1UBSA

Tryptophan synthase (e.c.4.2.1.20) with a mutation of lys 87->thr in the b subunit and in the presence of ligand l-serine
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
268
structure length
257
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE
publication title Crystal structures of a mutant (betaK87T) tryptophan synthase alpha2beta2 complex with ligands bound to the active sites of the alpha- and beta-subunits reveal ligand-induced conformational changes.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase/peptide
total genus 89
structure length 257
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 1995-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ubsA00
4UNLA 5E0KA 3QW4B 3SZ8A 3THQA 5IM51 4I7VA 4AEOA 2ZQ0A 1LOLA 5LZLA 1EUNA 4RX0A 1V5XA 4HIBA 3B03A 1LLZA 1SFJA 3LHVA 3MBDA 5GVJA 3NQAA 2CZFA 1EP2A 4ADTA 3FIGA 4TMCA 4OQVA 4MFEA 2YGYA 3U2OA 1W37A 4HSNA 5G5IA 4ZL1A 1VR6A 4EF9A 4AVFA 3G8EA 1GJPA 1BWKA 4P61A 3BW2A 3L2IA 1DQXA 3C56A 3NPXA 3G18A 1YDVA 4LNYA 1JR1A 1SO3A 1YDOA 2X30A 3PUEA 3JR2A 5KZEA 2NX3A 3RLUA 1JCLA 1I2NA 4TX9A 1H7OA 3G1XA 2DZUA 2ZRXA 2E6FA 3A24A 4K38A 5F2IA 3DFPA 4MFDA 4Z0SA 2A0NA 2V2CA 4LW7A 4O12A 1VYPX 1T8XA 3P5YA 2NUXA 1KV8A 1NAL1 3W87A 4KFOA 3TA6A 2Z6IA 4PODA 5AN7A 1KTNA 1MEHA 1ZFJA 2NV1A 5C2XA 1LRNA 1XDLA 4KKXA 2GVLA 3PB2A 1KM5A 4O53A 4R34A 4O54A 4TO8A 1F5ZA 3TKFA 4A21A 5LNSA 1KLZA 3M7WA 1FWTA 3NEVA 4ADUA 4HKPA 1X8FA 3W7RA 3UWUA 4AWUA 4OBTA 4NT0A 4P2VA 5EA9A 1LYXA 3UPBA 3NQ2A 1OVDA 4PC8A 3LX9A 3W7CA 4BWLA 4ZQNA 2X16A 3P7YA 4IX0A 3SI9A 3CC1A 2H3BA 1JVNA 1KM0A 1THFD 1JJKA 4D2JA 5J5RA 3VCRA 5EKYA 3DFOA 2O7QA 2QJGA 3MP5A 3NQVA 1DVJA 2NWRA 1ICSA 3CIXA 2BX7A 3DI0A 4AXKA 3TNOA 3W1RA 3NQ6A 1YTDA 4FNPA 2QDGA 4DPPA 1X1ZA 1KFEA 3P82A 3NR0A 5KZDA 3I7QA 5I3GA 2QJIA 3LI1A 4Y9AA 3W1MA 2H8ZA 1VLIA 3O15A 3W7NA 3PC0A 5AFDA 3EB2A 1XKYA 3BK0A 4UUIA 3LRMA 1ZAJA 3GXTA 3T55A 3DU0A 1DL3A 3IIPA 2E6YA 1B9BA 3C8FA 4ZMGA 3QJAA 5ABTA 3L5MA 5D2TA 1WXJA 4CCEA 4Y8FA 1XCFA 4RXFA 2X1TA 4QIUA 4CQAA 5C55A 1W3NA 1KTCA 3QEZA 4XBKA 3NQ8A 5KSWA 3ABQA 2GVGA 2BZNA 1FWWA 2NUYA 3UWZA 2V30A 2QCDA 3B0PA 1GOXA 3C2EA 3I6RA 4DELA 1B57A 4Q33A 4WZHA 3NM1A 3FS2A 4XKYB 4IX2A 3N2MA 1VHCA 2GPTA 4IWWA 2RDWA 5K4ZA 2ZCGA 3DFSA 3BVJA 3EWWA 4C1KA 5DLCA 3EX2A 3W1NA 1CW2A 1I8JA 3O8AA 1SW0A 2V0TA 4X3ZA 2JKEA 5LKYA 2WKJA 1JCYA 3LHWA 2QCLA 4LY8A 3INPA 5MHBA 3LCLA 4K7YA 2YYTA 3LHZA 3NXFA 2CWNA 5K9XA 1OFEA 3STGA 1N55A 1D3GA 3TV8A 1QPNA 1T96A 2ZDRA 3EX4A 3O6YX 3HQ1A 2DORA 3F03K 3LV6A 5FEWA 4JYEA 3BG5A 3TH6A 3MYPA 3W1QA 3HF3A 3QW3A 2QR6A 4O13A 3ELFA 5HULA 1P5BA 1K3UA 3N73A 4WY0F 1ZHAA 1ME9A 4FIQA 4GXMA 4ORIA 3TC6A 3TU9A 3CWNA 3NYZA 1JCMP 3P62A 2E6AA 5BMXA 1LROA 3NQDA 4K6AA 4LUJA 4UCGA 5K4XA 2J6XA 3WK3A 3E96A 5HR6A 4JGDA 1R2TA 4GNJA 2NXHA 3STCA 2WNNA 3LBCA 4GUIA 1G4EA 4BF9A 5LNVA 1YPIA 3SW6A 3AJXA 5G4WA 3W1AA 2FPVA 5CZTA 4K8HA 3W6YA 4AB4A 3G22A 1TIMA 3IGSA 3PR2A 4IJBA 2FDSA 4MJMA 3HG5A 1FDJA 1U5JA 1TQJA 3NL6A 3UXDA 3MO7A 5HNRA 1TPEA 3F4WA 1TPFA 1EEPA 4GUHA 4M7TA 4CNOA 1NEYA 3W88A 3QMTA 1Z41A 2QCFA 4JN6A 2FPTA 3DHFA 2QDHA 4MUZA 5FF3A 2B0MA 3LERA 3KX6A 3YPIA 5AHEA 4IMDA 3WJWA 1FXPA 1OFAA 4E2DA 3ABSA 3M5VA 5F2LA 3ABOA 3TR2A 1C8VA 4GBUA 7TIMA 2H6RA 1EP3A 1GVFA 5HR7A 4M7SA 3NPVA 1AG1O 3NDOA 4MOZA 1IXNA 1W0MA 5EPDA 5EBUA 1W3TA 4LUIA 4MLRA 2FJKA 1B4EA 1KM3A 3B8DA 4UTKA 3DGRA 1I4NA 2Y63A 1TSIA 4UR7A 1H50A 2I1OA 3TAOA 4N9CA 3TIMA 1UASA 5CZSA 3C6CA 3ABRA 1H62A 3QQ1A 3C0JA 3DKLA 1WAUA 4JTSA 4JIPA 4JX6A 3IEBA 2QUVA 1K02A 4JTKA 3W7HA 2GUUA 3A21A 1G4SA 3W86A 3RFAA 3W85A 4UTMA 3O06A 3THAA 4AWSA 4ZQCA 3W7OA 2FB3A 1IIGA 1AK5A 3M47A 2OMAA 5D32A 2YW4A 1SFLA 1ADOA 3NQGA 1YLVA 3L65A 4NUWA 3U6WA 4L4MA 3G0XA 2GJNA 1F73A 2Y61A 5AHFA 4IMCA 2V8ZA 3NZRA 2C16A 3GLCA 1PHQA 3FEMA 3W74A 3G1VA 2PCQA 2VENA 4NJGA 4PH6A 1TYGA 1MSSA 4N6EA 4NZFA 3HMJG 4RZ6A 1W8SA 5D33A 1P0NA 1EP1A 4S1FA 4X9SA 3S1XA 4JTEA 2CU0A 2X1UA 2G95A 5HWJA 4JR5A 3RF9A 2A6NA 5T26A 3E02A 3LCXA 1VYRA 1HG3A 2XN2A 4TU1A 4Y96A 1G4PA 5DY3A 4O1AA 1SSGA 2ZZ3A 3A22A 4YCOA 3LGEA 1DOSA 1SO5A 3UY8A 3DFTA 4LTSA 5AYXA 4LC6A 4Z1DA 4FX6M 4NNBA 3EWXA 4QM1A 1O4UA 4RLIA 3BGGA 1J2WA 1M5WA 3P74A 1TTQA 3O05A 4LC8A 4K37A 3WJXA 1TMHA 4NNCA 5TBOA 4NX5A 2GQ8A 2CZEA 1W5NA 1C29A 3QMRA 1KFCA 2J9ZA 1B4KA 4KFNA 2UV8G 3EX3A 3NOEA 1FY6A 1KM2A 1DKWA 4JX5A 3IGXA 4JEQA 2BXVA 2ZZ6A 4E2BA 1LP6A 2ATSA 4QISA 4ML9A 1SR9A 3TJXA 3EXSA 1GVSA 1LLWA 1OX4B 4FHAA 4DXVA 3TFXA 3SFKA 2GJLA 4IPJA 5KTLA 3UZ5A 3B4UA 1SPQA 5KMYA 3UYCA 1R2RA 5E1QA 3C4UA 1DBTA 1GYNA 3MUXA 1PVNA 3UWWA 3KAOA 5DBUA 1FWNA 2J24A 4ZQOA 1GTEA 1TV8A 2ZA2A 5LSMA 4FNTA 1QO5A 5AYYA 3GKFA 4FNQA 2YZRA 1VJIA 3W7LA 4CLMA 2FIQA 4TR9A 1TRDA 1F7BA 1WA3A 1X1OA 4YWIA 4UFLA 1XM3A 1ML1A 1K7EA 4L4LA 1XDMA 5F2MA 1GZGA 1FUYA 3M5ZA 3CQ0A 3TQVA 4BR1A 3RLVA 5AC7A 3GXPA 4R33A 3P60A 3TSBA 4N9EA 4IPIA 4H4IA 3ANYA 5BMWA 2C19A 2VFGA 2RDUA 4YCPA 4AHPA 2DZXA 4CNNA 1OFPA 2NX9A 3EWZA 3LHUA 1LDCA 1RD5A 1JQVA 1AMKA 1YXDA 4K8EA 1MEIA 2ISSA 1K03A 1JCJA 3IIVA 4MJZA 4AAJA 3FKKA 5CKSA 2NXIA 3TW7A 1LBMA 5LHEA 4LRSA 3S5YA 3W1LA 2QCNA 4WY0B 1DORA 3HG3A 