1UC8A

Crystal structure of a lysine biosynthesis enzyme, lysx, from thermus thermophilus hb8
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
280
structure length
254
Chain Sequence
b'MLAILYDRIRPDERMLFERAEALGLPYKKVYVPALPMVLGERPKELEGVTVALERCVSQSRGLAAARYLTALGIPVVNRPEVIEACGDKWATSVALAKAGLPQPKTALATDREEALRLMEAFGYPVVLKPVIGXXXXXXXXXXXXXXGFQHQLFYIQEYVEKPGRDIRVFVVGERAIAAIYRAENCPLTEEVARLSVKAAEAVGGGVVAVDLFESERGLLVNEVNHTMEFKNSVHTTGVDIPGEILKYAWSLAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lysine biosynthesis enzyme
publication title Crystal Structure of a Lysine Biosynthesis Enzyme, LysX, from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Biosynthetic protein
total genus 71
structure length 254
sequence length 280
chains with identical sequence B
ec nomenclature ec 6.3.2.43: [Amino group carrier protein]--L-2-aminoadipate ligase.
pdb deposition date 2003-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08443 RimK RimK-like ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.80 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 1uc8A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1uc8A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1uc8A01
4HNUA 4MV8A 2PBZA 5GONF 3JZFA 2W6ZA 1CS0A 3VMMA 4XYLB 1KJJA 3MJFA 3SE7A 2VR1A 3TIGA 4ME6A 2NU9B 1GSAA 2FPIB 4IWYA 2CQYA 3AW8A 4MV3A 2R85A 3VPDA 4C5BA 4E4TA 4EG0A 3TQTA 1JDBB 4EAAA 2CZGA 1GSHA 2FPGB 1C3OA 3TINA 1CQIB 1GSOA 2R7MA 3BSYA 5CA0F 1GGOA 5IYZF 4YBZB 2GPSA 4XYMB 4EABA 2QK4A 3BG5A 4Y8VB 3ORQA 4M99A 4HQ6A 1T36A 3R23A 2YZGA 4EGJA 2I8CA 5KKNB 5LP6F 1PX2A 2W6OA 3K5HA 3VOTA 4YB8B 3HB9A 1I7NA 2YS6A 2ZDQA 4QSHA 2NPOA 3G8CA 4EA8A 5C1PA 3E5NA 3AX6A 3G8DA 5D8DA 1B6RA 3WNZA 2HJWA 3N6RA 2QF7A 5K2MA 4FU0A 1VBGA 5LYJF 4O4HF 5LXTF 2R87A 2NUAB 4MV4A 2W6PA 2X0SA 4MV7A 1UC8A 3Q2OA 1W96A 4O2AF 2DZDA 5LA6F 1KJ9A 1CQJB 3WO1A 2W71A 4IZOA 4TV9F 5BMVF 4IWXA 2R86A 3BSWA 3K3PA 2SCUB 3N8DA 4MAMA 4TV8F 2Z04A 3LWBA 3I12A 3V4SA 2DWCA 2IP4A 5JVDF 4MA5A 4YJ2F 1JKJB 2YS7A 3ETHA 1EYZA 4EA9A 4M98A 2DLNA 5JH7F 2R6FA 3HBLA 4YAKB 4YJ3F 3LP8A 1KJIA 3TIIA 5KX5F 2PVPA 2YZMA 1BNCA 3ETJA 1E4EA 2YRWA 1IOVA 2I80A 2VQDA 5CAEB 2YZNA 1EZ1A 4O2BF 4GGMX 4XX0B 3RFCA 2FP4B 3Q1KA 4TUYF 2PN1A 2FB9A 2J9GA 3K5IA 3R5FA 5JQWA 2R84A 4ZI7F 1DV1A 4MV6A 2V58A 4MV9A 2YRXA 1AUXA 3UFXB 3QFFA 1UC9A 2V5AA 2W6MA 1VKZA 4EGQA 1M6VA 4HNVA 3U9TA 5CA1F 5J2TF 1CE8A 1KJ8A 5DMXA 2W6NA 1ULZA 4O4IF 4WBNF 3WO0A 5JVLA 2VHEA 2V59A 3RV4A 4L1KA 3GIDA 2R7KA 1KEEA 4I4TF 4DIMA 1DV2A 4XZ3B 4M9UA 2GLTA 4I55F 5I47A 1DIKA 2NU8B 1JDEA 1JLLB 2I87A 2NU7B 5C8YF 5EZYF 2P0AA 5BPHA 4C5CA 4IHJF 5C1OA 2OLSA 1B6SA 3BSSA 4EA7A 4C5AA 1W93A 1WR2A 1GLVA 4HNTA 4ZHQF 2R82A 4ZOLF 4ZQIA 5H80A 3JRXA 3RV3A 5J2UF 1KBLA 3GLKA 2XCLA 4MV1A 1KC7A 2XD4A 4I50F 4DLKA 2W70A 4J6EA 5HBRB 4MA0A 3MWDA 5CB4F 2VPQA 3OUZA 3VA7A 3HO8A 3OUUA 2GPWA 3ORRA 1EUDB 3R5HA 1AUVA 4M9CA 2FPPB 3MWEA 3VPBA 1SCUB 4WD3A 4O4LF 1EHIA 2C00A 1I7LA 4HR7A 2ZDGA 2W6QA 5LOVF 1A9XA 1VBHA 2YYAA 4RZQA 1PK8A 3JRWA 2YW2A 3U9SA 2R7NA 3BFPA 2R7LA 5HV6A 2DIKA 3VPCA 1C30A 1KJQA 1BXRA 3V4ZA 3TW6A 3RUPA 4YAJB 2ZDHA 1EUCB 1E4EB 2NU6B 1IOWA 2YL2A 3JZIA 3R5XA 5BPFA
chains in the Genus database with same CATH superfamily
