1UBNA

Selenosubtilisin bpn
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
275
structure length
274
Chain Sequence
AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETNPFQDNNSHGTHVAGTVAALNNSIGVLGVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDSFYYGKGLINVQAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electric fields in active sites: substrate switching from null to strong fields in thiol- and selenol-subtilisins.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
molecule keywords PROTEIN (SELENOSUBTILISIN BPN)
total genus 85
structure length 274
sequence length 275
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1999-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1ubnA00
1T1GA 5B1DA 4AKSA 5ARBA 3LPCA 2SICE 1ZVKA 5AVJA 1Y48E 1WMFA 1Y1KE 2ID8A 2HPZA 3LPAA 1S02A 1BE8A 1SH7A 4CFZA 2Z57A 3A3NA 5CW1A 5JXHA 3OSZA 2SNIE 1GTL1 1JEAA 3LXUX 2WUVA 1T1IA 2ZWPA 4NE9A 1SUPA 1BE6A 3DE4X 3F7OA 2PRKA 2SECE 4AKTA 4RYDA 3VV3A 3WIVA 1SUAA 1KE2A 4DWWA 3DDZX 2HD4A 3DE6X 1AV7A 1Y4DE 4H6WA 4NMXB 3UNXA 4C3UA 4CG0A 4JP8A 1OT5A 1AU9A 2DUJA 3BX1A 2X8JA 4C3VA 2W2MA 1IAVA 1MPTA 1SCBA 2PWBA 3PTLA 1R64A 4J94A 3SQOA 1GCIA 1GA1A 1VSBA 3TI9A 4Z2AA 2DQKA 5ARCA 2WV7A 3I2YX 1NLUA 1KDZA 3DE7X 2PWAA 1BH6A 3P5BA 1T1EA 1THMA 3QTLA 2V8BA 3VYVA 1SCNE 1C9MA 4FONA 1TO1E 2PKCA 1C3LA 1S2NA 4KG7A 1TM1E 3F49S 1TM3E 1R0RE 2QTWB 1Y33E 1YJAA 1SCDA 2IXTA 2IY9A 4ZOQI 3EDYA 1Q5PA 1TM5E 1WMEA 3DWEX 5FBZA 5JXIA 1SIBE 3LPDA 3DVRX 3EE6A 3I37X 4MZDA 3VTAA 1AQNA 1ST3A 3GCXA 1TM4E 1TM7E 1BFUA 1V5IA 3WHIA 2TECE 3CO0S 3A3PA 4NE7A 1DUIA 3TECE 1GTJ1 3I34X 1NDQA 1SBIA 2WWTA 2PMWB 1AVTA 1GA6A 3DE1X 4GI3A 2XRMA 1BJRE 3BGOS 1SBTA 1GT91 2Z2YA 2B6NA 1EGQA 2Z2XA 1PJ8A 1XF1A 1IC6A 1SVNA 1P7WA 3TI7A 1Y3CE 1OYOA 1TMGE 2E1PA 4ZARA 4DJ5X 1R6VA 3DVSX 4CFYA 2W2OA 3F7MA 3SICE 2WUWE 3GT3A 2Z2ZA 4YN3A 1C9JA 1KE1A 4M1ZA 3ZXYA 1C9NA 1SUEA 1ST2A 1GNVA 2DP4E 3L1KA 1AH2A 4LVOA 1YJCA 3GCWA 2PYZA 2Z58A 2ST1A 3DE2X 1SBCA 1TO2E 5FFNA 2ID4A 1SUBA 1UBNA 1SELA 1DBIA 4H6XA 4OV6B 3AJ8A 1WSDA 1ZVJA 4WOBA 4HVLA 5JXJA 1GNSA 1P8JA 1TK2A 5I9SA 3GT4A 1SCAA 5AVKA 1CSEE 3VSBA 3ZXXA 1PFGA 3CNQS 5JMOA 4BWGA 3DE0X 1CNMA 1AF4A 1YJBA 2W2PA 3DYBA 5K7SA 3A3OA 4K8RB 1SCJA 3D43A 1NDUA 2XTJA 3EIFA 3DW1X 2Z56A 5SICE 1KDVA 1Y4AE 5ARDA 1GTG1 2ZWOA 2SBTA 2GKOA 1Y34E 1MEEA 2G4VA 1V6CA 2W2NA 3DE3X 3DVQX 3VHQA 3WIUA 1EA7A 3T41A 1SBHA 1SN7A 1SPBS 1KDYA 4DZTA 3HJRA 1Y3FE 4OMCA 1Y3BE 1OYVA 3PRKE 2Z30A 3WQBA 5B1EA 3QFHA 4OMDA 1WVMA 3D9QX 1AK9A 1PEKE 3AJ9A 4KB5A 2PQ2A 3DE5X 3H42B 1SUDA 1GA4A 3I30X 3Q5GA 2X8JB 4KPGA 1SIOA 1TECE 1LW6E 1S01A 1WMDA 1YU6A 1SIUA 4WOCA 5AMXA 5AQEA 2P4EA 1A2QA 3AFGA 4I0WB 3QMPA 2W2QA 1Y3DE 4HX2A 3DW3X 1Y9ZA 4H6VA 1PTKA 5JXGA 4LVNA 4B5LA 5FAXA 1SUCA 1BFKA 3BPSA 1HT3A 1P7VA 1SBNE 3VV2A 3Q40A 2ZRQA
chains in the Genus database with same CATH superfamily
1X7HA 2P79A 2QG6A 2G7ZA 3AU9A 3C6XA 3JS5A 3U4QB 2ID8A 2QUJA 1ENOA 4LYYA 5FWXB 3ZHQA 1H69A 3TIGA 1VZ3A 2CJYA 1RJEA 3B53X 5C1BA 5KJ1A 2NP7A 1TIPA 4L5BA 3LX4A 4V0ME 1Q0RA 5ICCA 5L45A 3GNQA 4A27A 2HRRA 1PO7A 1Z4KA 3ZNOA 1JFTA 4N3AA 3FTPA 2ZB2A 3TL2A 5IVIA 2OORC 5AVQA 3ZXSA 1KWKA 4BB5A 3OZRA 5E4TA 4RSMA 4A36A 3L7NA 1MRSA 2KYRA 1N3BA 1I33A 1VJ0A 3ZHOA 3LGAA 4OJKA 5DM60 1A1VA 1DFHA 3D8SA 2J30A 3LK7A 3FPCA 2V97A 3CXUA 4EQ6A 2PKYX 1XQ6A 4D3XA 1YDMA 5LU8A 1T1JA 3TX6A 4JFAA 2I22A 2Y1EA 4BNUA 3ANLA 4UAJA 4ZCMA 1R0RE 2XYVA 2YY7A 2ZXFA 2BR3A 1F0PA 4B8WA 1KU0A 1JPNA 1WZCA 3SBEA 2ZYVX 3WGLA 5DBOA 5BR7A 3D5QA 1PG2A 4P32A 3FYHA 4QYIB 3N39C 4DTCA 3QEBZ 1H85A 3HCOA 4QT0A 1RWXA 4NY1A 4F1JA 3QNMA 5TPZD 1L9KA 2NYAA 4YEDA 5AK3A 2ZTSA 5JSZA 4H0CA 2RONA 2YXLA 3A1FA 4I50B 4G2TA 2HMTA 2JLYA 2PUVA 5CRIA 3UAYA 2BFMA 1HT1E 2PD3A 1Z3IX 5JCPA 3WL8A 3RVRA 4JZKA 2P8SA 4Y9UA 1OYOA 5J5CA 3W2HA 1IIRA 5IX8A 2M6LA 5DNYB 2B7BA 4BEVA 4P4UA 3RUFA 4LF5B 2VRNA 4LOIA 2VBCA 2AG1A 4YRGA 2BGUA 2PYZA 1P6QA 2XKAA 3AV0B 2HA0A 3DJYA 1W1IA 3DHWC 2FPMA 2JH8A 2PPVA 3B6ZA 3UY4A 2W4QA 2XF2A 1P8JA 4Z5XA 1DI0A 1K7YA 5EE5B 1LPOA 3U4IA 1DRWA 4GRIA 3KFVA 3KYDB 1KHTA 2QL7A 1NUAA 1Y4SA 2INGX 2RDMA 3MTEA 1GPDG 1DAPA 2ET6A 5C8YB 2QVCA 2VO1A 3THOA 1EA7A 1BKDR 1SOWA 3DNPA 3H7AA 4FDUA 3VNAA 2VF5X 2AI2A 3O1HB 5DE3A 5EIAA 4FHCA 3DTYA 4LZJA 3R7BA 1J5XA 3OT5A 2IPAB 3I76A 2EZUA 5EE1A 3U39A 1E58A 3NI2A 1BG6A 3KR1A 4LRTB 5TVKA 3CZRA 4I9UA 3IAM6 1SIUA 1XTPA 4HT3B 5INTA 4CLEA 2AYYA 2OFOA 3GIWA 2D3TA 1C8LA 3OZIA 3MIZA 3MZ0A 4KWEA 4LDNA 1N1EA 2Q50A 1FUYB 1C14A 3CLKA 2B8WA 3V2GA 4ANFA 3IBYA 1K5HA 3ZVLA 4OVKA 1K1EA 3HBAA 3S3TA 4NCKA 1VDZA 1R10A 1GZ7A 1OLUB 1OZ0A 5F33A 3TSYA 2AN5A 3OQVA 1SUPA 2VZ0A 4FGZA 3T4XA 2HU5A 5AXAA 4W5JA 4X41A 2CCGA 1VBFA 4KQCA 5FJJA 1U0JA 1E66A 5CLLA 1AQUA 3I01M 3PE3A 4DR4B 4TT3D 4P7FA 4BZQA 4AXBA 1VA4A 4YMUA 2I66A 1NBME 2X8JA 3W4IA 4WLUA 2XVZA 4UE2A 4GMGA 2I80A 3H6HA 2R1VB 1XN1A 1O6FA 2YHBA 4K03A 4IVRA 1G3UA 4O2LA 4G37A 2C4TA 2QM8A 1KDZA 1KXZA 10MHA 5CG2A 3P5BA 2W11A 4ZCPA 1ICIA 3M5PA 4Q6BA 1O58A 1U7UA 3GGGA 4AMYA 2FE1A 4R31A 3WRYC 3QE2A 1NLYA 3VZQA 4WBSA 4ALMA 1PQ4A 3L5OA 1P4AA 2R7MA 2W43A 1HL7A 4H35A 4OP2A 3DVRX 3QOXA 5FBZA 