLOA 2NQ2C 1XTKA 2YWFA 3TW8B 4X8LA 5TB5A 4B3XA 1ODFA 4DLRA 3SYNA 1E2DA 1NN3A 1U81A 4N1AA 1KYIA 3R7WA 3RNLA 3LLMA 5G3YA 4WW0A 2FNAA 3RLFA 1CJTC 5DNYB 5JSZA 4BEBA 1NMXA 4CVNA 4IFEA 2XZLA 1E2HA 1ZJ6A 3Q8XB 2ZVQX 1OFUX 5EE9A 3ASYA 2CNWA 1KI2A 2VP2A 1PUIA 4U5XA 2CL7X 3WNDA 5CK4A 4PHTA 1T3HA 1FMJA 3FMPB 3REGA 1YE8A 4QHTA 5DHAA 4Z51A 2ZS7A 5H1YA 4Q4AA 2C9CA 2Z6VA 4D0NA 3O8RA 5ANRB 2NO9A 2V7QD 4NYIR 1E1QA 4A8JB 4HB4A 2H7VA 2QPAA 1XF9A 2H5EA 3T1TA 3BXZA 5H68A 1NLYA 2EFEB 3HR8A 1TX4B 4Q9LA 3OEHD 3QEJA 4FIDA 3T5GA 4JLNA 3P20A 4KFUA 4TTRA 1ZNZA 1U0LA 1AQYA 2OEPA 3FB4A 4DCSA 1YJ5A 3TNFA 2PZEA 4V0MA 1G6OA 1NN5A 3CZPA 1AK2A 4WOPA 1X1SA 4XSGA 5LDDC 1N6IA 4DKXA 2ZUCA 4C3ZA 3VQTA 3WYFA 2ZU6A 3U61B 5CM9C 2LKCA 2JLWA 1P75A 1U94A 5FBWB 4YDHB 3GLFE 3CZQA 1VYUA 4B2LA 2JCSA 2FPKA 4QJ3A 4QGHA 2EQBA 3RS4A 4EFMA 2WWWA 2BM1A 2AX4A 3K0EA 5C1BA 1TF7A 3HJNA 721PA 4DEXA 1P2VA 2RGAA 1N0VC 2IUTA 2X8AA 5KOYA 3PUWA 1NVVR 3AH8A 2FN4A 3U3MA 1KSJA 4Q4JB 1ZM3A 2ZR7A 1AS0A 1OIVA 3N5CA 1R0XA 4FN5A 3THYB 4A6XA 4IKEA 3RYTC 3RS7A 2OCAA 2EFDB 3KXKA 4RY2A 1YZGA 2C2HA 5DLQC 5K8LA 3W8NA 1MRSA 5DO9A 4EFNA 3LX8A 5SZKB 2BCJQ 3TLXA 5BYJA 2ZRMA 4JT2A 3E5HA 5KDLA 4V0NA 1M7BA 1JXOA 2R6AA 3SC3A 2ZRAA 3F0TA 4LUCA 3CPEA 2IUSA 2JATA 4DSTA 3A4LA 3P26A 4GOXA 1WBDA 1NSFA 1F2UB 4DB2A 4DT1B 1NMYA 2VH5R 3I72A 1F48A 1G8GA 3ZJYA 4C0JA 4G3XA 2IK8A 1R5BA 2RMKA 1R10A 1G17A 3MWKA 3BERA 4TMVA 4UXIA 2KBEA 1EK0A 4Z8XA 3FPAA 4PO8A 3SNHA 4H9GA 4P4SB 3OZXA 4XTRA 5EE3A 1SHKA 4D81A 1IHUA 3MFYA 3PEVA 4LHYA 2XNDD 2ZJOA 3EASA 521PA 3EPJA 5CYPA 4LWZA 2ZIAA 3LH5A 3K53A 1GNQA 4GZLA 3WHLA 2CL0X 2C78A 1OFIA 4ZPXA 3ONWA 2D3WA 4IEIA 2QORA 1ESNA 1N0UA 1XTJA 3VKGA 4HSEA 4B33A 4TLEA 3GLHB 1KOFA 4QM7A 5F98A 4WXPA 2IS1A 3O8DA 3AKEA 3WBJA 4NE2A 3U4QA 3Q5DA 3QPVA 3EWAA 3K0AA 2IS2A 3BB4A 1Z5ZA 3B1XA 1UDXA 4FW9A 1N5LA 4M9XA 2QT1A 1LTQA 5JHHB 2IX3A 1E79A 4JVMA 2A7QA 1A82A 4LBWA 1XJQA 2ZAOA 3BH6A 5JEEA 2CEAA 1NJFA 4OK6A 1OXSC 1TQ4A 3NC0C 2V3CC 3ZVLA 4ZIRB 1M6NA 1KO8A 4G5SA 2WV9A 2GAOA 4L15A 4KVGA 1SULA 2QY9A 4MUAA 3SE0A 4WBSA 5SZIA 4HDCA 3DVLA 5G41A 1G7SA 4A8JC 2XB4A 3CR8A 1OH5A 4US0R 3DL0A 2RKOA 4EPYA 4JJZA 2EWWA 1XJCA 4Q4AB 1LS6A 1QHHB 3QF4A 5JFGA 3SYKA 2WAXA 2O8CA 5G40A 3WYGA 1RKBA 2RGCA 2VIIA 3L0SA 3MAAC 821PA 2BBTA 5FBQB 4B76A 2WJGA 4MYHA 3MCAA 3AF3A 1N5KA 1KK1A 4LDJA 1G16A 3OESA 3UANA 4OQNA 1TUEA 4BRUA 3E70C 1LS1A 2IWRA 1G5TA 4E09A 4YQFA 4PZLA 4CEJA 4M2LA 1SVKA 3MGCA 5C46F 1RFLA 3L8YA 4Q1DA 4ARZB 5HKKD 1O87A 5E4FA 1G3IA 5DSZA 1TEXA 4G5QA 1XB2A 4DCNA 4C9BA 1TAGA 1FNMA 3M6AA 4X8HA 3RWMB 3GJ7A 2YWGA 3GJ4A 2C95A 3CWZA 1T3LA 2ODBA 5J5CA 1JPNA 1IM2A 2YKGA 2CMKA 3T12A 2JA1A 3QKSA 4PANA 3C4JA 3AF1A 3VKWA 1XP8A 3LDAA 3K0FB 3AVVA 2VHJA 4PPNA 2XTNA 3O8CA 3NBFA 3ADBA 1E4VA 4MGKR 3A1WA 1DAEA 2IBMA 2MSDB 2ZJZA 1WCV1 1DAGA 3R7WB 3SJZA 4B43A 4MUBA 3PEWA 2JLYA 4QJ5A 1E9FA 1FFHA 2OFXA 4JLKA 3HP1A 1G19A 3UWKA 5L3SB 3AM1A 2A5YB 1LF0A 2BJWA 2HF9A 3KFVA 2VP9A 1R8QA 1U0HC 4MGYR 4F4IA 4XD7A 2VLIA 4K8OA 2W58A 5KU1A 4IDQA 1OW3B 1T91A 3B9QA 1JAHA 4Q7LA 4RCYA 3UMSA 1CS4C 1KI8A 2YVUA 5C4MA 1EXMA 2A78A 2OV2A 1II0A 4A2WA 3IEVA 2J0SA 2IF0A 4BFXA 4XD7D 4IOMA 4LHXA 1JR3E 1ZM4A 5K8IA 3MWJA 1XZQA 4NCKA 3M0EA 1T8TA 1X8JA 2IXEA 4WVFA 2EFGA 2XNSA 4C0SA 3TJZA 1U0JA 4RKFA 1KI9A 1KJZA 2F9MA 3CLVA 3GJ3A 1R0WA 3ND8A 4KFSA 4RZXA 1GILA 1L8QA 4PZZA 4QOSA 2C99A 1QHNA 3W5IA 2KBFA 4TYPA 1NKSA 2HDNB 2WJVA 4MRPA 1XPUA 3AVXA 2XOKA 4GP6A 2ZR9A 4BASA 5B57C 1OKKD 1FZQA 4Z54A 4F4CA 1Z06A 1LV7A 2OE2A 4NCIA 5EUQB 1W0KA 2G1KA 3PR1A 4A1FA 2RGDA 2D2EA 1XRJA 3CF0A 4JLPA 5D3QA 3CR7A 5FOVA 2WICA 3R20A 3Q7PA 1OKKA 1VHTA 5FL7D 2V6JA 1E1QD 5B64A 4FMDF 1EWRA 2SHKA 2QSZA 3ECCA 3LY5A 2O8DB 2HXSA 1RYFA 4FMDB 4YMSA 4C0BA 4GBMA 2WWHA 1R0YA 5BW8A 2WSSD 4Q1EA 4RFSA 2KJQA 2JJ2A 1EFUA 4HUQA 5EE1A 2C98A 5EP1A 4KJZA 5FUVA 2GJSA 1GFIA 2AR7A 3IQXA 3WRXC 2O0HA 4RD4A 3P32A 1I4DD 2GEDA 2JJ2D 4M1OA 5E7MA 5FI1B 3BE4A 3PUYA 2QP9X 4HLQB 5AUOB 3I62A 2YHSA 1KKMA 2C9OA 2QN6A 2V1XA 2X19A 1PLJA 2RAPA 3OF5A 1KI1A 3UMRA 3LQQA 3KKNA 3K1JA 1YR8A 2ZRKA 3LXRA 1E4YA 3AVQA 2ZVPX 3GLIB 4LY6A 4V03A 5KSOA 3IO3A 3IEUA 4LJ5A 1VTKA 3HYRA 1XU4A 3S1AA 1W4AA 3I5XA 2O8CB 2X1VA 5FPTA 2YWEA 2ZI3A 1SXJE 4HLDA 3SJCA 3TSWA 5GADl 4DSNA 1UF9A 4OQLA 3TUJC 3K0SA 4OQMA 2GDJA 4KAXA 3C5CA 2C9YA 2NZ8A 4PO9A 3V9PA 1D8TA 1TUIA 2XJ4A 1SVSA 3K9LA 4AKIA 1MO3A 3D7MA 3H4MA 2WWYA 3U7EB 2HCJB 2LKDA 4FWIB 4KBGA 2D4HA 3IBYA 2D74A 