1UBNA

Selenosubtilisin bpn
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
275
structure length
274
Chain Sequence
b'AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETNPFQDNNSHGTHVAGTVAALNNSIGVLGVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDSFYYGKGLINVQAAAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SELENOSUBTILISIN BPN)
publication title Electric fields in active sites: substrate switching from null to strong fields in thiol- and selenol-subtilisins.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
total genus 85
structure length 274
sequence length 275
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1999-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1ubnA00
5JMOA 1C9NA 3QFHA 4JP8A 3HJRA 4H6XA 4KB5A 1HT3A 4FONA 1SUAA 2DQKA 1SCBA 1EGQA 3F7MA 3OSZA 1SUDA 2QTWB 2SBTA 4KG7A 1IC6A 1BE6A 1NDQA 4J94A 3PTLA 3TECE 3A3OA 3DVSX 3SQOA 1TO2E 3UNXA 2PYZA 1WVMA 1Y4DE 4AKSA 1OYVA 5JXGA 5AVJA 1R0RE 1SUEA 4HVLA 1GA1A 1SVNA 4BWGA 5K7SA 3DE1X 1BE8A 3VV3A 1PTKA 1AV7A 1S01A 2W2QA 4ZARA 3AJ8A 1SIBE 2WUWE 2V8BA 1SPBS 3GCWA 1MEEA 5ARBA 1AQNA 4C3VA 1Y3DE 5AQEA 1WMEA 4CG0A 2W2NA 2Z30A 1Y4AE 1T1IA 2ID8A 3Q5GA 3VYVA 1SBTA 2PQ2A 1SUCA 3EIFA 4DJ5X 1C9MA 1PFGA 1SBIA 1TM3E 1CNMA 3A3NA 3GT4A 3T41A 5B1EA 4NE9A 3DW1X 1SBHA 5JXHA 2IY9A 1SIOA 1SN7A 1OYOA 1TMGE 3GT3A 4OMCA 1R6VA 4H6WA 2ST1A 1GA6A 3DVRX 1T1EA 3DE0X 1MPTA 4M1ZA 4NE7A 3D43A 4WOBA 1ZVKA 1GCIA 1V6CA 1TM7E 2Z2XA 2ID4A 3DDZX 1KDZA 1P8JA 1P7VA 3I30X 3DE7X 1AF4A 1P7WA 3DWEX 5FBZA 4OMDA 1PJ8A 1TECE 1KE2A 3VTAA 3CO0S 5CW1A 3D9QX 3DYBA 5I9SA 1TM5E 1Y33E 3LPDA 2Z58A 1Y48E 2PKCA 1YU6A 1Y3BE 2B6NA 3WIUA 1GTG1 1DUIA 3QTLA 3LPCA 2W2OA 1AVTA 1GTJ1 1WMDA 2HPZA 2P4EA 2PRKA 2DP4E 1SH7A 3SICE 3CNQS 1YJAA 2IXTA 3ZXYA 3I37X 5JXIA 3F7OA 1NLUA 5FFNA 3BPSA 1SCAA 3Q40A 3LPAA 3BX1A 4LVOA 3F49S 4RYDA 4MZDA 5B1DA 1CSEE 1NDUA 3L1KA 2ZRQA 2W2PA 3A3PA 4AKTA 1TO1E 3ZXXA 3LXUX 3VSBA 1THMA 1Y34E 2Z2ZA 3DW3X 4KPGA 3DE5X 1BJRE 1KDYA 1TK2A 1LW6E 3EDYA 3DE4X 4C3UA 1TM1E 1GNVA 5FAXA 4DZTA 1AH2A 1SCNE 4CFZA 3PRKE 4Z2AA 4HX2A 1S2NA 3GCXA 1R64A 3WHIA 4ZOQI 1XF1A 3AJ9A 3P5BA 5ARDA 2Z2YA 1YJBA 2G4VA 4OV6B 3TI9A 1OT5A 1S02A 2WWTA 1TM4E 1VSBA 1IAVA 2GKOA 4LVNA 2PMWB 5SICE 1ST2A 1A2QA 1SELA 2Z56A 1WSDA 1UBNA 2E1PA 2XRMA 2ZWPA 2PWAA 3BGOS 5JXJA 1YJCA 4YN3A 1GNSA 2SECE 2XTJA 1SUPA 5AMXA 4WOCA 1SUBA 1SIUA 3WQBA 4NMXB 1AK9A 3DE2X 1BFKA 1SCDA 1C3LA 1GA4A 3VV2A 3DE3X 2HD4A 1ST3A 1Y3FE 2SICE 4B5LA 1BFUA 2SNIE 4H6VA 3I2YX 1JEAA 3DE6X 2WV7A 2WUVA 1V5IA 3VHQA 3TI7A 1T1GA 1WMFA 1Y9ZA 2TECE 1ZVJA 2Z57A 1SCJA 1GTL1 2PWBA 3H42B 1KDVA 4GI3A 1C9JA 1GT91 3I34X 2ZWOA 1KE1A 3QMPA 1BH6A 1Y1KE 3EE6A 1AU9A 3DVQX 4K8RB 2W2MA 1PEKE 4I0WB 3WIVA 3AFGA 2X8JA 5AVKA 4DWWA 1DBIA 4CFYA 1SBCA 1SBNE 1EA7A 1Y3CE 2X8JB 1Q5PA 5ARCA 2DUJA
chains in the Genus database with same CATH superfamily
4ICIA 1YFKA 3Q2KA 1DKLA 3LL4A 1HDEA 1FS5A 3QFHA 4RQAA 5BSTA 2PJZA 4LJ7A 4BJ1A 3K94A 3KR1A 3C6ZA 4N8SA 5I4IA 3GQBA 2JFYA 3QW2A 1EVLA 3GIWA 3BULA 3PHJA 2VDUE 5M3BA 3PFBA 3U9LA 1SCBA 1Q21A 2ZTHA 2EBUA 4JIMA 1P7CA 1PFVA 3GJ7A 5D00A 5CEEA 2H51A 5KIAA 1AHPA 3BJIC 4YPVA 1K86A 4Q9IA 1TZKA 1WCYA 4R0NA 4FS3A 3CYFA 2YJ3A 3MBIA 2WF6A 1ECJA 1SU8A 1AK1A 4R3NA 1HUQA 3TD2A 1UZUA 4J3FA 2GYUA 2XOKD 4RNDB 5DI3B 2AN1A 2VI5A 3IUJA 2OBFA 4BQQA 5I7VA 1FRVA 4Q1DA 1D03A 2X9QA 1X1TA 3BH6A 3CH4B 2QLBA 4NCHA 4TT3A 4F21A 2I7XA 3VU9A 1QYWA 3PTLA 4HZIA 1QQ5A 4RY8A 3AGPA 4LWQA 5I7SA 2AXQA 3MLAA 5AK3A 2JA2A 4PC7A 4LYHA 1Y8QB 3ML1A 2FH5B 3SQOA 5ADWA 5AKIA 3S1AA 4MV1A 1RE1A 4ESHA 4DV0B 3ICPA 4WI1A 3AL0C 2QL7A 5E4JA 3TLEA 3JD2A 4ALIA 3PHGA 1OJ7A 4CCYA 2XGJA 3WA7A 1ODLA 1G64A 4UHDA 3TLGB 1FE8A 1XTPA 2OWDA 1Q1EA 3FMVA 3H0CA 4P5PA 4PZ9A 4X00A 3O8NA 4NZPA 4WKPA 3OZIA 3O1HB 3GG9A 4QJIA 1VXRA 3FNQA 1XKTA 4BV8A 1HO3A 1B8NA 5CRIA 1SJ9A 5EMHA 4HN2A 5CEJA 1A2BA 1DQYA 2H08A 4IMIB 3C5WP 4DLLA 4Z0TA 4QTUB 4IVQA 5JPCA 3N6RA 5FKJA 1YS6A 5JFTA 2QVCA 3CIOA 3IQGX 4EGSA 4Q0MA 2QZZA 3ICQB 4Q4HB 3M34A 3HSYA 3S5UA 3EUAA 3SR4A 4X66B 1I7QB 4WJLA 2WOJA 3PUYA 5EJ2A 5ISMA 4FHFA 4N7BA 5E1OA 5C8VA 3U1TA 3VC1A 3PKIA 2YQZA 1N6PA 3W7BA 2H1IA 4IJVA 1VI6A 4HAYA 1CB0A 2ZVDA 2QYSA 3BG5A 1BVUA 2FPKA 5EP2A 4D43A 1VZ2A 2E0IA 2M1ZA 2ODBA 5DK4A 1C1DA 4PLTA 5T67A 5ULLA 3F78A 1DBRA 1P29A 2QN3A 3IIIA 2VXOA 4TQAA 3P32A 1I0IA 3BGIA 4Y1RB 3WBJA 5I9MA 3WL3A 1G5HA 3EK2A 1BXGB 1WRBA 5C8DA 2UZ3A 4BO9A 3CZRA 2Z30A 4GLLA 3UJ6A 1FFHA 5C80A 4RZUA 3SJZA 1NUAA 1NIPA 2PLAA 2VQFB 4M53A 3FPHA 2ETXA 4MIYA 2AK3A 2I55A 2Q4DA 2W2KA 3JQDA 3SKYA 3A10A 1IU9A 2ZITA 2DRIA 3EIFA 1AK2A 4BNKA 2JLWA 3GNLA 3C5HA 4RGYA 1UMKA 2HU2A 1U0EA 2B78A 1WMAA 2HFJA 5EJFA 2B4RO 3AETA 3FLEA 4LKRA 2CJXA 5JNTA 1C7JA 1IY8A 2HPAA 2YCBA 3K1ZA 1AN9A 4FJ1A 3CCBA 1XRLA 2ZWVA 4GWKA 4HS9A 1NV9A 2IHYA 4ZXPA 3AFOA 4PYQA 5DT2A 2ORED 2HHJA 4FKBA 2A7QA 4KNVA 4MUKA 3USES 1D6SA 1C8KA 1U2PA 2ILVA 1BCRB 3DDWA 4NFHA 2R5FA 3Q7PA 1C7IA 3OHPA 1QVWA 3OOEA 4LFCB 1SVSA 4RFLA 4DQ0A 3NPAA 2ZJYA 1EDOA 3SEAA 1SIOA 3HXTA 4D8UA 2WIJA 2W90A 1QQ7A 5KOJA 3EBLA 2FPIA 1VOTA 1ZXLA 4JYZA 3OKFA 1ZN7A 5BQOA 4MRMB 1DTWA 4E13A 3TVYA 