4EATA 5I8PA 2GNPA 3UEOA 1FLNA 1PX0A 2C2KA 2H9IA 3CW2A 4XPIA 3I34X 3BGVA 2YZNA 1GG2A 3C16C 3HFJA 2OP0A 4QREA 3UJDA 2A30A 5GQSA 3V8QA 3FYUB 1LW7A 1WOYA 3MGGA 3PL1A 2GD6A 4DLUA 3CLSD 2IW1A 3G23A 3AW9A 3PUWA 5IS2A 1SVNA 5C8ZA 3BZWA 3EMVA 1LI7A 3RHFA 3MJEA 4JUDX 3DVSX 4MJLA 4F12A 1RCFA 4URXR 4EFNA 5CXXA 3GZNB 3S28A 3CWZA 3IIKA 1XPRA 4L3VA 4BNNA 3GUCA 1F8FA 2YR0A 3FKQA 4EB0A 2WUEA 1X0XA 3U44B 4U63A 4OH7A 1GJRA 2I67A 3VVMA 1VSVA 5ECDA 1B42A 4NBLA 1NY6A 4IQ0A 5KYYA 1WXQA 2Q2VA 2YQ5A 3GRVA 1Y6ZA 3WTBA 4FEGA 3MXOA 1X19A 2H51A 2QRLA 4P86A 1TJYA 3ZY2A 1F6BA 2QMUA 3DMNA 4LYGA 2NZJA 1TW2A 2CW5A 1QGDA 3N2GA 2XCIA 3ZI4A 4BCCA 1RBYA 2ODBA 2DC1A 3V8PA 4BX9A 1GG9A 3ORFA 3STVA 4C4YA 1SN7A 1ZHFA 1HDIA 1C3EA 3WGNA 4URHA 4NPCA 5JBQA 4I66A 1MF7A 2HUNA 3RIMA 5ALZA 3H04A 5KKCA 4JUAA 1W93A 2A7QA 3DV0A 4WNIA 4D0LB 1SPXA 4CKZA 1D03A 5KTMA 4KXMA 2R86A 1O4WA 2ODEA 2VP4A 3VHXA 4JLKA 4CTNA 5DNCA 5AQEA 2WKWA 3LOQA 4C1NA 5DNDA 5B1HA 2P3OA 1WHSA 3DW3X 2B4RO 3MAAC 1RRVA 1S3IA 4M1TA 4X7MA 1FDIA 1T5SA 2P6PA 5I7HA 4XIJA 1A9QA 3I2GA 1EB9A 2OV4A 3PNBA 2QZSA 3CR7A 4EJ0A 4QLBA 1U7OA 3IQXA 4O0MA 1YIAA 2CB9A 3IVGA 4DQXA 2W6PA 2C2XA 2XT0A 4DVJA 2EU8A 1FU7A 2WYHA 1Q14A 4NE9A 4MJXA 2W93A 4NAUA 3BSFA 2ZUWA 2GBCA 5DFAA 4OBWA 5C1IA 4C0XA 4PO3X 1DBWA 4ZU3A 3ADPA 1GU0A 3BXGA 4QDJA 2YNMC 3T7JA 1CRPA 1ZD5A 4AJLA 1Y7TA 3UAWA 2AZXA 2W6ZA 1L4GA 5AW9A 1E0AA 3IPXA 4KXYA 2GKGA 5FNVF 3L7BA 3C5WP 1WSAA 3JYNA 3R75A 5HK9A 1E2QA 1X7ZA 1DKNA 3SVLA 5F76A 1HXHA 3R3SA 1WPQA 3PF8A 1FW8A 4PYRA 3EFOB 2FR8C 3GXBA 2Q0HA 4B2LA 4D98A 4ZQGA 2PKCA 2DKFA 2R1TB 4JQZA 4KG7A 4XOIA 1W36B 1XDWA 2I4NA 2ZYWX 3OM1A 2ODTX 2FPPA 3BK2A 3G7NA 3ONEA 4E4RA 1GR1A 1DKMA 2HEIA 3HXLA 3Q6NA 2NNLD 2A8YA 1XMVA 1E6KA 4L5IA 3H75A 4TV9A 3KFXA 3KR9A 1JAXA 2O0LA 3D4BA 1HNXB 2Y05A 3JY6A 5JH7B 1AKWA 3IBCA 5EUQB 1MX1A 3DWGA 2NZ8A 4TLAA 3BMNA 1EVKA 3EXEB 3L8CA 4KTTE 4U02A 4E12A 2Z2XA 3NVKI 4UCFA 1EVZA 3H3XA 1Q1EA 4NI5A 1R88A 5HEKA 4EMTA 2VF4X 3G0DA 4D9FA 1AKTA 4W7SA 4MLZA 2ZSIA 4NENA 1HTWA 4PPYA 1VJTA 2NU6B 4BNDA 4WECA 1MIHA 3W1VA 1APBA 1V5EA 2Q5FA 2VZEA 4P9NA 5JY1A 2JGRA 1HE1C 4L9WA 3AR3A 2PZKA 4BU0A 1ZINA 5GVRA 3SF8B 5J2UB 2YWDA 1N2CA 3LYHA 4AZVA 1V3VA 4LTMA 2ZYDA 1CDOA 4RVHA 3TQQA 1BGXT 1RAAA 2ORWA 3DAFA 1RJWA 5C80A 4RTLA 3ETNA 3PHIA 2JLUA 1W2GA 3FNGA 4F2DA 3NDBB 4WNAB 4B4UA 3HU5A 2B4TO 4JIGA 3G1WA 1YCDA 1NQUA 1YS2X 2YHAA 1IM5A 2JFYA 4K8RB 1DRVA 4PSVA 4OB6A 3SGLA 3RT9A 3DPSA 4BPBA 4MHSA 4DLZA 4EFKA 4OB8A 3ZDRA 1RE0A 2E85A 1TD1A 1WMBA 2PX8A 3BVPA 3CLRC 4UBJA 4AMUA 3GA5A 3GEBA 5EQTA 1HGXA 1SBHA 3PV0A 4M8LA 4BVHA 3PQFA 4COOA 5KSYA 3NOOA 1IB0A 1AO3A 5K0LA 1MW8X 2JIQA 4KFSA 2VLBA 3OD1A 1YDWA 1CUFA 4NH4A 1H6CA 1V8BA 1BNCA 1CZUA 3NHZA 1JFRA 3ODPA 1HLFA 1V3UA 2GAIA 3OF5A 4IF6A 4LISA 3VH4A 1B3BA 1W8DA 1V4VA 4ILEA 3W6UA 3BIOA 3D1VA 4R0VA 2EFEB 3I5UA 1UZAA 1XKQA 2PGXA 4CW7A 1QB7A 1V95A 3IRUA 2Z6AA 2Q21A 3LRPA 4O4LA 1DGQA 3LFTA 1JG7A 4JBGA 3ZWOA 1HT3A 4O4JF 1AZLA 1R15A 2HMWA 1IBCA 2HDNB 2MYUA 3FPLA 1N7IA 3LA8A 1L5GB 1MW9X 4HD8A 1DAEA 1PZXA 1SVUA 2A0KA 3S2SA 3WB0A 3LSTA 4HQNA 3RJTA 2NYRA 5JDCC 4LJ8A 1EQ2A 3BQ9A 1Z22A 4EHNA 5FOQA 3DTTA 1D4ZA 1KIAA 3HH8A 1QO0D 1E1RD 3E2PA 1JR6A 4P93A 2AQHA 1CQPA 3DXYA 3GEPA 3ND5A 2XLCA 3KQYA 3ILSA 1RWMA 5TF4A 5EIEA 5KTTA 3TW8B 1TKRA 4DR5B 2KQUA 2XRZA 2F8LA 3TI9A 3TW4A 2GX6A 4IQ4A 1HDZA 5I5EA 3EQ7A 1JU3A 2CDAA 1I7PA 2ZCJA 1NT2A 4N5DA 2YOFA 4DNFA 5JZSA 3PC3A 4QOHA 1Z34A 3UK7A 5LMZA 1UZUA 1J0XO 3UJBA 3ETEA 2X4DA 2XE8A 5LIRA 3QVXA 1ZD1A 4F5EA 2XKKA 1NAIA 1E1DA 2GARA 3AEUB 4Y6RA 1J0EA 4PZCA 1K7EB 1Q74A 4TKUA 1XZBA 4QXPA 1J07A 2HCTA 2GM5A 4DC9A 3OZTA 3QOYA 4WBNB 3T4PA 1J2RA 4RNCA 3UOAB 1NHGA 2KWIA 3OIYA 4TL8A 1YNOA 2I4LA 4G0UA 5C1PA 2Z43A 3L7AA 2EJUA 2QPAA 2X3UA 4Y3UA 2AZ4A 3BK7A 3K1TA 2V6MA 3KVYA 2WY2D 1EQUA 5C7OO 4G0VA 2XMRA 2ZT7A 4HDCA 1VIYA 1CWUA 2V7QA 4IWNA 1CUBA 3ENWA 4DF3A 2R25B 3ILYA 2FSGA 1I0IA 4H15A 13PKA 3DA8A 4CF5A 2YUIA 3Q9UA 5HGXA 3JQGB 1C9NA 1G2IA 1QX3A 4JKOA 3CF4G 4C0SA 1WRBA 4RD2A 2OLJA 5M29A 3OZDA 3VM6A 2NO4A 4RK7A 2C97A 3EIOA 3QU2A 4U7WA 5E8JA 3ISVA 3HI4A 1RWWA 2BEUA 1ZQ1A 3ROTA 4F4UA 5ED4A 4HWKA 3ESQA 4WDQA 1LQUA 2ZG6A 4DV2B 1K6MA 2X1HA 3JAKB 3PSAA 4RACA 4DLRA 2JHGA 3RV3A 3IX7A 3R76A 5HZHA 1PZHA 4LXXA 2G70A 1RD4A 4KQ1A 5FBKA 2IP4A 2HIAA 4U00A 1ULTA 2O8BB 1J1ZA 4DMRA 1G8KA 3JD0A 1VLLA 1C4XA 2C82A 1TQDA 3P2KA 2WAYA 2YJ3A 3KJIA 2XYRA 3GGDA 4S1WA 5C5IA 2A9PA 3QVSA 1ZA1A 1AT1A 3AXTA 4KLZA 3HUUA 8LDHA 3V1LA 3JATB 4FW9A 3TCKA 1G5IA 4GVXA 1I1HA 2AJDA 3M4YA 1XQWA 1PZFA 3BAFA 2P1ZA 2OUKA 1O96A 4HPWA 4MQUA 4XYGA 5ISMA 3L7LA 2VA9A 4PQGA 5FFMA 2FCAA 3JPYA 1TCVA 5C0OE 2XBMA 2ZK7A 3P9SA 2HO4A 2VQSA 2OCXA 1SHKA 2TYSB 3P9KA 4GX2A 4H17A 4KN6A 5FPQA 5BO5A 3PT5A 4IRMA 1QM5A 1B0ZA 3C3DA 4LE1A 5EKDA 1MOZA 1GUFA 2WSBA 5M3BA 5EIWA 2H29A 2M98A 2QNBA 3BMCB 4JOBA 3ZIAD 1IRIA 1A50B 3D81A 3VC1A 3WZLA 2A1TR 3EA0A 4EI2A 4UHEA 1G8MA 1QQAA 3IT1A 2J4FA 1II8B 3B6EA 1I2CA 3EAQA 3I32A 2OHGA 3PUKA 2JCGA 4RIGA 3KAQA 3RSZA 1TCUA 2GD0A 3CLHA 2VHQA 4B4DA 3IB3A 3SVTA 1PT6A 2FX2A 1N6LA 1W8IA 2LIVA 3RRBA 4DADA 5B7PA 3OTGA 3TXXA 2M1XA 1MORA 4PEVA 4BTLA 2JARA 5ALXA 