5JWOA 3GP8A 4I1OA 4AWXA 2ZI9A 2AKAB 1U8YA 1N5IA 4TT3A 3A4MA 4Q00A 4URUR 2GXSA 4ARZA 1GZSA 3IHWA 4JBXA 3EIEA 1VYVA 2O5VA 5L3QB 2J0QA 2H57A 1G20E 4R2IA 2O8BB 1R2QA 2IYWA 4LYHA 1E2PA 1HQYE 3B1WA 3GFTA 1XD2A 4Q47A 3PITA 1VCMA 3FMIA 2CVHA 3KB2A 4RSGA 1AGPA 3U7FB 1ZIOA 4D4LA 3H2YA 1TEVA 2QM8A 1JB1A 1QDEA 2LCFA 4C0AC 3K9HA 4M1MA 2WIAA 3B5JA 1JAIA 3KKOA 4LPSA 1KI4A 2W2XA 1AGRA 4Q9KA 3GLFA 4N3NA 4CEHA 3N2EA 2A2ZA 5AK0A 1ZUNB 2G77B 1HYQA 4R7ZA 5L3RA 2FU5C 4WAUA 4WZAE 3RABA 2WJIA 3KQKA 2PZGA 4DB4A 1NSTA 4TLAA 1PUJA 2ORIA 3DO6A 5F3WB 1M2OB 1T5LA 3EW9A 4DCVA 1KDTA 3TQCA 1IBRA 3V4FA 4KFRA 5HZKA 2J46A 3LFUA 1GTVA 2IYXA 4QBIA 1N3BA 2DHRA 1II8A 3D3QA 3X1WA 1NJGA 3GLIE 1G18A 2DWPA 1G3MA 4A0RA 4JVNA 4PHFA 4C0QC 1F3OA 1HQCA 1JR3D 1XD8A 3HU1A 4B3FX 2A3RA 4CZ2A 4JBWA 2CLSA 2XITA 1UPTA 3NXSA 3PENA 2G1JA 1XEWY 1RIFA 2V6IA 1AIPA 1MR3F 2VBCA 4DLSA 1N2CE 2PT5A 4OL0A 4L5BA 2JGNA 2FFBA 4QNRA 4URZR 1KNXA 3KQNA 2MSEB 3EAQA 4BLRA 1TADA 1DG3A 3AB3A 4L9WA 4A4DA 4EQ6B 4NONA 3QKRB 1G5RA 4UQOA 1B23P 3CNLA 2REBA 1R0ZA 3AV0B 2WWFA 4W5JA 5JCZA 4M9ZA 3KTAB 4B3CA 4M1SA 1JXMA 3C8UA 1G5PA 3QIAA 4ACAA 1BIFA 4DDTA 3CF2A 4DC9A 2R44A 2VRWA 4G0NA 2V55B 3PEYA 2VYFA 2XZPA 5DISB 1PZNA 3AVWA 1QVRA 5KHOC 1GL7A 3MRSA 1FX0A 4CT5A 4EPVA 3OEHA 2VHQA 4IHQA 4M53A 3FFBA 4Z1MA 2QZ4A 5FUXA 3RWOA 1W46A 4QC2A 3WRYC 3VNUA 1AQUA 1HY3A 4XVUA 2PEYA 1XEFA 1G64A 1XMSA 2ANCA 3B6EA 2BKEA 1OSNA 3EWSA 2AXPA 4TZ6A 4PC2A 4ON9A 4BFSA 1TTTA 1Z08A 4OHZA 2ECKA 2WTUA 1GL9B 1IJFA 2ZR0A 5EQTA 4XOIA 2AD1A 4URVR 1MRNA 1KK2A 1Z2CA 4R9UC 2PEZA 2NO1A 5EXTA 5EP4A 3K9NA 1N5JA 4LC1A 4UNQA 1N0WA 4Q19A 1AZTA 1U9IA 4GOJA 3W6NA 1K5DA 1XFAA 2W6JD 5EJEA 2AD5A 4DDWA 2QROA 5HTKA 3LBHA 2OCPA 5DH9A 5L8VA 3MJHA 4BECA 4P33A 3PV0A 4OYHA 4A15A 2C77A 4DSUA 2HYDA 1VECA 1TNDA 3CKLA 1M34E 2D7CA 2ZRIA 121PA 2HT6A 4CEHB 3EZ6A 1VG8A 4ZDJA 3KXIA 3LV8A 3Q5EA 1CIPA 3HPRA 4EPRA 2JDID 4HLCA 1E2IA 2FJUA 3A37A 4WZ6A 2W2TA 3BK7A 4BZXA 1TQ6A 1US8A 5HR5A 3ZYCA 2KE5A 3BBPA 3EZ7A 1MOZA 2IYUA 3SBDA 4PAQA 3VU9A 1ZD8A 1XD2B 3H0KA 1E0JA 1IN7A 1PLKA 5A0FA 1KAGA 2ZYTX 2YJTD 4EJSC 1TPZA 3QXHA 4CGZA 1KI3A 4OBEA 1P2TA 4ASUA 4GI7A 4II7A 2ZSEA 3GLHE 3FE2A 5HPYB 3FFAA 1ZP6A 1N6HA 3IGFA 2CCJA 4KSCA 1CF4A 5DI3B 2ZYVX 2QQEA 2WVJA 5DYGA 1G8HA 1C4OA 3GJ0A 2JJ8A 5EE5B 1EFHA 3AVOA 3U3RA 3VR6A 3GJ8A 2IS6A 5E95A 3THOA 1SKQA 4OI1A 1GNRA 2AFIE 2IYYA 1YR9A 3WYAA 1BOFA 1KTVA 3QY0A 4I1SA 3U60B 2ZJYA 4UJ5A 4PPQA 2HCBA 1P61B 4LOAA 4Q4HA 3W5JA 2C5LA 5EZ6B 2F6RA 1JQJC 4HB3A 3VHXA 1T0HB 4HLUA 2FFQA 1G291 1KDRA 2V7QA 3E2IA 4D4KA 2RHDA 1N6KA 4LBZA 4ACBA 1JR3A 5J47A 1G4AE 1YU9A 2BC9A 4AKGA 4GSYA 1XDBA 3SYLA 1G6HA 2CHQA 4PSAA 4YONB 4QGGA 2BJVA 1PV4A 3W6OA 1BMFD 2ZRCA 3H84A 4KITB 5J4HA 5JLJA 3THWB 1Z0KA 2ZS9A 5LB4A 2N1BA 4NP6A 3BORA 2CK3D 2WZQA 3L2OB 3QG1A 3IO5A 3BS4A 5A5GA 4NTZA 2EWVA 3IUYA 3NG1A 4KVAA 4P31A 4Q1FA 2QAGA 3I5YA 3NEYA 2XXAB 2EYUA 4F7WA 2FG5A 3ZLJA 3SOPA 1FPMA 1E96A 4OJKA 3TR0A 3X1ZA 4CEJB 3FKQA 4QGFA 5FBRB 1G3QA 3UMFA 8OHMA 4TMWA 5AUPB 1ZM2A 1CKEA 1XMIA 4URWR 3NTUA 3NVAA 2P2LA 3Q72A 3CNNA 2ZREA 4GNKA 1Z83A 3NWJA 4NZYA 1W49A 2PLRA 3VAAA 3GJ5A 5F2EA 3WP0A 3TGPA 1S3SA 2BBWA 1R5NA 5JCPA 1N6PA 3C14C 2LWIA 1AS2A 4G5RA 4J0QA 1P73A 3THXA 2NOAA 4M1WA 2ATVA 1YZQA 3IIJA 3FWYA 1QHYA 1KO5A 2FGJA 4Q21A 4FMCB 4TSFD 3NBXX 3KQHA 3ZD7A 1TU3A 5L3SA 4TT3D 1E9EA 5EZ5A 1W5TA 1BO6A 1KO4A 2VPPA 4OQFA 4W5HA 4LJ6A 4U02A 3T61A 2ZETA 2ZE8A 4O2LA 3C5HA 4ZDKA 1VCIA 2OESA 3JZMA 1R4AA 2GZAA 1NG9A 2P0EA 4JSTA 3ZH9B 5BXQC 5FBVB 2ZS8A 4KFTA 4NYMR 1R5OA 4CDGA 2O8EB 2DFTA 2JLQA 5BYKA 3GLGE 3K70C 1GKIA 3SN6A 3K0AB 3NEJA 1RC8A 3JVUA 2H17A 1ZYUA 3FHOA 5P21A 4IEEA 3CPJB 4NDZA 4MRSA 5L3QA 1Z6TA 1N6OA 2J3EA 3VMFA 4TMXA 4BZPA 1N6LA 2G0TA 4CEIB 2XB2A 1E2KA 4DZZA 1B0UA 2WMOB 4BLSA 1Z28A 3BH7A 2OUKA 2MMGA 4M9QA 2ERXA 4Q7JB 4D26A 3CRW1 1AZSC 1N25A 3X1XA 1KHTA 3A36A 2GA8A 2ONJA 4Q7KA 4MDEA 2OBNA 2ZQ5A 1DE0A 2YYZA 3QE0A 4P4UA 4QHYA 3EPKA 2OCBA 1FUUA 2ORWA 2CDNA 4TTQA 4C30A 1E9CA 1IAQA 1KNQA 2KWIA 5IK2A 3SI7A 1SQ5A 2MMCA 3QI2A 1R8SA 1DOAA 5EXXA 4JT4A 4Q66C 4HI0E 1CR1A 5FTLA 1M1YE 2OLKA 1Z6GA 2BM0A 3SHWA 1QG2A 2V9PA 1MO4A 4AYWA 5IK2D 2QMUA 3S1AB 5CLLA 3B9PA 2AL7A 2IYRA 1Z2AA 3GQBA 3QPWA 3U44A 3ICQB 1Q3HA 2IXGA 4MGIR 1E2LA 1KAOA 5C18A 3CH4B 1E2FA 1L7VC 2GVDC 2WWIA 1ONBA 3D31A 1US8B 2GK7A 2DBYA 4Q1CA 3DZ8A 4LHWA 1U90A 2IA5A 3RRZA 3NDPA 2DFKB 5AWFC 3B1ZA 3TUIC 3EPLA 1LF5A 5FOSA 3U2QA 4R2HA 2GESA 2QPTA 4NKRA 