2WB4A 1TMGE 2VHUA 4OMCA 3ZVLA 4BXOA 1RDFA 2Q1YA 3IT3A 4TQGA 4L6AA 4L7VA 3IT1A 2O8VA 1NVVR 5D2CA 1OTHA 2MYUA 3PWZA 2IBMA 3QVLA 3VDRA 3WTBA 5BW8A 3L8MA 3IOMA 1W5EA 1Y37A 4NCIA 5EE5B 4C7VA 2RK4A 3IP1A 1Z8NA 3H2HA 3BDAA 4JVLA 2CEKA 2R1TA 1XMPA 1YB2A 1GSOA 4ZVTA 2EIXA 2WKPA 3KUXA 2IE0A 3TQHA 3VXKA 4DG8A 3B36A 5LXTB 1N2BA 4FGSA 4ER7A 5KOYA 4RD1A 4DIEA 1JB1A 4HMOA 5HKLA 1P1BA 3ZQUA 3TB6A 2DKNA 3RUAA 3OHMA 5FNVA 3V2IA 4HVAA 4TM8A 2AQIA 3L7KA 1MOSA 2GN6A 2EERA 4FR0A 3JALB 3ONDA 3MZ0A 2VL7A 1WY5A 2J46A 5BMVB 3WWPA 1QPGA 4X54A 1H6AA 1KNXA 4KDEA 2Y1WA 3ENWA 1AV6A 2F8MA 3AUSA 1E66A 3AWIA 3LW8A 1WP4A 2WYVA 5DM4A 5FA6A 3PD7A 3HZRA 3NCHA 3SIWA 4OQMA 3ZYZA 4B7ZA 2ZJ3A 4ZI7A 4PYKA 1Y1TA 2AMFA 1E20A 3WLMA 1DCMA 1MG5A 3JAKB 4OATA 4NJMA 3VJMA 1H2WA 1OE0A 2C07A 3VMMA 4QEKA 3WZLA 3RKRA 1Z2AA 4WEQA 4EPYA 5CLJA 3NHKA 3RYIA 1TADA 3BQMB 3ISVA 5EJEA 3DOIA 3PFCA 4MV9A 1PJ8A 1KVUA 1T9ZA 4D5GA 5FOXA 2XZLA 4WZBA 4HNHA 1ACLA 2NXNA 3CVJA 5AK6A 1FNMA 4RPLA 3OTHA 1CRLA 4NYJQ 2O2SA 4LVUA 1U04A 2HEIA 4D4JA 2F7SA 3NAQA 1BX3A 1ZGZA 3LQ4A 1CS0B 3N39C 5AM0A 4RMNA 1Y6RA 2XMQA 2IIQA 4I1OA 4LTDA 3DKVA 4M49A 1XZIA 5ERYA 5FRDA 5JO9A 3CLVA 1NLFA 3ZXUB 4DA0A 2XADA 4R9UC 1B8UA 2IFTA 1X7WB 3M9LA 1LDEA 1OLXA 3I5UA 1TM5E 2AK2A 3H87A 1XFDA 5K0CA 1TEVA 1M3SA 1VBNA 3H9BA 4YJHA 3K0CA 3B3JA 5C7YA 4Q1VA 5BVGB 3W1EA 1Y6JA 5CFZA 2BMWA 1YCFA 5BSFA 2RG1A 3AVWA 2FK7A 1R66A 3AJAA 2PMBA 5J5CA 3U09A 3ZHTA 1TCAA 4P7KA 3IMFA 3E70C 3H1AA 4DM7A 4XYGA 4CG1A 2A9FA 1IBCA 5CDTA 1UR5A 5G3YA 3RARA 4X0EA 3EVGA 8MHTA 2FSGA 5CH8A 1R4MA 1R8XA 2BC9A 5FA5A 3BEOA 3DOHA 2GAOA 3DYVA 3RTDA 1LY1A 2XUHA 4HYTA 2G0NA 4J2TA 1ZCZA 3TQOA 2YHIB 4ZO4A 1AUVA 4YB8A 4Q82A 1ZIXA 1SOWA 1L5YA 4MAFA 4RXUA 4Y2TA 2NZWA 4NARA 2DM6A 5EE9A 4I1YA 1EVQA 1QB7A 1P1FA 1VRCA 1IXRC 1U9CA 4Q05A 1VHJA 3VZBA 3LWDA 2NXWA 4LCBA 4JI0B 5J2TF 1MDFA 2REQA 3GEDA 2A33A 3OIDA 4I9FA 3TPCA 4HNTA 2IEYA 3Q40A 2CXSA 5EIEA 2F67A 4GQBA 3BORA 1OAKA 1QGOA 5BRNA 1V8ZA 2BJHA 1KPIA 5JBQA 1O9HA 2FPUA 3MUFA 1XDBA 4QDTA 5EWLA 3AVUA 2CN1A 3RFXA 2GAIA 3C6QA 3ZX5A 3AKZA 4O1MA 4BQPA 4JWKA 4BZZA 5EHNA 3MWDA 5FWXA 4E5VA 3ZXXA 2VSXA 3I9KA 3VSBA 1VB3A 3RS3A 3CURA 4LZZA 1K98A 4YREA 3FNHA 4GC5A 2BR3A 3S99A 1R4AA 2X1HA 3UG7A 3VPAA 1XCJA 2QM7A 1ZXXA 4II2A 4CKZA 2BLLA 5E0OA 3A26A 4I66A 3C7KA 1ZWLA 2H7VA 2IYAA 3ME5A 3RIXA 2HRCA 3VAAA 4R0MA 1XGKA 5IKXA 2EHDA 5K0LA 1X9IA 4CMGA 3O2JA 4JLPA 3ST7A 1TFUA 1FQJA 1QH8B 2XV1A 2DC1A 3AESB 3NT4A 4PPGA 3GLFA 5FPQA 1QX3A 2OCYC 1KVSA 1TZCA 2LCFA 5LQNA 3SYRA 3UXEA 1PZGA 2IXAA 5A05A 1XEXA 4XSHA 1Z0DA 2B82A 5IAEA 4ETIA 5L3SB 1AKNA 3M6UA 3LY7A 4EHDA 4G1EB 4HX5A 1PK8A 4ZEMA 1HYBA 2GF9A 2RHMA 3F5FA 3WHIA 3DEJA 5JLAA 5HM6A 3UTCA 2C7RA 2WNHA 3VI4B 6REQB 1R3DA 3DHVA 5CXUA 3FPAA 2EP5A 1NMXA 2CLOB 1VC2A 1XF1A 4QNMA 3AEUA 3HKDB 3RU7A 1B73A 3LVRE 5IF9A 1NQAO 2WG1A 4REQB 4PFSA 1MOQA 1YJBA 4O59O 4YRIA 5CNMA 4I3FA 4FTWA 4MWDA 1I9CA 1OVGA 1YKGA 4MAAA 4KYTA 4FIZA 3ZBPA 2XNDA 2Y2VA 2RE8A 4JN6B 4UBNA 4TSKA 1PX0A 2AG1A 4TWIA 2VK8A 4RQTA 4UHCA 1T3ZA 3ID6C 2Y4OA 2YY7A 3S2EA 3WNCA 4B33A 2HA5A 3BWVA 2R65A 5HDQA 2VEDA 2VJPA 5GTDA 2P2ZA 2FUNB 5AUQA 4G0WA 2VIIA 3CLUC 3OEEA 3NGLA 1PG0A 3PICA 2ACEA 6AT1A 1G20B 2GETA 3H2IA 4FGLA 2P4HX 5A3SA 3EC7A 4X8OA 5EXXA 2C8LA 4NI5A 4C1BA 1A50B 4H4DA 2J8ZA 3GJYA 1NW6A 1DAEA 3C7CB 2VT3A 3TDMA 2GPYA 4BVKA 1A4UA 3HCCA 1NQOA 4L3OA 1HE8B 1UAYA 2WU1A 2W6MA 2YVAA 2EJUA 5K6RA 4Y6RA 4L7QA 5KI6A 5BR4A 2R79A 1N75A 5SY6A 3U9SA 3PQ8A 4HNGA 3F47A 1ESCA 1LTKA 1NUQA 2C04A 2H1WA 5AUOB 4GGMX 2PGAA 1D6JA 2JGFA 5KTKA 3U31A 1VLHA 4YROA 2YJTD 2CXQA 3CNOA 3DG9A 4MUNA 4FXOA 1B6RA 3OJOA 4NPHA 1NVEA 5A7HA 4RTJA 5CG2A 1DCFA 4HWRA 3VPHA 4M3NA 4ENQA 2BFEA 2IYWA 3LVQE 3QVGB 4LOLA 4D0SA 1SCDA 2GILA 2H1OA 1G3RA 1YVRA 1PS0A 4PSVA 3DLBA 1Y63A 2QRNA 3B9QA 4LC1A 4PLVA 2QW1A 4QGSA 4FR5A 1S4MA 4YJGA 1ORWA 3FI0A 3SQMA 2NUTA 5DBOA 5PGMA 2CDCA 1JR2A 4KRXA 1N5KA 4P3NA 4DV3B 4NBLA 5DULA 3ND5A 1EDDA 3LPLA 3DV9A 4UPVA 4INJA 4B6PA 2ZXUA 1GLVA 2NSDA 4HKTA 3PL1A 1J7JA 1Z5GA 4UZEA 3FTNA 3LNTA 3FWZA 2VSNA 4N48A 3AI7A 2GI4A 2VK2A 4QWMA 4DYVA 4YMVA 1A97A 1UKVY 5B3KA 1A9QA 1F6WA 2W6ID 2HCFA 2D5IA 4EHAA 4RU1A 2BJWA 4N7MA 3RG2A 3UMRA 1MJGM 1PZMA 1YDHA 1E77A 2YJ4A 3K1YA 2O59A 3U7IA 1A9OA 4M9RA 5BSEA 1CY6A 1KR5A 1E1QD 2P0YA 3CO5A 4W82A 5IMBA 1P1HA 1GT91 3C8HA 2ZVPX 4G5FA 2JIDA 2W6JD 1KE1A 3SZ3A 1L4BA 5AI4A 5D8DA 3S40A 2SKDA 4Y2SA 3UMFA 2DAPA 4B73A 2QMHA 3UWPA 4HWSA 2A88A 2AD1A 4EEZA 3DVQX 1NBWB 1W6UA 1LJUA 2IU6A 1J0XO 4J0QA 3SZLA 5EMMA 3I72A 4WDRA 4LYYA 3UB3A 3ZLTA 1HMYA 3LC0A 1WPRA 3MRVA 2SKCA 4HYEA 3P0JA 4PZAA 1U7HA 5THKA 3RSLA 3ZHYA 4DJEC 2NMVA 1U4OA 4MQUA 1AUXA 3BE5A 3H2JA 1Z0ZA 3IXLA 4EHFA 2AYZA 5JVDF 2CSUA 4FZJA 5JS2A 2C20A 2XVZA 2X5NA 3D8HA 3P9SA 2PZJA 3AERB 2FRXA 1K0UA 3CLUD 3LLUA 1Y7LA 1YOVB 2DUNA 4BRUA 5JEEA 2VF7A 4E1BA 3HJCA 1L5WA 1CCWA 3HKEA 1G7CA 4P7JA 5CX1A 4Z7JA 1KRXA 3OT1B 3WIEA 5B58T 4DV1B 5IKPA 1GM5A 5DFAA 4XQEA 4OBEA 1AQYA 2AFIA 4Q03A 3IEMA 3SOZA 1G8FA 1GPDG 4KB5A 4B34A 4XLLA 3N0XA 3UENA 2ZJ5A 3HP4A 5AKYA 4B84A 3HABA 5JZ9A 1TD9A 1TQ2A 2IS1A 1NNEA 1XZ8A 4YQYA 3RFUA 3SSNA 2YY6A 4C21A 2FWNA 3I5MA 3RTBA 