1DJQA 5EMUA 5AHMA 3TX9A 3GXNA 1YADA 2ZZ2A 1WBJA 1ZAIA 4LVGA 5I3KA 1HO1A 4IMGA 2V9DA 4Z1BA 3ZWSA 4WXZA 6TIMA 2Y7FA 3BG9A 3NG3A 4JTUA 1F6KA 4UR8A 2DP3A 2ZTKA 3W76A 2RH9A 3QQ0A 3WFAA 5BOOA 1W3IA 3C3NA 1HFBA 2PC4A 2VFFA 2Y88A 3WJSA 2AQWA 2BWGA 3VFLA 3GDMA 4ORMA 3GAKA 1UB3A 2A1YA 3I65A 4OGZA 1D3HA 3W7MA 3TJLA 3TXZA 1QPRA 5BW6A 1SZGA 4UC5A 5K9CA 3LXAA 4MY8A 3SJ3A 4ZQRA 5FEXA 2RHGA 5HJLA 2Q3OA 3W2MA 2VFHA 1NFBA 3T78A 4DF0A 3UNDA 3W70A 1OF8A 1H7NA 4UTHA 3RU6A 3T44A 3KVLA 3W75A 2VC6A 5F1UA 3CTLA 2FQIA 3LHTA 3LXCA 2AAMA 4RZ4A 2VEPA 2QEZA 3M16A 3QRHA 3NL3A 4JTIA 3PUDA 5BRBA 3GK0A 3RMJA 1TPB1 1OYAA 2C13A 3P81A 5TIMA 2Y62A 2ZRVA 2P10A 5EL1A 3Q94A 4S2BA 2CZDA 2J9XA 5U7SA 3OHIA 2WQPA 3BARA 3L0NA 1BEUA 4WUIA 3CHVA 4BI5A 1QOQA 1L6YA 3UWVA 4G1KA 4IOTA 5G2HA 1VPXA 3Q2DA 2TSYA 5HMSA 2Z0IA 4YLWA 2RDTA 2NX1A 5CZ0A 2CLKA 5D2XA 1KTBA 1Q45A 5G1YA 4AHQA 1VRDA 3QC3A 1JULA 1FCVA 4UMCA 1BWLA 1GYLA 3GNNA 4CCDA 2CLHA 2JKAA 3NVTA 2E09A 1G67A 3KVKA 3PM6A 4I9AA 3NZ1A 4UFMA 5L9FA 1FCBA 1Y0EA 4UFKA 3L5LA 3SSJA 3F1QA 1OFRA 5CSSA 2QKFA 3PBWA 2CLIA 4JDYA 1OYBA 1TV5A 4HSOA 1GPWA 1Z42A 1YYAA 2HS8A 4UIOA 3W7DA 3HPZA 3O63A 1R47A 4FNSA 4A3UA 2G97A 2HS6A 2LLEA 1GWJA 2WO5A 2E5BA 2TPSA 3A9IA 5LNRA 3K30A 3S1WA 5CZJA 4WOZA 3MHUA 3U8GA 2GOUA 1WYIA 3E49A 1A50A 1Q6RA 5EY5A 4I7UA 4CCCA 3BGJA 3MWAA 5AHLA 4O17A 3B05A 3W84A 2V2DA 3N9SA 1H63A 4O8RA 3EKLA 1TO3A 3T40A 2H3DA 4E0CA 4UTTC 4DEFA 4DPQA 1MZHA 3LRKA 3TXVA 4JD4A 1TREA 4QJ1A 4FX7A 1DQWA 1GVQA 1FBAA 3SECA 1H1ZA 3A23A 3TE9A 1H1YA 3S5OA 4IXXA 3O16A 4E38A 3VKJA 4UTIA 4LOCA 1YXYA 3UPWA 2B7NA 1VH7A 5FEZA 5CSRA 1TTPA 3W7PA 3IV3A 4UMBA 5HUOA 4O1BA 4N9BA 2IQTA 3W7EA 1OG0A 3CEUA 4RKAA 4WD0A 3VE9A 3C2VA 4FXSA 3CT7A 4MZYA 4Z1AA 1PV8A 3BPWA 3HPXA 5SWUA 2A7NA 1SZEA 3NGJA 3ZWTA 1CX9A 1ZJIA 2W79A 4NJIA 1QAPA 3OBKA 4O1CA 3IVSA 4PTNA 3N3MA 2CZ5A 4LT9A 3P84A 3M44A 2GQ9A 3G1YA 1WV2A 1A53A 4FIRA 5C6MA 1OFQA 1IXOA 2YCEA 2JBMA 3DFQA 1GEQA 3QF0A 1SO4A 4IMEA 4ONVA 5DELA 3NM3A 1TPH1 3HIJA 4XBSA 3RNDA 3P8IA 5D30A 4AMAA 4BK9A 1FQ0A 1C9DA 3MHFA 4GJ1A 3JRKA 1AW2A 4N02A 1I2OA 4O19A 2HTMA 4N4QA 2YR1A 4FF7A 4OHQA 3W1PA 5AYZA 3OIXA 3W07A 2WOQA 1LM1A 2V82A 3S5NA 3W2JA 1L2UA 4O0KA 5D2WA 3MI6A 3GDKA 1T99A 3E9AA 4ICNA 5U4NA 3GZ3A 5AHNA 1ZENA 1TTIA 1QDSA 5HWNA 1R30A 3NAVA 4M6QA 3H55A 2ALDA 1ZY9A 2ZBTA 3GAYA 4GE8A 3NNTA 4RK8A 2NZLA 1XI3A 3GX9A 1K8YA 3QYQA 1LTDA 5D2YA 3VE7A 1FWSA 2QCDB 3EKZA 3HPSA 4RR4A 3BV4A 3BLEA 3W1TA 3P8JA 4HPJA 3GR7A 3S1UA 1PL9A 4MPQA 1KA9F 1KBJA 3LM7A 3R2GA 4FEZA 3W71A 1F6PA 3QM3A 4GC4A 3OVPA 1PS9A 3M0ZA 5F2GA 1FX6A 3VI2A 2A7PA 3G0SA 3HJZA 4A2RA 3B04A 2FPYA 2ZRZA 3OG3A 1AL8A 3W72A 5CGQA 4H6KA 3T4CA 3PS7A 4ZQPA 3Q37A 3HGOA 1VCVA 1GTHA 2V81A 3S1VA 3N34A 3P80A 4IXHA 2DU2A 2B7PA 1W56A 3S6DA 4NQ1A 3M6YA 5C54A 1FDYA 1RR2A 2W0UA 4RZ5A 4O1DA 3UZJA 3E0IA 4WOQA 2Y85A 3W7JA 3MJYA 4CQ9A 3HO8A 1GVRA 3HGJA 1UBSA 5D04C 1OK6A 2DZPA 2X2GA 1E51A 1H7XA 2VFEA 4FB7A 1N8FA 1ALDA 3S9YA 1OHLA 2B7OA 1KFKA 3L5AA 3PY2A 1KW1A 3FA5A 1UUMA 2JGYA 4U4MA 1XBVA 3M5XA 2V2HA 2C0AA 2ZZ1A 3MP4A 2EGZA 3UXAA 1YTKA 2H90A 2CLMA 4GWEA 1FCQA 4MVAA 4UTWC 4HNVA 3IVUA 4HNUA 1S3HA 3O1NA 4JX4A 5K3VA 4N2YA 2ZFAA 1TPC1 4UNKA 3I7RA 1VQTA 1IGSA 2HSAA 3PSVA 4PL2A 3DHDA 5A5WA 1MXSA 1VGAA 2EKCA 4W9TA 1DHPA 1PCKA 3B06A 1O95A 4GRSA 1TQXA 1OK4A 5LNWA 1GT8A 4BI7A 1G69A 5DCEA 3WJZA 1WX0A 3HG2A 3W1XA 4X22A 2CW6A 3G1DA 2TMDA 4K36A 1RQEA 4NZJA 2EPHA 3PB0A 1YDNA 3WK1A 3W7GA 5TQLA 3GIYA 3MMTA 2Q8ZA 1PIIA 2YDAA 3DXIA 1QO2A 1K7XA 5LNUA 2ISVA 1ZCOA 2Y7DA 3DBPA 3FYOA 4EOUA 4JIQA 4FNUA 4RV8A 3DKJA 1I45A 1LRQA 3OVRA 3R12A 1LRTA 1QNVA 1EWDA 2ZZ7A 4ZZ9A 3PG8A 1AL7A 3BO9A 1SZNA 2Y7EA 3H54A 3PVFA 5KZMA 2ZTJA 1A5AA 3G0UA 3G1AA 5FF0A 5FI8A 1VCGA 1OFDA 4JS3A 4MIMA 3W7KA 1JQXA 3TFCA 5I3JA 4XWUA 4FNRA 2PURA 3LRLA 1XBYA 1TCDA 5CPLA 2PRMA 2ZRUA 3MP3A 4HNNA 5F4XA 2G96A 4KWWA 5KITA 5AC6A 1S5TA 1IF2A 4R53A 2A6LA 2E5DA 4HPXA 1ICQA 4JTTA 2YPIA 3L21A 1TPWA 1HTIA 1VC4A 3H53A 3N9RA 2R91A 4ALDA 3TMQA 4N4PA 3ZFHA 1VHNA 3R5EA 2ZA3A 1P0KA 1WDWA 3L9CA 3N19B 3T7VA 4O18A 3EWBX 3UD6A 2AGKA 5F4SA 3OVQA 5DXXA 1TV7A 2YYUA 4PFMA 3QMSA 2Q3RA 3UY7A 2ATMA 2VXNA 4JDBA 2WSRA 3A5VA 1I2RA 3O6CA 4JY9A 3C52A 8TIMA 2Z6JA 3F4NA 3QSTA 4M6VA 1XL9A 1VS1A 2YFOA 4O50A 5AC8A 3SGUA 3L67A 1QFEA 1U83A 5AHIA 1NF7A 4UTWA 2W6RA 3P67A 1SW7A 2A2IA 3NPWA 3P61A 2V5LA 1T0OA 4POCA 4GFSA 3FFSA 3C61A 3BG3A 4RCXA 4UMAA 1H60A 1H5YA 3NQCA 3HG4A 1VZWA 2PE4A 4O4WA 5G2IA 5D37A 1KM1A 3O07A 1X6UA 3BW3A 3FYPA 3Q58A 3STEA 2ABAA 2EF9A 1DJNA 4EVZA 4WX2A 1TPUA 3L66A 1TB3A 1JUEA 1PHWA 2F84A 3O6DA 1O94A 3KHJA 3LCWA 3W2KA 1RZMA 1R46A 2YW3A 5C5YA 4PA8A 2XN0A 2C6QA 1G4TA 1GG1A 2J9YA 3G1SA 5D05A 1W5PA 3A5FA 4OV9A 3IRDA 1ME7A 1RQHA 3AO0A 5HWMA 4XQ6A 1I2QA 5DY2A 5K7JA 3LCIA 4UFHA 3MI2A 2E68A 3IVTA 3GYEA 3I68A 5BNKA 1A5CA 2QUUA 3C2RA 1RPXA 3QZEA 3KVMA 4EIVA 5EYWA 1ZNNA 5DBTA 4M5PA 2R14A 3PAJA 2RFGA 3L0GA 4O11A 4GUJA 4JTLA 3MI3A 5I3FA 4NJJA 3W2UA 1VLWA 2E77A 4MZ8A 1HL2A 1M7OA 3KOFA 4JTFA 2HMCA 1K7FA 2KZHA 3HGSA 4NU7A 5FEPA 2VOMA 1SZFA 1H61A 3DFNA 3N14A 5D2VA 1NVMA 3EXRA 4HT3A 4AH7A 3W2NA 3TAKA 4C1LA 3KVJA 4YL2A 2QJHA 