3T15A 3DDCA 2AXNA 4F93B 2JAQA 4TLBA 4Q7MB 2ZI6A 4DJTA 3UKDA 3IQWA 3RRYA 3B1VA 1E94E 2B92A 3N2IA 2IS4A 2WJJA 2BEKA 1GVNB 5LD2B 2XXAA 5KUTA 1UBGA 4DUGA 2AKYA 2J0UB 2XAUA 3SQXA 4RKEA 2OZEA 3C41J 4K81B 3VR3A 1NIPA 1UM8A 2GETA 2FSIA 1NLFA 4DLVA 3ZD6A 2H92A 3GLGB 1W48A 2RGXA 1PLLA 2I1VB 2VF8A 3G5UA 2VP5A 1EX7A 1ZCBA 5HCNA 4ZKDA 4IDOA 2P3SA 3EARA 2Q9BA 2IT1A 1DG1G 2YNMA 5JEDA 5CJPA 4Q48A 2B7CA 1DVRA 2RGNC 4JLVA 2JLUA 3EPHA 4TMZA 1Z0IA 1DTSA 4LCBA 5EP2A 1GG2A 2YC2C 5FOTA 4A9AA 4F38A 5FBLB 4ZO4A 1IQPA 1T5IA 2NTYC 3O47A 4XSHA 3BWDD 4KV9A 5B2ZA 1YZTA 2IYSA 2RGEA 3RHFA 2PBRA 4KODA 3LLUA 1E99A 2BEJA 2HEIA 3B13B 1NY6A 2GF0A 2ZI7A 4M21A 2ANBA 2GJ9A 4IFBA 3CUEF 4MKHA 4FXPA 5E7IA 1LB1B 4LHZA 3KB1A 1UDWA 2OLJA 5HZHA 3HWSA 5CDFA 4WXRA 5FFMA 4Q9JA 2PX0A 1SGWA 3B1YA 1XPOA 3T1OA 1DARA 1FUKA 4B3GA 4IVPA 4RZ2A 4Q4JA 3ZVMA 2BMEA 2VP0A 4TQAA 3IIMA 1IN5A 1A2KC 1J70A 3BOSA 2CBZA 4DIDA 5JWRA 4JLBA 1I4TD 1Z22A 2ZJ8A 1GRNA 2EFCB 4HAXA 4AKEA 4ZKEA 2RCNA 2W83A 3ZQ6A 1N6NA 3LVRE 4HDQB 2FV8A 3AP3A 4XWAA 3Q3JB 1YZLA 2HLDA 5KO2A 4ZDWA 1FP6A 1Z6AA 3OEED 1UBCA 2YOGA 4GFDA 2OCYC 4I1VA 4MKFA 3UG7A 1E1RD 3UPUA 2GKSA 2XGJA 2ODNA 3W90A 4LRWA 1F2UA 4M22A 3PUZA 5J4YA 1J2JA 4OK3A 4DCUA 2ZI4A 3B78A 2ZJBA 1P72A 2VEDA 2W0SA 3M4YA 3L0PA 5BN3A 2BBSA 3H1TA 4K46A 2ZUDA 2HJVA 2QRZA 1RVDA 1RW4A 1X8KA 2OSBA 3VR5A 3VU9B 1CJKC 4GPTA 1DAHA 3MUFA 2WHXA 2CVFA 4EPWA 5DN6D 4BUJA 3DOEA 4OI4A 3BIFA 2QSYA 4HAZA 2OFOA 1DO0A 4OJQA 1ZNWA 5DI3A 4BFVA 1H8HA 3ASZA 4IOJA 3OHMA 4OI2A 3CRMA 1UKYA 3TSZA 2QAGC 4FINA 1DADA 1HT1E 4U7DA 3J81k 3GEEA 1H8ED 2DR3A 3REFA 1RYHA 2H8KA 4Q02A 1Z0AA 3A8TA 4LBVA 1RPZA 3OE7A 5IHPA 2ZRNA 2QT0A 1OH7A 4QNMA 4PX9A 4PPGA 3DMDA 1VCNA 1BMFA 1JQLB 2IXFA 1ZD1A 4YLGA 4LJ4A 1ZUIA 2WBLC 4LYFA 1QHHA 3QF4B 4N0EA 4YMWA 2QNRA 2AK2A 3QNUA 3OE7D 3UK6A 1GL6A 1KJWA 4H1UA 1QHGA 3NBYC 5KNDA 1G7TA 4B48A 4YMVA 4QL3A 2D2FA 2YOFA 4LI0A 3ADCA 2XSZA 2ONKA 4M1YA 2DY1A 1Q57A 3D6TB 1FTSA 4B6EA 4QFMA 4NH0A 2E1RA 2I3BA 3VR4A 3BRWD 3NDBB 1CJUC 3FYHA 2MSCB 2FEMA 4A92A 2QTVB 1TMKA 2CLDX 2XSZD 4TL8A 4P32A 5TV2A 3AGQA 5KTYA 4DDUA 2OT3B 4I1UA 4V02A 3TE6A 1W4BA 2NO6A 3NHAA 3HYTA 2A5JA 2BDTA 4IXNA 5CM8B 5JJKA 2YV5A 2O0JA 3GLHA 1P7CA 5LBIA 4LJ8A 1Q1EA 2WSMA 2ZJ2A 3L43A 5DI9A 4XWKA 1MKYA 3RSOA 3FOZA 4V0OA 4PZYA 5DYIA 3ZZTA 2QBYA 1ESMA 1GSIA 1KK3A 1KSFX 3R9WA 1XBTA 2NPFA 4P4SA 5DHFA 2GCPA 4Q18A 1OFHA 4V0KA 2WPDA 5DGXA 1NN1A 2QPOA 2WOJA 1SZPA 1OXXK 5JSZB 3QKTA 2ZEJA 1T3SA 2DCUA 1Z3IX 3PG5A 3K0CC 3OIVA 3QJYA 4HDOB 4TLCA 2XTMA 3NH9A 2ZSFA 3R9IA 1F5NA 421PA 1VG9B 4YDSA 5JECA 1RJ9B 2GVZC 2BBOA 2RHMA 3AKCA 4NMMA 3OFNA 5IDVA 5B30A 4RZUA 1NP6A 1OXVA 1P9NA 2KI5A 1WA5A 3A58B 4MKGA 5K8UA 3GLFB 4Z8YA 4XIGS 3U44B 1Q12A 1YR7A 4DIEA 2F9LA 4BLQA 2GXQA 2IYTA 2ZTSA 1IN8A 1YZUA 2QEQA 2W2VA 5H70A 3ZGXA 4MRRA 4Y0AA 2QMHA 4B35A 2J45A 2FPMA 3OEEA 3UXMA 1COWA 5EUMA 2ZM5A 4M1KA 2WAYA 3KX2A 3V4RA 1J99A 3GD7A 3QBVA 4G5GA 4ABYA 1MABB 2Z0MA 1Q22A 1W5SA 5TDHA 3F3YA 1IXSB 1W36D 4FCVA 1R6BX 2ZYWX 4F4JA 4BRWA 4TL6A 1K8RA 3SZRA 3OAAD 2QTHA 2HJGA 3R8FA 4A82A 4LSGA 4GMDA 1XTRA 3W3AA 4LYAA 2RGBA 3UATA 4PC7A 2ZANA 3VHLB 3GLGA 2Q3HA 2B7BA 5JS7A 3EIHA 3FKSD 4PO1A 4FWTA 1XCPA 1GP2A 3QEOA 1AM4D 4LJ7A 1NI3A 2WJHA 4DLWA 2A5GA 1WQ1R 2ZAMA 2VTKA 1A7JA 4ASUD 3CX8A 1XPRA 2DWOA 3Q7QA 4PTLA 1E98A 4DWJA 3C7KA 3MSXA 3ZVRA 1OLOA 1ZIPA 1S0UA 4B47A 2F1RA 5AJVB 4CIDA 4GMXA 2PJZA 2F55A 2YOHA 2E87A 4JL6A 4EFLA 1I4LD 1XTQA 5FOXA 4C0LA 4RD0A 2CXXA 1J90A 4B74A 4GT1A 4C4PA 2ZE6A 4TN1A 3GJ6A 4HAWA 3WP1B 1NRJB 2O8BA 2P6NA 5AR1A 4DUGD 4GP7A 3SFVA 1FOEB 3FGNA 4KXFB 3MMPA 2PCJA 1CXZA 5TARA 4A8JA 2ODEA 4TL7A 2IWHA 2AFHE 3L82B 4M0LA 5JJIA 4URYR 3SHFA 3KKQA 4L16A 3RVBA 1VYTA 2FMXA 1XTSA 2GK6A 1S1CA 4JMPA 4D80A 2J0UA 2IYVA 3QKSB 1EG7A 2VSFA 3T06B 4BE7B 4DLUA 3B82A 2UZ3A 3C16C 1HE8B 5JI2E 2ZRFA 2JLRA 4QXAA 4PHGA 5FTKA 3DKPA 3NKVA 1QBKC 5LB2A 2R6FA 3I4LA 1UBFA 5CIWA 3VX4A 3IKJA 2IUUA 1SVIA 1G4UR 2GTPA 1CTQA 2ZRHA 2GNOA 4CF7A 1W2GA 3LRPA 4UNSA 1SKYE 3KQLA 4HB0A 2OXRA 2W6JA 4MYTA 1UEIA 1IJEA 1WE2A 1Y3AA 2GBLA 4NYIQ 2IC5A 1KKLA 1VIYA 3AKDA 4HEJA 2CJWA 3TUZC 1CJVC 4L8GA 5GJBA 1Z0FA 3SJBA 1VCOA 1M7HA 2QP4A 4D25A 1KMHB 2R6GA 3OIYA 1Z07A 2ZRLA 1KDPA 3T35A 5FOWA 1BKDR 4AG6A 4QM6A 3LQRA 4ITRC 1MT0A 1TQ2A 2N42A 2OO7A 4E03A 2FZLA 3RRMA 3GEIA 3W9YA 3DPUA 1G8PA 4LZZA 4JLJA 6Q21A 1KSHA 5FUYA 2WIBA 1NVXQ 4B3BA 2OXCA 3QXCA 2G88A 2VHTA 1JJ7A 2RB4A 5E3HA 4B2IA 2X77A 3CONA 2ODWA 