3W2IA 1LPAB 1RWVA 3AF0A 4MV3A 1QO0A 4Q7KA 5FBLB 2WNIA 5TGDA 1JH9A 3I3SR 3F6RA 3QW4B 3ERCA 4PRLA 2CVHA 5ALRA 1D9ZA 1X8XA 4D3SA 1XTUA 1PWXA 2PLFA 3JXEA 2QMOA 4OHXA 1I80A 3UM9A 3NBZC 4PCUA 4RA6B 3RVDA 1SKYE 1MO6A 4DIOA 1JLMA 2A0KA 4U5XA 5K3SA 3AEKA 3V2GA 3KCNA 1XI2A 3FMFA 4I4TF 1TQ4A 4JC8A 4HDMA 2WIKA 4K81B 4J94A 3N6VA 2NXCA 4CWAA 3EHEA 4IMRA 2D1YA 2PUCA 4O4HB 3R76A 2ZIEA 2D2IA 3RQSA 1R4NB 1MTOA 4JLVA 4RZ3A 4LZWA 3O0TA 4R8VA 3L02A 4F6RA 3WA6A 1XHFA 4DKXA 1IH8A 2EFGA 4JSRA 3UPUA 4JJ8A 2L69A 4TVSA 3ZWYA 1YHYA 1TYBE 3U4AA 4CKXA 4EEXA 1DEXA 1IM8A 1NASA 1XKLA 1M8KA 4QUIA 5ALHA 4QFBA 4C4ZA 1ZCBA 3IXMA 3KWLA 4NWIA 1AZWA 3UAWA 5B6PA 3U16A 1OYVA 1B0PA 2HWXA 3ZC3A 4B31A 1KA9H 2Q5JA 4CM7A 2VJCA 1Y8CA 4B44A 4OQQA 4OYHA 1X74A 4PX3A 3SFZA 1WQ3A 1U6IA 1IBSA 4DWOA 2P2DA 4UM7A 3PR3A 1K8ZB 4A8HA 4N41A 4LRWA 2ZRHA 1IVSA 4INPA 4WBNB 3R3UA 5A4KA 2P4QA 1DFHA 5AVJA 3DL7A 4JAVC 1IZ0A 4G0OA 4QUEA 5D6OA 2CZCA 1B74A 5EIAA 3NEJA 1HEYA 3ZEAA 1N9GA 1U02A 4QU9A 4CMEA 4YUWA 4ZQHA 1TC2A 5DTRA 2VZ9A 5K7SA 4BEJA 5CR9A 5KDDA 1KEEA 1K9VF 4PGHA 4N9QA 2P67A 1JG4A 2W37A 2XUAA 3B13B 3P5SA 4DUPA 3B60A 3N2GA 1W46A 1YBVA 2I2CA 1QP0A 5DGIA 2HZ7A 1MJGA 1ORTA 4ZOLF 4YRGA 1AV7A 1GO2A 1BXZA 1TIKA 1EAYA 2FMXA 3ASVA 3QH4A 3IKLA 4PQEA 2HWKA 4FS8A 1H9AA 3MS4A 3GFPA 3W5UA 3C3KA 3WIBA 2HZBA 3H6KA 3R3ZA 4ZYYA 2JS7A 3ILXA 1FYXA 4NMLA 1U65A 5TEWA 2ACWA 5TQJA 4ZYZA 3IBFA 3KBOA 4J76A 4OHWA 4ZZIA 1KYTA 3FN4A 1CUHA 4Y2XA 4QHYA 4G0UA 3PQ4A 1DHRA 2YOGA 2BCJQ 3DGFC 3B2QA 3PQEA 4NTZA 2CK3A 2RFLA 5KJEA 1CRQA 3R7WA 5JCOC 3SOPA 2W2NA 2ZJOA 3ORRA 3TDNA 2I1LA 1Y4AE 5HPYB 2ID8A 1C81A 3W6ZA 1AB6A 3KOOA 1X7GA 3PEFA 3KZXA 1O94C 3X1XA 2AFVA 4AUKA 5CB4A 3CUKA 4GOOD 5FBKA 2ZUVA 5ALYA 3EVAA 5ICGA 3G5LA 1IOLA 1OYYA 3DYIA 1AO3A 2AE2A 1N2SA 2QTNA 2XE7A 4HLNA 3G5AA 1Q12A 1VJGA 4DNOA 1UBOS 2WAXA 1F17A 2OORA 4G86A 1OZ0A 2Q4EA 1W35A 2VWPA 3SJBA 4HAIA 3IVCA 3NTRA 1O95C 1IN4A 1Z0FA 2NZXA 2OC4A 1D2GA 2OMEA 3B1KA 3N2IA 4L0QA 4OY3A 1CV2A 1DIAA 2H29A 3U3DA 5DTIA 1XPUA 4CHGA 4L9AA 4Q1EA 2R3SA 3RK1A 5AW6A 3K16A 4XXHA 5KSYA 3QJ5A 3BIFA 5DPMA 4P86A 4CN9A 2OQRA 2WPDA 1RIIA 3DO8A 5BMOA 1QYXA 1W5TA 3D02A 4EBFA 2A94A 4B6QA 5HK9A 2WYUA 4IGIA 4ZO8A 4JI6B 4B3FX 5IARA 4IDNA 1RPAA 4K9MA 2P65A 3ZWXA 4H08A 1IJBA 4Q9NA 3KJXA 5L9AA 4ESOA 1KY4A 3BCSA 4OFBA 5A6SA 2Y8EA 3K70C 1OFHA 3W8DA 1IJEA 4GX0A 4H1TA 1SU7A 1XNRB 1NW3A 4R16A 1KAHA 4XA8A 5DWQA 2P2NA 1OOEA 1VE5A 3MINB 1T2CA 3CX3A 4FGJA 1ABBA 1L1EA 2RGDA 1KVTA 1HE4A 4FJ0A 2JBAA 1D1QA 4Q00A 1MVOA 4C29A 2WZQA 3DE0X 5G40A 1X92A 4EG5A 2X0FA 4B4OA 1ZCJA 1C9KA 3OPXA 4DQLA 3SC2B 1SVWA 2HB6A 1UOQA 3R09A 4G1MB 3ZCVA 3L5OA 3IQEA 3ZZUA 4F2GA 4XYEA 5AKEA 2QZ4A 1WW8A 3G9QA 3TUIC 3FPJA 2V96A 3SVTA 5JATA 1RBQA 2UYQA 5LZ8A 5IFKA 2X5JO 1DI0A 4R6WA 4BNHA 4O02B 1ZOLA 1EUCB 1TA9A 2GO1A 4UTXA 1OMOA 1G4UR 4W1SA 3W77A 1CF4A 4RTPA 1RWWA 3D6TB 1N0HA 2NUAA 3IBTA 4L5CA 4BVBA 1Y98A 2DUMA 3O94A 1EXWA 3HLKA 1BOFA 2WFAA 5AM2A 5IF3A 3KYDA 4KO4S 1P8JA 5K8IA 5JBIA 1WL8A 1JE1A 1F0YA 2I34A 3DE7X 3SIPA 1KJJA 1Z34A 2W6CX 4RZ2A 1JG3A 4DXAA 1ZPDA 3MWEA 3TINA 1HTTA 4Z5XA 3NHBA 3DMDA 3FR8A 5DXJA 1H8EA 4BCBA 1ZAYA 1U99A 5CLLA 1LZKA 1XE3A 3FJYA 4MULA 4YV7A 3CRQA 1HH4A 1WB5A 2DY0A 4PZEA 2OV4A 1DKOA 4X95A 1OB5A 2BKUA 3AI3A 4MW7A 2WVHA 2VJQA 3TNYA 4ZAXA 1GDTA 4DBZA 4MWOA 2ZI9A 1DRVA 1VSQA 2C0QA 2HSEA 2YIVX 3MCZA 3OJFA 3Q7SA 4I6GA 4NEHB 1S0UA 1G2PA 2I2DA 2H1VA 3NO4A 4M1EA 1FTGA 4U7PB 2IV7A 4A8JA 4O4IB 2HQ1A 1RQGA 5L7YA 4BFSA 4DCPA 1V95A 4HQ0A 3EODA 4UUOA 2K7FA 2ZREA 3ZBTA 1V3VA 4FDLA 4M36A 4NOMA 4YWJA 3RC8A 1O94D 1R9GA 4A73A 3RGWS 2P1RA 1PFYA 5DLDA 4HDOB 1KI1A 1NP6A 4GWGA 3CINA 4E2YA 4TN5A 1P0PA 3OQHA 4GF5A 1CIJA 5A4MS 2AN3A 2BH9A 5J5AA 1Z7YA 2JCGA 3ORHA 3WJ7A 5I7EA 2EEZA 2O0LA 1YU6A 3GDWA 5E1MA 3D2BA 3PE4A 1UJ5A 1HMPA 5G1NA 3I5XA 4LOKA 4F3RA 1BCSB 4INAA 5K05A 1DU4A 4U2KA 3OJCA 1QK4A 5BNWA 1O95D 3IILA 3PITA 1EX7A 3HSSA 4YAJA 5SZHB 1QOZA 2Y1EA 3JPWA 4IFEA 2OHVA 4IXWA 4JP3A 4PZDA 3S2GA 2BFDB 4AP5A 3HDTA 2OFOA 1E2GA 1T36B 2AFHE 2R8YA 3LPCA 4OJYA 3V7UA 5I3CA 5KHLB 1IEXA 1M1XB 3FW1A 3KKNA 4KXXA 1A77A 3AVVA 2XQFA 1IN1A 2XQVA 4IXTA 4RK4A 4EB3A 2AZ4A 1MZVA 4FDVA 4TN1A 1OFTA 3UJ8A 2MHCA 2XE4A 1DXQA 4EY5A 3BIWA 2AG0A 4JK3A 5MFZA 3K70D 1CIPA 4X61A 4EG8A 3MQ2A 3W9YA 2Q5EA 1G8HA 4IWNA 1JQDA 1DG9A 1EWQA 2C4TA 2IXTA 2VYVD 2PS9A 4MRSA 4OFZA 3ZXYA 1VJTA 2YFYA 3HWWA 1WABA 1S8FA 4R8MA 4MGZR 3A4MA 1W29A 4AJJA 6YASA 2XE8A 4FYJA 1V16A 1GGEA 4PHTA 5EMLA 5GZ3A 4BYGA 2A1UB 2HRZA 5J59A 3IBSA 4ID9A 1U8EA 1RI5A 3EGEA 4D81A 5BR1A 3TEFA 3L9WA 1ODCA 3U13A 3L3BA 4Q7LA 2E89A 3K70B 4C4OA 1YCDA 4NMWA 2O2ZA 2QTTA 3Q0IA 3PXGA 3KVNA 4BKMA 2IYRA 1VLVA 1RZRA 1VHDA 2NUBA 2VF2A 2XUJA 4HY3A 4ZAZA 3ORFA 4EARA 3K9LA 1SVUA 5IBCA 2D5LA 4KIUA 2B21A 3MK31 1A7AA 1WUTA 1XXHE 1YV9A 1G4AE 2Y1OA 5EFZA 4C4YA 1LW6E 1UWKA 3EDYA 4EFMA 5ABPA 1Q84A 5HCIA 3BQNB 3M6FA 5F2KA 3QENA 2GHRA 5BN4B 3WWEA 5L45A 3RS0A 3NTOA 2UUOA 4TL8A 1F0KA 3C98A 3U3JA 1N5JA 1L5OA 4E08A 3AR8A 1EM6A 1E2PA 4RDIA 4CMHA 5JZOA 3S8YA 1OF1A 3ZJVA 3KU1A 4MVJF 1R9JA 2HLPA 5GPBA 4RE5A 1YK0A 4WV3A 3A05A 5ALNA 4M1SA 4MGEA 3D7SA 4FLFA 3LGSA 3EN0A 4C30A 2ZR8A 