4DBEA 3TDFA 4XKYA 1YXCA 3W7QA 4UTLA 1W5MA 5I3HA 4KFPA 2WNQA 2DZWA 1O5KA 1KBIA 1RV8A 3LI0A 2JK2A 2WSQA 1EIXA 3GVGA 3G3DA 1XUUA 1KFLA 3GDTA 4Y6GA 4O52A 4Q4KA 4FX8A 1EUAA 3MBFA 5HINA 3G8RA 2YSWA 5LGZA 2QCMA 3TSDA 1D9EA 1XUZA 2GQAA 1TPDA 1FCUA 1HO4A 1WBHA 1XXXA 1UJPA 3JS3A 3CU2A 3USBA 4FO4A 3FLUA 4GUFA 3M43A 1QWGA 3FJLA 4RJEA 1IXQA 2D73A 3D0CA 5IBXC 1J4EA 3NPUA 1FXQA 4XZ9A 2WPBA 1A5SA 2BLEA 1XBZA 5DCBA 4BFAA 2OX1A 1AW5A 3P5ZA 1SW3A 1LOQA 3RK8A 1S5VA 4CQ8A 1W5QA 5LHFA 5A8GA 5FF2A 2QCGA 2NUWA 4JTHA 4U28A 1MEWA 4DO5A 2PRHA 3W22A 4QNEA 2QAFA 3DI1A 4Y90A 3M1ZA 1B3OA 3PUOA 3SGZA 3GDRA 4M6PA 4IQLA 3B0VC 4JYFA 1JRCA 3LTSA 1OJXA 4O57A 5CG7A 1K8XA 1VYSX 2A21A 1XFBA 5D09A 3EEGA 1G6CA 2NWSA 4DO4A 4QNWA 4MY1A 3OA3A 1EPXA 1QCWA 3N2XA 2Z2UA 2QCHA 1LOSA 3KXQA 4NJKA 2I9EA 1WOBA 1ICPA 3FKRA 3NQMA 4RXGA 4UXDA 2YXGA 2WNZA 1M6JA 2P1FA 1Z44A 4O28A 3NA8A 1JCNA 3TQKA 1L9WA 2C18A 2C3ZA 3G1FA 5FESA 1N7KA 1EWEA 2RKXA 3KRSA 2OT0A 1LBLA 5K2ZA 3PF3A 1HUVA 4WJEA 4OT7A 2DZTA 1GVOA 3LOTA 3EX6A 3W83A 2WJZA 5FF7A 4K7VA 1Q6OA 4TIMA 1ZALA 2QAPA 1G7VA 1LZOA 4LV9A 3W9ZA 2XN1A 1BTMA 3L0KA 2FB2A 3HOJA 4X2RA 1M7PA 5L6UA 1JUBA 4HNTA 3W1UA 1KV5A 4R7JA 2TYSA 3NO5A 3CLMA 3R13A 2QCEA 2VFIA 3PBUA 5D02A 4N9DA 2JGQA 1W54A 2QUTA 5CPOA 3TC7A 2FTPA 1OYCA 3BW4A 2ZZ4A 3TROA 3FJ6A 1W31A 5DXYA 4O0ZA 4B5NA 3PSWA 1R2SA 3V75A 2R8WA 4QSHA 4JY8A 3UWYA 3VNDA 4ADSA 3PBYA 2GVJA 3WK0A 3NQEA 4Q32A 1PE1A 1ONRA 4DF2A 3W73A 3PULA 4QITA 1TJPA 5HUPA 4QAIA 1SUXA 4A2SA 3MHGA 2TRSA 4QQ3A 4ZVJA 1OFOA 3I7SA 2ISWA 1O60A 4JTJA 4ZQMA 1FWRA 4XTDA 1LBFA 5IBXA 2CLOA 5F1VA 4WQ6A 3TSMA 1JRBA 4UTUA 3CWOX 3HGRA 1IIHA 1OABA 2VEMA 2Q8LA 4A29A 1H7RA 4O10A 4DQWA 3W2LA 3CB8A 1TPVA 3W3OA 3EWUA 3NL5A 1LCOA 2VKZG 3QH2A 3S8HA 1A5BA 3CPRA 2X1SA 3PWAA 1ME8A 3DENA 4LVFA 2NV2A 2ZRWA 1OFBA 3LDVA 4LVBA 4LU0A 1MO0A 3TW6A 1Q3NA 1QR7A 4XUGA 4UTTA 3BLFA 1F2JA 4HHPA 2VEKA 2R94A 4K39A 5FF4A 2CFFA 4Z1CA 5AB3A 4O14A 2ZYFA 3IIOA 1TRIA 4O15A 2C15A 2ZZ5A 1XC4A 3FOKA 3R8RA 4EWND 4AF0A 1W1ZA 2VEIA 2WSYA 1H7PA 3EX1A 3M9YA 3TK7A 5J5DA 2F7FA 5E93A 4MLJA 3R89A 2EHHA 2A5HA 3LCFA 3SY5A 5D03A 3LLFA 1O5XA 1SSDA 3STFA 2ABBA 4NJHA 5F4WA 4AWTA 1IXPA 2XFWA 1OX4A 4O16A 3TMLA 2YFNA 4OU1A 4S2CA 2OT1A 4JYDA 4NX0A 5H2ZA 1BKSA 3MYOA 2PRLA 1RQBA 1Z48A 3IGUA 1LORA 3C2OA 2E1DA 4MYAA 3W23A 2CLFA 1L6SA 4CNPA 5DN1A 1KM6A 1YTEA 1W5OA 4NVTA 1F74A 3ATYA 4O4VA 4NXSA 3IIXA 5CPMA 1F76A 1UCWA 5KINA 3M5YA 3S42A 3SR7A 5I3IA 3EXTA 4LS0A 4M19A 5CPNA 2DJXA 1CI1A 1AW1A 4DO6A 2J27A 2OJPA 3LTYA 1TTJA 4EF8A 3LV5A 4Z0JA 4GUGA 1H7WA 4J9JA 1L6WA 4MYXA 3E12A 4LS1A 2A85A 3DH7A 4N6FA 3LHYA 3V1PA 2JKPA 4YMZA 3LCHA 2G5WA 5G4EA 5D38A 2O7SA 1OF6A 4LVDA 3LB0A 3B0UX 1QMLA 1S5WA 4PCFA 4AHOA 4PL1A 4LV4A 4MKNA 3NQ7A 2Y70A 1QPOA 3TQ0A 4LWWA 1SU5A 1JCXA 4UFIA 2Y6ZA 1OX6A 4DF1A 1FDZA 3BLIA 1KM4A 1SQ7A 3LLDA 3IIZA 2NXGA 2DZVA 3CM4A 5G1TA 1DV7A 3GR8A 3LXBA 1UUOA 2B7QA 4LVAA 1SO6A 3EWYA 3NL2A 1QOPA 4JTGA 2BSLA 2P0OA 3DZ1A 1KFJA 4UTJA 2OCZA 4WY0A 5AOUA 2FFCA 3SIZA 5K9DA 1YPFA 1NSJA 4IGHA 1JUKA 4JICA 4LS2A 5G2WA 3MW7A 4NXKA 3G1HA 1TJRA 4AF0B 2Y89A 4NNAA 3UWQA 2V5BA 2C1HA 2X1RA 1P4CA 3HB9A 4UFJA 4YXGA 4JXCA 3GNDA 1QPQA 1OX5A 2A7RA 1RVGA 4HN4A 1WQ5A 4IMFA 3LTPA 2E6DA 3GB6A 1VCFA 3L68A 2ZA1A 1Q6LA 4PEKA 1H51A 3CIWA 1PCWA 1KLYA 3OEXA 2BTMA 6ALDA 1G7UA 1X7FA 2QF7A 2ZRYA 1J5TA 2FLIA 1I2PA 1WOAA 4OV4A 3S0CA 3WK2A 4Z08A 2DJLA 3G24A 4IUOA 2YX0A 3W7IA 2NLIA 2EAWA 4FXRA 3S5ZA 3G3MA 1ZAHA 3KRZA 2QCCA 2I14A 2VELA 3QPYA 3DAQA 4A22A 2WV8A 1NF0A 1GQNA 3NQFA 2B4GA 5HQEA 4LRTA 4KWVA 2DZSA 3ZS4A 1EB3A 4BWLC 3TUUA 3LCGA 3C2FA 4TMBA 3PG9A 3ATZA 3LBMA 4WXYA 1P1XA 2J88A 5H91A 1V7YA 3HBLA 2C14A 2E5CA 4JNMA 2H8XA 3QSRA 4XTIA 2OZ0A 2CLEA 3PBVA 2A4AA 4MZ1A 2Z1BA 3GKAA 4OWGA 4BI6A 3UQNA 3CEPA 1KFBA 3QFEA 5DCDA 1F05A 1EA0A 3WJYA 1GG0A 1Q6QA 5LGXA 3QPZA 1EX5A 1K8ZA 1XBXA 3GDLA 3KRUA 3M41A 4OE7A 4H3DA 4DBDA 2VFDA 3ZR4A 4I7WA 2CLLA 3TCEA 3KFTA 2Y7GA 4MY9A
chains in the Genus database with same CATH superfamily
2HNHA 1UOZA 4J3VA 4UNLA 1NH6A 4I7VA 5LZLA 1R8LA 2R24A 4RX0A 1V5XA 5HDRA 3WF2A 1LLZA 1V6UA 4ZOCA 3W0KA 2NT0A 3K4DA 3FIGA 4OQVA 4MFEA 3U2OA 3IUHA 4W5ZA 1GPFA 4B92A 1VR6A 4KCTA 4EF9A 4AVFA 4J3XA 3MUZ1 1EXPA 4FMVA 1JDDA 1V3HA 4C6DA 3NPXA 3G18A 2PDHA 4LNYA 4NZ1A 4Q7NA 5HJXA 1JR1A 1SO3A 2QS8A 3OP2A 2NX3A 2WMGA 1W9DM 1K8CA 1WCGA 1HVXA 5A6JA 4W7UA 1M9HA 3A24A 3VTRA 4Z0SA 2A0NA 4LW7A 1VYPX 3WDQA 1KV8A 1D8CA 2Z6IA 4A3YA 1P0BA 5AN7A 4J4KA 2WC7A 3V16A 1MEHA 3E5PA 3N2OA 1ZFJA 1XDLA 3SN4A 1UW9A 5LA1A 4HK6A 1TKKA 3MSGA 1KM5A 1CYGA 4O53A 1JEZA 3TKFA 3VU2A 3WLRA 2QULA 4A21A 5I0DA 1S2CA 3WIJA 4ADUA 3TQPA 1PWLA 1UWUA 2WK2A 5FJPA 4S3JA 4PN2A 2J7HA 4ZQNA 1PBGA 1VBUA 2I5IA 4CCZA 1THFD 2ZKMX 1JJKA 3VDHA 1BKHA 3CXOA 3QOKA 3AMLA 4HZ8A 2O7QA 4WK9A 1Q4NX 3R4IA 3K46A 4PR4A 1GK8A 4FNPA 2QDGA 3BV7A 4DPPA 4D6EA 3PAOA 1W32A 3I7QA 3EKGA 2XM1A 3LI1A 4JL2A 4Y9AA 3W29A 2HZGA 3O15A 4R7WA 3W27A 3AMDA 2VNCA 1OSEA 5AFDA 1XKYA 1ZAJA 1AJ0A 3DU0A 3RO6A 1DL3A 1B9BA 2XSAA 2EJ1A 3WUGA 3GIQA 2GSEA 1IYXA 4CQAA 2NQ5A 2BZNA 4YYFA 1FHDA 1W9UA 1M01A 3B0PA 1GOXA 3H2FA 4JFSA 4Q33A 3VMNA 1MRAA 3H23A 4XKYB 