1E69A 3CPHA 2Q3MA 2C04A 3M1IA 1KJYA 3LXXA 3UIEA 2ZXUA 3VNVA 1Q1ZA 2GJAA 2UKDA 3SS8A 4JL8A 4NYJQ 2QMOA 4ERNA 1Z6XA 1KI6A 1XXHB 221PA 4DLTA 4O2RA 1COWD 1NL3A 2O8FA 1E3MA 2PMDA 3LX5A 2FE4A 2PMKA 3OIUA 4JVLA 2A9KA 1AKEA 2QAJA 5HCIA 3ZS8A 1H8HD 1VDZA 4JL5A 1AJEA 2ZUBA 1KY2A 3B85A 2QAGB 3BFXA 5FR1A 2BHRA 2CJWB 4TTPA 1SVWA 1A1VA 1EX6A 1G1MA 1ZCAA 4JSYA 3KKMA 1I2DA 1KI7A 1JPJA 3AP1A 1XMJA 2QTFA 1D2NA 1EGAA 3RS0A 4A6PA 4BGDA 2R9VA 4EJSA 3QVVA 2YC4C 4I81A 5A4JA 4G1UC 1NLZA 4D6PA 2GJ8A 1MO5A 3IPYA 4HB2A 1F60A 1G3UA 2AK3A 5FOUA 2QI9C 1KK0A 4IDNA 2JLZA 3TR5A 4BQSA 3KDSE 3FHTA 1RRPA 4YC7A 4DXAA 2FGKA 1OV4A 4P4TA 5FPHA 2BOVA 3EG5A 2NMVA 1SXJC 3TAUA 2V1UA 1ZM7A 4DT1A 4A0HA 2NPIA 1R7RA 2P6RA 5CJ2A 1AA3A 3ZIAD 1Q1BA 1VPLA 4MITA 1XMVA 3BFVA 2PCLA 5ELXA 1V43A 4PQFA 1GNPA 4HLUC 4PSVA 2P5TB 1M74A 3KQUA 1HURA 3PFIA 4B2PA 2V54A 3K0CA 1S9HA 4U00A 2YZ2A 4A2PA 2CHGA 2X2FA 4NCNA 2QP3A 1JR6A 1HUQA 5D3MA 4EPTA 4TYNA 5DIFA 3B2EA 2H1LA 4M4SA 4M8NE 4NL4H 3KJGA 3PUVA 4AYTA 3BFKA 4LK2A 1XXHE 4Q9IA 2G6BA 3IHLA 4QJ4A 1WMSA 2Z4SA 3U4QB 4RJLA 2HYIC 3RANA 2WPDD 1TF2A 4FD2A 4KLZA 5KPDA 4PSKA 1KIMA 2QBYB 3AVTA 3I8SA 1CEEA 3BC1A 2WKQA 2GEVA 1HE1C 4UXHA 2H18A 5CLQA 4JBYA 1E2EA 2CCGA 4QKQA 1VG0B 1P9WA 4CW7A 4C2UA 3TVDA 4OHVA 1YZNA 1M8PA 1AA9A 2NIPA 1HH4A 1OXTA 1OHHD 1SVMA 3OFND 4IW3B 4RD1A 3R8CA 1SVOA 4DLXA 2WKRA 1E2NA 2JDIA 5CB6A 5JMTA 3CM0A 2W00A 2F3RA 2NZJA 1E9SA 2BCGY 2GWHA 1W0JA 2Q9AA 3ETLA 2EW1A 3MD0A 1OHHA 4DLZA 4KI0A 4V0ME 2RH5A 1EFRD 3KJHA 3DKVA 4TQUS 2DFNA 3QXXA 3WXMA 2J1LA 3SQWA 1JALA 2OM2A 1DBSA 4MH0R 5BWMA 1CBUA 2F1IA 4MA4A 2A5DA 4RFVA 3X2SA 4G5OA 2KB0A 3KL4A 4ZCLA 5HE8A 4HYYA 4Y0VA 1IN4A 3SU8A 1D2EA 2CE2X 1IXZA 1ELOA 2X2EA 1XNJA 2ORVA 1G9XA 3FKSA 3OAAA 3PIRA 2IEYA 3D8BA 3KFXA 4IVQA 1E1RA 2FSFA 4JKIA 2XOKD 4LV5B 1KZGB 1EFCA 1G3RA 1LW7A 1HT2E 4Q5IA 1I2MA 1HEIA 2PT7A 4LV8B 1JEDA 3PJRA 1QRAA 3SFZA 1WDTA 3ND9A 3IIKA 4HZUB 3EX7C 1ZM9A 1GM5A 1BYUA 3LW8A 1DEKA 5TVKA 3MWYW 3L8ZA 1G41A 4Q4HB 3ADKA 4OK5A 3BB1A 1OIXA 1GUAA 2REOA 5G53C 4RZ3A 4LV6A 3ICEA 3QF7A 1OJLA 4XVQA 3RSLA 3HU3A 2BV3A 4JS0A 4ZI3A 1YRAA 5J40A 4Q9HA 3CH5A 4MYUA 2FF7A 3DHWC 2FSGA 2FEOA 2VSXA 2WSSA 2R6DA 5KDDA 5BN5A 2O0KA 1E9BA 3OIWA 1LNZA 1DPFA 4PQYA 2FZ4A 3GPLA 1VIAA 5FI0B 3CIOA 1F2TA 4B3DA 3K9GA 2D62A 4L4UA 1SXJB 1U98A 4KHZA 4PC1A 1EWQA 2WKPA 4TL9A 4NYJR 4ZV4A 1WBBA 5FTNA 4AG5A 1FX0B 1GRQA 4GZMA 3RS2A 3LD9A 4FCWA 4RVCA 2XEXA 3ZZUA 1W36C 3DM5A 1ZVQA 1KO7A 2B8TA 1OIWA 4UNNA 1JI0A 3BJIC 4MKIA 5AJYA 3VX3A 2GXUA 2VSOA 4DRZA 1WP9A 4EJSB 1P4SA 3K70B 1W1WA 5AJZA 1AKYA 1MO6A 4D4MA 2XX3A 1C1YA 4MGZR 4DDVA 2GXAA 3QOFA 5JS8A 2R65A 1Z0DA 1LY1A 2VO1A 3FMOB 2VL7A 4F92B 2ZSDA 3DOFA 1OB2A 2ATXA 1W4CA 4B32A 4D4JA 1QZXA 4DEYA 2EYQA 3AKYA 3KXLA 3PEUA 3U6KA 1VKJA 4ILEA 4X8MA 4LX0A 5K8TA 2O52A 1NG1A 2CNWD 4AY2A 1FP7A 2HT1A 4BLTA 1Q21A 1E79D 4E5UA 1ZBDA 3O8BA 4TYWA 2GILA 4TLDA 1XXHA 2Q0HA 1SHZA 4RD2A 3HDTA 2B6HA 3WBKA 2ZRGA 1D6JA 3LWNA 3FVQA 1S96A 3SEAA 4D2IA 4JJKA 4XWOA 4KYUA 5GJVC 2FWRA 4LYJA 2JLVA 1BH2A 1FQJA 2ASEA 3QBTA 4RFSB 4WA7A 4GL2A 3H86A 1ZINA 4XJXA 4ZI2A 1P2UA 1E9RA 2ZYUX 2HLDD 1Z63A 2G9NA 5IF9A 1IY1A 2UZIR 1E2JA 2VF7A 4B73A 4EAQA 3GMTA 1Q44A 2PL3A 1KMQA 1S4QA 3FDIA 2A5FA 3EZ2A 1QHSA 3HU2A 2IEZA 4A36A 4Q1BA 2ZITA 1KZ7B 3GEHA 4KO8A 4MQBA 1G8FA 1U2RA 3SJAA 1J8YF 4KLNA 4W9MC 2OBMA 3BH0A 4BFTA 1T8UA 4QBHA 4Z1MD 2P5SA 3WMGA 3EC2A 4OKSA 2P65A 1X8LA 4IRUB 1KMHA 2GHIA 4NHOA 1JEEA 1E0SA 2BKUA 4QBGB 1ZNYA 1K6MA 3CF6R 1FL9A 3K0FA 3ZS9A 3K09C 3LAWA 5FTJA 1L4YA 1Q0UA 1K5GA 4P3YA 5LD2C 4BLOA 1CRQA 3L0OA 5AUQA 2JLSA 3U7HB 2DB3A 2B8WA 4R98A 1KSGA 1S8FA 1UEJA 2J7PA 4S35A 5DE3A 1W2HA 2WM9B 1C9KA 3K8YA 2AHOA 2ZE7A 3W6PA 1UADA 5FH9A 1XCMA 4NPHA 4B75A 3K70D 3EZ9A 4PC6A 2GCNA 5AJWA 1YRBA 1XEXA 2RGGA 4XTCS 3U5ZB 3CX7A 2JJ1A 3FMFA 2WOOA 5TY0A 5JRZA 3QG5A 3TH5A 3CBQA 3LVQE 4R71A 4QRHA 1X86B 1XWIA 2OG2A 2DWQA 3KUDA 3ZZ0A 4Q03A 2GCOB 2NG1A 2UVQA 4LC0A 4LHVA 3U3OA 4HAVA 3W34A 3P1JA 4ESHA 2XTZA 4PHHA 4GRAA 1NBMD 1RRCA 4JYBA 1Z0JA 1LFDB 2GZDA 3NHBA 4DSOA 5FUWA 5AJXA 1YZKA 2J87A 1CR0A 3CW2A 1OPXA 3NIBA 3IDQA 3CNOA 4B6FA 5TXGA 4A2QA 2EFHB 3T1VA 3U3KA 3RC8A 3AEZA 1SVLA 2JEOA 3W3ZB 3AUYA 1NBMA 4KBFA 4TQ9A 4TMKA 2PX3A 621PA 5GVRA 3QPUA 1NVWQ 1QG4A 5C4GB 1ANKA 1KGDA 2ZPTX
chains in the Genus database with same CATH superfamily