4XYEA 4BKUA 3H5AA 2OHXA 2ZUTA 2XRMA 5KFUA 4OI4A 5TARA 2RGBA 1Q20A 3NHPA 3KG2A 1W25A 5KKCA 4JVNA 1E0SA 1ADJA 4XJXA 2V6MA 4QTUB 2FPGB 1UJ5A 3VYUB 1DC8A 4MQLA 2RH5A 2EWMA 4OH1A 1GSOA 1ZN8A 3QVXA 1XDDA 3O75A 1ZH8A 2VJAA 4EKEA 1YVEI 4UNIA 4YP1A 1OY1A 1KJNA 1QANA 5LD2C 2NUPA 4HQ6A 1U1FA 1N1MA 3VSCA 1Y8QB 1EX6A 2P68A 3KB2A 1X7HA 4BPBA 1T1SA 4MITA 1LLDA 1WCWA 5JADA 5KKNB 3M6LA 4QSMA 3ABZA 1E0KA 2JPDA 2O8DA 4JQYA 1MIOB 2YY5A 4LQLA 4P3YA 1YTLA 4DSTA 4EBDA 3GDGA 4TL9A 1KK0A 1KU6A 2AGVA 1P18A 1KWKA 1YHNA 4WLNA 3KXPA 1GAQA 2J9FB 5CM9C 2R87A 3RS2A 3R7NA 3D7MA 1D4FA 3TE6A 3BPSA 1UBJS 3QTBA 2HZ7A 3FKIG 1Y9EA 1WVGA 3TTWA 3BE6A 4U7DA 4H0NA 2WNHA 3FYCA 3QBVA 1V9LA 1Y9ZA 1PWZA 4RAQA 1PT7A 4UHEA 4HH4A 1VL0A 3DMHA 2FJUA 3CX6A 2FMXA 4L7QA 4X7BA 2J0QA 2UZ1B 4OK6A 3UMSA 1XXHA 1EJ6A 4YQFA 1G5RA 4IOMA 3TLGB 2BGGA 4PYNA 1F3OA 4B84A 3A4VA 4OBBA 4EEXA 4G0WA 1FNMA 4DV6H 3G8YA 2J3JA 1G66A 2PPLA 1IEXA 4U6SA 5CT4A 2YFHA 4C9BA 1J1IA 3EC1A 2ATXA 2WWTA 4YMWA 1J2UA 1WEKA 2HIAA 2ZJZA 2QGNA 4TSRA 4CXMA 3IOMA 3GHHA 1F0KA 2IY7A 1BXRB 3IAS6 2JBAB 5IJ9B 1B42A 4P54A 1ZK1A 1HM5A 1YUMA 4LDPA 1QDUA 2DBYA 3H2HA 3NEPX 1JYSA 2XE4A 4WW0A 3CLTC 3COWA 3B3QA 4JZYA 5JISA 4LFCH 3PYMA 4ASUA 3ZQJA 2W2LD 3UICA 2HCTA 1U2GA 3PQ7A 3VVBA 3OECA 4CKWA 3D3KA 5JZSA 2CNUA 4MIEA 4RH3A 1H85A 1XAJA 4Q12A 4IO1A 5FBVB 2BP7B 1AB5A 1Q12A 5K6AC 1KFKB 1SHZA 1EFAA 1H5NA 2CUNA 4ZOBA 2EYQA 3TCXB 4IDGA 3AEYA 3DL4A 3V33A 1M83A 4KMMA 3OP1A 3H0CA 4QIHA 2BUAA 1YUBA 3DOCA 4LFBB 4XJSA 5DCWA 4C0KA 4MSUA 4LF6B 1YKGA 1EVZA 1EM8B 2Z8ZA 2FHSA 4K6MA 5EJ7A 1TUIA 1W5FA 3MUNA 2GTIA 3UJ7A 1NXOA 3THXB 3IP9A 2IDKA 4EAQA 1ICIA 4R8VA 4LE1A 1KI9A 3I42A 3HCEA 3VA7A 2AGPA 4X20B 1SEPA 3T15A 3E22B 5CFRA 3BWDD 2FWAA 2CNBA 1SCDA 1CQZA 2Q5EA 1UEJA 3EXHC 3LF2A 3NWEA 1PJ2A 1D9ZA 4ZQBA 4JLSA 4BFTA 2Q5OA 4N7BA 4RW0A 4K9RA 3H9JA 3U4GA 1L9KA 3FHLA 2EX0A 1USVA 3M0EA 2ZIGA 2LWIA 1DKNA 4ENQA 4JLJA 3V4ZA 4DMHA 4YP3A 2OH2A 3NTXA 4PLVA 2YIMA 4YPOA 5LQDA 2VPPA 2I3BA 4HGYA 1YBVA 1JJIA 1MC1A 2ZTVA 4W1SA 4LHVA 1ZRSA 4AMGA 2ASLA 3TW0A 3PYXA 3O4VA 1KQNA 4HDMA 1M0SA 2P2YA 3EVDA 4N3BA 1YZNA 4F8JA 4BFWA 2GDZA 4C4SA 1QLHA 3GVIA 3RLIA 1H2HA 1TUBB 3UQ8A 4HDQB 1G42A 1OLOA 4BNHA 2JEZA 2K2WA 1F0PA 3PPYA 1V8DA 4P0PB 4FXPA 4RVCA 2NNWB 2IYAA 5L6LB 4J7XA 1FFXA 3DM5A 2OC4A 4E5PA 2QHXA 5CR9A 3CQZA 3SICE 1JS1X 1ZL2A 3C5HA 2BLLA 4FYWA 3TEKA 1GG2A 3C6MA 1WCV1 4RHEA 2Z9CA 2FEAA 3IDOA 1U9CA 3OICA 1PK9A 2FN4A 4IH1A 1UZMA 4M7WA 3NGMA 3IOEA 3P71T 4B40A 1Y14B 4HX2A 3SQLA 1A5BB 1HBJA 3UMBA 3N2YA 1SOUA 2NZVG 1DKQA 1EHCA 2W2PA 4MAMA 1XC7A 4G97A 3JZMA 3HZHA 1TM7E 3F67A 5GMOA 1IZYA 2QAIA 3BAZA 4NDAA 5A6SB 3DPSA 2B1GA 3DEYX 3KBBA 3GFGA 1ENPA 4YXWA 3GFRA 3W2IA 4CT5A 1AKUA 2X5NA 4F45A 4YALA 4PQEA 3ESYA 3W34A 2YXDA 4XZ3A 4U7CA 10MHA 1NXPA 2ZEJA 3RFCA 2EKPA 4Q45A 3TTSA 1J4AA 3K31A 4KIGA 5HP4A 3CH6A 4L7VA 2R47A 4BNGA 4KGDA 1LZKA 3NJRA 3RNLA 1DFHA 4PLHA 2CK3D 5H5JA 2PVCA 3L9XA 3DLHA 3RBAA 4D8TA 2C8VA 3NTVA 1ISMA 4TM5A 1V41E 1G8KA 3OIVA 1NL3A 4DL9A 4DJ5X 5JSZB 3ZQKA 4ZK2A 2C92A 4DV2H 1PN3A 4B3BA 1RC1A 2QPOA 3OMWA 2FPUA 4ACAA 2RB4A 5GP1A 5EKXA 1QJ4A 1DBRA 3KKPA 2CHUA 3PPWA 3QEBZ 5DBEX 3EPGA 5G0VA 4M1QA 3ZJUA 4Q4AB 3TSCA 4M0MA 4BJHB 2IBTA 1DC7A 3UUGA 4NBLA 1P2DA 3L1KA 4ZI3A 4KPYA 5J40A 5LYYA 3Q2IA 1U28C 4XVHA 1JGTA 1JECA 1BMTA 1A2KC 1URPA 1UZUA 3F1KA 3HLTA 4ICIA 3RSFA 2AK2A 3K4HA 4N12A 3LG2A 1DCFA 1AB6A 2IW3A 2CJWB 1X7GA 2ORWA 3ZLTA 3NRCA 1QWSA 1TO1E 1AH2A 4KKVA 5CLLA 1NMEA 1UDXA 1RYDA 4YHHH 5KOJB 1IXKA 2WP0A 4LH7A 2C00A 1R0XA 3KETA 1Q19A 2HJ9A 2BGNA 3NX4A 3EY4A 3L2PA 3D8HA 4MDFA 1TA0A 