1VHCA 3GG7A 1Q6FA 2ZCGA 2WVSA 3BVJA 3GH5A 3OZOA 5BXPA 1CB2A 3GFYA 2V0TA 3LHWA 4XZNX 1JPIA 3R11A 4F0HA 1P6BA 5HMDA 2FVMA 2VVNA 2CWNA 5K9XA 1R7AA 3OYXA 2VQTA 4PCPA 3MVIA 4LEQA 4Q6JA 1D3GA 4IIGA 1EDQA 3AMGA 5REQA 1T96A 3A13A 3O6YX 1SZRA 2Y8UA 3HQ1A 4WDUA 5FEWA 3NGFA 1P5BA 1K3UA 4ORIA 4FIQA 4GXMA 3TC6A 2IKHA 3VNKA 1NOWA 1GVYA 1JCMP 3TLLA 4MWAB 1LROA 2J6XA 2WW5A 4HYWA 3CAVA 2CEQA 3H7VA 4KGLA 4Q8MA 1J9YA 4JGDA 5D9MA 1UWIA 1BG9A 4ZTYA 2E9MA 2NXHA 1IZJA 2WNNA 4GUIA 5LNVA 4RE2A 3SW6A 4HNLA 1C90A 2PFHA 3NOYA 5CZTA 4AB4A 2G3FA 3G22A 1TIMA 2C0HA 2ZX9A 1FHVA 4LFYA 3NL6A 3MO7A 4GUHA 4HPHA 3W88A 2WCAA 2QDHA 5FF3A 2HISA 4H19A 5I02A 5J04A 3C0SA 3FXGA 4TX6A 3PJTA 5AC5A 3TR2A 4GIEA 1C8VA 2DVXA 7TIMA 3BQ6A 1EP3A 1R3RA 5HR7A 3GFZA 4DI9A 5HNUA 3NDOA 5EPDA 1B4EA 4NZ4A 4A05A 3AZSA 2Y63A 1TSIA 4X9YA 3WQDA 2I57A 1H50A 3N18A 1HKMA 3TIMA 3W6MA 4ZSTA 2Z29A 2E4TA 3QQ1A 3DKLA 1UWAA 4JTSA 4ZB2A 3W7HA 3CWHA 3CO4A 2GUUA 1G4SA 3W86A 3RFAA 1A5OC 3W85A 4IFKB 3THAA 4AWSA 3W7OA 3LGDA 2WM1A 1FH9A 1AK5A 3GD6A 3M47A 2OMAA 3S9IA 2WJFA 3L65A 4NUWA 3U6WA 5BXTA 4LB3A 4JKLA 4S3DA 4KRTA 2GJNA 1NU5A 2QMKA 5AHFA 3WBEA 1UYQA 2V8ZA 1EGMA 4QDMA 3GLCA 3H2AA 1E3ZA 1K9DA 3IS4A 4DN1A 2W67A 3MKKA 3MDWA 4US6A 3GE7A 4L64A 3GY1A 5EMLA 3TZNA 4N6EA 3HMJG 2P0IA 4EXQA 4O0QA 5D33A 4GLEA 4IG2B 4CN4A 1A47A 4X9SA 4JTEA 3GWQA 2X1UA 5HWJA 4FOJA 1L8NA 1KCKA 1OQFA 3NYDA 5T26A 3E02A 4E3TA 1CTNA 4UQCA 4Y96A 4O1AA 1KRCC 2ZZ3A 3A22A 4UWMA 4YCOA 1DJIA 3LGEA 4NILA 1DOSA 3BAXA 2J47A 1EZWA 4LTSA 5C7VA 1GVIA 2I16A 4Z1DA 4FX6M 1K4GA 4NNBA 2AL1A 4RLIA 2WWCA 3WQEA 1AJZA 3O05A 4K37A 5HA7A 4GOAA 2RAGA 3QHNA 4NNCA 3DC0A 3GHTA 5TBOA 2GQ8A 1QWKA 2CZEA 2G8ZA 4PCTA 4JIHA 3EMQA 4L5ZA 4KEZA 4IMAA 1ZJAA 4B5TA 4XIAA 1QHPA 1XLJA 3IGXA 3F5KA 4JEQA 3FGCA 3UXIA 2ZZ6A 2GGGA 1FWFC 3POHA 2ATSA 3OW1A 1WZMA 1OX4B 4FHAA 2DPEA 1W1IE 4IPJA 5KTLA 3WF4A 1JNDA 3V3WA 1DBTA 2O4MA 1VEOA 1FWNA 1K9FA 2J24A 4MDOA 1TV8A 3BURA 1XIMA 1W6TA 2WZMA 1GKRA 2ASHA 1VJIA 3VNJA 1WE5A 2XH0A 1XSIA 2E9BA 2FIQA 2BOGX 2ZX8A 3AS1A 1WA3A 2Q01A 3WDJA 1XM3A 5F2MA 3GG8A 3F5LA 5C71A 1FP8A 3EZ4A 1UD4A 4OECA 2HBVA 4JFVA 4BA0A 3ANYA 3OLIA 2RDUA 4YCPA 1OD0A 1MEIA 3AIUA 1PWMA 4GG9A 1EO7A 3C8NA 5CKSA 3TW7A 2HDJA 2VUYA 4Z2KA 5BU9A 1NOFA 4HK5A 4WKAA 4QG9A 1DORA 5EMUA 4FAMA 3ZMRA 3R58A 1UR1A 2XDFA 5AVNA 1HO1A 3FVMA 3K8LA 4Z1BA 4QRNA 1F6KA 3S2JA 4ERAA 3ARXA 3W76A 3WFAA 5CC7A 4FALA 5JVLA 4GZ7A 2PC4A 1XG3A 3VFLA 1JZ7A 3GDMA 3GAKA 5FIPA 1V0MA 3OGRA 3TXZA 3VZXA 3QYSA 4UC5A 3LXAA 4YS1A 5JBFA 1Q6EA 5FEXA 2RHGA 5HJLA 4AQLA 1E56A 3N6HA 1XF0A 1DTUA 3H21A 4UZUA 3T78A 3W70A 4QS6A 5ECVA 3QLLA 1Q7ZA 4UTHA 1DQUA 4WLCA 1YBQB 1RK5A 5IHRA 3V5CA 1BAGA 1JXJA 4RZ4A 1TX0A 4N0RA 3QRHA 3LQGA 3WMBA 5BRBA 3GK0A 3RMJA 2DH2A 3NCOA 4HA1A 2V3FA 2WQPA 4TVCA 4WUIA 4RPQA 3UWVA 3GG0A 1GOKA 3Q2DA 5HMSA 3BLKA 2YOCA 3VOJA 2QVNA 4YLWA 5H8PA 3EDEA 2WVUA 3LPFA 2RDTA 2EO7A 4JKKA 1RBOB 4GIRA 3QC3A 4J3WA 2PDXA 1GYLA 3GNNA 2CLHA 1EC8A 4WEVX 5FAJA 4I9AA 2AMXA 1UROA 1K6AA 3NZ1A 4UFMA 4AZCB 3SSJA 2R1NA 3TYEA 2YJQA 3OLGA 4XKMA 4JDYA 4HSOA 4IT1A 2HV5A 1VENA 4UIOA 3HPZA 3R10A 1R47A 3RJXA 2E8YA 2W91A 2TODA 3WLLA 1HKKA 3H2OA 4AIEA 2HS6A 2Q09A 1E6SM 3TJIA 2J62A 1BYBA 2XYLA 3GUGA 1JZ8A 2GOUA 2BGSA 3GW0A 3WQPA 1Q6RA 4CCCA 1XYZA 4TVUA 4O8RA 2H3DA 4WIWA 4YWSA 4E0CA 4TXEA 1TREA 2X7VA 1Y7VA 4QJ1A 1DQWA 3KWSA 3MQTA 5D9NA 1H1ZA 1V08A 4IXXA 1XV8A 4B5VA 4JIEA 4UTIA 3KCJA 3PWGA 3UPWA 2B7NA 1VH7A 3IV3A 4UMBA 5HUOA 3WLNA 1RCOB 1UWRA 5HJYA 1DWIM 2IQTA 4CU6A 3IUDA 3T0DA 1OG0A 3WQGA 1E73M 1ELSA 4UQEA 5RUBA 1JYXA 2Z00A 3CT7A 3KWXA 1TG7A 3IARA 3JZUA 5SWUA 3VA8A 3AYSA 2I9UA 1QAPA 3M46A 1YX1A 3M44A 1C92A 2HK1A 1WV2A 3GTFA 1UPPA 2O0TA 1E72M 4FIRA 1IXOA 2YCEA 3ZR6A 1XIDA 4LAMA 4P8VA 2WCSA 4IMEA 1EXBA 1TPH1 1M3UA 1X8CA 3HIJA 4XBSA 1G01A 3RNDA 3AHYA 2MANA 1GEHA 1C9DA 3DHPA 3MHFA 1US3A 1M65A 3WLOA 2CC0A 4FS9A 4S3FA 1FFQA 2P5NA 4Y9NA 1W3JA 4WSJA 3OIXA 3W07A 3W4RA 3WKZA 1L2UA 3O0KA 2D23A 4RDVA 2Z2BA 3CGTA 3DYPA 4GCAA 5AHNA 1ZENA 3VKCA 5HWNA 3OGVA 3CYJA 4RK8A 1W1YA 2NZLA 5FOOA 3UJEA 1K8YA 1KXTA 4H2HA 3GFXA 3QYQA 5D2YA 1EJSC 3HPSA 3RX4A 2J66A 3BV4A 3K2GA 3W1TA 4XO6A 3P8JA 1EDTA 3GR7A 3S1UA 5EU9A 4P7QA 3CUHA 3QM3A 3LLXA 2RUSA 5F2GA 2F6KA 2ZRZA 3GIPA 3OG3A 1AL8A 3T2QA 1IT7A 4A6GA 5A8QA 3T4CA 3WY1A 1QW8A 1VCVA 2OTDA 2V81A 1WXYA 3S1VA 4J35A 3RXZA 1F3XA 2DU2A 3PPCA 2B7PA 5XINA 4L1WA 5REQB 1KWGA 4W7VA 1BGGA 3MA8A 2W0UA 3UZJA 4O1DA 3E0IA 4H7VA 4CQ9A 5D04C 3RPMA 1E51A 1H7XA 3ME3A 3UF9A 3KCLA 3B97A 3GW3A 4B91A 2FZ9A 4GQGA 1KBKA 4IPPA 3APTA 3T8LA 3D3FA 1Z9AA 3FA5A 2G41A 3VD4A 4F40A 1XBVA 2V2HA 3VC5A 2H90A 1XQLA 4GWEA 4WSHA 4AVNA 3H6OA 4GYKA 3KBSA 4ZO9A 2ISDA 1EJWC 4HNVA 3L4XA 2XIOA 3D46A 4F8XA 2ON3A 3KOZA 3E5BA 4J3UA 4MMWA 2HSAA 3ALGA 3BCJA 3DHDA 4AISA 5C0QA 5KETA 1OEPA 2HVNA 1PCKA 3B06A 1TQXA 1OK4A 5LNWA 1GT8A 1G69A 5DCEA 3AC0A 2PDKA 4QP0A 4PUJA 4DIAA 3W1XA 3MSRA 3I4KA 4US5A 3V5OA 3UXLA 5A8OA 4QLKA 4YHGA 1IEWA 2EPHA 3CZGA 5FSEC 4GFIA 4JN7A 4N7QA 5GNXA 1EFZA 3W7GA 3ZVHA 3MMTA 3B8TA 3CB3A 4ATDA 3NVDA 3VNLA 5LNUA 1E70M 1E0UA 2ISVA 5I03A 1Q7QA 1LL6A 1A80A 3WH8A 4RV8A 4QGCA 3LGGA 4GJIA 