2YVLA 3TKYA 3NM5A 4F96A 3QXJA 4IVRA 5JQWA 1XZEA 4YJHB 3TTVA 2XUIA 5B58C 1XVIA 5JXIA 1ZITA 3I2GA 3TDNA 2XKBA 1QLWA 1H5QA 2VF2A 3ZWWA 4CETA 1O3YA 5EMMA 3ND5A 1P5ZB 4ND1A 3CZAA 1URPA 3GDHA 4Z7NB 1WMAA 3QP9A 1C3OB 3CINA 3D81A 1OH6A 2G63A 2O2GA 4DZRA 2ETVA 2GZHA 2J59A 1ORHA 2K4MA 2HPHA 2QGZA 2ZWMA 3DWFA 3KYJB 3PFCA 2DX7A 1NRWA 2MWMA 4PIVA 5JYDA 4RJTA 5B5SA 2OHFA 4BU0A 4PXAA 2FZWA 1H4VB 2Z6UA 2ZDHA 3B48A 4CZ2A 3K3PA 1GEGA 1R4ZA 1KBOA 1D6SA 4JBGA 5CK5A 2VDPB 3LQ1A 2JGIA 4L0QA 2A58A 4X1YB 3TKAA 3GZNA 1WCIB 2D8AA 3RRXA 2WJ4A 3AF0A 4OHWA 2MSNA 4X8OA 3PX7A 1RBMA 3BHJA 2FPWA 2QR5A 4BWGA 3C45A 4EL5A 5LPNA 2VTVA 1YC2A 1NKTA 2BMDA 1RPTA 2Y8EA 5CVEA 2V7XA 2YWHA 2P8SA 1NIJA 3FPSA 2GFHA 4E5VA 5HUQA 4YJGB 4XKJA 4RF2A 1GV0A 3CRQA 2VJLA 4FFPA 3GJQA 5D3MB 1OTHA 2Z8YM 4WJZA 1RC8A 2ZSUA 3OJOA 1YHNA 3F8TA 1GT6A 4D9KA 5T67A 1AZWA 3PQDA 4C1NA 2QRKA 3HYCA 4IXTA 3RVLA 5FEMA 1OMOA 3UWDA 3DHEA 1NG9A 2FDCA 1NC1A 1JDNA 4CMHA 2HH9A 3F73A 2YFKA 3IEIA 1FQOA 3MK31 1VZ2A 3A4YA 4US1R 5GOZA 1Z68A 3AUAA 4H7KA 1DCMA 2J6CA 3SCZA 1W9MA 2QU7A 2JIBA 3GCWA 3GRVA 3G0GA 3O8NA 4RMJA 1CWUA 1RJ9A 2B5VA 2HK9A 4AP6A 1F2TB 2O7NA 4LWQA 5GONA 5L51A 2ZRPA 5HKKA 1JHVA 1QTIA 3DHYA 3S29A 2ZRDA 1X7DA 2OBLA 3ACBA 3JWIA 2FWIA 1HM5A 1RI4A 4HWTA 4YUZA 1U0GA 1CR2A 1G21B 3VYVA 3OX3A 4LBYA 2P9BA 4P5DA 4R1OA 1CP2A 3RHFA 2HO5A 5D86A 1S7CA 1GKUB 2P2CA 5CXQA 4O3MA 3CLKA 3HB7A 1GQSA 4RAOA 4YQZA 5D5PA 3F46A 2DKFA 3CKKA 5A62A 2HZ7A 1A72A 1STOA 4H1HA 1YJ8A 3AZQA 3T1QA 4HV4A 1QYRA 4UHFA 1E7WA 4ZCMA 1H8EA 4NULA 4ZCSA 3U6BA 4I6EA 1J8MF 1L2TA 4QEKA 4A3SA 4HQLA 1PL8A 1XN1A 1OYWA 3I9FA 4XEHA 5E6RA 3TTWA 4BNUA 2C83A 2R8OA 2Y68A 4L6IA 1JAYA 1F5SA 2YBDA 4UJ3A 3SQDA 3EMBA 4J75A 2YWRA 1UBEA 1GGKA 1L7AA 4AK9A 2YDXA 2J5RA 1ZW6A 3S44A 1YKSA 5CDFE 1USWA 3WSVA 3HGMA 1C8KA 2X1HA 4FNAA 1DJLA 4GX5A 5CCDA 2ASVA 4Z0PA 4DG5A 4PCVA 3OWXA 5COBA 4J0HA 4ZYWA 3V8MA 1ZD3A 3IOCA 4GPZA 4C4OA 3WFZA 1TW2A 1WVIA 2GCIA 1CLUA 3B6MA 3VNBA 5KSZA 3EGWA 1SIBE 3IILA 1V16B 2WSYB 3WLEA 3HB5X 4IWYA 2QG9A 4F06A 3AHJA 1OH8A 3D2AA 1U8EA 1Y8AA 4A27A 3BIOA 4K03A 3VZPA 2REQA 3SBEA 4YP6A 3R8XA 5KPJA 1VJTA 3S27A 3UXHA 1DXQA 2JIZA 3USZA 4WN9A 2PMEA 1E9VA 2G17A 5BNTA 3TBHA 1FFDA 4LJ9A 3B12A 1SRQA 2VAMA 4ERNA 4IZIA 1FFCA 1II9A 1DTWB 4PYIA 2ODTX 4XVHA 3UMJA 4D0GA 3RODA 4ARVA 4RADA 3MTDA 1LRLA 2O1XA 1QJCA 3I4FA 4IYJA 3CTMA 1A8QA 2ZCVA 2ZIXB 3NP9A 4UM8B 5DT9A 4ENVA 5BWCA 3CW8X 3D3WB 2H0RA 3L7LA 3PJEA 4KTVE 3WRXA 3W2HA 2I6QA 1D2GA 1G42A 1BW9A 3MAGA 1QIMA 4MEJA 5BQFA 4IMPA 2I6SA 4MGHA 2HCRA 4XGKA 4X54A 4G8JA 1XEWX 2FDXA 4DLYA 4P82A 1AX9A 3RAJA 1KBQA 3TK1A 5LLTA 1M2EA 1OZHA 4B7ZA 3CSUA 2JKZA 3EXHA 2ZROA 3CHYA 2V59A 5LDHA 3BX1A 1Z8FA 3NYIA 1LK7A 4FGUA 3QWAA 5IHXA 3PX3A 5DASA 1BFDA 1GGEA 3L07A 4M9CA 3T52A 3CO5A 3TRKA 1RLOA 2WFLB 3KPVA 4D9EA 3A1TA 3V2UA 1UFQA 1IIBA 2V8OA 3GUVA 1H3EA 4OPMA 5D5QA 5EJ4A 1E9AA 1KVUA 4J1TC 4Y6SA 3Q11A 3ZCVA 2L19A 2P62A 5SZHB 1VYHA 3CLTD 2NM0A 2BWJA 2AG6A 2GRJA 1M2FA 1NGSA 3ZV7A 1S2MA 1ZVMA 4B2YA 4JA0A 4K6KA 3LWDA 4KSBA 3TOCA 1Z16A 3NRBA 3R24A 3HWRA 1DAIA 4K9OA 3JQ7B 1MD9A 3SWWA 3R5FA 2BMFA 4IQ4A 4AI6A 1JLSA 3C7CB 3KZCA 1KDZA 2WINI 1CG6A 3FX2A 1R15A 2R11A 4OUKX 1C30B 4FI3C 2QG6A 1U1DA 4I55A 3H3XA 2W2MA 2YV1A 3BUSA 3QXSA 2FX3A 1ABFA 3VPAA 4B71A 5JXWA 3B5IA 1ZGJA 1RJWA 2GNAA 2ERYA 2ZIWB 4JCCA 1LNSA 1O97D 4DA6A 4GOOD 1C7RA 3VC2A 1QGUB 4BNMA 2DT8A 3RVQA 3QKUA 2DHCA 5IF3A 2YINC 2VQSA 2IELA 3FNIA 4R4JA 3SXJA 1IN1A 1AQIA 5F23A 4JJFA 3TB4A 2CZGA 3EDQA 1Z29A 2A9VA 1OFTA 5IVHA 1HNXB 1L5OA 1GITA 4JB2A 4EA9A 1Z6YA 3DE1X 3F6SA 4DY6A 1XA3A 1GJRA 1Y9EA 2WNHA 2X5XA 2AG1A 4MWEA 5CDYA 2I2WA 1V39A 2GBLC 5ESDA 3ZV6A 2VBIA 1NOKA 4OB7A 4OLJA 3RQIA 4CHTA 1WMDA 2P3LA 4TXMA 1HR0B 5EHXA 3H5NA 1EWVA 4BPBA 4EI7A 5SICE 2V7EA 1BCRA 1Z33A 1Z8HA 2XEDA 2ZI5A 3IUMA 4DHEA 2GM3A 4JLAA 2WG0A 2RB5A 2ZSAA 3D6JA 1L4EA 1CF2O 1Z7EA 2JJ1D 2BMJA 3F5FA 4UTNA 5L4NA 4B44A 4MQ4A 2GCEA 3CV3A 5GM1A 4CUJA 3ORRA 1WSDA 1OZ0A 1SUDA 1OAKA 1V3VA 5DHTA 2PUCA 3D8TA 4NCHA 2HU5A 4I4TF 2N46A 3TTSA 1NXOA 3KK0A 1O4WA 1DQRA 1I3CA 1W8DA 1QX4A 3N87A 1DAMA 1P17A 1P60A 3DF9A 3KJIA 3QUSA 5DJ5A 4I2VA 1D5CA 3WIUA 3ZWAA 5I6DA 2BHLA 2JBAA 3QVTA 4RPJA 4ARUA 1FU7A 2JH9A 1DIBA 1XD9A 1Z75A 4KCGA 3L7OA 4GIBA 3DKKA 2C0QA 1GWNA 1Y3IA 1I32A 4OJTA 5I48A 1DBPA 4OXNA 1AN0A 5BSFA 2CD7A 3N6RA 4F45A 1SUCA 1VQ1A 4XFDA 3SR0A 2X1MA 3QVGA 5TGDA 2HLPA 3KYCA 1RZ3A 2HK6A 1VHJA 2RAUA 4JKYA 3A3KA 1M10A 3ABIA 2PWBA 4LOIA 4MV9A 4H0FA 4W7SA 4IUDS 5DVZA 1X1BA 1XLTC 1EJ2A 3CB4A 2JGJA 5CDUA 2GPWA 3GHHA 5L6LB 4NZMA 