5BSTA 1E6KA 5SZKB 1KJQA 4HWPA 4YPFA 5FYQA 2DFDA 3PFIA 4IJVA 2JA7G 4Z9BA 4MQBA 4NCKA 3W90A 4TSKA 3JZIA 1G21E 2RGWA 4F50A 2RJOA 4E2WA 4M37A 4RM3A 3SOZA 5E7QA 1I3KA 2C96A 4GBMA 5ILGA 4PV7A 1FEZA 3QMPA 5T4FA 1J7KA 3MINA 1MR3F 3Q8RB 2XF8A 3D3EA 4KJXA 3REQB 2HREA 3S5UA 5I6DA 1WQ1R 1XV5A 2XQJA 3TRIA 3DG9A 5AM3A 3KPWA 1MPXA 5C8ZA 1PT8A 1AGNA 1HE1C 2INGX 2DLCX 4AK9A 5B64A 5ELMA 3ORQA 2QI9C 2Y6UA 4MR9A 2GN2A 2XEXA 1OKKD 3B3AA 2OQVA 2PMFA 1CHNA 4FZJA 3S2IA 1XDGA 5K0LA 3D0QA 1ORTA 1KQ3A 1QVZA 2HRDA 3D5EA 3WYNA 5DMHA 4KMSA 3BTSA 5DHTA 4EG5A 2WYWA 1PU2A 3GWGA 1NY6A 4NE2A 3KHSA 1CR6A 1NT2A 3KVRA 4BV9A 3FRJA 3QVTA 3UO8B 3OPVA 3IVRA 3O03A 4JLKA 1QH1B 4AICA 1A50B 4CDMA 4BP8A 2GBFA 2P4QA 4GVPA 5KDLA 2BQUA 1OOEA 2Z6QA 1ZLYA 1VKRA 2V7WA 3KREA 1ZWLA 4R2WA 2YIJA 4YWHA 3WADA 2AGOA 2WAYA 4R3NA 4UXJA 5EWMA 3VPFA 1Z36A 4RK0A 2WVHA 1ZJWA 1Y5IA 2DFPA 1SKUA 2FMHA 3CEPB 2PGJA 1Z6ZA 3DEFA 4H7FA 2W7OA 1HURA 1A9YA 4B7CA 4ED6A 4MDHA 2C3MA 2X1LA 3GJ7A 2A94A 3EGEA 3GCDA 4HQFA 1CV2A 2QY9A 1DEXA 3RJ9A 4AZVA 2F3UA 1N2SA 4G67A 4DLTA 4EG1A 5JNWA 1EPUA 2BZ1A 1FP4A 2ZE6A 4ZANA 1H8HD 4KXYA 5IYDG 4RZRA 1U8UA 2XBMA 4B75A 1T35A 2QSZA 1WXXA 4CETA 4CHGA 1CNEA 1T29A 3KJGA 1PL7A 4E12A 1NXQA 1WD7A 2VNAA 1PX0A 4N65A 2O07A 4LNUA 4KXWA 4WRRA 3BB4A 4U9HS 2EXXA 4KRGA 5C8VA 4DR3H 2VQEB 4TQUS 3THWA 3OJ0A 2CLMB 5JFTA 4CM4B 3TL3A 4KWEA 3C97A 3Q7EA 4ZYLA 2AG5A 2XBLA 4IQ0A 2WTXA 4J8PA 1K3TA 1AZWA 2D7CA 4WCFC 3EZ6A 1E7MA 2NLOA 3Q0IA 1H0RA 2R8IA 2ZJTA 5FX2A 3CX4A 2C42A 1UJ6A 3TLCA 1XVTA 4CM7A 3KUXA 1F4PA 2C5EA 1I33A 4EF5A 1I30A 2H59A 4ZTUB 3T99A 2CNOA 1ZVKA 3LOPA 3PNLA 3M70A 4DSUA 3NIBA 5FA6A 2XDAA 3ZEIA 1FBNA 2V8BA 1GKLA 3RSLA 4E07A 3BIOA 5LU9A 4J0EA 3H1GA 1JDBC 3BH0A 2IF2A 2Z8YM 3V8EA 1UBMS 1G64A 1JRLA 2LKDA 1MABB 2LD4A 1CY1A 1BJTA 3R5JA 1NN3A 3KALA 1M2OB 4CDRA 1XKTA 2GHTA 5L3VA 5K3EA 4YAUA 1AO0A 4INOA 1WCXA 3HSKA 3H20A 1VG8A 1HE4A 4A26A 4AY3A 1Z9BA 3A9TA 2P62A 4NMWA 4I3GA 2GEUA 1UOOA 4IMJB 2F4VH 3ONWA 3RVJA 4RESA 1RXIA 4R1OA 1G3IA 1XNQH 2O2XA 5EIWA 5GVSA 2BCEA 2PWZA 4BBRG 3QKRB 4X6LA 1ULUA 1DT3A 1KPHA 2XUPA 1KJJA 4GU5A 4LE2A 3Q2KA 1UBRS 4JUCA 5FWYB 1KDYA 2B8EA 3DD5A 2QB5A 4EI7A 1AKQA 3F90A 4M54A 1IEQA 8ADHA 4CKBA 4LC0A 3DC2A 2P90A 1SN7A 3HLKA 2QDXA 4D3DA 2ERXA 5BSVA 2C0CA 5JUWA 2QWXA 2VZ0A 1JIIA 5C4XG 4KSBA 4IH9A 2Q5IA 3MM4A 4YRJA 4HFJA 1MHPA 3JVDA 4MW9A 4JKOA 3IMGA 4D8UA 1L8QA 1KIAA 3UUWA 3D6JA 1E1QD 3G0DA 3DSRA 5F12A 1CB0A 3ROTA 1KEEB 4NOJA 2EQAA 3KOMA 3CPJB 2GARA 1P0MA 5DGHA 1MJ5A 3ETCA 1X86B 2H2AA 3W8FA 5BR1A 3OPXA 2V4QA 1JPNA 3WWJA 5DTMA 3LQKA 3VTZA 4JGBA 3ZGNA 2ODBA 3OX1A 3GGJA 2JAQA 4BNTA 3WWIA 4RPGA 7ADHA 2FPXA 3ETGA 4R4JA 3FDSA 4D3XA 3WLNA 4JI7H 3LHKA 3UMGA 5EZSA 4AP6A 1H2AS 1TEVA 3VNQA 2D8MA 2YC2C 3W7BA 2H1LA 1QPGA 1Y1KE 2H1FA 5EUQB 3JARA 3OT4A 4KQ1A 5ALRA 3JYNA 4JI8H 4QXAA 4ZTZB 3S2YA 4JP8A 4NECA 4P33A 2XWPA 4RKFA 1IBMB 1QRTA 3E27A 1XLWA 5IN4A 4BQOA 3T1TA 1R88A 5J4YA 2EDAA 1TF2A 2HSWA 4KFUA 3HLYA 3ASUA 3W1EA 4GX2A 2Q7DA 3I9OA 3RYCA 2PT7A 1X70A 4CCWA 3PHBE 2C7VA 4L9WA 1KZGB 5EMLA 4GE3A 1XMQB 3VO8A 1TEXA 3MIIA 4EP1A 1MFPA 2BMVA 4LHZA 2C3PA 4HLNA 1IZ7A 4QWBA 1LPPA 3ZWKA 5B3JA 2J7PD 4FI3F 1O58A 3JYLA 4KWCA 2C7OA 5B1IA 1BG6A 4RANA 5C3UA 1XFAA 1MEEA 2GCEA 4NJMB 3F4BA 4DLPA 1C1HA 4FMCF 1GZ6A 4DLLA 1TQHA 3A1NA 4B2LA 1BHO1 2OZVA 1Q7RA 3JQAD 2H4HA 4ZO7A 3VSDA 2HJRA 4RZ2A 1E1LA 4JB0A 2XADA 1DLIA 4X5OA 3HXKA 1E2EA 2W2LA 3GBPA 1Q7EA 4ZAGA 