2D4AA 3IV7A 4C5AA 3R3JA 1HSOA 4IRXA 3ESRA 3OM0A 3RHSA 6CHYA 3G68A 4FGSA 4RYLA 1MOQA 5I7FA 1A4XA 1JLLA 1QYCA 2FK8A 2NU8A 1TPZA 1PQWA 2PLWA 4V2UA 1D3AA 1L4NA 3HO8A 3FOAA 2C29D 3EVDA 2CL7X 3K70C 3A10A 4FUQA 5K4HA 5H68A 4B7UA 5CB4A 1TO6A 4IIDA 3WLMA 1T35A 2H5LA 4PXYA 4RQUA 1H8ED 3UCXA 3H1PA 1UM9B 1ULHA 4JP5A 1JFFB 1K88A 3MCAA 4TLLB 1U5AA 2WFZA 1QV6A 4MUKA 3UFBA 4YBZA 4YQZA 1RLUA 4ETWA 2WVGA 3IIEA 1FTWA 2W6JD 3BXFA 3H4IA 4ML3A 4QU0A 1WXXA 3T54A 3L79A 1BXZA 1J1IA 1U0HC 2HK6A 1YMUA 3BHIA 4TX1A 2B94A 1F2DA 1SG0A 2W2VA 1D9XA 2A58A 2WF5A 3HCEA 3S1AA 1JKIA 2UZ1B 4XDYA 3SQNA 4EGCB 5TY0A 2XE6A 1EU1A 2VAPA 1QFSA 1Z0DA 1S9DA 2DBZA 4HDKB 1VSUA 4L74A 2DG2A 4J91A 5FB3A 4LJSA 2HA7A 4K9RA 2NQ2C 2ZYHA 1PVVA 1IE3A 4KGDA 2BGWA 3I83A 5KYXA 1S6YA 2GETA 4G9EA 1M2HA 2OL4A 2VDNB 4PGFA 3LH5A 2QWXA 5CHEA 2MWMA 3UHJA 2XODA 4LK3A 4MTCA 2C4WA 1TCBA 1HDGO 4DE5A 4WMLA 5DNEA 1GU1A 2P1RA 3LBYA 2PSSA 2QRMA 1E32A 2P9FA 3BL5A 1EUCB 1EVJA 3IJ5A 4DCVA 5CA1B 1NVEA 4OLJA 121PA 2JZOA 1UDRA 2ZYUX 4V1CA 5F64A 5JTTA 2P11A 5K8VA 3DCIA 5EXXA 4UFPA 2WWXA 2Q3BA 3MRXA 3QLUA 1EYZA 4FYJA 4IIVA 1T9KA 5CPBA 1R0XA 3FMPB 1YRAA 1CCWA 3O92A 1NQVA 1JBQA 1G20A 3BEDA 3AF1A 4Y1RA 4C5BA 2E3JA 4CM3A 3RFXA 4XVHA 1CUXA 1G63A 4OL9A 5AOCA 3CVVA 1G18A 2GK6A 3PFWO 2FWPA 3RB8A 4X8HA 4G1EB 4JP3A 4KQJA 4GX1A 1PL7A 2SICE 2DHDA 3LYLA 2IKQA 5F9HA 1YS4A 2NADA 2X19A 3IP9A 4MYCA 3S44A 2LCFA 2IYUA 3EQ2A 4M0DA 4NIMA 4B9AA 2FDXA 4RK5A 1NY5A 3OWHA 4NXNB 1KYVA 2D3WA 3LKVA 1C2YA 4PYOA 3Q0IA 3EIEA 2VNSA 3M83A 4MI3A 5EKTA 1E2UA 4GD3Q 2Z9DA 3KAPA 4JI6B 2QL9A 3D8BA 4QDOA 1XA0A 2IVZA 3JZDA 4K05A 4MCJA 1D0IA 1NDHA 1FBTA 4CM9D 3NUGA 4CM1A 2DR0A 2X0IA 1NRJB 1O6CA 3UT5A 1JDNA 2O7VA 2IOHA 5AI4A 4HNUA 1Z12A 3FWNA 3ECAA 3GP3A 1ZJJA 1GCIA 5G4LA 5CD1A 1VGQA 3RHZA 3B85A 4MPRA 2EBWA 3QJYA 3SSAA 1Q1NA 1L8LA 1RIFA 4HH1A 2OHIA 2P78A 4OIMA 5DGHA 3K2QA 4FLMA 2P3LA 4XVCA 5C7YA 3BRSA 4JBIA 3VR3D 1R0WA 3Q7PA 5JZVA 4Q3NA 2H59A 3QVUA 3BE8A 4G5QA 2FR1A 1UBMS 1LY1A 2NT3A 5B2FA 5AW3A 3K5WA 2WM2A 3NNNA 1WMEA 4QUHA 2VEOA 3U62A 1YBMA 2GZ3A 3QLEA 4K86A 4KKVA 1YS7A 4PFQA 1P75A 1P2TA 2IDKA 1H22A 1DO8A 2PHZA 3AUJB 4LBWA 1X8JA 1KYYA 2QV7A 3ESZA 3Q85A 4L51A 2DH5A 1R27A 4XWYA 1ZLYA 2JD0A 3ADCA 1WBBA 1D2EA 3OFSA 3F74A 3NGMA 3U4DA 3UV3A 4URYR 3R6WA 4AUMA 5J59A 3CCFA 2PN1A 2CXNA 4MRSA 1L7EA 5LQSA 1OT3A 3TSZA 3I53A 1V37A 2PYIA 1KDOA 4ZZ3A 1NXPA 3HHPA 3PUYA 4Q9KA 4CM9A 4MVJG 4KP7A 2FDCA 3SJAA 3SKVA 4N6OA 1PLLA 1BEZA 2HA4A 5TLSA 1E62A 2H6EA 5FWNA 2X5XA 4GZLA 3ZLTA 2XGJA 1Y89A 5JY6A 1RWQA 1QP8A 4NOKA 4TRNA 1YRLA 1AZTA 1DKUA 4TXNA 1ZSVA 4LY6A 2VG8A 2EDAA 1G8AA 4RWEA 2J31A 1ESDA 3VI4B 1C0PA 4NDAA 4B6EA 5JMOA 1QCCA 3QM1A 1TJ4A 2C78A 4N18A 2GXSA 4A5SA 5KHOC 4S04A 3GLFA 4E5MA 4TMTA 4X6YA 4A2WA 4CF4A 1S2LA 2PEZA 5ARDA 5F5NA 2EX4A 3OPXA 5JC8A 1AQYA 2NU9B 1VIMA 2BHNA 3W9UA 2J5KA 1GQFA 4ALLA 1W5BA 2ZBEA 4TTAA 3GD7A 1UKYA 4OQNA 3LHDA 4GM0A 3VFDA 1ZHHA 1G4UR 3UM9A 3LY7A 3VGPA 4QQKA 3ZN2A 1CQJA 2OLKA 5LOVF 1KJYA 4B3RB 1F0YA 1MTOA 1LW6E 3W3AH 5JXHA 4IZHA 2C2WA 1Z39A 4LJRA 2FRXA 2H9YA 1KBZA 1T9DA 4G3XA 4J9VA 4O2BA 2ZIEA 3LIIA 4S1NA 4PO1A 3DZBA 1A2KC 4GBGA 1QP7A 1KJ9A 1W25A 2ZRQA 2ZVQX 2IC5A 4OLBA 4H1TA 1L5LA 1Z0AA 2FQ1A 1LX6A 3D6TB 3QVLA 3LDUA 4YH1A 3UJNA 1M5UA 5BORA 4Y6QA 1CQZA 2PEYA 2RJOA 4L72A 5EJ6A 1AGNA 1G5FA 4AY2A 3H19A 3LQRA 1RAGA 3F3MA 4IDGA 3ZDFA 3G59A 3T8YA 1E1YA 2C7BA 1IEWA 4IUBS 4FMDB 1KNXA 1Y9AA 3GVXA 4AKTA 3RAEC 1O9HA 4OG2A 1KA9H 4QIHA 4RV9A 4M9QA 4B9EA 2OBMA 5HZMA 5LUAA 3B1JA 5CYGA 1ZN2A 5AKXA 2ZE6A 4D9KA 1ZW1A 2D6FA 2X1VA 3TINA 5EWLB 3W5UA 3ZCUA 1IQPA 4H9GA 4NV0A 1XQVA 1XVUA 3AYXB 4LHSA 4GBJA 3SQOA 3BD6A 1GA1A 1H66A 2B9EA 2EXXA 2QP3A 1ZOSA 3N8IA 1XHEA 3OM8A 4DBLE 5KOJB 4D6YA 1G9TA 3HDGA 1A5BB 3EH2A 4UNPA 2FLWA 2JCSA 1PT8A 1O6BA 2Z09A 3BZBA 4ZHSA 4BGUA 2CWWA 4JXJA 4DT1B 4UULA 3IAEA 3VH3A 3F2VA 5IMBA 1SY7A 3KQMA 4QULA 4YB8A 4PYJA 1ZN9A 2PTGA 5B7NA 3J81k 3WQQA 1MRNA 5AKIA 1GL9B 3KXKA 3L6CA 2NVUB 1QO9A 3FTCA 3HXKA 3HFSA 3M34A 5F7OA 3ORYA 1ST3A 4C07A 5ALHA 2VA8A 2D7JA 3UGKA 5CLFA 1SOMA 4AG6A 1A72A 4KU4A 4US2R 1DZIA 2J6BA 4PHHA 2P2NA 2JAWA 4Y2PA 3SIPA 4FLEA 3C6QA 3U37A 5JISA 5ELLA 3CBGA 2GXQA 4ZT4A 4RHYA 4V39A 5EZSA 2BGTA 4LV5B 1PX2A 4Q9IA 2WHRA 1GPUA 1X7DA 2XF8A 3UFXA 3EA5A 4CFYA 4ZI2A 5HHTA 3M6LA 3VMFA 4EGJA 1ZR2A 4TYWA 4C3ZA 3WNBA 3VAAA 3IDAA 1XU7A 2BISA 2FW9A 3NTXA 2IGBA 3D0KA 3L1JA 3ZW7A 4V0LA 2ZLBA 2RKBA 1H0RA 1WP4A 1NP6A 2QGZA 3IPYA 3L6OO 1EEHA 2K87A 4MIEA 4WNYA 1VECA 3AP2A 2ASEA 3HGMA 1HC7A 1JEQA 4G36A 4OYYA 3MTGA 4PR3A 3UC5A 3AEXA 4Y6PA 2GEDA 2VWPA 3MS7A 4LX0A 2CVQA 3V2UA 1MJGA 2REQA 3LYUA 3WG9A 2JIZD 3WWYA 2GYUA 3PNKA 3BBLA 4BLOA 1MGOA 1NQXA 2GESA 4ASUD 3CVWA 2HA2A 4MVXA 2C99A 3ZJTA 2YWHA 1MB9A 3A6FA 3HCBA 1N34B 1SAYA 2FHPA 2GJ4A 1PQUA 2PZLA 4NMHA 5FLEX 5EJAA 5JYDA 4D4HA 1POWA 2I2CA 2P77A 3SR3A 2YASA 1FFEA 1K6EA 2IYZA 3NBYC 4JLNA 1LLFA 4PC6A 4S24A 1T4DA 5L3SB 3CLTC 1FFXB 4ZVOA 2JIZA 4JJAA 2OT3B 2P6MA 4TSFD 3EQ6A 3EXHC 3BHNA 1E5VA 1XRRA 3SR0A 1ZJ5A 2WDZA 2ZQZA 5I47A 4RSRA 1W6RA 4D80A 4UXHA 2GTHA 2RB5A 4E1AA 1R12A 4E3WA 2QTVB 3U3DA 1VLVA 5LB2A 3NMUF 4LVNA 2FG7C 1BH2A 5A7HA 2IS6A 