2EVWX 4PPFA 4BJHB 3L01A 3FZEA 2QMZA 2FAXA 3MMNA 4BO6A 3GBVA 3EIFA 1AA6A 5FA8A 2BP7A 3COSA 4PX3A 1JKIA 2FJ0A 3ONDA 5DHUA 1UMDB 4B6SA 1ZX1A 1AKWA 2JIZD 5HRCA 5CAEA 3TSAA 1IZ8A 3KT3A 2O57A 4JYCA 3TSOA 1Q7BA 4LK3A 3DNPA 1P62B 3V3KA 4CT4B 2AI2A 3EK2A 5JAHA 3IODA 4R0MA 2H3HA 1H0SA 3KKPA 4K9LA 1QIDA 5H9VA 2QRUA 3R0IA 2DKOA 1DRUA 3N8GA 5EWLA 5FX2A 3WK5A 5I7SA 4BLRA 1GPUA 3ZQJA 3JQGB 5F35A 1GKYA 2O3RA 2V45A 1Y7LA 5TQ0B 1PJSA 1LA2A 3PHIA 3MB5A 1LVGA 5EIAA 1A9ZA 1SWVA 2ODPA 4ZTBA 4MDFA 1KEVA 1OI4A 4KIWA 4UHEA 2A86A 2FH5B 2GM9A 2IOFA 1CULC 2QJWA 4OREX 4CTOA 3I12A 1YR2A 3M33A 1IIRA 4Q05A 4Y2XA 1QJ4A 2X3FA 1XR3A 2FEWB 3LZCA 4V0LA 2F43A 1EBUA 3MWEB 2R3SA 5SYNA 4KGXA 3S2GA 3S5UA 2C82A 2Q5QA 5B4UA 4DR5B 3WGYA 5H9WA 1TE2A 5HS4A 3WK6A 1P1RA 3NOOA 5IW8A 4C4XA 1QZTA 2VJYA 3HKBB 4PAOA 1Q6YA 3RUPA 4KSYA 4NWIA 4OLHA 4AY5A 2NSHA 2Q6OA 2WT4A 4P9NA 2WB2A 4XARA 3CR3C 1Y3FE 3QQ5A 4XH9B 1V1RB 4A0GA 5BQ5A 2RGNA 1XMPA 4HY3A 1KWKA 4UKDA 3K6SA 4TYQA 2LCIA 4EQZA 1DFGA 3R5JA 3WHIA 1MIOA 4XQEA 1ND6A 1AC5A 2DC1A 3FR7A 3NOXA 1TL7C 2B2CA 4YRDA 3ZHTA 2YUTA 3F9RA 4NMLA 5JFTA 3JWPA 5F78A 3VAYA 1I2AA 1EFRA 4ZOBA 5YASA 2JASA 4MP8A 3E9MA 5LNK1 4D99A 1QM5A 4QQFA 3WWOA 3FTQA 3LUJA 1A27A 3D7KA 4G07A 4TZ0A 9LDTA 1QH1B 2HF8A 3OD5A 1N2HA 3RSFA 3B8EA 1WOMA 3Q8MA 2QUZA 4GW3A 4X91A 5C8XA 5K7SA 3UW3A 1NUUA 2FN9A 2P0AA 1VE3A 4QHSA 5HXAA 4HMOA 1P2DA 4FCTA 3JQ9C 2E4XA 3IBSA 1RSZA 2ZWPA 3JZAA 4BNTA 5JC1A 1WCYA 4JQCA 5JH7A 1A4XA 1TB4A 3Q8LA 3PRJA 5LBTA 3HUUA 3E3LA 3HI4A 4BLPA 4OVKA 1RJFA 3PEEA 3I1FA 1CDOA 2AC4A 2F1HA 2VKQA 1DPGA 1NVKA 5LXTF 1FMTA 3B8HA 5IKMA 1GZVA 3PXDA 2XUKA 2B21A 2YFHA 4HVCA 2GD6A 1TT5B 1YS7A 1VJDA 3AHHA 3FYUB 4JIMA 1SCJA 3A6ZA 4LECA 5DTRA 4G1EB 2Q3FA 4C7VA 3WLHA 1XELA 2F7SA 4Y6OA 4BC0A 1V48A 4ZI7B 3OKAA 1IONA 1JBKA 3UICA 1B0ZA 1M1NB 2HMWA 2OOSA 2BEVB 1UC8A 2DKNA 3OC0A 4P98A 4XLTA 3RT7A 5FPKA 3L6EA 3W5CA 1SU6A 1YQ9A 1E32A 4JJ7A 5I7OA 3WWDA 4LYGA 3R7DA 2ZM6B 2CLIB 1AKUA 1OTYA 3MG9A 2J08A 3E1KA 2HWWA 1X14A 4JUCA 1PR0A 3A04A 5HKOA 3UGKA 2E82A 3C74A 4JYPA 3Q87B 2JFWA 2R2AA 3NORA 1XZCA 3A6PC 1PUXA 3OJWA 5AFSA 1XQ9A 3UCEA 5TMEA 1V8PA 2QQ0A 1J2TA 2LNDA 3R0VA 2C97A 5JAZA 3IURA 1N6RA 4EBFA 1T1JA 3GCGA 2C94A 1TA4A 2Y1XA 3ET5A 5DXJA 4H4CA 3TW8B 4QLBA 1ODFA 2BGUA 3IUBA 1HI9A 1RM0A 1JLMA 5EMJA 4N1AA 1NN3A 4D96A 1KYXA 5G3YA 4KPFC 3UJHA 4OEHA 1FXWA 5JSZA 4UQLA 3FB1A 5FULA 3LBFA 1GCIA 3NIFB 1OVGA 2VH2A 3LC7O 3TXYA 3IRUA 1E2HA 1LSSA 1TYAE 3Q8XB 5F2OA 2FJPA 3GPDG 5EE9A 5CNMA 3HHPA 3WNDA 3FMGA 4TXLA 1T3HA 3A06A 3FMPB 5H59A 1CFJA 1YE8A 3REGA 2IVFA 4A8HA 1Z56C 3NC4A 1KQFA 5H1YA 2D59A 4CIAA 1U7WA 2C9CA 3E9EA 1NXSA 1L0BA 1OA1A 1IVNA 3DBHA 4IJUA 4QXRA 2QTCA 4BX8A 2NU7B 5JVDB 3W79A 4OJNA 5C3UA 5JT1A 2HIMA 4P4LA 2BT4A 4MW4A 4DGQA 4NYIR 1MVNA 5EIOA 5JAQA 3IJ5A 4TM8A 1H9BA 2JI4A 1XF9A 1TKRA 2R8EA 2LZ0A 2H5EA 4OMFG 2DR2A 1NLYA 4FPXA 4J3FA 1EQUA 2HQOA 4QYXA 5DP1A 3AFHA 4Q9LA 2NW6A 3VR4H 1PVVA 2CJFA 4AJIA 2XYGA 4UM9D 1BMDA 4L73A 5AXBA 4RVGA 3EOAI 4JVOA 5CT9A 1AQYA 4G6ZA 1PTKA 1ZGHA 4UAUA 2Q8PA 3D1VA 4Y7DA 1SZDA 3TNFA 2PZEA 1G6OA 1DQYA 1HYBA 3PXAA 4WBXC 2PLNA 3CZPA 5ALZA 2AQ8A 3C39A 1ORTA 4MKRA 4TROA 2ZUCA 4C3ZA 2Y2UA 1BJTA 3N0TA 4D3DA 3VZBA 2CFRA 1Z2PX 2HK7A 2WM8A 2GF2A 3IDOA 5LOVF 3U61B 1EHYA 1NC3A 4ARBA 5EHNA 3S7ZA 5BV7A 4DZTA 3JAWA 3Q1LA 4OAOA 2IOQA 3Q98A 4MTLA 3X0DA 3PHJA 1OFUA 4RWZA 2DULA 2EQBA 2A9PA 2V3VA 1VRWA 3P4UA 2WLTA 3LM8A 4Y6GB 5ALXA 4B80A 4C4SA 2P5UA 1EXNA 2AX4A 4JUAA 1NI4B 4NJMA 3GEPA 2GX6A 3W5UA 3IP6A 4GLOA 3SP1A 3UC5A 4U5QA 5BMVF 1P2VA 3ZOKA 4AJOA 2X9GA 1SQ6A 2EKDA 1IDN1 2NZ2A 2Q5CA 3W06A 1YBAA 4LDRA 4NPAA 2IUTA 4NFYA 2B1QA 4BOYA 3HRIA 3SIXA 5BSVA 1NVVR 3GXOA 4QPCA 3T3EA 1KSJA 1ZM3A 1L4FA 5JISA 2Q9UA 1YFLA 3TS1A 5JANA 1XA0A 5KYYA 2ON6A 4IKEA 1T8RA 3RYTC 5JDCC 3KXKA 1FUEA 1YZGA 1DT3A 5K8LA 1PHPA 4EFNA 3JQBA 4FYMA 3L46A 4NBVA 3ANTA 1SWWA 4Y2YA 2ZRMA 3E5HA 4RMIA 4ZOCA 2CC2A 4DMMA 4EHKA 4V0NA 1BZYA 2R6AA 1O54A 2V4UA 1RAAA 2O7QA 4PFKA 1F7UA 2DBZA 2QAIA 4AS1A 4NZOA 4DIBA 2MJLA 3A4LA 3OLYA 4GOXA 4Y2UA 2P1ZA 1NSFA 3A1EA 3ZGLA 5CVCA 1EA7A 1NWHA 4TRJA 1R0LA 4II3A 1ADBA 4DG9A 1R5BA 1DXYA 3GJTA 3PQ6A 2QXYA 5HIIA 3SNHA 4L85A 2VDJA 3VC3A 1E3LA 4CCWA 2DERA 4N54A 4I4IA 3A4VA 3PEVA 3F67A 2YS6A 4BNGA 2ZJOA 3EASA 4EMTA 3BWCA 3EPJA 3A28A 2ZIXA 5CJJA 3VOTA 5JZBA 3OOWA 1ONPA 3FCSB 3H0CA 4GZLA 4JJIA 1VPEA 3IMGA 2D3WA 1WXGA 4BC1A 2J3HA 2QORA 3KP1A 1ESNA 1XTJA 2X7XA 4B33A 1FLVA 4R1MA 