4ZYTA 4GR9A 3DJFA 3GDWA 4LGMA 5DM1A 1O95D 3O9MA 3WI7A 3KU1A 3LE8A 3WAKA 1A76A 5ERXA 2F1KA 4ER7A 1DSSG 4HGZA 5MFZA 2BFMA 3GUVA 2FFRA 2JF0A 2RH8A 5FOQA 4PS0A 1SCAA 1VYHA 4FBTA 4NBUA 4XWGA 1IYDA 5BYAA 3F71A 1DADA 4YR9A 2Y1EA 3R5SA 3P2EA 2PBLA 1B6SA 1F20A 2QL7A 4MJLA 1XF9A 1FX1A 2YXBA 1XK7A 1KNXA 1S2GA 4ZHQF 4NZOA 4FFSA 2JNWA 3RREA 2VDNB 3L84A 1VOTA 4POAA 1XVLA 1GPBA 5F98A 1L9XA 1M1XB 4RCNA 2QQ0A 1KHHA 4NBVA 3TG8A 2GAIA 4EEYA 2X23A 2H5IA 1IBLB 3HABA 2Y27A 3L7NA 2ZOSA 3ANLA 5H82A 4C7MA 1EFUA 4M8KA 3ZIDA 3IQGX 4I19A 2YXNA 4AURA 4EBFA 2GTHA 4QYSA 2GPTA 3N87A 5F1PA 1L5ZA 3I9V1 2J5QA 3MS4A 3IB3A 1DIBA 3DYIA 4MQMA 5CGQB 3U7RA 4C0WA 5KG6A 3R4CA 5IC5A 1U3UA 5FI3A 2RDJA 5DTJA 4LOIA 9LDTA 2L18A 2B9EA 2ZRQA 4MQ5A 4MXDA 3A4TA 1QGOA 2ZPUA 2H48A 4DR1B 1IYZA 3QJYA 4L4SA 2BQRA 3BXPA 3R7WB 4CGYA 1E9EA 2JK0A 3MC1A 4PYJA 5LM3A 2HC9A 2X3FA 5DEIA 2PL9A 4YDRA 3MTQA 3RVQA 4HMPA 3FBWA 4AKTA 5CH5A 2OZKA 3VPDA 2GQSA 3UAYA 1ZCJA 5ELXA 1DQSA 4NI5A 5E9QA 2PRZA 4V1CA 1H3FA 3HOVG 2POQX 2XY4A 1RAEA 1G4AE 3GRUA 1OASA 5CA0F 1WQ4A 2O2ZA 2RAFA 4B5LA 2HWYA 2JKZA 1GJRA 3OIGA 4DZRA 2A78A 4JA2A 4KNVA 1QIEA 1J2EA 4YRZA 3KOWA 5AIBA 1NN0A 3GCWA 4CBVA 2XMDA 2YS6A 2XXAB 1Z5WA 4JV2A 4GC6A 2F67A 1EGVB 3EAGA 3CR8A 4QFDA 1YR1A 1JVNA 4B47A 2P3QA 3W1VA 3QLVC 1S2NA 5LMUH 2R6JA 2OCPA 1AMUA 3BMQB 1V5FA 2OBBA 3O94A 3V46A 3ABRB 3DDUA 4G2NA 4ER6A 1RQLA 5FBKA 4DSOA 3R74A 5K8UA 3H3JA 4WFJA 4IF6A 3TAXA 3BS4A 5CFNA 2WIAA 3RK0A 4LMYA 4W9RA 1WUYA 2XITA 1MDFA 3EAQA 4WADA 1QPZA 5DG7A 1GEEA 4UDXX 1UK9A 4H4CA 3KOOA 2WV7A 4ZODA 1IY8A 1Q1EA 4RLFA 4MYDA 2AW5A 2C5SA 2I8LA 3OF2A 2ZSHA 3B8HA 2HIGA 1OYVA 3M1IA 5JJKA 4MR7B 3ESBA 2OG2A 3A70A 4JIMA 1L5LA 4Q8EA 3JASB 3KE8A 1P7ZA 5AO9A 1VRCA 3PE3A 2FAXA 3TEFA 1D4ZA 1UP7A 4A93G 2YRWA 3AU9A 4DEXA 4Z9FA 2E48A 2G6TA 2C9YA 2R92A 2G0NA 4DRYA 4AN0A 1YE3A 3E05A 1RJWA 2GUWA 3PC8A 5H68A 5I01A 2HQBA 3S24A 1QAMA 2Q3LA 4KRXA 3DEKA 1LBTA 1L2TA 5L7YA 1XYYA 1ZETA 2W83A 1ESEA 4D3SA 1R9GA 1KI6B 4Q3KA 1HDIA 4D0SA 4YO7A 3RS3A 2IIBA 3TYXA 4YDQA 5ARDA 1J5XA 1FU7A 3BA8A 3GJQA 1M6EX 2NMVA 4EGQA 3ABQB 4DDHA 2CK3A 4AIIA 1UWKA 2Q4RA 1UPAA 3QYJA 5G3ZA 3ZHXA 3L1IA 5KO2A 1H1LB 3QX7A 1T8PA 2J3MA 1Z5UA 2XX3A 1ECBA 2W93A 2EG5A 2FWMX 2ISSD 2YMLA 4G6ZA 4HGRA 4B32A 3UJPA 2F55A 4W8OA 3BJZA 2B3TA 2Q5QA 4DB2A 3EJWA 1NF9A 5JOQA 2PUBA 4MTDA 2ECPA 4QOJA 3LDFA 3K8YA 2CV0A 1EFRD 2GXQA 3DV0B 3ITNA 1RRFA 4NNJA 4AFNA 3MNFA 5FF9A 1H23A 3DAOA 1G8SA 3E48A 4R2KA 3LHSA 1AUOA 1ZD9A 3VHXA 3E53A 1WMDA 3K71B 3WL5A 3MUOA 4W5TA 4OM7A 4F3YA 3HOXG 4IPTA 5EUMA 4QATA 3UBMA 3NH9A 3W5DA 5FORA 4RA9B 2PRKA 1V9CA 4LE0A 1V96A 1NVMB 1NDUA 3EFOA 5F3DA 3EMDA 1FFGA 1XQ9A 2FPPB 5CEJA 1T4DA 2DG2A 3HOZG 2X2OA 2OZLB 1QSGA 5LOVF 4HB4A 5EE9A 2WQ6A 4ZHQA 2SKCA 1R5NA 1PK8A 2C4VA 2P11A 4FJ2A 1KDOA 3OFJA 4E5KA 2C2ZA 4JN6B 5EG5A 4H2DA 4E2FA 1XALA 1OGYA 1FLNA 1MZPA 3VU9B 2JIZA 3T1HH 4DWJA 5G0WA 1QMPA 4KP7A 4UCFA 3I6QA 3QEAZ 1U0NA 3OOJA 2ZZMA 3GLSA 2B8TA 4AJPA 2WKSA 3WMWA 1DRJA 5ADVA 4ARBA 2ZYVX 4LH6A 3QNUA 3RIHA 4U8GA 2FW1A 1VMAA 3I72A 3ADDA 1IAVA 2VJKA 4RJTA 3QF4A 2GMWA 2YV5A 3NIFB 3SGLA 2MSNA 3R09A 2P67A 4RTPA 1KFCB 1TKCA 4KXNA 1HSOA 5LMZA 1T36A 3U49A 2ZB3A 4I5DA 2Z6AA 2OXEA 1YOVB 1OKKA 1B15A 4TUYB 5JIBA 4DV4H 2R48A 4JJGA 2KW5A 2B94A 1SIUA 2NNLD 2PTGA 2VXCA 1IQRA 3FPFA 3KQVA 3GEBA 2OV1A 3Q8WA 3D31A 4KEAA 4ENTA 4DLBA 5CA0A 4M7OA 3KVYA 1WS6A 2B3DA 2BMWA 3KVVA 3NOQA 3AF0A 3WBJA 5E7MA 3UJDA 