1DJQA 1B43A 1R8YA 2WJJA 2IP4A 2XW6A 3E9DA 3PPIA 2PX8A 1JQKA 4P83A 1C7QA 3MCTA 4K5QA 1JR4A 4Z9XA 3IPXA 2Q29A 4LZAA 3WRWA 4CQLA 2BMJA 3VDQA 3WL4A 2CUNA 3A3YA 1HDZA 1SVOA 2Q0HA 2WFLB 4P7FA 4CFSA 2WQZA 1M0TA 3K5PA 2A0UA 1RJGA 3NIDB 3HLTA 5KNDH 2IUYA 2CDNA 1N6IA 3DLAA 4ZI2A 1YMQA 3JYQA 1J8FA 3N8KA 2PX2A 1L3IA 4M1KA 4XSVA 4YT8A 2ZT7A 1S02A 4AQDA 4NK4A 4KP7A 1HLGA 1KIAA 2ORIA 1OI7A 4H16A 2J7KA 5JYCA 1LS1A 2YWEA 4RHCA 4D3FA 2BFMA 3RLIA 1EG7A 3GLHA 5DYGA 4RCYA 3O4GA 4EF5A 4Q9AA 5A03A 1UADA 1ONPA 1K6IA 1HNNA 2W4IA 4QU8A 1ST2A 1WDKA 4ZTUB 4H18A 2GASA 2QWXA 1A9RA 2XQJA 3HVKA 1FSFA 1W4CA 4LG1A 1B42A 3I6BA 3FCCA 1DIHA 4TTRA 1XTSA 3P9YA 5TT0A 2DE0X 1A69A 2E82A 3JYNA 2FPLA 3KPWA 4HADA 5FUYA 3HKCA 3WK7A 3UMYA 1OFGA 2QTAA 2YZ7A 3H9QA 3IOCA 3QYAA 1GRRA 1TQ8A 4E32A 2ZRMA 3K8OE 1TRKA 2F1HA 4G0NA 1B6GA 4XDGA 4ZCLA 1KHHA 1U3FA 5K2MA 3OQVA 3P1JA 3OM1A 3N2EA 1GNSA 3RYCA 1GZ3A 1HE2A 2FEOA 4OPMA 3S2ZA 2MYNA 3KJQA 3H4VA 3UICA 1H22A 4DCJA 2VPTA 3MSXA 1GD1O 5CBPB 3T3DA 5ILOA 3K4PA 1L5GB 3IE2A 4IOJA 1T6BY 5F76A 3W5HA 1YL6A 2WIFA 1L5LA 3B48A 1PUJA 1X1QA 3VVBA 4LSWA 3O21A 4LHSA 3CWZA 2ZJFA 4PNHA 4QATA 1ULSA 5DSTA 5FEMA 4CL2A 2WD9A 4KO8A 5I5EA 2YX1A 3G9TA 4M1MA 2IYPA 4GDMA 4AZTA 5CYGA 2L17A 3BBLA 2WBLC 4G9EA 4MQFB 2GZMA 3FPBA 5IP5A 4B3IA 3MT8A 4UBJA 2G0AA 3KEOA 2BM9A 2YL2A 3DGEC 3A1VA 2G71A 3MS7A 5KJFA 4L72A 2ZYAA 4HDQB 1P7ZA 1OAAA 2V7TA 1V11B 3GRAA 1NPTO 1W1UA 3OZCA 2QRKA 4CLHA 5KNBD 1KMMA 2R7MA 3QSYA 3ZCQA 3BHJA 4IFIA 1JW9B 4LF7B 4WNAA 4AS3A 4MGHA 2XDQA 2HJ9A 1T9AA 1W2GA 5JUWA 3L7MA 2OXFA 3L93A 2BFNA 3VVMA 4M76B 2HM7A 1CW2B 1J9ZA 1S3GA 1DWPA 1TQDA 1U31A 2E18A 2Y0DA 3QVWA 1V5IA 4JNKA 3DZJA 3AL3A 4WUVA 5EYPA 4KOEC 4XPIB 3ZHBA 2GPWA 5B1IA 4FT2A 3ZHSA 1JEJA 3TAUA 4RTSA 2VP9A 1YA6A 1DB3A 1Z7BA 2L19A 4B71A 3UJDA 5JCXA 2KBFA 3DS8A 4F6LA 2H5EA 2UVDA 3K7EA 4EY3A 5J4VA 1YU9A 3GGGA 3IAS1 3DFUA 2PRIA 4JLMA 4B8ZA 4LE1A 4IDHA 2ZYVX 3AXTA 1SB9A 3L43A 3S2FA 5AVVA 3SGLA 3ZD9A 3KJIA 1G9XA 5AM5A 3NHPA 4JI7B 2VQ3A 4MKZA 4FHCA 1VYVA 1SC6A 1FSGA 1S7CA 1ZNWA 2ZWOA 3RADC 3QMPA 2GERA 1J2JA 3PGJA 1GVNB 4TL6A 3OFVA 5HIMA 4I55A 5L51A 3DCJA 3I09A 3M70A 1H0SA 5GM2A 1A1SA 4BNMA 2IIVA 2VKTA 4EG0A 2GLXA 2HFKA 2X8JA 1C0KA 2GHQA 2PWZA 1XZNA 3CBGA 5CFOA 1EQUA 4L8YA 2ZM5A 1UXJA 4BE4A 2HYIC 2YRXA 2WJHA 4LYGA 4YPFA 1Z7GA 3V4PB 2VF8A 1VA4A 3ND7A 4IH1A 3WYBA 2AOXA 2XWBF 4D9KA 1Q0RA 5DBFA 1O6CA 1GR0A 1I6LA 4EUNA 5KCMA 1XMJA 4EMUA 2AUMA 3KPYA 3HM9A 5HBRA 2ZBVA 2GTHA 3CLKA 3EUFA 5BWMA 3NRBA 1LSJA 2GCNA 1MENA 3T4EA 4ALKA 3U56A 4DLUA 2IU0A 1B00A 4FYIA 2FK8A 4LJ8A 2DFDA 3OU6A 1D1TA 1GPYA 2GEJA 4URFA 1YHNA 3KUUA 5T41A 4NOKA 2AUNA 3K9NA 1A1VA 1X7ZA 1JILA 4BKQA 1ESEA 4ZAGA 2X0NA 3HBLA 2XYGA 2YYZA 2CFOA 1T4GA 4PSAA 3DMGA 5ADVA 1SB8A 2RHWA 3GPLA 3GEPA 3KTAB 4EVSA 4F5ZA 4KFTA 3F7MA 3VR1A 3RWOA 3WGKA 5FUBA 1I1OA 4S35A 4K9NA 5AVUA 2IX3A 1CR1A 3MT9A 3VSAA 4IDGA 4NHEA 1DRWA 4OKIA 3BT7A 3A7DA 2FJ0A 2UZ1B 3PQ3A 4M8SA 4TKMA 4QFDA 3ZDFA 4BP1A 1A95A 2H1SA 1BO6A 3O03A 4RM2A 1EH5A 1SUFA 2N9UA 5IM5A 2ZUDA 1GWNA 2F43A 3QYFA 5K0GA 2XNCA 3R74A 4Z0NA 2C31A 4LISA 3I2GA 3B6MA 3OUZA 1QLJA 3K9HA 4LIPD 4HXYA 1C0EA 4BNWA 3PDWA 4N0QA 4BX2A 1NIJA 4CF6A 1CJKC 1SHTX 2YIDA 1YIDA 5L4SA 5JTUA 1PFUA 1X14A 1XT6A 2ZYWX 3ANNA 3PTZA 4NV1A 1E6WA 1PL7A 2NQ2C 3LT2A 3G2NA 4O29A 3UQZA 1NBME 4EJSC 2ZKIA 4R7TA 5DOVA 1KFCB 1GZHB 2WUFA 4OG2A 2OOKA 4C5AA 5D84A 4EFDA 4KPUA 2C96A 3GJ5A 3VMFA 1AHIA 2YHUA 3LH5A 1K5GA 2E5FA 2P6OA 3HZOA 5FPSA 3TLMA 3ZVRA 3VPCA 4QUGA 4IOMA 4U2CA 5FAKA 3ITNA 5KSZA 4DRXA 2JLUA 2QGFA 1JWLA 1Q1NA 4GT1A 1TAGA 1SKBA 4CF4A 7REQB 1AXGA 2QL5A 1M2GA 2C2XA 4WEOA 2G1UA 2YW2A 1FTWA 3F46A 3HO6A 3JYLA 4KSYA 1FFYA 1Q7GA 2OT3B 2V0NA 3R6DA 1GYPA 4MVCA 1G8JA 2V4MA 3O74A 2BZ0A 3ABRB 3UC9A 4TWJA 5K6TA 3ND8A 3ZE2B 2OO3A 1QZUA 1MT0A 3C1AA 3VTKA 1BE8A 4CI9A 4S1TA 4Q1AA 1DLJA 3P96A 3ZH9B 5LL6P 2BAGA 3WMXA 4ALLA 4PU0A 3QQ5A 3U17A 4BGVA 1CRWG 3NOXA 3U4IA 3ELYA 3OJLA 2BFBA 4RWZA 4WN9B 3HRIA 1QF7A 2FG5A 3AJ8A 2QN8A 2QP3A 3ECSA 1SIBE 3HKBA 4OMFG 3MJVA 1PUXA 1TYEB 2J9YB 3TAXA 4RBNA 1S8OA 4JFAA 2OV8A 4L9WA 3WWYA 3ZGOA 1JXAA 2A0WA 2WHPA 1POWA 3Q15C 3A2NA 3O47A 2WT9A 3DBRB 3NGMA 1M8FA 3WLHA 2X77A 3LHKA 3B7WA 2JAOA 1X42A 1QCDA 3FDFA 4RJJA 4R1LA 4Z54A 3SWWA 1G6KA 2X0IA 2ZQYA 3FTDA 1PR6A 2W8ZA 1O5OA 3NYQA 3P2IA 1T1IA 2C98A 5DBGA 4CJXA 4C03A 1L9XA 2C03A 1WY7A 3PGKA 3PF8A 3E3OA 3L4JA 5K0FA 1EBBA 1NMSA 3VYVA 3LLCA 2WV9A 1WW3A 5EPOA 2E4UA 1Z22A 3STHA 4CIVA 4M8NE 5DIZA 4Z4FA 1GL6A 1WF3A 2CUZA 2EGHA 2QUKA 2Q4OA 4LXIA 2ZRAA 3BOSA 4NCKA 4Y9DA 4MOWA 2BEWB 3H1EA 1T9GR 2BE7A 5CXQA 1FS4A 1V8PA 3L6BA 2WSYB 1G7RA 3SYMA 3IJRA 4QOFA 1P61B 1XQWA 3ZZ1A 4WHMA 1OKKD 1OILA 1Y9EA 3IP6A 2HLDA 4NEQA 2XT0A 1U7PA 2FNAA 2H5LA 5EJ4A 3ETGA 2RD2A 2M6KA 5AKLA 2WHYA 5KTTA 1VJCA 3A4YA 3KTFA 1KO5A 4D9HA 4TXJA 2QRPA 1RFGE 1ZUHA 2UZAA 1BYIA 1TAHA 2G7ZA 2R6ZA 2JI7A 3IQWA 4DM3A 4G0VA 1TF7A 3R8XA 5IJAA 2IY9A 3OKCA 4MCAA 2PUTA 2QTZA 2ERCA 2V6JA 3GRUA 4A0SA 5DXAA 2OXIA 5I8PA 1SD1A 2XMZA 3H86A 3RFVA 1LH0A 3ADPA 2OZKA 5K8JB 3RNOA 4LJ4A 1ZW1A 4B4UA 5F33A 2HHHB 1CJVC 4K6OA 1E9CA 4QLOA 4KR7A 4IIDA 5HJ2A 3R9XB 2FV8A 3QPUA 5EFOA 