3GLHB 3ZU2A 1HZJA 4GH5A 4QM7A 2QXTA 4WXPA 3PD7A 3EH1A 5FNVA 5KYXB 3G9XA 3U4QA 3ZGZA 1JKMA 2JRLA 3CX3A 4QUDA 1YJCA 4R2WA 4D8UA 2IS2A 3B1XA 1UDXA 2IV3A 3N2GA 3KR0A 2NQ8A 1LTQA 5CHEA 3Q6MA 1E79A 1L5YA 2A7QA 1A82A 4J0FA 4WK0B 4YGXB 4D56A 1R1DA 2OORC 3H6HA 3DE3X 2V3CC 2QUBA 3STWA 5ITVA 4BXOA 2QUKA 4F6RA 2X86A 5SYAA 4B9EA 3FCXA 4PVCA 4MUAA 2QG4A 5ESRA 1UWCA 5G41A 1P77A 4P3OA 4NE9A 4RTKA 2PE5A 3RADC 4JI2B 5A05A 3CR8A 3O38A 4JHXA 3RM3A 2RKOA 3I8OA 5DXAA 1IL0A 2VK8A 4O2BA 1IE3A 4FR2A 4WXHA 3UK0A 3H8VA 1LLDA 1XJCA 2FQWA 3HJTA 5ELMA 2GEBA 3H8JA 2C00A 4Q4AB 4CR6A 3QF4A 1X7GA 4KR0A 4KXVA 5J2UA 3HCRA 4HDAA 4TTTS 5E0KB 5G40A 2VRCD 1LD3A 4BMZA 5M7EA 1TM1E 2RGCA 3MAAC 3SR3A 5CG2A 821PA 2WJGA 1XLWA 4MR7A 2Y9MB 1WHTA 2ADFA 3MTQA 4JP1A 5IH7A 3IS3A 1TUEA 3E70C 3HY3A 4X24A 1DJPA 5ICEA 1G5TA 1BEZA 2EX0A 1GTJ1 4M0UA 1G6Q1 1XZMA 4V3CA 1BU8A 4GXQA 4JP3A 4Y6LA 3UYKA 3TG2A 1SVKA 5FBZA 1S8AA 4HFRA 5FFFA 4CI9A 1A0OA 5HF9A 5HKKD 4KXUA 5E4FA 1G3IA 1OUMA 5H3HA 5JTUA 2R0QC 3LQKA 2C7GA 1TD9A 4DCNA 1Z2NX 2E4AA 2NXJA 3O0DA 4N7JA 3M6AA 1GPBA 1PJCA 2YWGA 3GJ4A 3GOQA 3NNNA 4NV0A 2F8TA 1C9DB 3OZTA 2Q3CA 1T3LA 4QU8A 4ZZ0A 1JIKA 4P22A 5J5CA 5JV5A 2WF9A 3NTQA 1MQAA 3ZI4A 1T1SA 3T12A 2RARA 3QKSA 2PS0A 4HS9A 4PANA 2BHSA 2RH8A 5TPWB 1FEZA 3ZDBA 5J1SB 4NF2A 3PNPA 5C4IA 2WWVD 3K0FB 1QP8A 2HWYA 5A9TA 3T7IA 3E0XA 4N9WA 2AJBA 3QOYA 4YFYA 1N33B 4W5TA 1GGHA 2DUWA 2YY5A 1E4VA 4R8SA 4MGKR 4OO3A 3ADBA 2F4VB 1WCV1 3ZVKA 3SJZA 4MW9A 4MUBA 1K8ZB 2XIJA 4QJ5A 5DFAA 2DETA 1SBZA 1E9FA 2NAFA 1FFHA 2WIJA 4LDNA 3OZGA 1VXRA 2IRWA 2WW8A 3HR4A 3PC2A 2RHRA 2VJCA 3HP1A 4HKTA 4JLKA 4FQ8A 3ANNA 4S1PA 5L3SB 3AM1A 4GMKA 3SC6A 4KMRA 1ZFNA 2BP7B 2RD2A 3EEBA 1U0RA 4F4IA 1IFXA 4D9GA 2W58A 1MTOA 3GFSA 3IQFA 4I1IA 4KXXA 5E3JA 1JAHA 1M76A 1Z6ZA 2BF4A 4LISA 3BWBA 4Q9DA 5DHPA 4HYEA 3RR2A 2YVUA 4YECA 2C8JA 1RWWA 4J1NA 4A2WA 1XZHA 2J0SA 2IF0A 2K2WA 3WTBA 2OV4A 2ZBDA 4BFXA 3LYLA 3ADOA 2H9YA 4UU7A 3ZDXB 2W2KA 1U63A 3WLFA 3W8DA 2FB9A 4XQGA 3W9BA 3B53X 5G0UA 4CLOB 3OZRA 2VPYA 3GK3A 4WE3A 4GI3A 4WVFA 4Y9UA 5ALMA 5GONF 2EFGA 3ZWXA 1DEOA 1BN6A 2C2KA 2QTLA 3TJZA 4CM6A 3AWIA 5A0VA 2QLTA 1KI9A 2F9MA 2CD9A 3LUHA 4PYOA 4QE3A 3K05A 1PBNA 4FK8A 4ZQCB 2M6KA 1XQXA 3OQIA 5G02A 1LWOA 5LN1A 1QHNA 1GFSA 1NP7A 3SLGA 3GYGA 3AVXA 2NU8B 5CGZA 1XPUA 2XOKA 4KYTA 4BASA 4UD2A 4Y2RA 1FZQA 1H6BA 5IUKC 3UO8B 3N0VA 1Z06A 1U3UA 3VBCA 1MN6A 4J2HA 1C8VB 2G1KA 3UT5B 4OL9A 1J0DA 1JAZA 3WJ2A 1BVUA 2RH9B 2D2EA 4KQ2A 5FOVA 5ICMA 5M34A 1YL6A 1U1CA 3CR7A 3EEFA 1LJLA 3FSJX 1CPYA 3P9KA 4FYYA 5DW3A 1I33A 4G1MB 1E1QD 3WLQA 2PD6A 1CUIA 4IGEA 2SHKA 1PEYA 3EJWA 4FMDB 2WWHA 1PR6A 1RP1A 3OZBA 4Q1EA 4HUQA 1V37A 4Y2SA 2H1HA 5EE1A 2C98A 4UDOA 1I7PA 4EKGA 1PEAA 2XQVA 2JFPA 4EG1A 1K86A 2VXOA 3WRXC 1EJ6A 4QIHA 1JHOA 3H11A 3LUGA 4NCAA 4BZWA 2WHPB 5E7MA 4OSPA 1JTEA 1U1IA 4JITA 4PVDA 3ZE2B 4LX8A 2J9FB 2Q1UA 4LWOA 4E21A 4GOMD 3H17A 1J1UA 3EXHC 1T0UA 4IG4A 1I9CA 5GZ6A 4GP9A 2YHSA 4XUCA 5ENDA 4WLNA 4C7KA 1KAQA 3INGA 2I6XA 5H82A 2DPHA 4DLAA 1X1TA 1X7WA 3DJYA 3LQQA 1X74A 3C5VA 3KKNA 5TC4A 3HXQA 3N8HA 4K26A 2ZRKA 3SHOA 2W70A 3HJFA 3AVQA 2CYBA 3L79A 2NYUA 1HT3A 1VL2A 4X6LA 1GSHA 2XUOA 3ABZA 3FTCA 3KB6A 1VTKA 3MUOA 2QTTA 3OQJA 4O4HA 4RMNA 3WIVA 1JE0A 2Z2XA 4FSDA 2Q99A 2M6RA 3G8CA 1ID8A 4ODIA 3C97A 5FPTA 3NYWA 1SXJE 4HLDA 4AQ7A 2FN8A 2OHOA 3P8ZA 1UF9A 4HTFB 1HLDA 3VSCA 3K0SA 4DV0B 2CJYA 5FCDA 3H9CA 3HTXA 1Q0LA 4OQMA 4EJ0A 3C5CA 1N7HA 3URMA 4IHAA 2C9YA 2H63A 3T3IA 2R2GA 1WUIS 1D8TA 1TUIA 4ZODA 2XJ4A 1SVSA 2GI4A 5DMXA 3UJ9A 1P6QA 1SQSA 3OIFA 4UFNA 3V1UA 1CY6A 3AB7A 3GRPA 2LKDA 5ALGA 4EYGA 4KBGA 4RVUA 3GROA 3IBYA 4J4HA 2IP2A 1N4AA 1RYDA 1U0FA 3WV5A 1N7JA 2ZI9A 4AWBA 3GP8A 1LEHA 3OG9A 1MC5A 3ABQB 4WOJA 4TSKA 2NSLA 1TA0A 3A4MA 4CIVA 5EHZA 3VU8A 3GIDA 2O7RA 2B1JA 4YCLA 3IR7A 4FLMA 2JIMA 4BTEA 1B41A 3WHPA 1ZGBA 4DSZA 1G20E 5H3LA 3NEAA 3OKFA 3DHVA 1ZMOA 2CFIA 4LYHA 4K9PA 1VIVA 3B1WA 3EQ2A 4XIYA 3PITA 4S24A 1P1KA 2JBHA 2ADOA 3U7FB 3DZFA 1VE6A 1ZIOA 3CB2A 1WWKA 2HIAA 3H2YA 1QDEA 3KQSA 3LYUA 1SOMA 4NQRA 1B3RA 1IBCA 4ZAWA 3FPGA 3E22B 2H5IA 4FHDA 4QUGA 5CVUA 3MOIA 4IBOA 3GLFA 3B1FA 1CY4A 3QVWA 5C1IA 2GASA 1U8CB 1VL6A 2AOUA 4C7BA 5L3RA 2FU5C 5CBKA 3KO8A 2J4FA 4A8PA 1S5PA 3GIWA 1WDKA 5KHAA 3DFIA 4R8KA 1EH5A 3EVAA 4TLAA 1E1DA 2ORIA 3DO6A 3WSWA 3RB8A 3DLPX 4LXIA 4POOA 3OHSX 3TQCA 1ZKDA 3I0ZA 4TMFA 1VJGA 5HZKA 1SR8A 2ID4A 5EPUA 2HMUA 4AECA 2ZPUA 2OO5A 5AHWA 2XKJE 4LAFA 2DWPA 