3NKLA 3QSYA 5F21A 4AS2A 3DUFB 3IVGA 4FZVA 3VV3A 3MBIA 1T5BA 1MBZA 3KAQA 4TLLB 1VE1A 3Q3JB 2HK7A 3K1ZA 4C0SA 3F9CA 4RLHA 2VAVA 1W0JD 3OX2A 1YO6A 4PCUA 4B9AA 3HB5X 1OBCA 2VDVE 3RJTA 2HUNA 2Z5GA 3V1YA 5HIMA 2JD2A 2HNAA 1GTG1 3ZR4B 2HQRA 2Y4RA 2R68A 3ZD6A 2AH5A 1ES9A 3OA2A 2X22A 1FS5A 4UQLA 3W78A 3MMNA 1VE7A 4DY6A 3NHWA 5AHRA 3ZGOA 3EZLA 4ZEWA 1TM4E 2DUWA 1S96A 4EYIB 2CD7A 1I5RA 3UAWA 1QGUB 3Q85A 1EB9A 2NN3C 3GGOA 4QHYA 1X87A 4P5PA 4DV1H 3CF4A 1DKUA 4Q66C 1MRZA 3FKSD 4J9PA 1KNQA 1PR6A 2QU7A 3DVAB 1UODA 3LX8A 2FX3A 1FNSA 2CZQA 4QVKA 1XZAA 3WLTA 1KK1A 4EO9A 1BEEA 4CLXA 4ZD6A 1GAXA 2IZ7A 4JUZA 4J9MA 5HCUA 3ND6A 4XI9A 2OGUA 1XCLA 1XMIA 3DBVO 1CDOA 3M9OB 3H5WA 3U9LA 5GONB 4YRPA 4LRWA 2I87A 2VYQA 4Z3DA 3TQCA 1UOPA 1N2IA 1J8DA 5B6JA 2ZKIA 3G2MA 2HGXA 3W5HA 2V7VA 1F0NA 1PWEA 1CKNA 4GYYA 5KUTA 4N3AA 1JSCA 3IKJA 1GLVA 4DJAA 3EIQA 6CHYA 1KY5A 3P9CA 3X1WA 1PR5A 1U4OA 3DB2A 3GV0A 1RMQA 4IV5A 1ADFA 2W6ID 1S8NA 3WK7A 4US2R 1NNEA 4O7VA 1FQOA 1GRQA 4DUPA 5AM2A 3BJIC 1SUDA 3TNFA 3QQPA 2VA3A 2A35A 2ZAGA 4UAGA 1KRHA 3UC9A 2YVKA 4MRNA 4L8VA 2ALJA 4HF7A 2V7GA 2CLSA 3NAGA 3C4QA 4R41A 4NMLA 5JH7A 5B58T 2C29D 1NJGA 1PUXA 4X65B 1S0OA 2FV8A 4OA8A 3N5CA 2Q9AA 3JYOA 3MAJA 1TDJA 3KB8A 1F4LA 4MUGA 2I3GA 2R751 3WA7A 1VRWA 3VPCA 3SZRA 1LDEA 3B3FA 3ZU6A 3GLFE 1JEAA 3PZRA 1NULA 3SBXA 3MB5A 2AQIA 1E89A 1LBQA 2CUTA 3LCUA 2GNAA 1JT9A 2X0FA 1RD4A 3GG9A 3AF4A 3LRXA 3EH1A 3C8ZA 1Z34A 5K3AA 2P5TB 3TIGA 2TMYA 3TGPA 4FCWA 2BDUA 5B3LA 2J4DA 3N28A 5M34A 2E2WA 3IVAA 1XNRB 4PHHA 4BQEA 3CGGA 1ANKA 4MX8A 2FTKE 3BERA 5LOVA 4I4NA 4RGQA 3LWZA 4US1R 4W6ZA 2CWDA 2GPBA 2VRCD 4R0NA 1AS2A 4O4IA 4C2BA 3I3OA 2XNCA 1M6VB 4FD2A 1KKLA 4HSGA 2XIJA 2XDQB 1UMDA 1YS7A 2IS6A 4LZZA 3KQTA 2ZJ0A 5TVGA 5DHRA 1CUEA 2UXDH 1S6YA 2P91A 3B78A 1B2RA 1U1IA 1RBYA 4Q34A 4Z7OB 2ZB4A 4JSYA 3OZUA 1NF3A 5FBRB 5DM2A 4EB6B 3GZ4A 5IWAH 1CYEA 1WETA 3Q10A 1L5VA 3SSAA 1GZHB 4OATA 4MVJM 4B6JA 1JXAA 4TYMA 1WOYA 4I8IA 4E2YA 5J2UA 4UUPA 3UXEA 1N78A 4DR6B 4TN5A 4M89A 4OIMA 2IUEA 3RTEA 3OHPA 3I2FA 5K3FA 3WB0A 1WKCA 4DKXA 3WTCA 1SXHA 1HG1A 3NHSA 1P7WA 3KVNA 3KUUA 4PZ6A 3MT9A 1P4JA 4ID3A 1T5OA 4G9GA 4LWQA 2QLFA 2YHSA 2G3YA 2JIMA 3ONVA 3BHNA 2FEPA 4YJ2F 3GZNA 5A9SA 4DR4H 1E58A 3L6CA 1CK4A 4GMDA 4H6XA 1YVUA 4U5XA 5AM1A 2EFYA 1RXCA 4JVMA 1YR9A 4Z99A 1Z12A 3K92A 1GD1O 4PZPA 2VRNA 5CAEB 3B6KA 2BBSA 2Y66A 4O2BF 4IQ4A 5IJ0B 5YASA 2YOFA 3H5IA 5CDHA 3L6RA 3AHEA 2JJ2D 5LP6B 4HQ0A 1ORIA 3DMGA 5EERA 2J7PA 3BUSA 2HN9A 2EBHX 4DFDA 3E3OA 3MOSA 3G6YA 2GF2A 2RIPA 2UVDA 1RRKA 3NOVA 4DL7A 1E99A 2DY1A 3G0GA 3JQ8A 4JK3A 3W2GA 4FOLA 3GLRA 3T4EA 1EVQA 3BF7A 2JG3A 3RAFC 3K9BA 1C7JA 1O77A 2HO4A 2R4TA 1HYEA 1V11A 3DHEA 3SS7X 3I1YA 2JC3A 3AFHA 1WSWA 1KTAA 3Q8QB 1NUQA 3IIJA 2YV4A 4KI7A 1O95A 3H40A 4U02A 5LBUA 3W5JA 4CLOB 4IEEA 3TX2A 4RZSA 3SX2A 5KTNA 3OI7A 4RKWA 4YRTA 3K0FB 1QV9A 5LDHA 1AQLA 3GTOA 4KDCA 3HKZE 2C3OA 3WZ2A 3UZOA 2W2OA 2XAUA 4YQZA 4N8EA 4OLJA 2QLLA 4M7RA 5KT2A 6ABPA 2WWGA 3B1WA 4P53A 4Q7QA 3WQHA 1U0EA 4TWJA 2IT1A 3W1GA 3IHWA 1SXJB 1RYHA 5KTPA 1K83A 3T5MA 1P1CA 4R5MA 4ILEA 4KXVA 3FDFA 3U16A 3OTQA 1XTQA 1O6BA 3GNLA 4YS6A 2IYSA 1RXSA 3THRA 3D7LA 6GPBA 1HOXA 3KQMA 3GUYA 2C83A 2MSLA 1ESMA 5KFZA 1P1RA 4E46A 4H1WA 2CF5A 5LXTB 1RVV1 3AR7A 1U04A 4ZT6A 4ZO4A 3TOZA 1H22A 3IPAA 4DV3H 3PR1A 1CULC 3QTLA 1X7XA 3VTAA 4L4RA 4BNDB 1PHPA 3GEEA 1J25A 2JZCA 1OAAA 4KLRA 4UBOA 1SG0A 4UCTA 3WNBA 3BXGA 3HDGA 2J3KA 4KN8A 