1KR0A 1LRTA 3SCOA 4MB4A 1Z3NA 3BO9A 3H26A 4AFYA 4GQRA 4B5WA 2G4JA 3G1AA 3FAXA 3SQSA 5IOBA 1JQXA 3MMUA 4M82A 2VURA 2E7FA 4QG8A 1US0A 2GZXA 4FNRA 2V3DA 5D8WA 3BLDA 4HCLA 2PLKA 4HNNA 1R3VA 1XSKA 4Q8NA 2HWGA 4HPXA 3L21A 1VC4A 3N9RA 3MSYA 1VHNA 2Q71A 1PTDA 1GZ1A 3T7VA 3WQ4A 5DT5A 2AGKA 5F4SA 3T2PA 3CL7A 3OVQA 5DXXA 4PFMA 3QMSA 3CZJA 3ZR5A 4HNOA 2O56A 1UC5A 4I8DA 3FA4A 1E6XM 4DUXA 4M6VA 2YFOA 3SGUA 1QFEA 2CNCA 5D9PA 1E6QM 3BLLA 1NF7A 2WC4A 3P67A 1SW7A 2QGHA 4JAWA 5XIMA 1UR0A 3CLWA 3NQCA 2OGJA 4S39A 5DT7A 3PN8A 3DCPA 3UVIA 4GNKB 3EB4A 2VCAA 5G2IA 5HMFA 4FLOA 4GY7A 3BW3A 4KQNA 2EPMX 4X0VA 2CBUA 2EF9A 1O66A 3IGHX 4B15A 4XSMA 4MAVA 4A8IA 3EWCA 1F9CA 3L66A 1PHWA 1RLCL 3WNNA 3THDA 3FGCB 1H41A 4PA8A 3URBA 1RA5A 3QTPA 4H9UA 3R0DA 1U2YA 3OG2A 2CYGA 1MVYA 1YNPA 1ME7A 4LX4A 1RQHA 2IW0A 3RUBL 5HWMA 2D3NA 5DY2A 4HA3A 3LCIA 1XIGA 3MI2A 5FSDC 3IVTA 5BNKA 3I68A 3VILA 2QUUA 4HPNA 3CZEA 1RPXA 2BNJA 3BTNA 3IK4A 4EIVA 4YU1A 2RFGA 4F2UA 4RUBA 2A79A 5I23A 2EPNA 1VLWA 4ZXLA 2E77A 8RUCA 2EEXA 3MKVA 3HZ3A 4H41A 4AZ5A 1S2TA 4NU7A 1RY0A 5D2VA 4HT3A 1GKPA 3UR8A 4MPKA 4YL2A 3Q4DA 1YXCA 2GLKA 3BOFA 3VNZA 3GBDA 1TWWA 2ZWYA 1XCWA 5I3HA 4DRSA 2OSYA 4G7EA 2WNQA 4KIRA 3GTXA 2CESA 1KKRA 4NHVA 4Q4KA 1LWHA 1NY1A 4Z2HA 1Q85A 5T91A 3LU2A 1Q6DA 4HNCA 3MBFA 4IQEA 3G8RA 4IHCA 5LGZA 4JBRA 2QCMA 3MWCA 2XGZA 1WBHA 1XXXA 1XS2A 3B8UA 1UMLA 3EPNA 3M43A 3VNMA 4Y2WA 3L4ZA 4QFUA 4RJEA 4W8AA 3VKDA 5IBXC 4XZ9A 4H6RA 4R5EA 4C6BA 2BLEA 1XBZA 4HPGA 1IWBA 4KWOA 3CV2A 4BFAA 4OTKA 1JD9A 3S2MA 5GPRA 4D6IA 3ZLHA 4CQ8A 1QNQA 5A8GA 4GVFA 1RK6A 4JTHA 2PEVA 3WF0A 5C2GA 2PDLA 2PRHA 3BMXA 5DMYA 3DI1A 1JL8A 2HE8A 3SUVA 3PUOA 4M6PA 2OR2A 3RR1A 3K1DA 1JRCA 4JYFA 3LTSA 5CG7A 1K8XA 2A21A 4RE0A 3WBAA 5HPOA 4DO4A 3BAWA 4DJDC 4QNWA 3OA3A 2G3NA 4PMJA 2EPLX 3OQEA 1GOOA 2CHOA 3KXQA 4GKLA 3PJXA 3NQMA 4RXGA 4UXDA 3P2VA 3IPWA 1OCNA 1WKEA 1JPMA 1XLCA 3NA8A 3F7JA 2C3ZA 5FESA 2ACUA 4D8LA 4QLJA 1EWEA 2R1LA 3T6CA 3AIBA 3KRSA 4JFUA 1LBLA 1YRRA 3GVRA 1Q65A 5K2ZA 1HUVA 2YCKX 1GVOA 3LOTA 3EX6A 2WJZA 2W3ZA 4O1EA 4HA4A 2PLMA 1UPMB 1CIUA 2A3HA 1BTMA 3CT2A 5L6UA 2F6UA 1JUBA 3E2VA 3W1UA 4ECLA 5GQBA 2EJAA 1J5SA 1TR9A 4BY3A 1U30A 4OKDA 5D02A 3EAUA 1W54A 2QUTA 5CPOA 4HP5A 3WLQA 1XIBA 3BE7A 2EPKX 3PBYA 4TTGA 1IHIA 4DJDD 4IFOA 4Q32A 4F2BA 1PE1A 1ONRA 5ABFA 4RDYA 1JDFA 4DF2A 1L0PA 3ITXA 1WAWA 1SUXA 3RLHA 4A2SA 4EAYA 3MHGA 4CNUA 3I7SA 4PUUA 4JTJA 3PTMA 1FWRA 1C8QA 5IBXA 1OM0A 4DYKA 1ISVA 4WQ6A 3WDIA 3CQKA 3CWOX 2QXWA 2Q8LA 3SY8A 4A29A 4NI3A 4BF7A 4O10A 4DQWA 1B3ZA 4Z2GA 2IPFA 3EWUA 1NTHA 3BJSA 3H2CA 4XD3A 3CPRA 3OTRA 4U5KA 3T9PA 2WB5A 4NAEA 4TTUA 1IT8A 5CJ5A 3VZYA 1OFBA 1KC7A 2PGWA 2I5QA 5LIKX 3ES7A 1SR0A 3RILA 1MO0A 2GDQA 3ZQ9A 5JQ9A 4UTTA 3CPUA 2IMRA 1LQ0A 3BCDA 4PTDA 1O5QA 2CFFA 4X61A 3S9ZA 1TRIA 1TV2A 4O15A 2VM8A 2OZ3A 3WH9A 2C15A 3UG5A 1F4HA 2IKJA 5CBBA 1XC4A 3MJMA 2GQ3A 2V38A 1DJZA 2WSYA 3EX1A 5FCZA 3TK7A 2PWEA 1J18A 1LQAA 3SGGA 3C3UA 5D03A 1A3XA 3STFA 5DO8A 4NJHA 5F4WA 2JEPA 4WRHA 4PUDA 4O16A 3RDKA 5E70A 1B31A 3M0IA 4OU1A 3CO8A 1PIFA 4NX0A 3ABXA 3WQVA 3IGUA 3WL1A 2E1DA 4BQ2A 1DIOA 3C0LA 3WNLA 2AGTA 2CLFA 3CZKA 4LALA 4LH8A 1W5OA 4K8GA 3ATYA 4O4VA 2XSBA 1JXKA 3S42A 5I3IA 3AXXA 1UP0A 2XSXA 2J7GA 4A8NA 3LTYA 1TTJA 3RITA 3LV5A 4Z0JA 3BZGA 1XD0A 2A85A 2ISFA 3DH7A 1RHCA 4V28A 4WJ8A 1XFCA 2JKPA 2G5WA 1S5WA 4PCFA 1HKWA 3U4FA 4MKNA 7REQB 3NQ7A 1HP4A 3TQ0A 3KUMA 2YLLA 1WZLA 3RPDA 3IAQA 1OX6A 2P88A 3LLDA 3QR1A 3IIZA 4DYJA 1DV7A 4AIOA 4PZVA 1M1BA 4PGLA 3AWOA 1QOPA 3UCCA 2VR4A 2P0OA 3DZ1A 2NQ9A 1MRQA 4EPEC 1S2VA 3S5SA 1QW7A 3SIZA 5K9DA 3LZ3A 1SVDA 4IGHA 1JUKA 1OT2A 4LS2A 5G2WA 2PP1A 3MW7A 3TTSA 1TJRA 4HBKA 4AF0B 4NNAA 2G0WA 3EA3A 4EPBC 3IJDA 4FK9A 2WBGA 2A7RA 1RVGA 3ALFA 3E0FA 4KEVA 3LTPA 1VCFA 5AC4A 4P5UA 4XB3A 1ITUA 1UH2A 1TA3A 4FXFA 1MDLA 1ZJBA 3NTYA 1YEYA 2QF7A 1J5TA 3L12A 2BVDA 4Z08A 4LYQA 1BG4A 2DUZA 1XIHA 3WQCA 1QI3A 1ZAHA 3KRZA 3AU6A 2I14A 2XZ7A 3SRFA 1GQNA 1HVQA 2B4GA 5JMUA 5HQEA 4BWLC 4MF4A 3CAKA 5CPTA 2Z1KA 5GNYA 4WXYA 3MB9A 4AIUA 1E4IA 3UJ2A 2BB0A 3MS8A 3L4WA 4DYEA 1V7YA 2EPOA 3HBLA 1X38A 3QSRA 4XTIA 4GI9A 3ZVHB 4LXFA 4BEQA 1W3LA 2REQB 3ISIX 4OWGA 3BWWA 1TWDA 2PDMA 1HKJA 1EO5A 3AI0A 2PDGA 3L7RA 1E6RA 3GDLA 5A2CA 4DBDA 2VFDA 3H7UA 2DQWA 4I7WA 4ACZA 3CPGA 2CLLA 2Y7GA 2R82A 1I6NA 3HTWA 3OLDA 3QW4B 1QXLA 4DXKA 2VRJA 1LOLA 3GTNA 4HIBA 3B03A 1ZTVA 1SFJA 3LHVA 3NQAA 1EP2A 1HP5A 1GONA 3EA2A 3PZMA 4S3AA 1W37A 4EPDC 1JGMA 2G50A 3T0AA 3RIKA 4D1IA 3U48A 2BHZA 2V3GA 3BW2A 2I56A 1RJRA 1W3KA 4AG0A 3JUGA 1DQXA 2XIBA 1MUWA 2BVYA 3LNPA 2X30A 2QDDA 2WC3A 1UA7A 4CN1A 3M0YA 4GISA 2E6FA 4EANA 4O12A 4C91A 4AZ6A 2X09A 3P5YA 2NUXA 4KFOA 2P3EA 1FOBA 1QK2A 2NV1A 5C2XA 3FJNA 2GVLA 1Z7AA 3PZGA 2HXUA 4ZOAA 4TO8A 1F5ZA 4B90A 4QROA 4UQAA 1FWTA 2HK0A 3W25A 1XIFA 4L9ZA 3UPBA 1OVDA 3OO2A 3N4FA 4PC8A 4BWLA 4OJYA 2JIEA 1ZL1A 2J4GA 3SQMA 3WYZA 2O55A 3CC1A 1QASA 2H3BA 1FWAC 1R3SA 1WPCA 3N3TA 1V3MA 5J5RA 2XH2A 3VCRA 3CQJA 2XH7A 4C6NA 4UCFA 3WQ5A 4MTVA 2QJGA 1DVJA 1ICSA 5ENLA 1S3TC 3DI0A 4AXKA 3W1RA 3U2CA 1YTDA 2L5HA 2FGBA 3H22A 1KFEA 4J7RA 4GI4A 2VHLA 5I3GA 2V6AA 2ZUTA 2CPUA 3AAMA 3P93A 