4LYFA 1HDOA 3ROMA 2FW0A 4KR9A 5KTSA 1T26A 2YBEA 4P98A 3L8EA 4RS4A 4TYYA 4KH0A 1LPAB 1NBMA 1P2SA 3NHSA 4YXFA 2VZ8A 3PD1A 4JJ6A 2ZKIA 4COKA 3AC0A 2D5AA 2ZRPA 4GPZA 5CLJA 2F00A 2QTLA 4IRUB 4RH0A 1L5YA 3AW8A 5CK5A 3F3SA 5J40A 1E2KA 3RQSA 3E9MA 4G89A 4JHXA 4LF4B 1BD4A 4EY4A 2GEBA 4QGHA 1HTTA 1J09A 1P0FA 1Q20A 2FCRA 4KDRA 1AUVA 3A1TA 1OT5A 4QVGA 5IDWA 4R8LA 4Q4AB 1QIFA 4ZI5A 2RC6A 5J5AA 4CF3A 1EFHA 2QUIA 4KMOA 5LB4A 2HGZA 2PX4A 1U3WA 1VJRA 1ISSA 3JQRA 3QQPA 4M9ZA 4RF4A 5AM1A 4OFXA 1EK6A 2CXXA 2A5LA 5DOVA 1MPXA 1PR3A 2ETVA 3HA5A 1OBVA 4NBTA 3C7CB 1HEUA 2HM7A 3G2LA 4WZBE 1GOTA 2J09A 1H9AA 4G5HA 4X20A 2TMKA 4PANA 4XGRA 2CDNA 3OLZA 2XOEA 1GUBA 1O96B 1ZL2A 4FDLA 3NFYA 4OHRA 2AKAB 5JU6A 3EEYA 4NPAA 4YJ3A 2ZITA 4ND6A 4X61A 2AR9A 3SNHA 4PO8A 1MENA 2VP6A 1QHXA 1IVYA 5IM4A 5GJWC 5GADl 3IAS6 1Q16A 3ZE9A 1XCLA 2QA5A 2J46A 2ZB3A 2ZS8A 1PL8A 3I73A 4MR7B 3WLHA 4BAZA 4H1WA 1J8VA 1G6KA 5BSVA 5JALA 2AMYA 5E1OA 2YJ5A 2V9CA 2IEDA 1UC9A 2R4UA 5MN6A 2O4UX 3CUEF 5FBHA 4AY3A 4BBPA 4MLPA 5IAGA 4EG6A 4KBFA 1RHQA 2QTVA 2ZJ8A 4PR0A 1Z82A 4DIEA 2J0EA 3HKEA 2WZCA 3KXLA 5TB5A 3T99A 5CB4F 2X6RA 4ARUA 3U1BA 2J87A 3F7MA 3LX5A 3PG5A 3PYXA 3DZCA 1I0ZA 5HQJA 4JEUA 3W7BA 1C3XA 1DQSA 1K7FB 3MJHA 1UOPA 5KYUA 1PVOA 1E1RA 3HDVA 1SKBA 3NTUA 5EHNA 1MAWA 2JI4A 2CVPA 1J7KA 3MJ4A 1SU8A 2DECA 3Q3JB 1G291 2SKDA 3BH7A 4HUJA 3RAGA 2CL0X 3E1GA 3IPAA 1PK8A 3GQBA 2EF0A 4E32A 3PUIA 5CX1A 5L53A 1N2EA 2C7RA 4XLLA 2OBYA 2QR3A 5I9BA 5IJWA 1E7SA 5KB3A 3IV6A 5IJ0B 4PX9A 4B3MB 1I01A 1RYBA 3HCAA 3F67A 4RD0A 4AN1A 5KZMB 4RGQA 2WM3A 3HYSA 2PUBA 3N7AA 4KXLA 3K2BA 1P72A 1R6DA 3SZUA 2R6R1 4B79A 4A8HA 3BIFA 4EEXA 5L9AA 2GDJA 2J6HA 1RVDA 1YI1A 2Z2JA 1Y34E 1WW8A 2F64A 3MB5A 4OXQA 1JEQB 4FQ7A 4YMHA 1Y6FA 1Z2AA 2P5UA 1GTVA 1KS9A 4IJWA 2FN9A 2Z2IA 1NUHA 1JLSA 3GC6A 4I6EA 4UU1A 2JJ8A 3V1NA 4CDNA 4QDZA 4KVFA 1WVMA 4KK3A 3CTPA 1V5FA 5DIFA 4BL5A 5REQA 4HEA1 2BSXA 4JGIA 4N8SA 5AI9A 4EFDA 3NS7A 5JO0A 3QP9A 3D6NB 1QSGA 2JFHA 5ALFA 5B1SA 2D7DA 5EZYA 4PO9A 3WIEA 1ICEA 2OQVA 2Q62A 2XSZA 5AKGA 3OEED 2Q3JA 1M76A 3ASUA 5DHPA 2HBZA 3V8VA 4TWBA 1QORA 4EKYA 1RKBA 4HVCA 1QTQA 2RHBA 3F96A 5CM9C 2FZKA 2N0SA 3C5EA 3OIUA 4GE3A 3T3OA 2HSWA 4X3PA 2A35A 1KH2A 1I5RA 1D7AA 2EFDB 2VDOB 2WZBA 3AI2A 1MHPA 2QRZA 3MWGA 2GBFA 4GMHA 4JDPA 2Q5LA 3VSCA 1GPYA 1ELOA 1QHHB 2VT7A 3KJQA 2H7CA 4A2CA 1U2TA 4BS9A 1L5WA 3L18A 2NQTA 2KX7A 3OEWA 2PWZA 3AJDA 4Q0MA 5HKKA 2W00A 3NNSA 3QKSB 2X8WA 1ETUA 4CEJB 2B20A 3V48A 3P0HA 1IVSA 3TEMA 3V9PA 1ZH8A 4YT2A 3B1VA 3OTHA 2ZROA 3VU9A 3WI7A 2PL1A 2QS9A 2UZ4A 3LWZA 3NPAA 1NJSA 3DDNA 1YZTA 5FNVA 1JWLA 2GGSA 4RY8A 2VSXA 1S5PA 3FLEA 3O2QB 2PGOA 4OHPA 3TTSA 4AO6A 5DPMA 1ULUA 3N28A 5BPFA 4G86A 1GUYA 1RZ3A 1IXYA 3EDRA 4LA4A 3AB8A 3HZZA 1E2FA 2ZRMA 3MWJA 3KHSA 5IT9A 1LV7A 1MG5A 4CL2A 1C50A 1G17A 3HMKA 2YOHA 1HM5A 1IHPA 3E0QA 1KF0A 2YV1A 2EGHA 3F47A 2WAAA 4XLZA 1D1SA 2HSZA 3JAMA 2QQGA 3HACA 1AD2A 3OWOA 4GPBA 4M6WB 3WYNA 1DHRA 4CM8A 3OQPA 5JCOA 4HTFA 3RTDA 1IIBA 2Q3LA 2X1LA 4UAUA 2HRBA 1MO3A 5CFRA 3BOSA 4P0PB 3E48A 1FK8A 4RMIA 4S1TA 1R0KA 5ICEA 4YQYA 4OGKA 4ARZB 1JHUA 1QOQB 1TNDA 3AY6A 3BSWA 3CNEA 1VPVA 3BXPA 4LZAA 5H5JA 2C7GA 3LDHA 3GRZA 2Q7DA 2O9JA 4R2IA 3BT7A 4DNQA 4B3SB 2DXIA 4Q01A 2P5YA 3FUCA 1TEXA 2HOQA 5EG5A 3QRWA 5B37A 1A5SB 1MB3A 1WOMA 3LGSA 3TSAA 3O9MA 2H1HA 4ZRMA 1K08A 3HPRA 2WJVA 2WPDA 1NM5C 4B75A 4MLCA 1RQNA 1E7YA 1E2IA 3KXDA 4DJDC 5ADHA 1C7IA 3EVBA 2CNNA 1ZSNA 3KU4A 3K0FB 2VUIB 2DF8A 3P0JA 4Q16A 5ALJA 3WKBA 2IYSA 5BWNA 1DMRA 2V6GA 5BP7A 3BB3A 1CNEA 4EVRA 2VR1A 3F4KA 1Z62A 2A5GA 2ZTVA 3OIVA 2X0FA 2O8CB 1QGAA 1EVEA 1SHTX 4X94A 3UW1A 3L2OB 3KPUA 3KJXA 4UM7A 1V9LA 3USZA 4RGYA 3GLFB 3W05A 2Y0BA 1XCPA 1UK7A 4R7ZA 1N77A 4RPKA 5AVOA 3LC1O 4NFSA 1KK2A 1RXEA 3NG1A 3VNUA 2W98A 3UHOA 1JR3A 4P31A 3PDJA 1OFIA 3BGSA 2I1QA 4WFJA 5EPOA 3K70B 1NJ6A 4RQTA 2XQIA 4E5SA 1DOAA 2D1QA 2R1VA 3KL4A 3L0IB 3TTYA 1O57A 3JWEA 4DKXA 5D5PA 2NLOA 3H1AA 2BI7A 1AQLA 1LVHA 1NRIA 4EABA 2XITA 3BWCA 3FNHA 1AMUA 2FPRA 5ER6A 1T0PA 1EM8A 4Y2JA 2H5JA 4P3YA 3N86A 1H2ZA 3WJ1A 2WK1A 4MRNA 4NJMB 1JLLB 1MHTA 3MW8A 5AI5A 1JPUA 1HUQA 2H65A 1RAIA 1JB9A 3KKEA 3PZRA 4Y67A 3MMNA 2YQ4A 4RIFA 5DCYA 4D56A 3B8HA 4ENVA 2XZOA 4ABYA 3SZOA 3DVAA 3I09A 3EQ9A 3U7QA 1FYDA 2C3MA 3AZPA 5BWMA 1K2VN 4KI7A 5AW8A 2ZUUA 4JCOA 2Q3CA 2BGGA 2RGWA 4CR6A 3CWCA 3MWEB 6NULA 2HWKA 3A36A 4K5QA 3A2MA 1II8A 3CNHA 3WKEA 3C5VA 4PHFA 4YUYA 3EVEA 3PTAA 2DFNA 3ONDA 5DTIA 1MMFB 5CH3A 4F3KA 4HLDA 4WUTA 2C2OA 4GPAA 3NHAA 1FFGA 1H5UA 4XARA 1E77A 3A25A 1J8QA 3HWWA 3PFNA 4HN9A 4KO2S 2DY0A 5EMKA 1QYDA 3ZY5A 5EKSA 5SV2A 7ADHA 2IDZA 1MB2A 1RXSA 1XXHE 2C20A 3D3WA 3VPSA 5T4EA 1H3EA 2PUEA 3ZZ1A 2JCBA 5C8YA 1J8FA 3M4ZA 4B0PA 1SURA 1HV8A 1X1CA 4JC8A 3LXMA 1RWNA 4J6FA 4TN1A 4RY0A 3RSSA 1P2DA 2CJXA 3KB8A 3GFGA 4TS3A 4E21A 5C8DA 1SC3A 3IELA 4BLUA 2VK2A 3COYA 4RTSA 4MGEA 1HLGA 4HAUA 1BO6A 3BH6A 3QFRA 3WLNA 4P8RA 4UNRA 4TQGA 1Z75A 5THQA 1SK9A 1IL0A 3WJAA 1R6XA 2PMWB 4J90A 5EL0A 3AESA 3O8LA 3NOQA 1T36B 1E2BA 3TRFA 5FR1A 2O23A 4YPFA 3R6LA 3UPTA 3PRJA 4HYYA 3TUZC 4RK0A 2WAOA 5C81A 5FADA 5I3ZA 1Y8CA 4IJUA 3L7IA 4JWKA 2RK4A 3SS9X 1ID8A 3JALB 