4ED9A 2LV8A 3LC7O 2FWNA 3SSNA 3K09C 3H1BA 1F6WA 3KXIA 2Q0QA 2MT9A 4HEQA 5KT6A 4FZ5A 5ELLA 2J3EA 4B35A 3BMCB 4UTVA 2APJA 3G7NA 1K68A 4F7WA 2P3SA 3BX1A 4JQZA 4QASA 3LRPA 4A2QA 1Z8NA 4YQWA 3KAKA 1L4NA 3IHKA 1IN7A 4PFJA 4ARIA 3MHPA 3OOYA 5EJ2A 3T34A 4H4EA 2IPNA 5J63A 3FW1A 5C8YA 4F9EA 1OXTA 1SXQA 1V6AA 3KXKA 3IE0A 1A4RA 4F4WA 4FGZA 1PW5A 4JLAA 2VAXA 4A5OA 5CW2A 3H0KA 1XAGA 1QIDA 2COKA 2DABA 4ZREA 4AZ0A 4LF6H 1TTQB 2XMGA 5FOXA 3SPXA 1ECCA 3H97A 4L73A 1A95A 1DXQA 3G2HA 1E2HA 3L0DA 3IUJA 2Z43A 1P62B 1UJNA 3VR3D 4J1NA 5ALOA 5FA8A 2ZI4A 1DJOA 2I4RA 5KOHA 1Z33A 2BBWA 5K6AA 2O8CA 4UUGA 5U1PA 1GUDA 3GAZA 2JFUA 3CPHA 3KQLA 3UM9A 5KYKA 3M2PA 4LDAA 5EEGA 5FHQA 4KE6A 5JAHA 3WJ2A 3NTOA 2V6BA 3H3XA 2OD2A 3P9YA 4BP9A 2J9YB 3F73A 3NORA 5C51B 3V8VA 1WPGA 4YK7A 4D81A 1G3UA 4JP5A 5KOYA 4JIGA 3OEWA 1PR0A 2BHSA 3RHZA 3RW9A 4Q7EA 3TOCA 1FTGA 3FMOB 4YNBA 1HE5A 1K66A 3KHRA 1CUWA 1VRVA 1UBOS 4ZI7F 4XYGA 1RXEA 1C1DA 1WBDA 4YJ2A 4XCXA 1XNHA 1XTZA 1AQIA 1JF8A 1W85A 4AI6A 4IGAA 5DSXA 2RH4A 4TLMB 5FTWA 2C7GA 4D8YA 3R9XA 5BWLA 4WNAA 2QRPA 4R1PA 4N18A 1CW2B 1PRYA 4IJQA 4RTKA 1S2IA 3W5AA 3EXHA 1TK9A 4BVAA 1VLHA 4QICA 1DQNA 4S05A 3LT1A 3R3XA 1KJ8A 5TPZD 1QGED 2B1IA 4O2BA 4E5UA 3GLIB 1VM6A 3M4NA 2ZQ5A 2Z8YA 2KHZA 2JIPA 4L1KA 3G1UA 3MWYW 4MRMA 5BWNA 4BLRA 1VKOA 3SC3A 1IN4A 2GF0A 1Z0AA 1KSJA 2L0XA 1HO3A 4NYIR 4DQLA 2QI9F 1QP8A 3N0XA 4JENA 3QP9A 2QR3A 2QVYX 1JHDA 2PFSA 1UKYA 3RANA 1ECLA 4AP9A 3QY0A 3CW9A 3VC7A 1RPNA 1W5BA 1EFRA 1XXHE 4HFMA 4NWIA 2ZT7A 1PLLA 3EQ8A 4JC4A 3ZD9A 5KX5B 4F85A 4PZ8A 1VFNA 5GZ1A 3HU5A 4FC6A 4J9OA 2OECA 3TAUA 3G7UA 1L7QA 4ROTA 4FX2A 3MTJA 3OUUA 4W63A 1BCSB 4HNGA 3EGOA 3QMWA 1Z2OX 3MSCA 1XZCA 2A0FA 2AYZA 1TADA 4QOFA 3TNDA 4X3OA 3RNOA 4FSDA 4YBZA 1BKSB 4NLLA 2XGMA 1U0LA 3FF4A 4BX2A 3G7SA 5TJHA 3BFPA 1PQPA 2DPJA 4DARA 1NXXA 1Z62A 3KVOA 1ZMTA 3A4IA 1ECPA 4TS3A 4IXTA 3F5MA 4BO0A 4HMQA 1SQ6A 1JAZA 4UHBA 4EUFA 4ZVMA 4OHXA 4YRAA 2JH9A 2W9BB 1DKPA 2XQGA 3E5RA 3MRXA 2YJNA 3SC4A 4HBZA 4OUDA 4E70A 4ITRC 2WE6A 2BELA 4UUBA 1NW7A 3N7UA 3CVVA 3OQBA 1W52X 4NPAA 4MVJD 3T3GA 3EVTA 1U7DA 1NXSA 3K2EA 2HBRA 2IE0A 2X7HA 5GM2A 4F71A 5BUCA 3V6HA 1HT3A 2XUIA 4BP1A 4LZAA 3V80A 1QE3A 2WZQA 1J8VA 3W5BA 4N76A 4QUAA 1JX6A 4IVQA 3LZ6A 5MGNA 4JFAA 5DNAA 4A3SA 3C3PA 4C05A 2G17A 4P4UA 1XZDA 1AKRA 1LKZA 5T4BA 4JC0A 4NV3A 4DS3A 2A9VA 2QN7A 4U00A 4BS9A 4IFBA 3RU3A 2G9VA 3M9NB 3FLBA 3NWOA 2HA2A 4EFKA 4MRVA 4J0HA 5K0EA 4YROA 3RYFA 1FUIA 2D6FA 2IC5A 4GR4A 4GG1A 3CO0S 3S0JA 5FBQB 4Z6KA 4IMPA 2XGGA 2EKLA 5GADl 4X60A 4JYZA 3O7WA 1DOHA 3SKXA 1EEXB 1C8VB 4YCMA 1YDHA 3M49A 3M1YA 1IUKA 1FBTA 4HPWA 3U7QA 3HKBB 3ERCA 4FR0A 3PC3A 2OR3A 2R1VB 3LA8A 2ZTMA 4NK5A 3FR8A 2C5FA 1NPDA 4JLUA 3N5KA 2FLPA 3L7LA 3I9KA 4B3RH 4EFMA 3H1PA 4E08A 4M98A 1LQUA 2JCVA 1OC4A 4FUTA 4B31A 1DQRA 1U28A 4OSEA 3L92A 3TW8A 4BO2A 2HX1A 3O4HA 2GUGA 3PI7A 4YAIA 4CKEB 4BKRA 3HN7A 3IAEA 1D4OA 1KYIA 2G9RA 3G2PA 3OQMA 2HR1A 4YUXA 1BFKA 2QYZA 2OK7A 3CNHA 3GD5A 4BFXA 2HSGA 2GOYA 4S04A 4PYQA 3JWGA 1M6NA 1TLLA 3FJOA 3D4LA 1FFEA 3VU8A 3FKSA 4A0SA 3U4CA 4RGVA 2QTBA 2K87A 2JS7A 3LW8A 2JA5A 1R74A 2DECA 1ZESA 1K2VN 3LO8A 1P75A 4F9FA 3EULA 4HP8A 1CD5A 2IMWP 3RV4A 2RGGA 1QX3A 1EVJA 2HF9A 1F8FA 5KYNA 3UJHA 4EIWA 2Q3CA 1IK4A 1SNYA 2DWQA 4ZI7A 1AE1A 3EVAA 3FWNA 2OYCA 4DA8A 3MWFA 4K40A 4X64B 1VPTA 2ZR0A 3TGLA 1TCCA 4A3JG 1K1EA 3TLMA 1YC2A 4AB1A 2ODAA 4BFVA 4ETNA 2H1SA 4U4AA 4L0CA 5ALVA 4BUZA 