1VLIA 1CEOA 1RJPA 1BF2A 1YIXA 4K1WA 2PD5A 4XD5A 1CNVA 3S6OA 1AH0A 4XZHA 4S3CA 3GXTA 1B3VA 2FVKA 1DIDA 2E6YA 2F38A 2PODA 3QJAA 2PSNA 4D72A 7ENLA 3L5MA 3WLPA 5D2TA 3WNOA 3MZ2A 5EMJA 5C55A 1W3NA 3AROA 3QEZA 4XBKA 1QT1A 3ABQA 4BQ5A 4I90A 3ZJ6A 1FWWA 3WELA 4PBGA 4D8AA 2NUYA 3UGVA 1OGBA 4F0LA 5DMLA 4IIBA 2BMBA 2QVHA 4W8BA 3C2EA 3WLJA 4DELA 1B57A 5I2UA 1R7OA 2YCIX 4WZHA 4U10A 3M64A 3N2MA 4W89A 2GPTA 4IWWA 5I24A 2RDWA 2DSZA 5K4ZA 3AUOA 1JGIA 4Q8WA 6A3HA 5DLCA 3EX2A 1WKYA 1I8JA 1OGGA 3GR4A 4X3ZA 5LKYA 2JEQA 4WDWA 3KBJA 1JCYA 5MF5A 2DIJA 3INPA 3AISA 3U2ZA 1HXJA 4IFRA 2HJPA 2YYTA 3QOMA 4I5UA 1EJUC 2FYMA 1WB0A 4AMCA 2DORA 3F03K 4JYEA 3BG5A 3TH6A 3W1QA 3HF3A 3BH4A 3A3HA 3ELFA 5E5CA 1ME9A 2DUAA 1KGXA 2O9TA 3CWNA 5E6ZA 4CUCA 2CKSA 5KZ6A 3P62A 3PNZA 7A3HA 2VOTA 2PTWA 1W1B1 3QBUA 1UR2A 2NQHA 3OOQA 4X0NA 3E96A 5HR6A 1D7FA 1R2TA 1E43A 1G4EA 1E1EA 5G4WA 2FPVA 3W6YA 3ZJ8A 3IGSA 1C93A 1EX1A 2NSXA 2FDSA 1UR8A 1U5JA 2DFAA 1XLKA 5HNRA 1A49A 1TPEA 3QY6A 1XH2A 3K1GA 2QCFA 4ZE5A 3DHFA 4IPNB 4MUZA 4S3KA 2B0MA 5H1WA 2XIMA 3YPIA 5AHEA 3HFTA 3G6MA 4E2DA 3M5VA 3KTXA 3QN3A 1OCJA 1PIGA 2GGHA 2W4XA 2H6RA 1A0DA 4M7SA 3VUPA 3CV1A 4V1YA 1M68A 3VD9A 1QW9A 1IXNA 1W0MA 5EBUA 4MLRA 1KM3A 4KCWA 3NZQA 1V02A 3V1HA 4UR7A 1ZBWA 5CSUA 4N9CA 1UASA 3WH7A 4MWAE 3C0QA 5PTDA 1GKQA 3WBWA 1W9VA 2D0FA 4O8AA 1FP9A 3MT1A 3MV11 3NO1A 3IEBA 3EB3A 1FWJC 3LNMA 3A21A 3O06A 4KCVA 2PGEA 4HU8A 1RAKA 3BCFA 2NW0A 1SFLA 1ADOA 1W2VA 1DJYA 1UWQA 3G0XA 1V0KA 1F73A 2WZTA 1MQQA 4DLMA 3EOSA 3N15A 4HOWA 1TV3A 1ZBCA 2FKPA 4IGSA 4AW7A 2FZ8A 1P0DA 1VFMA 5ABFB 3REQA 1KCZA 4INFA 2PCQA 5H6HA 3ICJA 1E9IA 4NJGA 2Z1WA 1OC5A 4PH6A 3G6LA 1TYGA 1TUFA 2D0GA 4H7CA 1T6MA 4GVHA 4FLQA 4Q4QA 3GHUA 3PBGA 1P0NA 4XAZA 1R3TA 3HQPA 3ARVA 4JR5A 1TFVA 4H9ZA 2E1WA 3BSMA 3LCXA 3O0FA 1UR4A 1VYRA 1HG3A 4TU1A 3CAWA 4YNGA 1E4MM 5I79A 2VZVA 1SSGA 4M81A 1D8WA 2Y24A 3UY8A 3CUFA 3DFTA 4LC6A 1H11A 1GHRA 4W4QA 4X2PA 2OB3A 4H8HA 1FWCC 1JPHA 1EGZA 2NVAA 3QZAA 3BGGA 3KTSA 4JNYA 1M5WA 1TTQA 1GNXA 4PTMA 1MXDA 2P8CA 4HYRA 4IIHA 1VFTA 3R0KA 1C29A 1KFCA 5LXEA 1B4KA 3DHUA 3W01A 3U0HA 3RYSA 3NOEA 2GFTA 2DH3A 2QJJA 2WVVA 3W81A 1MW0A 1KM2A 1J0JA 2PWFA 3SUWA 1NDVA 3CHEA 3S2CA 4ML9A 3AIWA 2NSOA 3TJXA 3EXSA 9XIMA 3CL6A 2DT3A 3ZSTA 3RCNA 3SFKA 2GJLA 5JIPA 3B4UA 4XAFA 1SPQA 2XFRA 1R3QA 1J79A 2W62A 4W93A 4GVIA 1GYNA 1IEQA 3MUXA 1PVNA 3BLPX 2C1IA 5DBUA 3CH9A 2Z1SA 1GTEA 1JAKA 2ZA2A 3VIFA 5LSMA 4WDXA 1NM9A 1HJSA 1WP6A 5AYYA 2YZRA 3AIVA 4LB4A 1TWIA 1S39A 1F7BA 2PDIA 3BAIA 5I07A 2OYMA 1OADA 1NDYA 1GZGA 1LT8A 3ITLA 2WSPA 2XVGA 3M5ZA 1GW1A 5AC7A 3ITOA 4I6VA 4IPIA 3CASA 4PSRA 3VM5A 2BG5A 2IUZA 3ZO9A 3NJ3A 4JTRA 1GUVA 4QG6A 4CNNA 2NX9A 2IQDA 4WVXA 3QC0A 3OA5A 1ECQA 3VOFA 4HQVA 2ISSA 1BXNA 1K03A 3BZJA 2WANA 4MJZA 1YPXA 4GA8A 3AFBA 3W1LA 1XPGA 2YDSA 4JQ2A 4IP7A 4KF1A 3HG3A 1E5NA 1HF6A 2PS2A 1S1RA 4DBUA 4DJED 3QLDA 4LVGA 4IMGA 4LUSB 3IJQA 3FX4A 3H4XA 3CHCA 4UR8A 1IR2A 5BOOA 1W3IA 3H4WA 3C3NA 4UOQA 5ABGA 1TA3B 1V79A 2Y88A 2AQWA 4GXPA 5A6KA 2X41A 1E5JA 2WHKA 4DUOA 1PJ9A 3TJLA 1QPRA 3FDKA 3TYCA 5BW6A 1SZGA 5K9CA 4ZQRA 1XIJA 2Q3OA 4ZEPA 4DF0A 3UNDA 4AYGA 1OF8A 5TAOA 9CGTA 4FF5A 5CGMA 1V7AA 3KVLA 5GNZA 2QPXA 4EWJA 1OC6A 3LHTA 3ZT7A 4G5DA 2DVTA 2VEPA 2OKTA 3BJFA 2DEPA 4JTIA 5T9CE 4CD4A 4PEEA 2ZXBA 1JF5A 4HHMA 1XKJA 4E3VA 2C13A 1GJUA 4MWAD 3GUWA 2P10A 4I9MA 5EL1A 3B4YA 3Q94A 2OOGA 5U7SA 4DAFA 4GJJA 2OODA 3BARA 3L0NA 4BI5A 1UIPA 1L6YA 1W9BM 5M1TA 5M2FX 3ARUA 1C91A 5CJMA 2WXDM 3COTA 2TSYA 4BJHA 4ZFMA 7XIMA 2D2HA 2Y5EA 3URNA 5D2XA 3SRHA 1BQGA 1KTBA 3SDOA 3DG7A 1AQFA 5G1YA 1VRDA 4IL2A 1JULA 4ACZB 4UMCA 4G9PA 2DSUA 3A4AA 2JKAA 4KWUA 5BWAA 2A3BA 3KVKA 3BC9A 4B3KA 1B3WA 1FCBA 2Z28A 4XX6A 1Y0EA 3KZPA 1VAHA 1FTXA 4DWSC 4G2DA 2FTWA 1OYBA 1Z32X 3SSZA 1QNPA 3IANA 4CVWA 3AALA 1UH3A 3R8GA 4FNSA 1DWJM 3WEZA 3SUSA 2G97A 1GWJA 4AVOA 2E5BA 2DW7A 4GZIA 2WMKA 3VZZA 4WOZA 3MHUA 3U8GA 1WYIA 2WMJA 4JTCA 3BGJA 3T08A 1RLDA 1V6TA 4O17A 1P1MA 3W84A 2V2DA 3N2BA 3N9SA 4F0MA 3N4EA 3CBWA 3SCRA 3EKLA 1TO3A 4DNMA 3FAWA 4DPQA 1MZHA 3LRKA 3TXVA 4B16A 1NFPA 4LAZA 3OPSA 3VFCA 5I5RA 3TE9A 1H1YA 4E38A 3VKJA 1GOWA 4C7DA 2F9RA 4LOCA 1LWJA 4A3HA 3MUCA 4DJFC 4O1BA 1JPDX 4N9BA 4DWSD 4MZYA 4CQBA 3IJLA 2V5JA 1CX9A 1ZJIA 5FJRA 4Q22A 3MMWA 3OBKA 4O1CA 4PTNA 4IH3A 2PWVA 3VAVA 2OEJA 4Z2JA 1S5MA 1A53A 2VR2A 1OFQA 2JBMA 3DFQA 3QF0A 1ENUA 2DGAA 3K5XA 4ONVA 2XVNA 3ORWA 1XGDA 2VTFA 1EOKA 4LAOA 3WD1A 1AW2A 4N02A 3DERA 1I2OA 1V0NA 4N4QA 1TMQA 1ISWA 2BY3A 4PE8A 1OD8A 1GZJA 4Q7IA 1TJ1A 2QPUA 1S1PA 4O0KA 1AMYA 3MI6A 4G7FA 5U4NA 1CLVA 1QDSA 3Q65A 2BXYA 1VBGA 4M6QA 3H55A 1R87A 1J0KA 4DJFD 4OBSA 2VRQA 3VE7A 3OU8A 3V35A 5TNVA 2OGYA 3ITYA 5JXQA 4RR4A 2BFGA 2VDHA 2E28A 4HPJA 3AOFA 2NT1A 4RNFA 1PL9A 4QLLA 3G1RA 3N6QA 2YA0A 4GC4A 3OVPA 1PS9A 2XH4A 3FN9A 3G0SA 3HJZA 4A2RA 2Q6ZA 3B04A 5CGQA 5CXPA 4ZQPA 1GTHA 5CC6A 3ANUA 4HTYA 2CBIA 3N34A 3P80A 3V0TA 3AIEA 3S83A 5HOSA 3PK7A 3ARWA 1RR2A 2PBGA 4WOQA 5A1AA 4ACYA 3MTWA 4GCXA 2BGQA 2Y85A 3II1A 3DYOA 5AY7A 3HGJA 1UBSA 1OK6A 1SM9A 3ZM8A 2VFEA 1GORA 1N8FA 1OHLA 1QK0A 3H8AA 3QFWA 2EGZA 1GQIA 2CLMA 4BZYA 4L6HA 1FH7A 1I9CB 