3KTAA 4QU9A 2O2DA 4AMVA 2JJYA 1QDLB 5DX1A 3AMVA 2CBGA 1OLSA 4IWYA 1KIMA 4J29A 4DMMA 3PX7A 1ONSA 1Y1QA 4I5DA 3THYA 3N0VA 1O08A 4I50A 5EYPB 3ZTWA 2M6SA 2E0IA 3SMVA 2W7TA 1IG3A 4PPGA 5JRDS 3LA6A 3TCXB 3QPDA 4OB7A 1AKNA 3DAYA 1Z16A 2C8VA 1VI6A 2HHCA 3T7SA 4NWIA 1QE3A 2HDOA 2WE8A 2VT2A 3AVXA 3OA2A 2RH5A 3A4VA 1XRNA 1WPGA 4WUVA 2EEZA 4MUJA 1IEVA 2RGDA 2WYUA 2BT4A 2PT7A 1SA0B 1VLQA 1M2WA 3ROZA 3OY2A 5KINB 3KJNA 5C52B 4WK0B 4KBYA 3VA7A 2UYOA 2PSEA 3HJRA 4DM7A 3CC8A 2XWJI 3H11A 2WYIA 4R2XA 5U4XA 4TVSA 3AG6A 5HCIA 1A2OA 3M3HA 1JQ3A 3TR5A 1LU9A 1OXTA 3JWGA 3SYKA 1R9NA 3R5SA 1COZA 1DQRA 1F9EA 3RANA 2ZDQA 3PQ8A 2V96A 4QLAA 5A3VA 3JQ7B 4G9GA 2CXPA 3RVPA 2DWUA 2KW5A 4R40A 1B15A 4CUZA 5I8WA 4KR3A 4KIJA 4BKOA 4ZA2A 1R5JA 3BUSA 5JXGA 2C1EA 1F2VA 3AFMA 1WTCA 1SCKA 3FCYA 4M38A 1FP1D 2EARA 2QX6A 2RHTA 4CMCA 4REQA 3GGPA 3AERB 3H2ZA 4JEHA 2A5FA 4F3YA 1DT5A 4EOGA 5E7QA 2W90A 3KWFA 2IDMA 3R1IA 4DABA 1J2TA 2R85A 4RNDB 2Z8XA 2GDZA 4N8EA 2P8JA 5G0WA 5BV2P 2ESRA 2MYTA 1RFGE 2JAPA 1JLMA 2Z6VA 3DOUA 5J9FA 3Q8LA 3UV6A 5FUVA 4Z9FA 2X8LA 4IXDA 1P3JA 2ZRGA 4J43A 1D4OA 4O08A 2ZYGA 3ZH2A 3ZE6A 3SF0A 2AXNA 3HFGA 3OY7A 3WDMA 5MGNA 4DR3B 3LBIA 1XZJA 5DMHA 4UUMA 1OWLA 4B80A 4RTQA 2BJWA 1Z8FA 2FE4A 3S27A 4TLCA 3DVAB 5I9MA 2PWBA 1XPOA 3FR8A 3KLPX 4IGAA 4HSGA 2QTMA 3SHTA 3W5IA 2GBPA 1UFVA 1NE7A 5I7OA 2Z98A 2RHOA 4PN3A 4QNMA 3FCSB 3LD9A 4H08A 2NO9A 3M6IA 3FCOA 3KQPA 3TNYA 4A92A 4UU7A 1E3QA 2HGSA 2ONKA 4DWVA 3F8SA 4ZT7A 5LQRA 5EXEA 4MRMB 3SZGA 3I0MA 1HDXA 4C76A 4O2AA 3KCNA 5A7GA 3VR3A 4JSYA 3EWAA 2FW1A 1QP4A 4AYTA 2Y1CA 1OX6A 1JTEA 4O0LA 5EKXA 3B2QA 1KY5A 5BSKA 5LQNA 1AE1A 1NXTA 1XFAA 1N0WA 3PNPA 4FCCA 4A26A 3ZDDA 3D8NA 5K3AA 5CXQA 2JRLA 2RBEA 2XNDD 4LMAA 1ND6A 1EMDA 1QIKA 4F9TA 1E3JA 5DHQA 4B46A 4C03A 2FPSA 4RZ2A 3EUAA 2P9BA 4J1TC 2HRZA 4IIJB 4FEEA 4QYSA 1SHLA 3DD1A 4KSYA 5FO0A 5IJ9B 1KO4A 3K9WA 4O8ZA 1P74A 5F2EA 3PQ5A 1XDBA 1QQ7A 5BWOA 2C8LA 1JIJA 1JLRA 1R4AA 2BM0A 2IPNA 3ODGA 4TVOA 4LGYA 3DB1A 3THWB 3U3RA 5B57C 1E3LA 1YB1A 1VKHA 5DLEA 4Z0HO 1T4BA 3HCFA 4P4GA 4ARBA 2FMKA 1S89A 1TK3A 1V1RB 4LGVA 4DSZA 3QXJA 1USIA 1P9OA 3U80A 1GLNA 1J25A 3B1ZA 3PJGA 4R84A 1YRYE 4LSMA 4K6HA 1FNMA 4K6MA 5BRNA 3P7MA 2DFVA 3G8AA 2BP7A 4R41A 3UWPA 4Z4EA 2ETXA 1JG1A 3JAKA 2OE2A 4MQ6A 4N0EA 3FDZA 2BFDA 4JIMA 5KIAA 5E1MA 3IAS1 3BMNB 4RF3A 2VCEA 3ZR4B 3WV4A 1BKSB 3P71T 2W2NA 4OYRA 4QPPA 1E20A 3HWX1 1ZN7A 2WA1A 4FYIA 1D07A 1AA9A 2FKNA 4EH1A 3FTQA 3GJ3A 1BXRA 1OASA 1VLZA 3LP6A 5AJTA 3LT2A 2CNBA 2J9FB 3FGNA 3P2MA 1DBSA 2XADA 4L5CA 1IN8A 1MOPA 1Q0HA 3NIFB 4UE6A 4C4RA 3CVXA 4LPKA 2DJ5A 2ZGVA 4OQZA 4I4LA 3AHCA 4D8YA 2EL9A 2O07A 2XQKA 5HX7A 4IUDS 4E0BA 4MRVA 4UNSA 3Q8MA 1IOVA 2QPLA 4D4KA 1UK6A 2RJ3A 1R4NA 2MCFA 1V25A 3UH0A 2ISSD 1BH6A 2OCDA 2DMRA 2BMJA 2X58A 3RTAA 3NBUA 1D9ZA 4QEDA 5JJBA 2Z08A 2K6GA 3UPUA 4JC5A 4EG0A 2ERXA 3THYB 3L0PA 3K2EA 4WQMA 5H59A 1NQTA 1U9ZA 2FMXA 2H1VA 4TMWA 1FJ2A 4W5QA 1XEXB 3FYUC 3G2OA 3LPLA 4TWZA 2VEDA 1T3ZA 3EXIB 5DN6A 3S1LA 4KQHA 3ZDXB 2ZVDA 4KIUA 3U7GA 1QLJA 3H83A 2C95A 4Y1RB 2CLIB 1KYWA 3P9CA 1I9GA 3EN0A 5T4BA 4TMFA 1MO5A 2QJRA 3KYBA 3WMRA 2ALJA 1DCFA 3RFFA 4EX6A 4MV5A 2X5OA 4XIIA 5IG2A 1OKKA 1BGVA 1AHIA 2QUZA 3OQ6A 3WLIA 5KNBD 2VTVA 4Z6KA 3FTNA 1PR0A 3REOA 2KI5A 1H2EA 4R0MA 3L1HA 4KQMA 4QLOA 1VIVA 2C61A 3X1MA 2AZTA 3MGAA 4K3UA 3QX8A 4E2WA 5A5FA 4M49A 4B73A 5IK2D 3HL4A 4RH3A 4R8MA 1BQ4A 3DF7A 2PCLA 1PT9A 3KQSA 6AT1A 2IY9A 3IS3A 1WU8A 1NVVR 5EP4A 3W78A 2AI1A 1A8PA 1WUIS 2BSAA 1L7VC 3LUFA 2FPUA 1N1DA 2ZRAA 1NJGA 1L3CA 4ZCSA 2DM6A 4NS1A 1VYHA 3KT8A 1JDSA 2NSHA 3G9UA 2OCLA 5EKUA 1EBUA 2QUKA 1J20A 3G82C 1WPXA 4PAQA 3BGOS 3A2LA 3DKRA 2F17A 3OT1A 4Q7EA 4R5MA 3DOFA 5AI6A 3O3OB 3ETJA 1MA0A 2C0CA 1BXKA 4QWWA 4BZXA 5HUQA 3DM5A 4YRIA 2HJSA 4NEGA 1R4NB 1VHWA 2VQDA 1FMTA 1AS3A 4NK5A 2O3QA 4FMCB 3VYRB 1TF2A 3B6JA 4HH3C 1GZHB 6ADHA 5B7GA 5JJKA 4KVZA 4MVCA 4GU5A 1JT2A 2BIFA 2UZ1A 2VN8A 4DCUA 3DONA 5G0TA 1G1MA 3UQZA 2R1ZA 3FE2A 1YDHA 3IAUA 4QXQA 1ZH6A 1O2DA 2LW7A 5IABA 1DIRA 4FFRA 5E9QA 3EZ6A 5J58A 4CGZA 2QROA 4BTEA 1AUQA 3DV9A 2FJ0A 4MW1A 4Q3DA 3UA3A 4R6WA 4WNCA 3SFVA 1RKVA 3QYAA 4D2IA 1UM9A 2VT6A 2D5CA 5KYWA 1M6VB 1EFVB 1AF4A 2OHFA 2H2AA 2BRUA 1XWFA 1VXRA 1F20A 2O3JA 3ZVRA 1KERA 2CLDX 1KIFA 3H5RA 3KRTA 3QTTA 4LY9A 4OHZA 4D41A 4WNAA 2WA2A 3D0QA 3GHHA 2X5NA 1UEXC 1QHIA 4KREA 2AOUB 2OBXA 3WIUA 3O7MA 3B9BA 4NV3A 2KPOA 3STUA 1V1RA 2XEXA 4TSRA 1Z9BA 3L40A 4MROA 3OO1A 1N2CB 2R48A 2C42A 3W7AA 3B7PA 4RQBA 3ZEAA 5IXSA 3GCGA 3LO5A 5AJHA 1YVRA 3CRNA 3H13A 3E9DA 2G5GX 5AK0A 1VYVA 3R6GA 4X20B 1V16B 4WOCA 2PAAA 1OC2A 3D8HA 2GBLC 3C3PA 3MXTA 1ND5A 4G8JA 4MP3A 4G4SO 4RY9A 4EP1A 3NB0A 4B8YA 4YMTA 2H7XA 3FFBA 2X5JO 2GVDC 2V7TA 3QIAA 4KIFA 2YYZA 4BLSA 3CH5A 5L7YA 3I1JA 4IG9A 4OAOA 1I4EB 1KI2A 4CVNA 1EWQA 1IHDA 1M8KA 3LVBA 3R5FA 4F4DA 3MRTA 4NAVA 1H0HA 2AWNA 4CNQA 4GGOA 4P7KA 3PJEA 1NSFA 1X9HA 1YZ3A 4MO9A 1G0NA 4CM8B 1SHJA 3Q3HA 4M0FA 5KSPA 4XM1A 1HMYA 1BQ3A 2H9AA 2P0YA 4FCWA 4OI4A 1NX9A 5EA2A 3I45A 3BWVA 3URKA 1HZZC 2XD4A 3J80A 4CZ2A 2CV1A 2ZSKA 1M8GA 3CE6A 3UMVA 5KJEA 3ASYA 1LLQA 2BDUA 1ZAKA 1W9MA 3NBQA 3SHVA 5ES4B 5KVCA 2GXAA 3NAMA 