4LTNA 1G3MA 3QPBA 1CUVA 2W2LD 3RJMA 3X1KA 1QVZA 1NTOA 2RJOA 2W6QA 4PHFA 3UMBA 5CVTA 3ZXXA 2VK1A 2NYAA 5FBKA 2XHZA 4KKVA 1E3EA 1PS0A 4UUMA 2R8ZA 5GOTA 1GPJA 3E7PA 5FP0A 3ZY4A 2HBQA 3PICA 2CLSA 1KWGA 1JDBC 3PENA 3C3AA 3AOGA 3B3QA 2V6IA 3JZFA 4DDMA 4ME6A 3G85A 1N2CE 2E89A 1EDOA 3EFOA 3WISA 2A3NA 5JW6A 3SDBA 4URZR 1KNXA 2ZIFA 2FLVA 2V9ZA 3ONVA 5BV1A 2BGIA 5KB3A 5LL6P 1SA0A 4PU0A 1TADA 1DG3A 2Q5HA 3U7RA 1YUBA 1HNNA 1E59A 3BXHA 4A4DA 1JIXA 2WG1A 1P81A 3HKCA 4HH3C 3DV2A 2G40A 5CX1B 5E3IA 2VATA 3CNLA 2REBA 5CX1A 3UEOA 3V4LA 4Y98A 3KTAB 3C8UA 1PGJA 2JFYA 3QIAA 1QP4A 4G86A 3CF2A 2RIPA 4KWHA 4DRXB 2R86A 1JHUA 2OOKA 2R00A 5BRJA 3MW8A 4HDRB 4PEVA 1O0SA 1U2GA 1X1CA 5KHOC 1D1TA 1GL7A 2OC4A 3MRSA 4OM8A 3WLTA 4IHQA 1UKBA 1LI7A 4QLAA 5F76A 2CHFA 7REQB 2DG2A 4XGIA 1I7DA 3MBOA 3OPXA 1DL5A 1ST2A 1V7ZA 1G64A 1XMSA 4IIHA 1ZVJA 1M2KA 2BKEA 2WD7A 3G13A 2NVUB 2Y0EA 1RJDA 2AXPA 3JPWA 4BFSA 5KYYB 1Z08A 1TTTA 2BRUA 2JK1A 1ZH2A 1YK0A 2QHXA 5EQTA 3CT6A 4F11A 2VYVA 4URVR 1DDOA 4YCSA 4I9GA 1CS0A 3FUVA 1SNYA 3O9VA 3NETA 2NLOA 5JMPA 3MVEA 1Q83A 3K9NA 4E0BA 1P3Y1 2VHYA 2ZATA 1BMTA 4KP7A 1LSOA 3SX4A 2JLAA 1UWVA 4LXXA 5CW2A 3W6NA 3JASA 2W6JD 2FRXA 3H2ZA 5PNTA 2QROA 3LBHA 2P9EA 2HR1A 5AM2A 3WA6A 3MJHA 4BECA 2GZ2A 4P33A 4MMZB 4OYHA 2VSQA 2C77A 4R1NA 4DSUA 5AW0A 5IDQA 3PWZA 1S89A 1M34E 2ZRIA 1I3MA 4AFNA 1G8JA 1VG8A 1JHXA 3KSBC 1CIPA 4E6EA 4EPRA 1TYZA 5HFJA 4X3OA 2FQQA 1U5BA 1GRCA 3A37A 3IV9A 2W2TA 3GGGA 5HR5A 1TQ6A 2MTBA 3A6EA 3QK7A 4XFJA 5KTRA 4J4TA 1P1HA 3V2GA 4JP2A 3O1JC 1SXGA 5I47A 1PJ3A 3EE6A 4ALNA 4CKZA 1TYCA 1XD2B 1IN7A 4F1KA 1PLKA 3EPPA 1Z13A 1D03A 5A0FA 1EM6A 1KH2A 1WIWA 1DAOA 2A1IA 3QXHA 4KR3A 1DC5A 1MOSA 2FHSA 3EVFA 1P2TA 4ASUA 4II7A 4MMYB 5K8CA 3GLHE 4X6UA 4ZXFA 1OAOC 1HDXA 2D0PB 1DI0A 1TYBE 3L92A 2M2IA 3IGFA 1E77A 1TQ8A 1D6NA 1ZPDA 2H4XA 3D2LA 2QQEA 5H83A 3GLTA 5DYGA 1RWKA 5DEOA 3IQZA 3RYHB 3ZYZA 1EFHA 1NV9A 3VR6A 5IAOA 4G8BA 4ZEMA 4KO1S 2I2BA 2A57A 1DLJA 2ZTLA 3UFXA 2IYYA 3ZX4A 4WBNA 3ENKA 4GC9A 4NOKA 2ECPA 2XB6A 2VTBA 4IIDA 4I1SA 2DH5A 3J81A 4WKCA 4HFMA 1OGYA 3WDKA 1ZWKA 1A76A 1TVMA 2ESRA 3I23A 4K0RA 3VR6D 2HSJA 4W5QA 3W8FA 1E89A 4IIYA 3MGGA 4HDSA 3VHXA 3WGUA 1ZGAA 3A26A 4S12A 1KDRA 5JAPA 4BQQA 3FG9A 1LI4A 2J9XB 1SBYA 3OUZA 5J47A 1YU9A 4AKGA 4FNMA 3VISA 4GSYA 3SYLA 1J24A 1UBRS 4YONB 1XMXA 5T6MA 4AP5A 5JLJA 1YBHA 4IMIB 2QNIA 1Z0KA 3GEBA 5BYBA 2N1BA 3BORA 4MB0A 4GWLA 4JOSA 1NT4A 2HMVA 2AEMA 4N47A 3OP4A 3AIOA 3FFXA 4QPZA 4EG0A 1FXWF 2H1OA 3SBOA 2CVQA 4Z99A 1IVYA 1EUDB 3E7FA 4KVZA 2FK7A 2H0AA 2ID8A 1YKFA 2QAGA 1M8GA 3IALA 4KNWA 2QKYA 3NEYA 5CDHA 3WAGA 2RJ3A 3VKUA 2CZQA 2XW6A 3L18A 5LQNA 1WVGA 4F7WA 2FG5A 3ZLJA 1ZCZA 3SOPA 1N34B 1NFRA 4OJKA 5FV4A 3DTTA 6ADHA 1NUPA 2GGSA 4MWTA 1XK6A 3RBXA 5HDBB 3F74A 2IKSA 1Q14A 3DEIA 4GLBA 3RC7A 3UMFA 5AUPB 5JJBA 2GN9A 2BFPA 5KOIA 2H1FA 3NGMA 3M3DA 2VJKA 1VKZA 2J3KA 2JGFA 4LMPA 4YJ3B 5ERXA 4ENSA 3VAAA 4MW2A 4ND2A 3GJ5A 2JFQA 3UUGA 4B9AA 3OCVA 4ZPJA 4YJ3A 1FSPA 1R5NA 2NX2A 3R41A 3GRAA 1TT5A 2Y1GA 2BM9A 3FYUA 1QZ3A 5DBIA 1XZDA 5AK4A 2WVGA 1TK9A 1DQSA 3E9RA 1P73A 3IUNA 5JMOA 1P18A 4M1WA 1EX1A 2PGLA 1SBQA 2PMWB 4LNAA 5ICGA 1PO7A 1Y8RB 2MYPA 1KO5A 3C6MA 2BELA 4XPZA 3AW9A 2UYCA 4PX2A 3VNQA 3OHPA 1XZIA 4JI3B 5L7WA 1E9EA 3MERA 4MLZA 5EZ5A 1W5TA 5F3DA 3NNDA 1OXBB 1TZJA 2P9JA 3C3DA 4LJ6A 4Q6BA 4W5HA 1JMKC 3KKLA 1KEEA 4YCDA 3C5HA 3QU2A 1W30A 4HPWA 4OGGA 1VCIA 2GLUA 3F7TA 1P4JA 2GZAA 2PUHA 2P0EA 3JZMA 1SMKA 1Z4KA 3ZH9B 2ZS8A 4B8YA 5JPCA 3HYSA 1YOVB 1YXMA 4NYMR 4PNHA 4TZKA 3E35A 3KEOA 4QYTA 3AX6A 3HZRA 2JLQA 3A7DA 4I50F 4XZ3A 1BG6A 3NRCA 4JNCA 3QH4A 5I4KA 2C4VA 3BTVA 3SN6A 5L95A 5LU8A 2C7BA 3DD5A 3FHOA 1ZYUA 5A3SA 1HBJA 5P21A 1VCHA 2PO7A 4INAA 1LNQA 3VPGA 1Z6TA 5DXFA 2FXVA 3H6GA 5I9SA 3VMFA 3HJUA 4Z4CA 1SHUX 2G0TA 1KPGA 5FHRA 1C80A 2XB2A 4AY3A 5HOEA 1B0UA 5DBGA 1NQXA 1WU7A 2V7GA 4GX0A 4X62B 2NZXA 3M9XA 3K9WA 1AXEA 3RT9A 1YZHA 2NV2B 4J0CA 1YCGA 3QEMB 2ERXA 3JYHA 4Q7JB 4QPNA 3REOA 1O96A 1N25A 4R9SA 4CI0B 1Q0PA 1C3VA 4CIWA 3HB4X 3CLRD 1U02A 2GA8A 3P9NA 1A9QA 4H15A 3EVGA 4Q7KA 5F5NA 3V8VA 4AJJA 1T4CA 3CQ9A 3M9LA 4RK4A 5KYWB 4TTQA 2CDNA 1E9CA 1KNQA 1UODA 6ABPA 3SI7A 4DA7A 3SC2B 4HXGA 5EIWA 2A9QA 1DOAA 3QXGA 3UMCA 3QTTA 2NACA 3R76A 4Q66C 3UW1A 1I1OA 1TVKB 3KWJA 3U4HA 4D45A 5FTLA 1TK2A 1UCFA 1CNFA 2OLKA 3IJPA 3MCWA 1C9EA 1H2AS 1QG2A 3IVXA 5T4EA 4EG8A 1MO4A 1FSFA 2M98A 3O2JA 2XUGA 3NHJA 5JSYA 4AYWA 6PFKA 2C4WA 2Z58A 3B9PA