3PZIA 4P8UA 2INEA 4JX4A 5K3VA 3PZNA 1XSJA 2QYGA 3IK2A 2QJMA 3I3EA 3DOPA 3PSVA 2CETA 3EGJA 3H4GA 3KEHA 2FGLA 5I7GA 3TW9A 1VFUA 1VGAA 4W9TA 1DHPA 1HJUA 4GRSA 4OBRA 3UCDA 3U5YA 5A8MA 4BI7A 1Z69A 3MUIA 2GUYA 3AHXA 1PDYA 4X22A 4C1NA 3WDRA 4K36A 4D71A 1OIMA 1J93A 3PB0A 1W8GA 5A3HA 2Z2AA 1AFSA 4IIEA 4ROPA 4QE5A 2Z26A 2HEJA 3EA1A 1HL9A 1PIIA 1V6VA 2YDAA 3NUKA 3GZAA 2D20A 4QHRA 1Y8BA 3DBPA 3KW3A 3T07A 4EOUA 3DKJA 1M7JA 1EWDA 3PG8A 4CQDA 2Y4SA 1SZNA 3PVFA 1QRQA 2GDVA 3DX5A 1BYAA 3EDKA 1HIZA 1A5AA 4LAKA 2HPMA 5FF0A 2GL5A 4JQ3A 2BP1A 2PF8A 1V3KA 3TFCA 2TAAA 1XICA 2QF8A 3VKBA 3LRLA 1DXFA 1TCDA 1S2WA 5CPLA 1NJJA 2O9RA 2ZRUA 2DT1A 3VIGA 3MP3A 5F4XA 3REQB 5KITA 5AC6A 1C8YA 1S5TA 3V18A 2ZUWA 4R53A 1KR1A 3F2DA 1OCBA 1RP8A 2YPIA 2WVTA 5JBDA 3H53A 4Q4MA 4B5XA 3TMQA 2VC9A 3A4JA 2NQZA 4HHHA 1WDWA 3L9CA 5C7HA 1XYBA 4W84A 3M0KA 1UA3A 3VXGA 1XHGA 1HNYA 2ATMA 2PU0A 3D6NA 3G77A 2WPGA 1I2RA 3NSMA 1UIOA 5FACA 2FJUB 5A69A 1XL9A 1VS1A 1VPQA 3E2RA 4O50A 1U83A 4J40A 4EE9A 2I17A 2X0SA 2A2IA 1TX2A 4KWSA 4GD0A 3BG3A 1QI0A 1A4LA 1EYEA 4ZO7A 1FWDC 1CENA 4O4WA 2PE4A 3C5QA 1HKVA 5D37A 3E1F1 3AYRA 4Q6XA 4IISA 1X6UA 3FYPA 2ZE3A 3WNMA 1HJVA 4DM2A 2ABAA 4PUNA 1QNSA 1DYSA 4AEEA 3DUGA 1DJNA 3WQOA 4HZMA 4WX2A 3I3BA 2AOSA 3EDFA 2VEGA 2CXGA 1O94A 3LCWA 4GPNA 2J13A 1JG9A 4PMZA 1ECEA 1J6PA 1XPYA 3GS6A 1ZS2A 5IDZA 2YW3A 1EDGA 3FCPA 2A3AA 3UXKA 1QNRA 1F3EA 3A12A 3GHRA 4QTGA 1HN1A 1GG1A 1V3LA 5A6AA 5D05A 4IM4A 1PKLA 4R88A 4RE4A 2O9PA 3TN4A 5B80A 4UFHA 4QSFA 3CV7A 2E68A 4UQDA 5C9XA 1LF1A 4P7RA 4HZ7A 1TIWA 4FOUA 1J0HA 4LAUA 2ZX5A 3QHMA 3AZRA 1J8VA 1G94A 2R14A 3PAJA 4GUJA 4NJJA 3P0WA 3IAPA 4P8WA 1UR9A 1K4HA 5T9BG 2KZHA 4AD4A 5FEPA 4J27A 3KDOA 2VOMA 1H61A 1NVMA 1A5LC 4AH7A 3TAKA 2QJHA 3TDFA 1ODUA 1SMAA 2PDCA 2W5FA 3WF1A 1IGWA 2C1GA 4KFPA 4V27A 1RV8A 2WQDA 3HV8A 3WLHA 3B9DA 4E6MA 4F9DA 3G3DA 2VUNA 3OZPA 1CXFA 2E67A 1EHNA 5CSYA 3SB0A 5AYBA 3FNDA 1HZYA 2YSWA 2OYKA 4CNSA 3TSDA 1D9EA 4RPPA 1UJPA 3JS3A 1E1FA 2OELA 3MO4A 1QWGA 1TZ7A 3FJLA 3BANA 3NPUA 1BLIA 1MWOA 4LYKA 4RW5A 3MV01 3PZ9A 2XGIA 3DBNA 1PEZA 1AW5A 1PSCA 2QZRA 4Y9OA 2V69A 1H49A 3GQYA 1W5QA 2HPIA 4IICA 5FF2A 2QCGA 3M4HA 4ES4A 1MEWA 4DO5A 4JFWA 4KRZA 2QAFA 3BL3A 1NWUA 4Y9PA 4U2ZA 1VEMA 3UYIA 2PWUA 3SGZA 3MCNA 4IQLA 1DJHA 4O57A 3VKKA 3EEGA 1A5KC 4WGHA 3UZZA 1DWFM 3S6TA 4C5YA 1DE5A 3N2XA 1LOSA 4LUYA 4NJKA 2YBUA 1AD1A 1ICPA 4E2OA 2WNZA 1US2A 1BQCA 1Z44A 2YBVA 1L9WA 1GOQA 4M1BA 4PYSA 1OY0A 4FSAA 3XISA 1V8EA 2P50A 3TYAA 4KESA 2DZTA 3NDYA 4A3QA 5FF7A 4PTXA 1QVBA 2OEKA 4KGJA 5CPQA 1G7VA 4ZB5A 3VIJA 3L0KA 2VX7A 2BOFX 1S38A 4X2RA 1N8IA 1NQKA 4HNTA 1U1HA 1W3HA 2TYSA 3IV8A 3CLMA 2QCEA 2A3EA 2VFIA 3WSUA 2XIQA 2JGQA 3BW4A 3OBEA 2PDBA 2AQOA 2VD9A 1UD2A 2DIEA 3PSWA 1R2SA 2D3LA 5CLWA 2R8WA 3UR5A 1DPMA 4JY8A 3UWYA 2FVLA 2WNWA 5FA5A 1NWRA 3GVWA 3WK0A 2VGFA 1B90A 4QITA 1JZ6A 5G1MA 4XD6A 5HUPA 4QAIA 4LEFA 3CQIA 2ISWA 4ZQMA 5C9UA 1G5AA 1JNEA 4HHLA 1SJAA 2ZUUA 3PWIA 3TSMA 4UTUA 3HGRA 2J77A 1IIHA 1OABA 2VEMA 1H7RA 1K70A 1UC4A 2V63A 5I77A 2P3ZA 3CB8A 1TPVA 2V5KA 2R1PA 3EYPA 3LA4A 1W9XA 1LCOA 2VKZG 2FMOA 1R38A 3UETA 4G56A 3E6EA 3C2YA 1ZUAX 3B9NA 2Z4GA 6PTDA 1PO9A 3WQFA 1JDAA 1C7SA 3P14A 4LVBA 2Y5SA 3PZQA 2R94A 4H8NA 2J74A 1BHGA 5EMKA 4Z1CA 1J01A 1P43A 3GC4A 2VGIA 4L7ZA 5CG0A 1TVNA 7CGTA 4LBUA 3R6IA 1O1ZA 1ISZA 3FOKA 1YNQA 2ZE0A 4EWND 4PRRA 2X7WA 3CTTA 2FFIA 3M9YA 1JZ5A 1K1DA 4A4AA 3R89A 3OZMA 1KCLA 1NOUA 2ABBA 4YIWA 1IXPA 2VR5A 4HK7A 1DE6A 3F4VA 2YFNA 4CD7A 4S2CA 5H2ZA 2AKMA 2Z24A 1BKSA 1Q6GA 2PRLA 1RQBA 1LORA 3C2OA 4MYAA 5LA2A 1L6SA 5DN1A 2PCEA 1O6IA 1YTEA 1QU4A 2V3EA 3URQA 3ES8A 4HD5A 3PP7A 3TYUA 2WZEA 3AUJA 4DWSB 4P8XA 3IIXA 5CPMA 5KINA 3M5YA 2OPJA 3UVAA 4FI4A 4EACA 4ERGA 5CPNA 1P6WA 2J27A 2OJPA 1C8XA 4EF8A 1BVNP 4ZR8A 5IXEA 1L6WA 4MYXA 2XHYA 4QDPA 3P0XA 3V1PA 1QI5A 2WKGA 2O7SA 1OF6A 3LB0A 3B0UX 4OUEA 2C71A 1LJYA 1QPOA 1OB0A 1SU5A 1JCXA 1FDZA 2NXGA 1E0WA 3CM4A 3AYTA 4I9JA 2X8RA 4H7ZA 1UKTA 1QBAA 2QUNA 1UUOA 3NZGA 3PTQA 3U7VA 1Q8JA 4U3CA 2WMHA 2ANUA 1B0IA 4ZB0A 4UTJA 4WY0A 4HU4A 1T41A 4C6FA 5TF0A 1YPFA 1Z89A 2C1HA 1P4CA 4YXGA 4ASTA 2J8FA 2OLHA 3GNDA 1OX5A 3BAKA 3KS6A 1E1CA 3DG3A 2JF6A 1HGWA 3KL3A 2ZA1A 2CHNA 2Z7GA 2F8QA 1RCXB 3FYYA 3OEXA 3CJPA 6ALDA 4GQ0A 2ZRYA 1V93A 2BV9A 2PWHA 2OEMA 3S0CA 1PZ3A 3KOXA 1REQA 3WK2A 3HQNA 1UD5A 4X60A 4M8UA 1SGJA 3G3MA 2QCCA 4E8DA 3DAQA 4H8VA 1ZSXA 5M3WA 1NF0A 3NQFA 2INFA 3ARTA 4LRTA 4KWVA 1T40A 3TUUA 1UUQA 1MMFA 4U31A 2VP8A 2PDFA 4E8GA 1U22A 4TMBA 3LBMA 3BMWA 4C1NB 1P1XA 2BGNE 2J88A 1EKOA 3WBYA 1KRBC 3BSGA 3TCSA 4QAWA 1NQ6A 2EG6A 2OZ0A 2CLEA 3V0SA 1EL3A 4MZ1A 2Z1BA 3LPPA 4PUMA 2XWEA 1A4MA 2QLYA 3PZOA 2UZ9A 4W85A 5DCDA 2NQLA 4S3EA 5A95A 1EA0A 1Z8AA 1T8QA 3WJYA 2SFPA 1GG0A 1XX1A 3E3HA 1EX5A 1K8ZA 4AY8A 1BYCA 1ADDA 3KRUA 4OE7A 5BRQA 3ZR4A 3KFTA 2VVSA 2JE8A 3SZ8A 3THQA 3WD0A 4AEOA 1CWYA 1PUDA 1EUNA 3KDNA 1PXGA 2GWNA 3VIMA 4CNTA 4HMEA 4F4RA 2QQ6A 1E0XA 3MBDA 5GVJA 2CZFA 2WMIA 3ARPA 4H9VA 4TMCA 3SFWA 4B9YA 2YGYA 1U5HA 4HSNA 3TYZA 1W2PA 3VIIA 5JU6A 4AY1A 2YKKA 4I9TA 1GJPA 1BWKA 1P48A 4PCNA 4TX8A 1UZDA 1Y5WA 3AQUA 1IEIA 3PHAA 3C56A 3IUIA 5JBEA 1LUCA 1YDVA 