4HNAA 2Y77A 3PPXA 1CS4C 3LXRA 1KP3A 2BRUC 2B36A 4G5SA 4JWTA 2NUAA 1FLAA 4RZQA 4AN0A 1QR6A 3E58A 3VU3A 4CM6A 1UT8A 4Z2AA 5HUJA 1NKVA 2FZVA 5GZ6A 2GN1A 1VMKA 2IDJA 3N8HA 4YX9A 5ITWA 1ZJYA 2DFPA 1IU9A 4IR7A 2XVYA 2RB4A 3BXXA 4UE3S 2V7XA 4P4TA 2XZPA 3HVUA 5FUBA 4DLLA 5KPJA 1NV9A 3LHIA 1XL1A 3I52A 2FFRA 4D45A 4RGBA 4B4VA 4LUCA 4DRXB 3DP9A 5TT0A 3E5NA 4BZWA 4JKIA 3TR0A 4XVRA 1PL6A 4JYCA 5F77A 3VC3A 1YCFA 1EHYA 2QL6A 5LZ5A 4ZV4A 2EF1A 3Q98A 4I1UA 1I80A 4RMJA 3EZ9A 2YWGA 4XFDA 2WABA 3OQJA 2QPOA 4MS3B 2Y4OA 3F5FA 2G76A 3C8HA 1UBRS 4OM8A 1YBAA 1GU7A 5AXBA 3U6KA 2NT4A 3TFOA 3L1UA 1HMPA 4GX0A 4TL6A 1HE4A 1M73E 4RKRA 4ZARA 2FV8A 1E63A 3U9LA 3NQ41 2VP9A 3G02A 1QIJA 2AEJA 3EWNA 4L6IA 2XY4A 5KAMA 1ML4A 3KWLA 4LYEA 5BT9A 1NBAA 4HJXA 3ZJYA 3H5AA 1PK7A 4I1OA 4Y6OA 2WKPA 3UJ3X 4ZEMA 1D2RA 1VFNA 4KAFA 2OUIA 1NF3A 2PPLA 4ZOLF 2FP3A 1UL1X 2H07A 2XPCA 3ZE2B 5TGDA 2OC4A 1Z0JA 3K09A 4AT1A 4PLFA 5DEOA 5FHQA 1RQLA 3R0ZA 3USES 4ZYXA 5HW0A 3QVWA 1NKSA 2JZCA 3QBJA 4BV9A 5DRTA 1SA0A 3VYUB 1W1WA 5KTRA 1EZ4A 5KHAA 2POQX 4EVQA 4RFLA 1TTTA 5L3VA 2R8BA 2DPMA 4OQQA 2Q1XA 3SBOA 4CETA 1BDJA 2JRCA 3AM4A 1EBBA 3QFFA 4KYIB 4WAUA 1ITZA 3VJRA 4GR4A 4W1PA 2IYNA 5DGDA 2VJCA 4BNMA 2F3TA 4YAWA 2GH1A 1I3OA 3Q0TA 5LNK6 2H8KA 4KOAA 2QRNA 2XXBA 2I4MA 1IH8A 3SM9A 5JAPA 4ESHA 1PJLA 1Q3HA 2ZI6A 4QOGA 5K0CA 1S01A 3I2FA 2V7EA 3SEAA 1PHPA 1KSJA 4QYTA 4UKDA 1P45A 4ROSA 4F4JA 1HNZB 1U7ZA 1R0LA 3WLQA 5ELXA 3AR5A 1LBEA 1Z4LA 4I1VA 2VPPA 3WZMA 1FXWF 4PTLA 5DU2A 1NF2A 1EDZA 1OB5A 2HHHB 3QPUA 1BWRA 1JXOA 5BSHA 1PJCA 1XTTA 1ZM4A 3CUVA 3FROA 4V0QA 4EA8A 5KC8A 2XJ9A 4TV8F 3GJQA 4Q03A 1UBCA 2QAGA 4NZPA 3KXIA 4FBMA 2AYZA 5CDFE 4HWGA 1EFRD 1I3NA 1JALA 2ZR7A 3JQQA 4LYDA 4RQAA 4JELA 4DCMA 2LUOA 4WY8A 5KSWB 4YJ3B 3FOZA 2N9UA 3V4PB 2IHVA 4X8OA 2FZGA 2E9SA 5ERXA 4S0ZA 5I6DA 2Q7OE 4PFJA 1ZGJA 3B36A 3SX4A 3ANSA 3I2KA 4MUGA 1ZH4A 3L6BA 1IPHA 2TMGA 2YWRA 3DHVA 4BC0A 1CD5A 4UPEA 5TPWB 1EAMA 4MVJD 1J2UA 1YE3A 3BXEA 3K1AB 1X87A 5ENVA 4K0KB 1SOVA 3LKBA 2AJ8A 4EF4A 4G5OA 2EHDA 4AUNA 2OTCA 2PS3A 1RZRD 3I1YA 5E7JA 2YZ2A 3VVCA 3WYDA 1ZD3A 3NV9A 2YMMA 4D96A 5LR6A 3VKGA 2V8BA 2KBEA 1NWCA 2MOKA 3WL6A 5JYEA 2XGOA 3LRTA 3PKZA 2ZPAA 2XZDA 1CLEA 2YVQA 3TJRA 3ZD8A 2DWOA 1OGIA 3F6CA 5CDYA 3O8CA 4AJPA 4KN5A 1JDTA 2C5LA 2PV0A 1F2TA 3QQ5A 1SQFA 2C57A 2OHVA 4FK8A 4IX9A 4Q3OA 3W8RA 1RRGA 2JBWA 1KETA 2MMGA 3PEYA 5L51A 3OZAA 4GOXA 4R1NA 2Q5HA 5F78A 4DLTA 2R1UA 2BOVA 4KJZA 1BVRA 1XG5A 1KTIA 5FKJA 2B7CA 2ECKA 2J3LA 4WCFA 4AVYA 1E4VA 3NTRA 2OWDA 5BV1A 1NR7A 1Y7HA 5JSHA 3WL7A 1NI4B 1CJUC 1DXOA 1QYRA 2PM8A 2X9VA 1R6VA 1QYWA 4DQKA 2PUDA 3WGYA 2OPBA 3IIIA 5CAEA 4YP7A 1OAAA 3JQEA 3HJGA 2CYBA 4IX1A 4X63A 3BICA 3PUJA 1NQ5A 5HK8A 2H0QA 2H7VA 3R8CA 4NYJQ 2LTAA 4KNYA 3FNQA 1CETA 1W1UA 1RC1A 3NTLA 2QGNA 3OKAA 3OQIA 4QUBA 4HCJA 3RRMA 4ZIRB 2AKEA 4CTMA 3ABZA 3ZD9A 2FZLA 1JIQA 2O1WA 3MK31 1UWCA 3W9BA 4JB8A 1CVIA 4OXYA 4YCAA 5K8CA 4QUDA 3GPIA 1FRFS 1KEZA 3RGGA 1KHHA 3SC3A 1Z7EA 5KJ6A 4J1NA 3IUQA 1XEXA 2BE7A 3ABOB 1V6CA 2J3HA 2XMBA 4GOJA 5D7BA 4DT1A 1NBOA 2CFSA 3KD3A 2J3JA 4POOA 1ZESA 2O8FA 5LP1A 2FXVA 3C7DB 3UPDA 3E9EA 5KNCA 5A62A 4MIKA 4BX0A 3CV3A 3OIWA 3E7WA 4LGCA 4OCZA 4ZT2A 4IIBA 1Q0UA 4QA9A 2D1SA 4PYKA 4BO9A 4PRLA 5DT2A 4M9RA 4LHXA 2E4VA 3HV0A 4ZO7A 1IVNA 1PNTA 3O4FA 4FCVA 3SPXA 4AG3A 1QU2A 1VG8A 4B48A 1ZI6A 4RD3A 3ZQ6A 1VJCA 4UTPA 4I99A 1ZY2A 4H6VA 4HY3A 4PLWA 5DTEA 4YV1A 3QU5A 1OA0A 4FW8A 5GPBA 4B5LA 4BQPA 5ITZB 3DZHA 1O6ZA 4WY5A 3LVRE 4PYLA 1XN4A 1ECBA 4NU6A 4UEQA 2WDPA 3HB5X 2ZUEA 1BCSA 1HZJA 4JB3A 4MV3A 4NFYA 4DBLC 5FH9A 1OB2A 1N4DA 4F45A 2IZ7A 3QNUA 4RV5A 2CD9A 4J4HA 3ZH9B 1ZM2A 3GUYA 3FOEC 4DXHA 1LWOA 2G9QA 4BQEA 4OY3A 4LGMA 2BFDB 3DE4X 4R1MA 4GOLD 3OMLA 1ECGA 4PZDA 2XTZA 4X3CA 4KNVA 1ENPA 3K72B 1KZGB 4OD0A 5A1JA 3BE5A 2DTDA 3CZPA 5A2GA 1EM6A 1N2SA 2PG3A 5BW8A 1NNUA 3L0YA 4M7WA 2G67A 2VH5R 2YFHA 5BQOA 4KXQA 5TIIA 5HQTA 4Q1BA 2NYUA 4KX5A 3OZFA 4HB2A 5TQVA 3TOCA 4JBWA 4KYVA 3SI7A 5F73A 3R3XA 2A9VA 3HDQA 2ZRDA 4NCBA 4KR7A 5K3OA 1UMCB 2G9UA 1R0BA 1N2GA 2B4QA 2PGDA 3R6TA 4AICA 1K98A 2YZGA 4B87A 2ZUFA 1U8ZA 2AEEA 4EKEA 1EIWA 5K8IA 2UUBB 3M81A 4DREA 5DVZA 1MKYA 3DZJA 4HLQB 4FBGA 1ZD8A 3HADA 1UMBA 2F90A 5F4ZA 2FWBA 4PU0A 1C1DB 5EGSA 1E92A 2E6UX 4XDZA 2H1CA 1QDEA 2OZKA 3HM2A 2G88A 1K5PA 3B3GA 4NG4A 2HNKA 3ZZ0A 2F3UA 5A5GA 1SNYA 5CDHA 3QVTA 4Q15A 2AOXA 4C2BA 1FTQA 2WWRA 4OQMA 5IAEA 1K92A 4IF4A 4MQFB 4ARVA 3CZQA 2XYGA 4QJ4A 1XJ0A 3CWQA 2OCKA 2DUUA 4UNQA 3N74A 4OHBA 5B3JA 4RJJA 4QZVA 3GNTA 1E69A 3L0ZA 3G9XA 1L5ZA 1RM5A 3ANMA 1E5QA 3P94A 4M89A 1TJPB 3VPBA 1KEEA 3GN1A 3C97A 2N3ZA 3PP8A 2QMOA 2ADOA 3MJVA 4FFLA 2QLMA 3N5CA 2GAAA 1E4EA 1L5OA 4WXHA 4TT3A 1VKOA 4WXYB 2OYCA 3RVKA 1Y1LA 1M1YA 3WDSA 3P9QA 1UDXA 2GRAA 3K4PA 1AUOA 1MEJA 4BNVA 4ENTA 1DUVG 1W19A 3WHKA 1GPAA 2FPIB 4MRAA 2FA9A 3EIQA 3MFYA 1NOJA 1U4NA 2LPMA 1R5BA 5JQGA 4WFQA 3TFQA 3OTWA 3LUBA 3N2LA 3CLUC 3GT4A 3TQTA 1IUKA 4TT8A 1SRQA 3DMFA 4FX2A 4C0WA 1RTTA 5B3LA 1DKQA 1G2OA 3HHEA 3JYLA 1H8HA 3PE4A 3FYTA 1Z73A 2VQEB 1EUZA 2QEQA 1UANA 2Y76A 1W35A 3H5NA 4OFZA 3PNQA 4X60A 3EGEA 3TQOA 4ALJA 3HCCA 3HKDB 3TQHA 5JO9A 4P4NA 