2G1PA 4P38A 2V6GA 2D6FA 2JAXA 3ZE9A 4AJ9A 2XQKA 1A8PA 1A7KA 3RNLA 1GA6A 1CF9A 3BZBA 2FWBA 3H8SA 4U2EA 2NU8B 4PNZA 1PDWA 1J99A 1DS6A 1TK3A 2JVKA 2EG5A 2ZU0C 3KKPA 4Q3BA 2N42A 3I05A 3ROKA 3V8NA 3L1UA 2B69A 1N2XA 4A91A 4DG5A 3QZUA 2OBMA 4XB2A 1CVRA 1JKMA 3JQ6A 2H4FA 4PQYA 1KOLA 4OX9B 1KQPA 3BWYA 1PDOA 2FPMA 3H2KA 2G5GX 3NB0A 5EXDA 5ICCA 4JI2B 3T35A 1HT1E 2JCXA 3FFAA 1GHTA 5J40A 1H6BA 2NU6A 2O3RA 4YFVA 1P39A 4I6EA 1TJYA 4IHAA 3VO9A 5GIPE 1MC4A 4DIFA 4EJSB 4L3VA 4WXPA 2ADOA 2DFTA 1TKAA 2XUDA 5K3BA 3UAGA 2B34A 2ZXFA 3QXSA 3ITDA 5K4HA 3N7AA 4XCQA 4MJXA 4ND8B 3ORSA 2WFMA 1Z3CA 2AR9A 4XGRA 2W22A 3BTOA 4GOKA 1N2JA 3IUNA 3DWEX 2FMKA 4NBRA 3WQRA 5AW7A 2ZDGA 2D13A 2AG5A 2D8MA 2PEZA 4D9EA 3DCIA 1XZHA 2B2CA 3IBYA 4XM0A 1EINA 2H16A 1YR1A 3FZEA 3SJCA 4GP6A 2J5RA 2WHXA 5BP7A 1REQB 3HH8A 1A9ZA 1J70A 1PUIA 3FHLA 5KAPA 2QDKA 1G21B 1TT5B 2CLCX 2ZUSA 3QVVA 4DDHA 3LCVB 1H4SA 1QTIA 4ZJPA 3MTGA 2X1MA 3K2BA 3MAGA 4O2BB 2PZMA 4P2GA 3CRVA 4R05A 1RQ2A 3KJHA 4U2FA 1I3MA 4FEAA 3ZI7A 1U4SA 3E1SA 3OOJA 1WDLA 4QYWA 2HY7A 3Q8WA 3D3KA 2NG1A 2ZJ4A 1EFPA 2F1IA 2C3OA 1KY5A 2QNBA 3DAFA 4FFBB 3P0HA 4M7PA 1EDZA 3PGLA 4X20A 2UDPA 4XWAA 5L3QA 3UH1A 3NVKI 3U7QA 1YDEA 4QBGB 5K0BA 4AO8A 1YB6A 4FSHA 4GS5A 4Z51A 3DKRA 4ZRMA 5EEGA 1HYEA 4BNXA 4W99A 1E2EA 1H2AS 1QWSA 3K8YA 3OLXA 4RIIA 5KS2A 2QAJA 2XB9A 1A71A 4CGZA 4G63A 5BUZA 1X1CA 3DTVB 1JVBA 1IHOA 3GDFA 1N0UA 3ZDDA 2X0EA 4MS3B 5K3FA 1KQGA 2P4EA 1D2RA 1M1YE 4B83A 1AXEA 3WBBA 3CV3A 521PA 3QWBA 4HV4A 2O6LA 1PTJC 1CQPA 4XOUA 1AQ6A 3RYTC 2JIMA 4GL4A 3DUFB 4HB0A 2MSDB 5B5SA 2BGGA 1EI9A 2PSSA 1Z8DA 2VTEA 3VSDA 2GM4A 1VL0A 3K5WA 2VUTA 4L78A 1FDIA 4XFJA 1G18A 2HGZA 4G89A 1KK1A 2W4MA 1E1RA 1NVTA 1II8A 1P8AA 4FJ2A 4YT5A 3ZBUA 4DA4A 3IVGA 2G67A 2D1SA 1OIVA 2C7OA 2DECA 3T1NA 1K7FB 4OHBA 2X41A 4OHZA 4EUKA 1IY2A 3PTAA 4RF4A 3W8FA 1W0KD 2H2DA 4F7DA 1DXYA 1M2VA 1D7OA 1L7MA 1WZ2A 3VHXB 3ZDXB 2QOEA 1X86B 3IKMB 4L51A 4JT2A 4EFKA 1D04A 4UEOA 4US1R 2OLKA 3W5JA 5JZMA 2WSBA 1QUFA 2C4VA 1ZG3A 2QR5A 4RKFA 4R1QA 2HK7A 2EKZA 2DEUA 4DQXA 1L7XA 3VFDA 2C9ZA 3I83A 4MYCA 3WRYC 4AROA 1S7GA 4KR2A 2DPMA 1PX2A 2JK0A 2OVFA 3LMKA 4YV2A 6PFKA 2OKGA 4DPLA 4BFCA 4M0KA 1C3VA 4IRMA 5CMLA 3GYBA 4ZHQA 1RYZA 2WIBA 3HA3A 4X3OA 4RXMA 1XC7A 3T1TA 1P1KA 1OREA 1JLHA 4QECA 2MMGA 3T12A 3E53A 1SQSA 2XAAA 1GCGA 4UFOA 4YV1A 3U39A 3CF0A 4G6ZA 5AIBA 4UQOA 4JXXA 1W88B 1RQNA 5HFAA 4URVR 3KQYA 3V97A 3RAJA 3GZTB 3PRKE 5TQ0B 5A6VA 3PQ2A 1JIUA 2GPJA 1BQ4A 1U2GA 1YCGA 4O5OA 4WTOA 1GRCA 2NO6A 2FWRA 3BDIA 2IUUA 4KFCA 1K4MA 1GNQA 5AXAA 4LOJA 3IX7A 3IXQA 4OA5A 1F7VA 1E8DA 1QZXA 3Q1KA 4R5HA 1W1IA 2H2IA 2XUFA 3FVRA 1QO9A 1U2RA 1SQ0A 3DEFA 1CE8B 2C7BA 2E4ZA 1P5RA 4RJ2A 3WL7A 3UK2A 1I7NA 1E4YA 4EKEA 3O1JC 1MABA 1U3TA 2ECPA 2QX7A 5FL7D 3L1IA 1HDYA 3IE1A 2QG6A 5IZ4A 2P6PA 4OOFA 3ZU6A 2VNJA 5JH7A 2NIPA 4C6HA 3CH7A 2BUCA 4PYNA 1CEQA 3MIIA 1S6YA 3ENVA 3OQIA 1JHRA 1IXZA 1O8CA 1UP4A 5SYMA 1KDTA 1JJAA 4DIBA 4PNEA 1EVKA 1VSBA 2N3ZA 4PLYA 2C42A 1RWKA 5EJ8A 4DC0A 3QBJA 1F1JA 4NBKA 4V0LA 2WE7A 3PX2A 3A32A 3GFSA 1R9NA 1YL5A 3PQDA 2I03A 3GUHA 4R41A 4BGDA 3CIFA 4XQGA 2CB9A 3R9WA 1STOA 2G1KA 1QHIA 3GG2A 4EHNA 3F96A 3BJMA 2CZGA 4UDYX 5TXGA 2IEDA 1RXVA 3ZZ0A 2WAAA 4ZVKA 3D7RA 4U7JA 4OBWA 3COPA 1TYCA 3CR7A 2NT3A 3PCRB 1RJ9A 2ARKA 4F9FA 1MJ5A 4JLJA 5TMBA 2XCTB 1DC6A 1ZL0A 3D4IA 3NX4A 4YN3A 1N77A 3GW8A 1PLKA 1RAHA 4FCWA 4CM9D 5GJBA 4L95C 2D2EA 7MDHA 3JRXA 3OCWA 2PX3A 3SKXA 4WOCA 5THQA 3D6JA 2H1LA 3TZLA 3HMKA 4Q34A 4Y0VA 1XCMA 2PT7A 3QELA 2FWJA 2J1LA 1KKMA 3WGTA 3AJEA 4EVRA 1ZHOA 4RK6A 1WXFA 3VDNB 2VDWA 2X22A 3D3WB 2YS6A 5GWXA 1AMOA 2VQ6A 4ZAYA 3M3DA 2WU0A 5FD8A 1JR3D 2NO4A 4L73A 3CKMA 4QBKA 2GNOA 2BFAA 2EG9A 3A6HA 4HSGA 4PO1A 4W6ZA 5LP6A 5G0TA 4GZ3A 3HJNA 1NYLA 4OH7A 1ZH6A 3AEQB 3DE3X 3B70A 2SICE 1NL3A 2FXIA 3CXRA 2GZ3A 2I1VB 2JFXA 2PKWA 2YASA 5EIBC 1JIXA 1Z56C 3WZMA 4AMVA 4KN6A 4QA9A 2ZUWA 1A4IA 2V03A 5B7PA 4HQLA 3U44A 4CF3A 1VHLA 4KAAA 4I7EA 5K8CA 3EDCA 3KAQA 4NYMQ 2Y4NA 5IYZA 1U0LA 1XAJA 2ZRDA 2IKQA 1T1RA 1AN0A 3QOXA 4IWYA 3ZK9A 3OWXA 4TTQA 5B2EA 5DGHA 4FEGA 1YE5A 1KEWA 3LX8A 3MWJA 2WAOA 3HHEA 2WP0A 5C7OO 4LF8B 1JZSA 5K3EA 5E4FA 1E0DA 1I7DA 2Y3IA 3L7AA 2OM2A 5HKBA 4LAFA 2IHBA 4A2QA 5CDUA 4F4UA 3K6SB 1E5VA 1W94A 3AR6A 1JQBA 3TI7A 4B7XA 4D4IA 5BOSB 3GEMA 1JUDA 2AG8A 2O7SA 3GGSA 4JKYA 2Z5FA 1HQDA 1A5BB 1HQKA 1GKIA 5HCUA 3H42B 3QV2A 1KI6B 1GGNA 1BKSB 2VF5X 1JAXA 4UUPA 3RS9A 4CCAA 2X4LA 1CQJB 5BN3B 1N2CE 4KAXA 4I46A 5IEBA 1IBKB 2X13A 3I9V1 4YHBA 4AJNA 1HYQA 1M8PA 2ORWA 3GK3A 1W36C 3BXOA 4OHMA 4F4HA 1Z3IX 5ICMA 3W6NA 1V8OA 2XBUA 1EZZA 1DQSA 3PGVA 2G1JA 4L3WA 3UK6A 2BFCA 3WDSA 3TWOA 1F14A 3T5PA 4OOEA 4JBXA 2COUA 2HC9A 3QLJA 4I0WB 4A26A 3FSEA 4PNPA 5JECA 5A9TA 2R1VB 4HQRA 5K0EA 4LBVA 1XALA 1GVHA 4IIHA 5H4HA 4BBPA 1BVHA 4GP7A 3QE0A 2EKDA 1W4RA 3H6GA 3ZCRA 5I9NA 5LPNA 2WQ6A 2QXTA 3OWOA 4J29A 1F1BA 1SCIA 3KHSA 4RH0A 4DIDA 3WLIA 1F9EA 1KO1A 5IC6A 3EEYA 2CFIA 2BDTA 5FT9A 3PNOA 4BNLA 3P9QA 5H68A 1IY0A 3FR7A 4MS4B 1YS9A 1XEWY 1WXEA 1UJMA 3DZBA 5CU7A 2ECQA 4YQZA 3GU3A 1LCIA 1SA0B 1O5IA 4GHWA 5CDHA 2V1XA 1ZH8A 1CY4A 4IDCA 4DYHA 4YAGA 1GSHA 2C59A 3CNEA 4YCMA 