4MCAA 1U5BA 4HNTA 4HUQA 3E23A 1SHLA 2EG9A 3GGCA 3M3HA 4B80A 2C9OA 4ML3A 3PNOA 3U0BA 1R9TA 2ZXEA 2EW2A 1DJLA 3C43A 4DREA 1LW6E 4N54A 2FPIA 5AK0A 2BTQB 4K6KA 1HZZC 2NYVA 3CUUA 2W6IA 3VU1A 3MB8A 1U2QA 2GPWA 2LUOA 2C7RA 4BN5A 4LSAA 1HZZA 2R9VA 1Y1QA 2IDZA 1SCUB 5JCPA 2HHLA 3PT5A 4GRAA 1D5WA 4ZQFA 1MMFB 2YYAA 2WZCA 5BNFA 3PUZA 4UEJA 1M1UA 4GZLA 3I2KA 4Z4GA 2IHBA 4HTFB 2FE1A 3PGLA 3ENZA 1BZYA 1Q14A 1MC8A 1KVTA 1S3IA 4YRNA 4MGHA 3L4SO 4DT1A 3KSDO 2OHHA 1QHHB 4NE7A 2O2SA 1JHZA 1JG7A 3ZLBA 4X6YA 1DGQA 4O4JB 1TIKA 4AWXA 3QLEA 1P6UA 1SKAA 5IBCA 2ZUBA 1EFVA 1MGOA 2DPGA 4H6PA 2WAOA 2HMYB 3TINA 1O2DA 2DR2A 4Z4FA 4UM5A 1XDWA 4NEGA 5DX0A 1PZXA 3RU2A 4E2XA 5KJ1A 1ZUD1 4KBYA 3VR4D 4GXQA 2DQSA 4XFKA 5KNLA 5EEHA 2OK8A 1P1HA 2VQEH 5K3BA 4P7JA 1KZYC 2RONA 5KU1A 1YIAA 4MW4A 4DV7B 3I45A 3KTMA 1V25A 2I33A 1KO1A 3HHEA 1Q3TA 1D1TA 3TBHA 1P16A 1U02A 3Q7SA 1TZ2A 4C7KA 2GFQA 4MYSA 4Q4DA 2MYNA 3TQRA 2PV0A 3HDQA 5ICCA 4LHYA 1Y8RA 5C52B 4LGCA 2R6ZA 4CQMD 5FWXA 4Y0NA 4NAUA 3EGVA 2EEPA 2ZTLA 5HJEA 1U1EA 2HM7A 2QGFA 1POXA 1T9HA 2WTFA 4LSZA 1MAWA 1APBA 3WYEA 4AKEA 2JH8A 3U7JA 2ID4A 4PU0A 2OUIA 4UCQA 1H3NA 3S4YA 3PX3A 2NO1A 4OHPA 3IG0A 5I7UA 3OFKA 4DDUA 3AZQA 3G5LA 1XKXA 4EI8A 4QTTB 3H84A 2XUAA 5EY5B 2ZYSA 1LA2A 4CM3A 3GLQA 1LWNA 3FGZA 2VJPA 4BFZA 2XJ4A 3F8WA 3U62A 2LBPA 2D0PB 4KH0A 3E7WA 1T9GR 2WTBA 1P33A 1FFBA 1A98A 2GS9A 4WCFA 4MTEA 2B8NA 4IUDS 3GA7A 2QMZA 4WCVA 1USKA 4EFBA 4ZOLB 5IVKA 5E4YA 3AVTA 1T0UA 2HU7A 4L5CA 1D9XA 1EVIA 2YZNA 3HL4A 1OTXA 3QSGA 3NBUA 1VA4A 1T24A 1NIPA 4M87A 1JPVA 3NM6B 4YUVA 5HUQA 4Y6PA 1KI1A 2QR5A 5AOVA 2BR4A 3ZV5A 1MPTA 1X9IA 4UBJA 1V1MB 2AI1A 4FWBA 1XCGB 2AKYA 4U2EA 3EDMA 2QAGB 2VDLB 4BJ3A 4RD6A 3KPUA 1O7JA 2QZPA 4YLYA 4H9GA 3AKYA 1CF2O 1U3FA 1XZJA 4EFEA 3GFOA 3SVTA 1CE8A 2IITA 3I6YA 4DHWA 2GM3A 2AF3C 3HA7A 5JVLA 4C3ZA 3QPBA 4R84A 4JV5B 4HFNA 4DM7A 3ESDA 4LJSA 5EIAA 2AXNA 3TSAA 1ICEA 1WCIA 4HD8A 4HAVA 3JAKA 4N03A 4REOA 3Q3GE 3A04A 1PL0A 2YX1A 1JHPA 3SYNA 4WKCA 5IMSA 2X1HA 3H13A 4A8JC 3NIGB 4NAVA 2XRFA 3L0YA 3GTKA 2ORYA 2P6MA 3AW9A 3GIIA 2DEUA 1GKYA 5HCIA 2F3PA 3BJRA 4F04A 5B12A 4RA6B 3CUTA 5I5YA 1YQTA 2ZGVA 4KAFA 5L45A 4CWAA 4D42A 2PIDA 3K72B 3QFRA 3T9DA 3PC4A 5TXGA 3PPXA 4BX3A 3HTXA 3OFND 4WZBA 5E3JA 3OLCX 3OFVA 2X13A 1PFYA 4M0JA 3FNGA 4EYOA 2QVCA 3GLGB 4QYIA 3K3VA 1RWOA 4WH0A 1IBMH 4MVJF 1EFPA 3ETEA 1W88A 2ORED 3CUVA 2CV2A 2RHMA 2R4QA 1QOPB 4U2BA 4ZAFA 4HX5A 3FB1A 1HEYA 4ZJPA 1G60A 4MVYA 4RNOA 1XMQH 4DGSA 3VM6A 4HS4A 4ITUA 1C41A 1H4QA 4ZGBA 3HPQA 1I01A 1J06A 1PS8A 1S9DA 3KO8A 4K9OA 4CODB 1YKSA 3FTEA 4QPZA 5H4GA 1J0DA 5LZ9A 2PS3A 3W0LB 1WKBA 2K7ZA 1PEAA 4IJ6A 4AS3A 2F90A 2QX9A 4YEDA 3IAM1 1A7KA 4WLEA 2QKYA 3WRWA 4AMVA 1K89A 1P4GA 5MN4A 3N0VA 4UZEA 1DIHA 3TZEA 4UPDA 2OMKA 4C6RA 2YJ3A 4Q9JA 3PVXA 1A9XB 3X1XA 4EGFA 4LXHA 4X8MA 5C9ZA 2ZANA 4MVXA 4ENVA 1ZOIA 1RRPA 2QYTA 3FVWA 5DHPA 4QJBA 3ZU2A 4ZCTA 3R7DA 2E85A 3G8DA 3H75A 2QQGA 3SMQA 4LRTB 5JZMA 1N7GA 3ES9A 1X7WB 2WT4A 2ZWAA 4HAYA 3Q87B 4P58A 1OBDA 1WP4A 4MS1B 1E9RA 1KOLA 5F1KA 1CQJB 2IV3A 2N42A 1HL3A 4QTZA 1FJXA 1I1MA 5DGBA 2R6CA 2CMKA 2CXQA 4G9EA 1RAFA 2A0YA 1IBLH 2HHJA 2PZ8A 2X2EA 1VMKA 2JLUA 3OJCA 1N2HA 1QHFA 1B04A 1BEUB 4FNMA 2DWCA 1WF3A 3KTFA 2XC9A 3KEOA 4G3XA 4WXEA 5F9LA 4URXR 2QW1A 2OAP1 3SJ7A 3REFA 5T57A 1TEZA 3RU7A 2BISA 3N6VA 1V1JA 4R9NA 4F6RB 3FZYA 5EQFA 2YUTA 1AA6A 5KQMA 1NBOA 4Q48A 1FW6A 2CXNA 3T3IA 1L5OA 3LA6A 4DR1H 1NWCA 