1V8DA 1ZGHA 3B1FA 3EZNA 3LUHA 4JFRA 4IIHA 1V39A 2AB0A 3TQRA 3DFIA 3VOTA 4N7BA 2ZAMA 2EWMA 3M5CA 4R1OA 1F8UA 1PR9A 3JWJA 3R09A 4U9IS 4QQRA 2NXCA 3H9JA 4YT8A 1PZGA 3AP1A 4YASA 1AIPA 2X8JB 2C0QA 2GD2A 4P7BA 1E3SA 1F8XA 1Z0FA 4OA8A 1WG8A 4Q12A 4BZPA 1KMHB 4IM7A 4D97A 1MEOA 2H00A 4DCPA 3OJXA 3LBAA 1N6HA 3PDWA 4AZ3B 1EVIA 2AVNA 2D74A 2PR7A 5E7MA 1N92A 7MDHA 3L4SO 1H3FA 4U6QA 1G8GA 4B1FA 4Z0NA 2IIQA 2LRHA 2XNJA 2Y92A 4C43A 2VJKA 2ZUBA 4UEWA 3QLVC 1CV2A 2QSZA 4EMBA 1TA4A 4HVAA 5TC4A 1XZDA 3LM8A 2LKCA 3RHTA 2SKCA 2ZQ5A 3FR7A 2WTBA 3I6MA 1W0CA 3JV7A 1MAHA 3PRYA 4ZZ0A 1NL3A 3G5TA 2V7WA 2RGNA 4JMLA 4YJKA 1ZWLA 4RTNA 1Y4UA 5BNWA 2R0QC 4R1UA 5KX5F 1Z2NX 1Q92A 5ESDA 3GXOA 3QH4A 1RM3A 1ZW6A 4JUCA 4EVSA 3D6HA 3ZI0A 3WYBA 1I6KA 1BEUB 4QT4A 5F23A 4PQFA 4NCAA 2CDBA 1SRRA 4OSEA 4YIHA 2OG2A 3GG2A 4RM2A 4H4CA 3IILA 4TRMA 3CINA 1JU9A 4UEKA 1E98A 3O95A 4QATA 2V3VA 4ZDJA 3I5AA 1MNAA 1MCZA 4L28A 4EO9A 1K4MA 1XMJA 3E7FA 4GNKA 1HYEA 1WUHS 2OXEA 3SC2B 4G23A 3SLGA 1Z08A 3ZEIA 4F9FA 1BMQA 5A9SB 1TMOA 3OE7A 4HSEA 1WZEA 2QJTA 1MDBA 3DKIA 1SVKA 3K6JA 3KL2A 4XIFA 4URVR 4L6CA 4JT9A 3PXGA 4DDMA 1FQKA 2FP4A 3LP5A 2Q4RA 1G7TA 3I58A 1DTWB 1E9SA 4IG4A 4Q9JA 1WNFA 4CF6A 5LDDC 4X65B 4GLFA 3ESAA 4K6OA 3IAFA 4LXQA 4PFSA 3D6UA 2XV1A 2ONZA 4W1RA 4UDOA 4UU0A 3WXBA 1OLXA 3KQVA 2BYTA 1ENYA 3MTDA 2X8AA 4J3JA 4RV4A 4Y2TA 4B7AA 1KI6A 1SZCA 3OZVA 5EE0A 5A0VA 5JLJA 3CLUD 4BKUA 4UTOA 5C34B 5D3KA 4P80A 3DEYX 1EGQA 4N76A 5D6NA 1C0LA 2H2DA 5F9MA 3TUIC 5GONA 3CRVA 1UOEA 4DJ5X 3JQFA 4FU0A 3HZRA 1C7EA 2ZYTX 3ZQJA 2DFDA 2RAVA 3A27A 2ZSDA 2JEYA 2P6NA 2RCNA 1MP0A 2QYHA 5IBCA 3UENA 3HPQA 5EQJB 3ZZUA 5JNLA 2OENG 2QB5A 4QBHA 2BGMA 4EENA 1P9NA 1Y98A 5JVDA 4JYZA 3AVYA 3MA0A 4S0XA 2G5TA 1MXHA 1SD2A 2BDEA 2BMEA 1TUEA 2JIRA 3CG4A 3PZBA 3QBTA 4H7PA 1OZHA 2EQAA 3HMQA 4YMIA 3T06B 4C6HA 4BQQA 4HDMB 2Q5CA 3VRHA 4YT5A 3EYAA 1ODTC 2GN9A 5CA0A 1ZPDA 3T9EA 3ZV7A 2XOXA 5JASA 1TAHA 3C85A 1P9WA 3EUWA 1KI3A 1MFZA 3GJ6A 2B6HA 3JQAD 4ZJZA 2ZJZA 4D4GA 1EXDA 4LW8A 1MEEA 1R5OA 2IBMA 3JQ8A 4H59A 4BNGA 3WGIA 2XKJE 2GZ2A 4C7OA 4D25A 2PBLA 1QU3A 3PXEA 4MICA 3VNBA 1M6YA 2VSNA 4DSUA 1QJCA 5J4YA 4IJ6A 1GV1A 2IRWA 2J9XB 1CFZA 1Z74A 2BGIA 4TKUB 2NPIA 5AKKA 2WU3A 1TXGA 1C9DB 2A0XA 1OROA 3O0TA 2FN3A 1W59A 2GOYA 1HI9A 2D2FA 2IOFA 4KPGA 2RKWA 4MV9A 5KTKA 1KPHA 2R7AA 1T6YA 4W82A 5JG7A 3RJMA 1PWYE 1KMHA 3UFXB 5JSFA 1COWD 1YVEI 4P83A 3TOSA 1YR1A 5JDIC 2R9VA 3K5PA 4QGBA 3A6DA 1QFYA 3P27A 3BPSA 3IULA 3GR6A 4R51A 4PGGA 1J9GA 2XAAA 5FV7A 1T5IA 3AF2A 4RDCA 4RMGA 3VZDA 2AN1A 3H65A 3ZPXA 3M1IA 1WJGA 2PX6A 1FYVA 2Q4TA 5D7NA 2ECOA 1K9VF 3DZIA 3K5IA 3K9HA 1XO1A 1JFVA 3H4VA 3KNZA 3OECA 4H60A 2DT5A 4R1PA 3K6KA 4XWAA 5IT0A 1XAJA 1J24A 2PQ0A 1Q2XA 1TFUA 1PJTA 3REFA 3K9CA 4Y1GA 3VAYA 4MKXA 1BD3A 2FGKA 2EFGA 2RGEA 3QHPA 2QPTA 3EC1A 5T5QA 1M7GA 3IBFA 4EW3A 2PT6A 3KPVA 1I30A 3DCNA 5I4KA 3TLYA 4YACA 3JCZA 3C43A 5AHRA 4IHJB 5EP3A 4WLVA 1L4MA 3KLBA 3B3QA 3A26A 5E1DA 4IICA 2OXCA 3Q6IA 1S8OA 3R0XA 4N54A 3AF5A 1ZIPA 2YTZA 4KSBA 4QG3A 1E2HA 4PN7A 2BUBA 2DPGA 4FMDF 4IZOA 2H08A 1IZZA 3OLQA 5FXMA 1NOIA 3MHPA 3WLSA 4NHOA 1B7GO 2WHPA 3WICA 3KYJB 4M60A 2XUDA 2H0AA 1I7NA 5CD9A 1OBHA 1H2WA 1XRLA 2REBA 3A2NA 4HMOA 4BDSA 4EM6A 2Y93A 2GUWA 1SVOA 2QD2A 5FTKA 2M2IA 2D62A 3Q41A 5M7EA 2AZDA 2G9VA 3W9YA 1W36D 2VDRB 2PVSA 4ITUA 3RYTC 2VC2B 1Y1SA 1N5DA 2YMPA 4M22A 2O0HA 3L4EA 3SCZA 3LV8A 4RXUA 1FS5A 2YYYA 2I0FA 1BW9B 4YP5A 2PZJA 3HV2A 4AS1A 4XLTA 3IKTA 2GCOB 3GT3A 5BSGA 1C9JA 1NASA 1PYOA 1Q1QA 1T4GA 4UDYX 3UUFA 2WF9A 3MCVA 2WU0A 3FUTA 3QEOA 4RHTA 4URWR 4AJKA 5BMVA 5KWEA 3G6KA 5JCXA 5CLGA 3S5UA 3PTZA 1WS6A 5JHHB 4R1SA 2Y1FA 4J3FA 4BJ5A 5LLTA 1NC1A 4ZQIA 4BNXA 1CUCA 4D3FA 2BBSA 4YLGA 2J3QA 2NU9A 2CCKA 1FTNA 4Q4HB 1KVQA 3D3KA 2AG5A 3RSGA 5MDHA 1YL7A 3GJYA 4YMVA 3K09C 1SMKA 1YRBA 2QI9C 5HRCA 1JKJB 2VDMB 3UANA 3PYLA 4R8SA 1NOKA 2BHLA 3QG1A 3W1WA 4RTJA 4ZCTA 3AVVA 2XVAA 1M2VA 2Q6IA 3HY4A 1JH9A 3LTEA 1N78A 4BO7A 2ZSFA 2Q46A 3T41A 5DWVA 3OI7A 3EPKA 4RHFA 1KQOA 1WY7A 3BFXA 2VAXA 1BCSB 1OF1A 1VOTA 2OP1A 1O54A 3BHMA 5K3DA 4YAIA 1AK9A 3JRXA 2ZDGA 3LT5A 1GEEA 4IH1A 4D9HA 3JQGA 3LT4A 4MNTA 2RSLA 2EC5A 4N12A 1C81A 1QJ4A 2R97A 1QFXA 2Q4BA 3LS2A 3M5DA 4QGAA 1UPBA 1WW2A 2EBUA 2FGJA 3O74A 4F8EA 2BR5A 3QMPA 3QFSA 2W2XA 2ZIVB 1NW8A 5HE9A 1QVWA 3V1KA 3TPZA 5TARA 3N2EA 2EJTA 2IF2A 2NQ8A 3OCZA 3NWPA 5EC8A 5JS7A 1ZVQA 3KZXA 2JJ2A 4V0NA 1IK6A 1FSFA 1NN5A 3LYAA 3QMMA 4YUWA 4U2CA 1U31A 1IK4A 1EP9A 3F7TA 2OILA 4RVNA 2VDQB 2VHJA 5J4LA 2V7BA 2ZTMA 3FZEA 3M8KA 2FZCA 2PKQP 4Y18A 5T3YA 2AC4A 2CUKA 4GNRA 4BNFA 2FI1A 1P1RA 2XUPA 3D4IA 5IULC 3IE2A 3GRRA 5K09A 4QXMA 2HD4A 2C94A 3HP4A 2I2FA 1I2BA 4IDBA 3STYA 5JROA 4R9UC 5DYWA 4BO3A 2VNKA 4EUNA 2WU1A 3WSTA 3VTFA 1W36C 5COBA 4LXGA 5LWQA 4HQKA 4C9BA 5BN3A 1NIPA 2HY7A 3PQ6A 4I55F 2V1XA 4IJ5A 3D5TA 5FUMA 3EISA 3BEOA 1Q0TA 4QXRA 1T1EA 1TUBB 1JHRA 3QNWA 1LVUA 2P9GA 2QQ0A 4L8WB 2I4RA 3BKXA 1EUYA 1U2SA 3KKNA 1L3IA 3GU3A 4JSTA 2Q0QA 3H2YA 3HNRA 4FNGA 4DMUB 5KQPA 4XD7D 3EQ8A 1EGHA 4DPMA 1RXIA 2AFHB 4WZAB 1GD1O 2GR9A 1U8CB 3TRKA 1B6SA 1VL5A 1QV9A 1A7UA 1ID1A 2PZFA 1L7NA 2XJ4A 4I55A 1OY1A 2UUOA 3GPBA 