5KWIA 2FKAA 2DG2A 1Y80A 3KQPA 4ND3A 1L7VC 3RJZA 5LQJA 4FEEA 1N5RA 1RKQA 3W1VA 4P4LA 4YCDA 5FWYB 4CKWA 1TF5A 3GZNA 4TV9A 4BQFA 2IXBA 2EZ8A 3AB8A 3PC3A 4H4CA 1ZU4A 3NDIA 1CY2A 4I50B 4MR9A 4ARUA 1V9CA 5CFLA 1JG6A 1OXKB 1Z7EA 3I4CA 2RGUA 1TGVA 3DCYA 2QRLA 3LKDA 3G79A 2XR1A 5DGDA 4PWYA 1V26A 1RLUA 3EA0A 1WCV1 3JVEA 4GUAA 4KGZA 2Y0PA 2D2FA 3LYLA 2YMQA 1EGQA 4HQKA 3VBCA 4D44A 1Y7PA 5B4VA 4KMRA 3D7MA 3K0AB 1N25A 3Q85A 4ZYLA 1GL3A 1H8HD 3WKCA 2KI5A 3SQDA 4YYZA 1JFFB 3I12A 1X6VA 2X40A 3V8RA 3WYEA 3WMFA 1ZNZA 5AUPB 4IDPA 1OZHA 2JFGA 4KUGA 3AB7A 1DMSA 3OOWA 1H2FA 4WVLA 2A4MA 2IYEA 5FQOA 3UK1A 1E3WA 2V3CC 3WI7A 4BJ3A 3MGAA 4OAOA 1QMPA 3EZGA 3KB6A 1JEYA 1ZZGA 5KYYA 1DFGA 3LO8A 5EIBD 3S1SA 1KF0A 2W58A 3LF2A 4Y1FA 4PE5B 4W63A 4RTQA 2AOTB 1UF9A 4L4ZA 5JAIA 3ZD7A 2DERA 4EA7A 2XXAA 4QJ5A 3FD8A 1EZ4A 1FNCA 2C0CA 2IKSA 5A02A 1NJ2A 3HO8A 4RY2A 3AR2A 5EMJA 3PFHA 2RCNA 3A1DA 3H1PA 3MNFA 1TO2E 1XG5A 4GG1A 2VJMA 4L0MA 2AOUA 2GN2A 1QC5A 1BMDA 2B4TO 1U1FA 3GNSA 3K1AA 4RSHA 3TBFA 1WM1A 4PX9A 2ZM6B 3MERA 1TOAA 3GJ6A 1YQ9A 3G13A 4KV9A 4TV8A 4ZI5A 3NBFA 1HL3A 5JS1A 4K1LA 4NG5A 3FPLA 2A1TS 5HILA 1IZYA 5I4KA 3NPMA 3X1JA 1HT0A 2DYKA 1PR3A 1E8NA 3BQ9A 3IP8A 3MQFA 2GDJA 4WY5A 4IUDS 4AT1A 1KEKA 5CG1A 4C0SA 3K6JA 4BLPA 4B1FA 4D4HA 2PVSA 1RKVA 3DHWC 2O2GA 4QLAA 1NVAA 2YTZA 4C4RA 5EJ6A 1S8AA 4BIMA 3VYWA 5KOHA 4G81A 1KK0A 1PIWA 3L6RA 1SVNA 1W36D 4DA6A 2O3QA 1RRGA 4EW1A 2LNDA 3EW9A 1KTVA 1JEDA 1KFEB 3LYHA 2AWNA 2IP2A 1YA8A 4IIJB 4A6XA 4UOZA 2OPBA 1TJNA 3ADOA 4A7PA 2P1ZA 4DF3A 3N8DA 3VH4A 4XIFA 1Y0BA 3U61B 4JEUA 2QRUA 1RJWA 1B41A 2CWWA 3NVDA 2GNPA 1P5ZB 1CUEA 1SPBS 2FLWA 4M0MA 1O03A 2A14A 1T9KA 2A1IA 5KX5B 2I4NA 1AQNA 4UOEA 1HURA 5CT8A 1XB2A 1X19A 3ZN2A 4MKHA 1EFDN 1W36B 4Q3EA 5JAQA 2YWDA 1FFWA 1R0XA 1RYHA 3GJ3A 3ON5A 4WCFA 5TMEA 2D3WA 3TF5A 1RQRA 3EEFA 1DC4A 2ABWA 4B74A 2M9MA 3BMQA 5DASA 4P2BA 2OR3A 4RX1A 1OASA 4YQEA 4CU2A 4MJ3A 4NFYA 2AC7A 4P0PB 1J90A 1QYDA 3BH0A 3OZEA 1DNPA 1Z6GA 1VL8A 4W5OA 4KNYA 3H17A 3OE1A 4PX2A 2QVLA 3IIKA 3O31A 1UBRS 3SYTA 4FHDA 2J67A 3WJAA 2UVPB 3GLRA 1E2QA 4KLZA 5GP1A 5C0OE 2I4OA 4JQOA 5BQ5A 4NENA 2ZIWB 4KQCA 1SBIA 3V7FA 1MX5A 2WSIA 1TM3E 3BHNA 1ZN9A 1WV1A 2XITA 3DXXA 1FOEB 1KZ7B 4FP9A 2A67A 1J5PA 1PVDA 2WWRA 1CNMA 1BDBA 3QY9A 4UVHA 1L7NA 4ZZ3A 5C51B 1NUUA 2NWQA 4BGUA 2YZGA 4RD3A 5BW6B 3EG9A 2GOYA 3ZE0B 2WIGA 1DC5A 2JI6A 1U2DC 3GT4A 1LLUA 2FZGA 3LX6A 4V38A 1GQYA 2CLIB 1AKQA 1ZGJA 2H1HA 5IVIA 2VYND 4HMPA 5JXHA 1VLJA 1R74A 2FP3A 2FPSA 2Y6VA 1RWPA 1SEPA 2DVMA 3W3AH 3GRZA 4DEXA 1SN7A 4D0RA 4TKZA 4UTZA 2CHVA 4K6FA 2OGZA 5DN9A 2QSJA 3L6EA 1J24A 2A5GA 4Y6LA 5CA0B 2CFSA 1PHPA 3QPCA 3T38A 3JWHA 4I2NA 2OP1A 2Z1NA 3MVEA 5K3OA 3NV7A 5EA2A 4QHSA 5F12A 2AN9A 3Q3JB 4P35A 4YFYA 5DLEA 1NFFA 3LPNA 4M1ZA 4P98A 2DX7A 3IV7A 3OFSA 1FFCA 1XYGA 3LZCA 4CTNA 3PRHA 5BY2A 1WBDA 2BHTA 3CGWA 3RS8A 2G08A 4NE7A 4K3UA 5F3RA 2VAXA 1G8GA 3NM5A 4BYMA 2P79A 3CPSA 3O7WA 1TA0A 4HC4A 4I1UA 1XQ1A 4OEHA 5JQGA 5IH3A 2YHSA 1LF0A 3RIEA 4DDVA 3VSEA 1UODA 2BTQA 4Y3UA 5JTTA 1XEXB 3TW8A 3FYHA 3V3KA 1HWYA 3D1VA 1VM6A 3KDPA 1IJKA 2IH4A 1Y8AA 1PGOA 2WAMA 3SBOA 5IM4F 1W85A 3OEHD 5FTMA 3EZ9A 1A9YA 2PR7A 4Y1GA 2P7HA 3WGNA 1GN8A 2B1QA 2X8BA 4RMHA 1B23P 3KE9A 4E4TA 2HTEA 3PJFA 3H2BA 4Q6BA 1USGA 3R8CA 1JG2A 5LYJB 3OA2A 5D3ZA 3R3HA 2Q9BA 1USUA 1XIVA 4OMDA 1WULS 1WF6A 4IS3A 5ETJA 1NF8A 3LDHA 2P75A 2V7WA 1ECFA 4AKHA 1G3UA 1U8YA 1NW8A 3I1JA 4FUQA 4RJKA 3AKYA 2J48A 3FNFA 1E1NA 3MEQA 4L5JA 3D7LA 1HYGA 4N5MA 2WOOA 2Z5LA 1ND5A 2AD5A 3VOBA 1KJ8A 3SEZA 3L0PA 1RYNA 1R6UA 1G1AA 1GOTA 1GZ7A 2Q3FA 3PQ6A 1C30A 3JQBC 4F2WA 3B6JA 3QIAA 2ZUTA 4MLPA 4PR3A 3V3TA 4F0JA 3OOHA 5IJZA 4BFWA 3ZH2A 4BO2A 4F6CA 5JR3A 2FDRA 4KU4A 4OQEA 5FH9A 2Z58A 3C3AA 4YRDA 2JH9A 5JG7A 3NIBA 3K9QO 5CYFA 4KGVA 2A5DA 4E88A 1T3GA 2GMWA 1JFTA 1VJ5A 5JHGB 2PX6A 2RAUA 1TAUA 4FZRA 1DUIA 4RK0A 4EKGA 3WMEA 5J47A 1OQAA 3D8BA 4GE3A 2AG6A 3TFQA 2VYCA 4ZK2A 2ODAA 4C4PA 2XHEA 3P27A 4PS0A 1X1DA 2D0DA 1V8BA 3ZIAD 1JAHA 1CJBA 5KNLA 2ZRIA 1J09A 1QFMA 4F1KA 4LY6A 3N3BC 1Q20A 2OGSA 1CQIA 3KEQA 3WP1B 1YQGA 5BN1A 1G9SA 3ZJYA 4EMTA 2RIPA 5JSQA 3IDSA 3N2KA 2DR2A 2BFEB 3IJEB 1FUUA 3Q3IA 4YJ2B 1ODKA 1VKNA 2WKQA 1AUPA 1QE0A 1ZX1A 2PRSA 4LDPA 2ODEA 1NXOA 1SVIA 5BN5A 3IHLA 3ADDA 4M6WA 4X8LA 5ESWA 4LZOA 1EE9A 1FFDA 5LMCA 3OLCX 4JUBA 3JQ7A 3BYZA 3IUSA 4MLZA 2P62A 2B8EA 1PFKA 3ZY4A 5HIKA 2RAFA 3GWGA 1VKZA 3BPSA 2JHAA 2WMNB 3CUTA 5CB6A 2BI7A 4HQOA 3MGKA 2QUZA 3TJMA 4ZEXA 1ZUNA 2QF7A 2R4QA 2OBYA 4KN9S 2PG3A 1COZA 3MHPA 1CSEE 1JIVA 2CLKB 3D5EA 2AVNA 2OLEA 3OY7A 4OAPA 4PHCA 4R9VA 4WZ6A 2IZ5A 2W2PA 2HI0A 4H1VA 5H59A 2X9VA 1Q3TA 2JGNA 3NATA 1CJCA 4CN8A 1LFDB 4OIFA 5IAAA 1SZDA 3VKWA 5DCWA 3GUCA 4XYBA 2F2TA 2NGRA 1KEVA 4E2ZA 2VBCA 4MRRA 3BBPA 1FP2A 1HR0B 1UP7A 3FLMA 3KHUA 4HQFA 3QUQA 4UE3S 5DNDA 3IO3A 3NEPX 4E2WA 4H7DA 1QIIA 1GCUA 3RU3A 5L4NA 2YUIA 4FINA 4KWEA 3BMOB 3F8TA 4K26A 1U0GA 4QUDA 3N3AC 4B46A 2F55A 4IR7A 3T15A 4IHJA 3OFKA 2I3DA 4UASA 4HVTA 2ZQZA 4IO1A 3B1XA 4P4SB 4KYIB 2ZSJA 4W5RA 4E5MA 3Q11A 4DPMA 3H1BA 1W4AA 2JIOA 3U4DA 5IWCA 1UH5A 1I2DA 4HTAA 4CKEA 3RSCA 3OAAD 2FQ1A 1KZ9A 1NMZA 1OA1A 1ZD1A 4O4JF 