3HQOA 1YDOA 3KS5A 3PUEA 3JR2A 3RLUA 1I2NA 4TX9A 4AZ7A 3VABA 1KQYA 3G1XA 3PZUA 2DZUA 3WUBA 3LSCA 2RDXA 4K38A 2WZIA 4XK2A 5F2IA 3XINA 1X96A 4HCHA 3DFPA 4MFDA 2V2CA 4HB7A 3UG8A 1T8XA 1NAL1 3W87A 3TA6A 3FHQA 4ZA0A 1JPKA 1UD6A 1ZP4A 2PLCA 4PODA 1CPUA 1I60A 1PDZA 3SCPA 3PB2A 4R34A 4D6HA 1W17A 4O54A 2DQXA 2CERA 4A35A 1O12A 1KLZA 1HGYA 3M7WA 1PTAA 4F3HA 1M03A 3OGSA 3NEVA 4HKPA 1WZAA 1X8FA 3CUZA 3UWUA 4OBTA 5EA9A 4P2VA 1LYXA 3VNYA 3LX9A 5TD4A 1J96A 1AQHA 1KCXA 1DWHM 1DP0A 4IX0A 4WSKA 5DRCA 3CHFA 2BHUA 3M0HA 4KT2A 5AECA 4BHYA 4WCJA 4GI6A 1B30A 1JCTA 2BX7A 2QV4A 3TNOA 1Q66A 4NKCA 3UJSA 3RMEA 6REQA 1R5YA 3EWDA 5KZDA 4C6QA 3K13A 3FVDA 3W1MA 2R1MA 2FDMA 2J78A 4DVOA 4D6DA 3EB2A 4XIMA 3BK0A 3LRMA 4XZBA 3T55A 3GC2A 3C8FA 4R85A 3KZSA 4D6GA 5ABTA 3IJ8A 1WXJA 4XVEA 4CCEA 4Y8FA 1XCFA 4RXFA 4W87A 2FHFA 2X1TA 2IPWA 2J7BA 3NQ8A 3LN3A 4DO7A 5KSWA 3NQBA 4KW2A 1SMDA 1N82A 3AXIA 2V30A 2QCDA 2VO5A 2PDUA 3GU9A 1ZLPA 2G3JA 3FS2A 2E9LA 4IX2A 1E9YB 4LCSA 3EWWA 4C1KA 5GJMA 2HCVA 2Y5JA 1W9PA 1CW2A 3WO8A 5EGRA 3CAQA 5GJNA 2JKEA 5I06A 1XC6A 3TN6A 1UD8A 1XJBA 2QCLA 4LY8A 2ZC8A 1UQZA 2QJNA 5MHBA 3LCLA 2VCCA 3LHZA 1OFEA 1N55A 1BPLB 1EA9C 1F4AA 1QPNA 1TVLA 4I6KA 3NDZA 2HRWA 3MYPA 2RGLA 4O13A 5HULA 3N73A 4WY0F 1ZHAA 1CB7B 1RBLA 4H04A 1JFHA 2GK1A 5HK4A 3SJNA 2WJDA 4EX4A 1XLDA 3GNRA 5H8MA 3NQDA 3GHSA 4KERA 3UA3A 3S3GA 2W61A 3WK3A 2RJHA 3RM8A 1I75A 4KS0A 4M24A 3ZJ7A 3STCA 3LBCA 1EHAA 3UA4A 3MDUA 4ZODA 3QV6A 5EMYA 3T0CA 4I5RA 4L9XA 4ZOEA 4MJMA 3HG5A 4YTQA 4IG2A 1TQJA 1J12A 3UXDA 2RGMA 3PUGA 3F4WA 4M7TA 1EEPA 1EOMA 3VD5A 1NEYA 1VD6A 3B8WA 3UWEA 1Z41A 4JN6A 4PB4A 1XYMA 1POKA 4JCLA 5C9RA 4HU0A 3WD4A 1V6WA 4IMDA 1V4YA 3WJWA 1FXPA 3ABSA 5F2LA 1UMYA 3ABOA 1VIWA 2DVUA 4S23A 2ZVIA 1LLOA 1WDRA 3KLKA 3GC5A 2PA6A 1GQJA 4DBWA 3K8MA 3MSDA 5E0CA 1AG1O 1JDEA 4LUIA 5G4HC 3B8DA 3DGRA 2GSJA 2I1OA 4C6OA 1B2YA 1R9XA 3C6CA 3ABRA 4WJXA 2HBXA 3C0JA 1WAUA 4JIPA 2Y1HA 2QUVA 1K02A 1E4NA 3WF3A 4LJ3A 3WNKA 4UTMA 1J0IA 1PKNA 4NY2A 4US5D 4I5XA 5D32A 2DIKA 1YLVA 4PMDA 3ONCA 4L1XA 4KRUA 1A0EA 5E9AA 2ZADA 4MB5A 3A3WA 3J7HA 2EG8A 2Y61A 4IMCA 4YYCA 3NIYA 2VZSA 3NZRA 3U57A 1BXBA 1LG2A 1PHQA 1RBAA 3FEMA 3G1VA 1GOIA 1YKWA 1XR2A 2BHYA 2VENA 2VL4A 3DECA 2ZUSA 3RCMA 1OC7A 3ITVA 1W8SA 1K9TA 4AZGA 1MFUA 1XRFA 4S1FA 3N17A 3BICA 4JIRA 2Y8VA 3RF9A 2A6NA 1D2KA 5B7ZA 3ZIZA 1V3IA 3AHVA 2DT0A 1G4PA 3WFZA 4QX4A 3HURA 2FZNA 4E4PA 2VYOA 1SO5A 3IJ6A 4BS0A 2O4QA 4Y7EA 4R7OA 5AYXA 4M29A 3UU0A 4IIDA 4D6FA 4QM1A 1O4UA 3KBWA 3GNOA 3P74A 3SO7A 1MW2A 4LC8A 1EC7A 2E3ZA 3WJXA 2GSHA 4R9OA 4LCQA 4NX5A 2J8TA 2OX4A 4L65A 4ZO8A 3QMRA 1KXHA 4KFNA 2HXTA 2UV8G 3EX3A 1GYMA 3E0WA 4C6EA 1X6NA 3FA3A 2CBJA 4JPGA 1ZQ5A 2BXVA 4MB1A 4E2BA 1LP6A 4YN5A 4QISA 3PPGA 1LLWA 2O9OA 3QTGA 1VF8A 3UZ5A 5KMYA 3CZLA 3UYCA 5E1QA 3WG6A 2DSVA 4U5IA 3C4UA 3S46A 1KO0A 3UWWA 3KAOA 2D24A 4ZQOA 4GQBA 3RM4A 1RUSA 3WD3A 1DJWA 4FNTA 1V77A 1QO5A 5EBAA 1YBQA 3GKFA 3VC6A 1F3TA 1RVKA 1TRDA 1UP2A 1IEVA 4LNCA 1K7EA 3W00A 1XDMA 1FUYA 3U3HA 1H0IA 5LA0A 5JH2A 3RLVA 2Z7KA 4M1RA 3GXPA 4J3SA 3P60A 1WUEA 1QHOA 1V6XA 4PMVA 1PZ1A 3CUGA 2VFGA 2OOFA 4AHPA 1OFPA 1AQMA 3EWZA 1EEXA 1LDCA 4MHBA 4OZOA 1JQVA 1AODA 3N2CA 2GGEA 2W27A 4CD6A 3QHOA 1JCJA 3IIVA 3ONBA 4AAJA 1JDCA 3FKKA 1S2UA 1LBMA 2HE5A 5LHEA 4LRSA 3S5YA 3EDJA 1XLIA 4KIEA 2QCNA 2YCJA 4WY0B 3TLQA 4J2MA 4AZCA 1U33A 5AHMA 3T09A 2G4FA 1YADA 2ZZ2A 1ZAIA 5I3KA 2Y7FA 3O6AA 4JTUA 3URAA 1E1CB 1OBAA 3H2MA 2ZTKA 2RH9A 2UY3A 2VWSA 3B9OA 1HFBA 3HMCA 3WJSA 5BWFA 2C8NA 2A1YA 3I65A 3VNIA 1D3HA 3W7MA 1DIEA 4MY8A 3DDMA 1REQB 3PZTA 4Q8TA 4HOZA 2VFHA 4AD5A 1NFBA 1DTNA 3CV6A 5AZ0A 4C6JA 3TN3A 1ZB5A 1RA0A 3UBPC 4U33A 1O5RA 1Y5XA 4RL3A 3RU6A 3W75A 1E4LA 4PRTA 2FGZA 4X63A 2QEZA 2YLAA 3IACA 1TWSA 2QV5A 3MUAA 3VVGA 3P81A 5JIWA 5TIMA 3H7RA 2CWXA 4UQ9A 3VDBA 2CZDA 2PLJA 1P7TA 3KTCA 1LG1A 3CHVA 4G1KA 4IOTA 2D2GA 2NVDA 4V15A 5G2HA 4F79A 1VPXA 1MFVA 1MQRA 3N6JA 3OLEA 2XINA 4YVXA 2UY2A 2X05A 5CZ0A 2CLKA 4GX9A 1KNWA 2Y0FA 2MUCA 1FCVA 4JCMA 1UD3A 4CCDA 3CH0A 3W6LA 3PPHA 2W92A 1L6GA 5AKQA 1G67A 3PM6A 2HROA 4UFKA 3F1QA 4NASA 1OFRA 4P7LA 5CSSA 5F7UA 5IFTA 1TV5A 2PU1A 4JZ5A 4XZIA 3FY1A 1GPWA 5BROA 4B5SA 1RP9A 2WMIB 1Z42A 5FJTA 1YYAA 3W7DA 4FP1A 4LYPA 3R8HA 2ZUVA 1E0VA 1UKSA 3ZLFA 3K8KA 3VK5A 3VGFA 2HVOA 2LLEA 4KETA 2GWGA 5I00A 8XIMA 2BY0A 5LNRA 4QJ4B 3KLLA 3K30A 4MNJA 4WHBA 3PJUA 2FZBA 1AA1B 3E49A 1A50A 5EY5A 1LUCB 1N2VA 4I7UA 4NZCA 1FH8A 3T0TA 4FZIA 3QGAC 4M6UA 3KBMA 1UZ1A 1DIKA 1H63A 4P7OA 1PZ2A 4HA0A 4UTTC 3WLSA 4QS5A 3UZXA 1XYLA 4JD4A 1GVQA 4K3ZA 3M6DA 3S5OA 4C65A 1EBGA 1R9ZA 3O16A 3CUJA 4A8LA 4D8ZA 3DIPA 3LEPA 3W26A 3E0VA 2XPKA 1E3XA 5FEZA 3SAZA 5CSRA 1TTPA 3W7PA 4IGMA 1B3XA 3BAYA 4AD0A 4DX3A 4RKAA 3C2VA 3BPWA 4WDTA 3VMOA 1B54A 1PYMA 2A7NA 3R0UA 3ZWTA 3CMGA 2W79A 1J6OA 4W5UA 4D6JA 3N3MA 3SIMA 2VC5A 1FWBC 3V5FA 5MKGA 2BOEX 1KRMA 2ODOA 3VOCA 2XGBA 1GEQA 4LYRA 2FHCA 1Q13A 2GGJA 5A8PA 1ESWA 1KGUA 2YL6A 5M03A 1FQ0A 4GYFA 4GJ1A 3JRKA 3VIKA 2OSXA 4N42A 5C2CA 1P0EA 2HTMA 3NURA 1PB0A 6REQB 4FF7A 1Z6KA 2D0HA 5CAHA 1AZ1A 5HQMA 5AYZA 1J0YA 4Q8QA 1LM1A 2V82A 4M80A 4DNHA 1TE6A 3PJWA 4YVVA 1IE7C 1EGVA