4HP8A 3IA2A 5J23A 4GVLA 2IHNA 5CEFA 3R3UA 4QD3A 2GSDA 5D00A 5K99A 3BDVA 2O5CA 3EUFA 4MVJP 2ZRHA 4MYRA 1JQDA 5IBPA 4DDTA 2W6OA 4HUTA 3FUWA 1H4TA 4AYWA 1GY8A 2GMWA 3EFBA 4AJIA 2D2VA 4O29A 4YGYA 1ILEA 3LCJA 1J90A 4E07A 2Q8PA 3DOEA 1N2IA 1PG5A 1KH1A 3WGMA 1IHUA 2XNDA 2AUNA 2I3BA 5HA5A 1ZMRA 1V1JA 2Y1OA 4RD1A 4G0WA 1GAJA 5FEUA 2FRDC 4Q7KA 5B53A 3PWTA 4D9BA 3AYZB 3QYPA 1K3FA 3U31A 3F7NA 5A4KA 1GTRA 1THGA 2WYVA 4GDMA 4C29A 1EWYA 1RM4A 2EV9A 1T25A 2PUCA 3BIXA 4MW2A 2HXYA 4RVCA 4I4TA 1FLDA 3HCDA 2JZNA 1JVSA 2PA0A 1A8IA 1P3Y1 3RYHB 1JH8A 3VHQA 4HQLA 5DBHX 2A67A 2PH5A 3PD7A 5KNDA 2WWHA 5EWMA 3U81A 3CJRA 4TQUS 3DXFA 2O0KA 4M8IA 3WLPA 2XYQA 2GZ1A 3HKBA 2ZM5A 3D6AA 2BZSA 4PV7A 4J1SA 1NZJA 2O2HA 1NZFA 4HDKA 3ND8A 1G55A 2V58A 3OFNA 2I1VB 4Q34A 3ZNQA 5BSMA 3EBOA 2UV8A 1B76A 4IEEA 1CY6A 5C31A 5CJPA 5JJCA 4B2PA 2WWWA 4ALIA 3ZD6A 3LLMA 5FUXA 3ESBA 3BRWA 2VZ9A 2R4QA 3KKQA 521PA 3HYTA 4PC3A 4X54A 5LKRA 4JLMA 4WINA 5JS2A 5L3SA 2PKWA 3NDRA 1GCAA 4FTWA 5YASA 1FC0A 5SZJA 2PFGA 4JK3A 2XMQA 5MHTA 3QYJA 4GKVA 2HSEA 2SNIE 5AM2A 4TV9B 4OI2A 4HFNA 4QODA 4FYYA 3VR0A 4TLMB 4DANA 4NBWA 2FPPB 4MMZB 2NUPB 3OZXA 3ER9A 4BQSA 2REQB 4WZBA 3EGWA 3I4LA 2O59A 3OCWA 1RIIA 4ZJPA 4IO0A 3V32A 2AH5A 4JLJA 2D1TA 2D5LA 3R5JA 4C3VA 4LRSB 3ZIAA 4DRYA 5C3MA 1OAKA 2QTAA 4FSXA 2P9CA 1GV0A 1ZOPA 2VDVE 4FFNA 4LNHA 4GPEA 4PLGA 4F0JA 1IEXA 4WJZA 1GFWA 3A4IA 3DMDA 1P80A 3D1LA 4PX2A 3TJZA 3UICA 1CX9B 1BHO1 1Z29A 2BFFB 3OTIA 2V0NA 1UPAA 2RGBA 4MMYB 1TVEA 1GKLA 1IPEA 3C70A 3PXBA 5IJAA 1KAHA 4ZAXA 9GPBA 3DHYA 4ACAA 3T1VA 1LQTA 4XWWA 3D4NA 1G6OA 4BU1A 1N9ZA 1KMQA 4DM3A 2XMDA 3OU7A 3CYFA 4WW0A 1U2EA 1M2FA 1YACA 2XUOA 4R2MA 1U8TA 4UEJA 1EWKA 1K4KA 1TJ5A 3SQXA 3KT3A 4WASA 4F1WA 2ZSUA 1GZDA 3OZUA 2VWHA 4ZOLB 2PGLA 3MN1A 1PFQA 1CY8A 2VHXA 4G0XA 4PLPA 4XDGA 5CTJA 2JFPA 3KSUA 5EJMA 3IO5A 3HXOA 2QX4A 2H1SA 1SVWA 1VHTA 1GLGA 4FSDA 4DFDA 2GN2A 2LVBA 1P17A 1XZFA 2RCYA 3D6MA 4DBZA 2F2TA 2YJZA 1RADA 2BCEA 3PFKA 4UBLA 3GJTA 2O7RA 4X84A 4RVOA 2DEUA 2O2ZA 3N0TA 5CH5A 1M1NB 4CCYB 3BFVA 4GQIA 5FBRB 2AG6A 3X1DA 3THXA 1PFYA 4CLRA 2R8EA 2JCYA 1DNPA 1YB2A 3MRVA 4UHHA 2IUTA 3MWFA 1TQ2A 3D1JA 1ZHOA 2F43A 4QXOA 3ZW9A 1U63A 2UXDB 4JYPA 1YB5A 4I9NA 2CHFA 4B7XA 3KVRA 2XMGA 3UXYA 1NT4A 1QTIA 3QU7A 3P0EA 5I9SA 3A04A 5LQCA 4B4KA 1VYTA 4CKEB 1UADA 1T24A 1TMYA 2A94A 2IQ5A 1SC6A 3KUXA 3OIGA 3H1BA 4ARCA 1LLUA 1HYQA 3LWNA 4CLOA 3MJCA 1V1MB 3C8DA 2ZBFA 2BEKA 2HK8A 1AGPA 1O95C 4YV0A 2YOGA 2RHCA 5IAAA 3K6SB 1CVLA 2AEFA 1AGXA 4N01A 2BBTA 3Q1KA 1T2FA 3P96A 4DA4A 5H9WA 4X24A 3HWRA 4J1TA 3NIWA 2IUSA 4P54A 4F04A 3THSA 5HVNA 1JZSA 2R6JA 2CHQA 4GS5A 4MEBA 4BMOB 4ZAYA 5BYKA 4C88A 2V7UA 1N32B 2PV7A 3G2MA 5IVDA 4WFIA 3W3AD 4J7XA 2O50A 2XZTA 3A1SA 1GTZA 1HQYE 3ELBA 2VHZA 1KMIY 4YAEA 1MUUA 3F46A 1FMFA 3T1NA 1VKNA 4IFBA 2ES4A 3KZVA 1W0JD 4NZOA 3PGMA 4E15A 1SBNE 3ZWNA 2XUFA 2TMYA 3TLGB 2IU4A 4YROA 5K5EA 5A0TA 1XD2A 1LRLA 1WSWA 2QQEA 5BW6B 4I50F 2GHRA 4GPTA 2Z1DA 3ZS8A 4WBNF 1BE8A 1JMYA 4U8HA 1U2DC 2E7ZA 2HF2A 3GW8A 1KSGA 3TZ6A 2V6FA 4RHEA 3UKDA 2X42A 2Q4DA 1JHMA 4KIWA 2AOUA 4KITB 3DLPX 1TPYA 3V5NA 4Q7JB 5EJGA 1SXPA 5FDFA 1IY8A 3O4GA 3LX6A 4I4CA 1DX9A 1QWSA 4TS9A 1XLTA 3X1ZA 3LC0A 4JJ4A 4OTZA 5H16A 3DFZA 5CNIA 2V3WA 4BGIA 4D3DA 5DTQA 3L77A 3C3WA 1AV7A 2VK1A 1FYWA 1MDFA 2W58A 3A9CA 2DSNA 3OKPA 5BUZA 1ZKDA 4W8OA 5TMPA 4CMEC 4J94A 5LYJF 4FBLA 4K1XA 2ORYA 4UHBA 4QBIA 2EOAA 4C6SA 3PX2A 1GGVA 4QYXA 4HAIA 4PS0A 2H17A 3NYRA 3QGMA 4EYGA 1CDZA 1PZNA 2WJIA 1TU4A 4H1VA 4H3SA 1O4VA 2YVLA 2OZLA 4AP5A 3V1MA 3FCCA 3H5IA 1OGJA 2ZZNA 2P9TA 2VYVA 4JKYA 4E2ZA 4MWSA 2KS6A 4L15A 2YIMA 2B98A 3IXMA 1V5IA 1MU0A 2J59A 3IA7A 5JDIA 4FM9A 6REQA 3SXUA 3ZCTA 2X7XA 2JIBA 2IZ6A 3AEQA 3GY0A 4HLUA 2ZAIA 2UZIR 3U7FB 3ITEA 3J7TA 3ZWKA 4C14A 2Z4TA 3P0FA 3RS3A 4AW9A 3SBDA 2XR1A 3M6UA 4KQFA 4EJSB 1H23A 4EAAA 1ZI9A 3OOEA 1CHNA 3TI7A 3GP5A 3OAAA 5JYBA 1O95D 2ZDHA 3WGGA 5BYAA 2PX3A 1L7XA 1QF9A 1QFMA 4BV2A 3U7RA 1E8DA 3WGQA 1P44A 3U7JA 3UATA 5DHRA 1LSOA 1IOLA 2VP2A 2QR5A 1ST2A 2NPOA 3JVUA 4MJ3A 2ZTLA 3CEHA 2HQOA 2VYFA 5FFNA 5TVGA 2GI4A 3TZHA 3T7TA 2X4IA 1UXIA 2GAJA 1QRRA 2Q8QA 1WSDA 1T9HA 1ONBA 2Z95A 4UFNA 5AYVA 4I19A 4Z7JA 3R6DA 3BORA 4KE8A 4IUYA 2H06A 3T3MB 1KVSA 1I2DA 2FW7A 1G21B 3LRXA 3RE1A 4OLHA 2O4CA 2A7XA 4EMSA 1KBOA 3RYCA 2OHJA 2Q49A 4W5HA 4ZO8A 2IBTA 2DPHA 4OHXA 1L4KA 2JFOA 3ZZNA 4B83A 3EXIA 4JUIA 4M0LA 2AJTA 2WKQA 3VDQA 2FAXA 2JLRA 3GVHA 4UEOA 2ZIGA 3IURA 4Y2SA 4GKKB 3G7SA 3BWDD 2QN1A 4HGOA 4QRDA 3DBLB 1YBFA 4QJ5A 1HDEA 4Z53A 4EUSA 1ZMTA 3NJ8A 1QIDA 1UODA 4IHJF 3JQFC 3QWAA 4IINA 1E0JA 1TLFA 4YFVA 1PDOA 3S7TA 1DG3A 2GWHA 2QTHA 3MG9A 3QENA 4C6RA 3R7DA 4MX8A 1IDN1 2F59A 4GM4A 4RFVA 3I30X 3PC8C 1FRNA 1Z6XA 2AXPA 4JNCA 2JI9A 2XTAA 1GIAA 3T9BA 1C7RA 2GNOA 4DGSA 5AK6A 1ZYUA 3S29A 4W63A 4MAFA 1FNCA 1ZS9A 3EVAA 1B4DA 4BB0A 3PI7A 1TZBA 4R7TA 3UC9A 1R66A 4P3OA 3ABIA 4WN3A 5DB4A 4WZAE 3ZDQA 3UBMA 4ZQFA 3N8NA 1P2UA 4ARZA 5B58C 2C8KA 1QWOA 4IV0A 2IITA 3CXRA 2CSUA 4Z9BA 1TF7A 2PJUA 4ZI7A 4E1VA 4CDGA 4L95C 2H3HA 4P5PA 1CHDA 1UBFA 5ILQA 4E30A 4BZZA 3GGOA 3ND9A 4ZQCB 1XTZA 3EFEA 4BCDA 1UINA 3U61B 2AL7A 3ENNA 2G77B 4MVWA