1W0JD 3TJZA 5KNCH 5IT9A 4G0MA 4ZPXA 2MTBA 5LSAA 4OJNA 3DC2A 3MTDA 5C3UA 2P6RA 4JT4A 4QDXA 1E6CA 3QU5A 1IZ9A 1VHTA 4XEUA 2D62A 3UYKA 5E3JA 1UC9A 1JSXA 4I5DA 1MQSA 3PDHA 4EB6B 3T1YB 2OCDA 2OL4A 4FOTA 1J42A 3WK9A 5IDQA 1JJ7A 3Q72A 4Y2VA 5IUNC 1XZKA 4QQNA 2YCLA 4XVCA 2F48A 8OHMA 3OMLA 1UWCA 5C8ZA 3GUUA 5HOEA 2GYYA 1SPXA 1J4AA 3L77A 4OQDA 4BZQA 2RHCA 2I29A 1U1EA 2WF5A 5F78A 2XOXA 3IP3A 2LVBA 2NSHA 4U0KA 1EXVA 3MQ4A 4ZT6A 5IS2A 4AQ7A 1FXSA 4DA7A 3KL4A 3ZU3A 4YV0A 7ADHA 5E6RB 3OPYB 4LBZA 4DT1B 4Q3AA 3BMXA 2I0FA 2OXTA 1UJ4A 2R8RA 3C3JA 5FFFA 4ZVLA 4RPIA 1KI7A 3M0EA 1T26A 2K87A 4YAFA 4ZMSA 3ETCA 3UKOA 4EYEA 3T3EA 3N2YA 3L7JA 3BRQA 1TQ6A 2Z5VA 1EM8B 5JDIC 3H2GA 5KDOA 4L02A 2B35A 3TPZA 1MB4A 3ZDAA 4QULA 4I5FA 2HNKA 3PLRA 3C39A 5EI5A 1TYDE 1KOFA 2ILTA 2R6R1 4FU0A 4TS1A 3V8BA 1TKBA 1UQRA 3ANXA 4QYIB 4B48A 3K09A 1H1LA 2SECE 1PRYA 1KZ6A 1OX4A 4F8EA 2C7VA 2YN2A 1IVNA 2AF3C 2JFBA 2ZSFA 3PPVA 2H7XA 1OFUA 4BX9A 1P9LA 3FFXA 3JTEA 2DPGA 4GLJA 2QLMA 3A04A 4J16C 5G3ZA 1G6Q1 5EZYF 3VZRA 1E5XA 2G28A 2Q3LA 4H17A 4NC9A 1F4VA 4LGCA 3RROA 2BEUA 1U0SY 3FBWA 2GK3A 1YONA 4Z4HA 1KYIA 1EBUA 4GUDA 2JJ2A 2RHHA 5DIFA 2Q8PA 2F4NA 2QORA 5GADl 5KAMA 3RT1A 3TOVA 4PZUA 2CLLB 4BO0A 1J06A 2VATA 1ST3A 1DLIA 1COWD 3E4CA 5ALEA 3IDFA 3G8BA 3JYOA 4GEKA 3HADA 2DHQA 3VKHA 2C5FA 1AY0A 5EIXA 3ADKA 4U7DA 2CL6X 3Q88A 4Q21A 1V3TA 3BSSA 3KQMA 2ZAIA 2ZSAA 1XLTC 1ZK1A 3FKSA 4MUXA 1OLSB 4WESB 1WCIA 1L5QA 2Q9CA 2ADFA 2X0JA 3AY6A 3TBKA 1HA3A 3G0DA 3FNGA 1QP8A 1R5BA 1AKMA 2P5UA 4WFJA 3EXHC 3TNJA 4D3ZA 5LQKA 1OGJA 1SVLA 1MAUA 4NAHA 4YUXA 1DO8A 3IH5A 1CUCA 5IT5A 3QXCA 4FZVA 2X4GA 3DH0A 4ZEWA 3TD6A 4X90A 1U4NA 4C7JA 2IYLD 1F8YA 5HZGA 1HDGO 4I4IA 3RBZA 1TA4A 3ZGVA 4W7HA 2IUFA 5ELLA 1HRDA 3AR5A 4B2YA 4QDKA 4HVCA 1N0WA 2AHOA 1EK0A 1MV5A 1DTSA 2FSHA 4QVGA 4BLQA 1A72A 1GTL1 2VTBA 1PNOA 4PAGA 3UT5A 1J25A 5JASA 4FGKA 1OJLA 4CLXA 3EFOA 1ZQ9A 2W00A 3QMVA 3G1UA 1FSZA 4QG7A 1YMUA 1C0LA 2ZBRA 3P0RA 5EJGA 3TR5A 1JSCA 3VO1A 5CP8A 1E5LA 1DMRA 4YT2A 5IN4A 3H04A 1KWGA 3PX3A 5I48A 4G07A 3ZXIA 1RXSA 4LWPA 4MI9A 4ND1A 1HFWA 3HFGA 3KSRA 4V02A 1AB5A 4XWTA 4CF7A 7ABPA 3T4XA 1DT5A 2HHLA 4X97A 3TRHA 1QIKA 4HGYA 4EO9A 2GD6A 3FSGA 3A9RA 1QTRA 2E7ZA 5HIIA 1QDLB 2BYTA 1I4EB 3ZZTA 1LFAA 2G40A 3ESCA 4FK8A 3AO0B 1E1LA 3QBVA 4QPJC 5BSHA 3WLOA 2XUKA 1ISRA 3MTIA 1JG7A 4RZQA 3V1KA 1Q1AA 4J4BA 1P3DA 1X8KA 3A1FA 3SLGA 3A7EA 4I9NA 2HDOA 5BUCA 3UMMA 3W5AA 5LMUB 1R0BA 2ODNA 4H7FA 5SV2A 1YS7A 4BLRA 4PHHA 2RI6A 2Q1UA 3EIHA 3ADCA 3CRW1 3HR7A 3THSA 3CWCA 3T95A 3URMA 2YS7A 4IX1A 1NVVQ 2PBFA 3BE4A 1PSZA 1AGNA 2GPSA 2GBCA 1X1EA 2GZDA 4XR9A 4QYXA 3S5JA 4JP8A 1VG8A 3CZMA 1VCNA 3NTLA 3AVXA 3KKEA 4RM3A 4KHPB 1ESDA 3T4PA 4RK1A 1N36B 3PWSA 2D7DA 3VKUA 1JFLA 1F7UA 2CZQA 1MRSA 4OB6A 2QSYA 3H3FA 1V5EA 1E7WA 4YRNA 3FSJX 3PK0A 1U28C 4E5PA 1YKFA 3VR2A 4O2AB 1JIQA 3DNPA 5A3JA 5DI3A 2I8LA 4PSDA 2Y9MB 4KDCA 2R44A 1O58A 3WYAA 4BKOA 3TG8A 4OLFA 4A6EA 4YUAA 1H23A 5P8WA 3S0JA 4BCDA 5CW2A 3GLGE 4Y0AA 1LBEA 3QU9A 4QXMA 2O52A 3RSQA 1MW9X 1XQ9A 3KM0A 1PLJA 2R1UA 3RRBA 4N0DA 4EPVA 5DNUA 1XQVA 2J4CA 4LDQA 3OX3A 3O8OB 1JHAA 1Y8QA 4QDOA 4BFVA 4D92A 5B2FA 1XK6A 4KDFA 1IATA 2GCOB 4WT7A 4JY7A 4I19A 1Y3HA 5DGTA 4P4NA 2IS6A 3LK6A 2QYTA 4DDMA 2GD2A 4X41A 5FUVA 5IXJA 1U80A 1ZK0A 2GCEA 2JB9A 2MSKA 3C3YA 3G9ZA 4LOIA 1YRAA 2D0OB 5I7AA 3RF7A 3TJRA 3VZDA 4QSMA 5DYNA 2XOKA 3I52A 3TLGA 1ELOA 3GAZA 5F7OA 4ZANA 1XNQB 1LSUA 4BWFB 4G8CA 3D8UA 2UYYA 1TUEA 4QXQA 3TSZA 3E5MA 3ETJA 3Q3EA 3LDFA 4OBBA 1NQ5A 4JOCA 5J63A 3TEMA 4ZVPA 1E3IA 2J33A 3L8GA 3GCGA 5FNZA 1WVMA 3ZGLA 3O8LA 4CIAA 2QMZA 3KYDB 1Y1SA 1PL0A 1U8UA 3RTEA 2FPOA 3UK0A 4NBTA 2P2GA 3DT8A 2BTOA 5DYTA 4GMHA 1FUKA 1IN5A 4TS4A 1CU1A 2R85A 2QAIA 1QMGA 2ISQA 3H11B 4Q4HA 4ZP1A 3GD5A 4ZU1X 3W5VA 4G3XA 5AM3A 4B3XA 4PLPA 5K6AC 5KQPA 3KELA 3DR5A 1QIGA 4HBZA 5C5EA 1CTQA 3AINA 2VHZA 1JNYA 3S44A 1VPVA 2PIDA 1V3UA 2OCLA 3EXHB 5KYNA 3NCTA 2X3FA 3H5WA 4B47A 6GPBA 3V33A 2JGRA 1BXKA 4ITRC 3ESXA 3RKUA 4JLSA 3DE1X 3TTYA 4GFDA 3UPDA 3LSTA 5IUJC 1KEZA 3MXTA 3S6JA 1SU6A 3CTMA 4E21A 1QHFA 4LEIA 5DMHA 1T34A 1I0LA 3G8CA 3NFRA 4NCXA 1A3CA 4Y1RA 2HF7A 4XQ0A 3UAVA 4D9IA 1V4VA 3ET4A 3TLKA 1BXGA 3MM4A 1DHTA 1ILEA 2O8CB 2LWIA 1ZAKA 4ER6A 3I6YA 2UU9B 1VPWA 4HD8A 2RGGA 3SBXA 3T5AA 2EJWA 5HZKA 2FKNA 4YCSA 2VJLA 4BVHA 1EE2A 2JG3A 3N70A 4JNCA 3O4HA 1RQ7A 2A58A 2QT9A 5CVDA 5TT1A 4ZV4A 3C3WA 2H92A 5TF0A 2A9JA 3PHLA 3K0FB 1T2VA 2FUG6 2XWJI 1VZ3A 2PNJA 2XNHA 3WYDA 3MMNA 4KQHA 3Q7IA 2IPAB 4KMSA 2R7NA 1YRWA 4KQ6A 4LJ6A 4N6GA 1E7YA 2RGAA 1HDOA 1DEHA 3GLIB 3ZU2A 5FLYA 2DT8A 2X19A 3R3SA 1R1DA 2H2AA 2P0AA 4JT9A 3SYLA 1MJNA 2EU8A 4Q7MB 4E22A 2WSMA 2UUAB 5FPTA 2HXYA 2WKWA 4KQMA 3JATB 2PFSA 3AI2A 1SUCA 2V98A 3H75A 5BNZA 1PVOA 3NWBA 2IXFA 3EEIA 4YP0A 2NU7B 2ZIUB 4DJ5X 3RFFA 1LBQA 1C9MA 2YVKA 1TTTA 3EZ6A 4BMOB 3KOUA 1P4GA 2RI1A 3I58A 3IA7A 4FBGA 1BCRA 1QLWA 2GN9A 1YZHA 3VVCA 4NNPA 4RL6A 3UOGA 4N39A 4CL0A 4CTKA 1SAYA 1X7YA 4MJLA 3OC6A 1DWQA 1NQWA 1QGZA 4MMXB 3RJ9A 2QUJA 4YMHA 2XMBA 2JFPA 2GK7A 5J43A 2KSQA 2FZLA 1T6NA 2JRCA 1ICIA 3QEOA 5C1PA 2H4WA 4MRMA 4KXYA 4K88A 4FBLA 1FDRA 1SUIA 3DW1X 3N8IA 2C92A 2FPPB 5EJ9A 4TTJA 1DDIA 1AQJA 4TGLA 4JYMA 2O5VA 2Y05A 1K8XB 1QOQB 1HE3A 3A4VA 2G04A 4TMKA 3I32A 1G291 1OYOA 2X0KA 3GRKA 4W1PA 1N6KA 3ZD6A 1LBTA 1XAIA 5D5HA 2BMFA 3L8HA 1TZJA 3OE7D 5H5JA 4AJ2A 1E9BA 2CYCA 3L18A 4MIOA 1DQZA 1XKXA 2ONYA 5LXTA 3E9CA 5AK5A 3SX0A 3SQWA 4I36A 1KRHA 2J08A 5FV4A 1QX4A 5CXSA 3WLQA 3OETA 5A9SB 1Q83A 4X8MA 2ZSKA 3JALA 3ZQ4A 1JHYA 4IEFB 5BMVA 5KQMA 4LMPA 4TRMA 3BMCB 1ZS9A 3D4BA 4PX5A 4OM7A 4H35A 3RU9A 3G0HA 2B7CA 2WMYA 4GOJA 4CIWA 2ZSBA 1T8UA 3P7MA 1BHJA 2HA4A 2OEPA 3MAJA 2PJUA 1V6CA 2ONCA 1OXSC 3JAKA 3GLQA 4FMCF 1VPEA 3QHPA 1S2LA 4HR7A 4JHLA 1K8QA 1MKYA 5EWMB 4MWSA 4BQNA 1E6KA 4IQFA 4HH0A 1T1SA 2ZTLA 4ZQCB 4YRQA 4MEJA 3SX2A 1Z5VA 2JDID 2K5UA 1NUHA 1DKQA 3GBPA 3E0QA 3AVQA 1JHDA 5HFJA 3RIYA 2J4FA 3AP3A 1O0CA 2J9ZB 1JAYA 3U7EB 1CS0A 5M29A 2TMYA 3LQRA 5KYKA 2H3HA 5JSZA 3I0NA 4AP9A 1XRRA 4WGGA 3UPTA 3TW4A 1X7WA 2I2XB 2ZSIA 2XI4A 1W1WA 5ALPA 5BR7A 3PPXA 1G4HA 1XTVA 2IU3A 3MPUA 5I5GA 3DDOA 4Q01A 2FW9A 4PIMA 5BVGA 5C1BA 2GJSA 5AXDA 3M5PA 3CEPB 3R77A 1QH1B 3KEGA 3PDCA 1KXJA 4D0LB 5AW1A 2PQMA 4TX1A 4BJ6A 4BMCA 2WTEA 4JVSB 4XKJA 2C2ZA 1UPXA 3ZLJA 3O84A 2PUVA 1NSFA 1RLTA 2O2HA 2Q50A 4RHTA 1W52X 4F3KA 3UK7A 5CA1F 2RJ3A 5IC5A 1N5MA 2Y1LA 1LRLA 3RVLA 1Q11A 4EJ2A 5KSOA 5EIFA 2DY1A 2ORVA 4J6FA 2EJCA 5TLSA 3ED1A 4CYMA 1LDNA 1BJKA 1CB7A 2V7GA 3K0BA 2J0SA 1WVGA 1LDMA 1ZK2A 5HNKA 4F06A 3CY6A 2YHIA 2W2VA 1EWYA 1ECPA 1S2MA 1SMKA 3ZW8A 4QLBA 5GONB 3D7NA 2X9GA 2HU8A 3CW2A 4D6XA 4NATA 5F7XA 1SXPA 4GMDA 1T0BA 1GTJ1 1AXRA 1RHMA 2BMDA 4QOJA 4TMZA 1Y4ZA 4PPYA 1Q0HA 1E3DA 3EXG2 4Y6GB 3T3MB 5J9FA 3BDVA 1AMNA 1VG9B 1KZYC 1YZQA 2FZCA 2YJZA 3UBMA 1ULTA 4NICA 4MW9A 3IR7A 2HUPA 3QHAA 2C5SA 3EDOA 4J0KA 2H9IA 4JA2A 4YECA 2X14A 1UC8A 2YMLA 4IV5A 3W9UA 1QPZA 4FWBA 4V0SA 3GFOA 2RHRA 1TMYA 2R8PA 4I3GA 3V8VA 3VH1A 4BV2A 4IW3B 5GV8A 3F7OA 2GJAA 2C58A 4W8OA 1HC7A 5EP3A 4JL8A 4WA7A 4HP8A 2IHNA 4LV6A 5A3VA 3QEMB 3IV9A 5DF1A 3WLEA 3CEAA 3WX0A 3INRA 4PG8A 3PYLA 4EO4A 4DLBA 3HACA 3FMIA 1IWBB 5B1DA 4ZKEA 1MO3A 2OC9A 4HFMA 1BEZA 3L1KA 4GSLA 2I7DA 4DFDA 4J2OA 2RMKA 2OUIA 2V6FA 3PGA1 2GFIA 3L01A 1YVUA 2A9KA 5CNIA 3SR0A 6LDHA 1QG2A 1IWPB 3R40A 2Q6LA 2QP4A 3JAMA 1Y34E 1QH8A 1EFRD 2YRFA 2Z2ZA 1ZD3A 3DW3X 3JYHA 4JGBA 4PBSA 3AESA 5CVJA 4B6SA 2XA2A 1LTQA 2OYSA 2QRJA 3OH8A 1LPBB 1FNDA 2G8NA 3IAXA 3NJRA 3KT6A 3KOXA 4MO2A 5TPWB 4A2WA 4BMSA 1V2HE 4EAQA 3ABQB 3DE4X 1IUOA 2P1DA 3I92A 5L3SA 4MA0A 3UC5A 4B3RB 3FSRA 1ANKA 4HUQB 5D3KA 3NBYC 3RJ5A 5F35A 1CQXA 1AH2A 3PXDA 1R5JA 4B82A 1E6MA 5ENZA 1GPAA 1TK9A 6REQA 4IL5A 1SCNE 2AF4C 1OPRA 4X93A 2ATEA 5LA6B 5BV7A 4MROA 4ZEOA 4CL8A 4URHA 2VHVA 3HKDA 3O4VA 1I4DD 1CY8A 4L1KA 3EF1A 4MH0R 4REQA 4CM8A 4F45A 1IZ7A 1A0OA 3HFJA 2V6BA 3MW8A 3Q87B 2HT6A 5AJZA 2HSJA 2VJOA 3BTUA 1Z4LA 3JYPA 4W8HA 2J5QA 3OMXA 4UOQA 1RQPA 5KWSA 1MFZA 3IE0A 4ZTZB 2CLHB 5FTJA 1VDZA 1DBSA 4LGYA 2G9RA 4N54A 1ZESA 2CB0A 2OWEA 1U7UA 4MDYA 4D3XA 3K15A 3NWEA 1J2RA 1D2EA 4G8BA 1U8XX 1ISHA 2POCA 2IVZA 3IVMA 4PYRA 2UXDB 1U1IA 1Z7WA 3M4YA 4CUZA 4EPWA 5C8YF 1MR3F 2FHSA 4RKYA 4TLMB 4C7XA 1TLTA 5AOAA 1GZVA 1YZKA 1R4ZA 2CLEB 4OQFA 2K6GA 1Z12A 4M89A 4OHVA 2QN7A 2AKYA 1WSBA 5IKEA 3IHKA 1YR7A 3DKKA 4QGGA 3H5NA 4YDRA 1X7ZB 4MI1A 4QPPA 5SICE 2IW3A 3DDHA 1ZXBA 3UHFA 2O5RA 1H2RS 2EFYA 5HYVA 1P2GA 1UOEA 3AK4A 4E11A 5KTNA 2J41A 3LQKA 1USKA 2MWMA 3V4RA 3MD9A 4FKMA 1MQAA 5BYAA 1YD7A 4GXNA 4MVJG 2FPXA 3T9BA 1KJIA 4GEGA 3ZQ6A 3GPCA 3DV2A 3R3JA 4QU0A 4ES6A 1B8VA 4U1RA 5BW4A 3VNUA 1PYOA 2VP4A 3BHIA 2FX3A 2PY6A 3GAMA 1GITA 1QB8A 1ZNYA 5MFPA 4S12A 1NBOA 4ZFNA 2PKQP 2ZAYA 3N8GA 3BIJA 5SYAA 1EQAA 3BFJA 2VAMA 5FWDA 3TL3A 3QVGA 3HJFA 4YMUA 3HRKA 4KGXA 1N1EA 1RFLA 1P60A 2O7VA 5LU8A 3B1JA 4IIFA 1E7SA 2OBLA 3OP4A 4BBAA 3TLCA 1KVRA 1SUBA 1N1MA 2PN1A 5HCNA 1XZJA 1QAQA 1KKUA 4M60A 3NWJA 3VO8A 3G8DA 4ZCSA 5AW9A 3G8YA 5KEIA 5JO0A 2J6CA 2ETVA 1FP6A 2YWFA 1GTRA 2H2WA 1RJEA 1HZJA 3QE2A 4ID3A 3LY9A 4KR3A 1H3FA 1NKTA 1GA4A 4YO7A 1KY2A 1ZMOA 3A9VA 1ZJYA 2BF7A 1U3UA 4C0KA 1W75A 1FP7A 1YACA 2DHDA 1CVIA 1DKNA 1OX6A 1E4VA 3NXSA 4J7UA 4QYTA 1X1RA 2QV0A 4U7HA 2ZSUA 3R0VA 3A2KA 3JZAA 1KMHB 3RVJA 1F38A 3VGPA 4DG9A 2QW8A 3A0UA 4S1NA 3THOA 4MVYA 2VTDA 1WMBA 1GPH1 2Q99A 3E22B 5EWJB 5G1OA 3BWEA 3KJEA 2FZEA 2RHGB 3L05A 4F5EA 4AN1A 1AHHA 4KK4A 3Q0EA 3FYSA 3W34A 4DQVA 4CIDA 4ECEA 2VQDA 4KQKA 1A5AB 1BS2A 3P4UA 1CZRA 5C1OA 3AI1A 3FB1A 4ZTBA 1G5RA 4DV7B 4HFNA 4BV9A 1K97A 4R8SA 3OJXA 2VZ8A 3LWBA 2IYZA 3WK8A 2BGKA 2QTVB 4ER5A 3NHRA 1O8BA 3A1CA 1X13A 5EKSA 3IMKA 1Y9ZA 2Q7DA 3ZJ4A 5KYGA 3Q9LA 2W6IA 3ZI0A 5GIOE 3A1NA 4YLYA 2H2GA 1JQ3A 1TUBB 3DEAA 5H82A 3VNAA 2G9VA 3CVWA 2ZRKA 2O48X 2ZUUA 2VQEB 4PZCA 3S70A 3I34X 4TQ9A 4GPBA 1XJCA 5E6UB 2CC2A 3CB2A 1IRIA 3FTQA 4PS1A 4XIIA 3W04A 1E1QA 2J3EA 1Y1KE 5IN5A 3ZX4A 3VU0A 1XHEA 1RZ3A 2CEAA 3AERA 1Y1QA 2B4AA 2DBRA 2W6JA 3EMKA 4GOMD 1YOVA 4XYMA 3V7NA 2RHDA 5FOTA 1GUFA 1YVDA 1UPUA 3AFGA 1K66A 3DEZA 4MWBA 3WC4A 1YRYE 2JFQA 1XTTA 1DBIA 2VSFA 3K6KA 1IZZA 1VYHA 2AMYA 3P94A 2Q0QA 1L6IA 1TRHA 4OMUA 1VLLA 4RZIA 2G0TA 3OT1A 1ZGCA 1FBNA 2YKGA 1FK8A 3K0KA 3TTTA 1GZDA 4WUTA 5TC4A 2EKPA 4GSYA 1J49A 5LBTA 3WFZA 4UVGA 1O7JA 2C5AA 2YWBA