4UBKA 2VLIA 4LPKA 4I9NA 4MS4B 3H2ZA 3DAAA 1H2YA 3AERA 1FRQA 1R8YA 5HF5A 3HN6A 1DV1A 3TY5A 3OPNA 1J42A 4FZRA 4JVLA 2AN4A 4I9FA 2FFQA 4GRIA 4HAWA 1MAAA 2Q0SA 2Z9DA 1OD6A 1FMTA 4RVUA 2COIA 4RKQA 2P2GA 2VJMB 3BIXA 2Q3BA 4Z4HA 4KO8A 4LBYA 4R8UB 2BFOA 3FHTA 4UHDA 2HMVA 3E0QA 1HT1E 3NANA 4FS2A 3NWPA 4QOGA 4IR7A 4OI0A 4L8WB 3UMMA 2PX5A 3D3NA 2RGDA 2G9QA 4M1EA 2X5JO 3VZQA 5IK2D 1XRQA 3BCHA 5FWDA 3EBOA 4URVR 5IF9A 2IPOA 1F2UB 3KZOA 5FBLB 3V3KA 2P2NA 1C9NA 3WDSA 5JPDA 5LYJA 4F1WA 1O8BA 4IDCA 2QMQA 2ZJ6A 1CU1A 2WD9A 4BMPB 4R1SA 3IP3A 3N75A 3JWJA 4JBNA 3T9AA 2QQFA 3EF0A 4O2LA 5JMPA 2P9ZA 1JDJA 4B73A 1PZMA 4BKQA 5AYVA 3CNOA 3W6ZA 4Q82A 4IRCA 3KEFA 2RBGA 4J2OA 3LYAA 3A2LA 2BUCA 4UKDA 1EHYA 3WGNA 4QQKA 1OZFA 2LDXA 5JVDA 1QOZA 1V35A 3U1TA 1P19A 1WZ2A 3O9ZA 1NE7A 3RVSA 3SR0A 2VOJA 3IDSA 1V6CA 3HBJA 4JDPA 1VC2A 4JVSB 3BILA 1YRBA 3ZK8A 2JLAA 2F3TA 1Y7LA 5CX1B 1VBHA 2VHVA 3MTBA 4DQ0A 1UQRA 1R8XA 3FOWA 5DWQA 1JA1A 1Z0KA 2UAGA 3HRKA 3G6KA 3JQ9C 3QLVA 1NQAO 4F97A 4WJLA 2I0FA 3QX3A 4CMFA 3ROPA 4B3DA 4HEA6 2O2HA 1KQPA 4XIJA 3JQ9A 2QRGA 4BMYA 1KS9A 1RKUA 3VMMA 3Q5GA 4I5EA 5KDDA 1JH9A 2Z2JA 1LB1B 4EG0A 4GX5A 3VU3A 3AGPA 3PR4A 5L3RA 4IM7A 4MVJA 1YZUA 4KN5A 3I30X 4YBRA 1QHGA 2B30A 5CB0A 1QU3A 3A1WA 5JNSA 4PHFA 1DNPA 1MT3A 3EGIA 4JP1A 4BO8A 2VP0A 4XQ9A 4ILKA 1OH5A 4M1MA 1A9QA 3ENKA 3BMXA 3M5PA 3NVKI 2XOKD 4YRIA 2GSDA 1T5DX 4RTSA 3AUTA 1VHQA 2P79A 1Q2XA 5KNDD 3DOIA 3EVEA 1HFWA 4P9NA 5KNBD 4FR5A 2QTNA 2E4WA 1N5IA 2G0AA 2Q5LA 3R0JA 1ZLXA 3UT5B 2EV9A 1YCDA 1YASA 3AL3A 2NUTB 1KOGA 4NV1A 2ZRHA 2MSWA 2W6PA 3AHJA 4MI3A 4CKCA 3Q2OA 2O06A 3U3ZA 1TQ6A 3DWFA 3MR3A 2WDZA 2WHEA 4REQB 4HY3A 3G8BA 3NHLA 1UPBA 2BLNA 9MHTA 4BE7B 1P2BA 1JFFB 4RV5A 4BFSA 2HIMA 5K0FA 4G4SP 2J5KA 3GQBA 1QRAA 3K3PA 2I03A 1Y9DA 5HJ5A 4B6FA 5MF6A 3KTAA 2NZJA 1R0LA 4B33A 3NQ41 2ZJAA 3ZTWA 5L3ZA 5CXQA 2CNKA 2X40A 1BMDA 1ODCA 2B78A 3PD7A 5JH7F 1G20B 4E1BA 4MWSA 1N3YA 1YE5A 3WBBA 1PV1A 3LX6A 1QYDA 4MLCA 3AR2A 2PUGA 1SGWA 1JJVA 3LBYA 3OEED 3PGMA 2CCJA 4OHZA 3FA2A 4IV0A 3D7NA 1P5HA 4DC1A 5I5VA 3OPQA 2V1XA 4X61A 4DCSA 2WU8A 4UZFA 1NI4B 3CV3A 4ZEXA 1ZW6A 4BXXG 2ANBA 2JJ8A 1N4DA 1ZD2P 3GR6A 4HGPA 3KYDA 5TPWA 1YSCA 2VI5A 3HY6A 4ZGWA 3IQWA 5AXDA 2EKDA 3V5NA 1C7EA 4A8TA 1W4ZA 3MXOA 1QCZA 4WOPA 2W9AA 3NV7A 3HGTA 1Q0SA 1YZGA 1Z2PX 4ZYWA 3NXKA 1RJPA 2DYKA 4RPJA 4O4IF 2IYUA 1SA0B 4ARZA 1PYGA 2WLSA 1NONA 4EY4A 1XSEA 1PL8A 3I39X 1R6BX 3SFZA 3GRZA 5ICFA 1JIUA 2P6PA 3D3WA 4JQCA 1JDUA 1C7IA 1WULS 4YJFB 3W4KA 5LQCA 1X1DA 4H3HB 1K06A 4M55A 4R9UC 2DSNA 3EXFA 2R93A 4TTPA 1VIVA 4R9VA 3GGGA 1J0AA 5JG7A 5KFWA 3JVEA 1V8ZA 1VGQA 1U2SA 3THYA 2J30A 2J87A 3DR3A 1EDOA 3W3AD 1PUJA 3N9IA 3I73A 2OYRA 1V3QE 5J2UF 5JAQA 3G3EA 4HDSA 4MV1A 3EZXA 5F5XA 3QBTA 2MJLA 1GRRA 3AIMA 4YPVA 1MZVA 2YJ4A 4FYKA 1PS0A 3VX4A 1UADA 4PSVA 4GWLA 2WTAA 5U9CA 3GEGA 3UTCA 5KMGA 3TFOA 5AP9A 2RD2A 3JQGA 4GVXA 1WAMA 4RS3A 2HDNB 5DISB 3EUWA 5J5VA 2CD9A 1D3AA 1FUYB 5FDFA 1U0RA 4E51A 3KL4A 2IVZA 1V1RB 1TLFA 1HT2E 5KT7A 1FTSA 3RUPA 1A9TA 3RTXA 2A1HA 1ITZA 3UAOA 1XDUA 2F9FA 4D4GA 2AVDA 3HJCA 4G0QA 3DJYA 2RCYA 2D59A 2DFNA 3MTGA 5MN5A 5CCBA 2VR1A 2R66A 3DAPA 1VBFA 1AV6A 1AKMA 3WLMA 2J6CA 4G1FA 1KMHA 2B4KA 3PNQA 1CPYA 4WXRA 1WBJB 4HB0A 3M82A 3NHBA 3EZNA 1HMYA 1W73A 4GYKA 1CERA 4GI1A 1UINA 5CDUA 2WWFA 4G4IA 3RB4A 2G6BA 2O8EB 2X0EA 1Q11A 2F48A 3H1FA 4IDPA 1JEQB 4FEAA 5EYPA 1EGAA 1ZK2A 5K8IA 2COEA 1N75A 1F0YA 2PT6A 3KSZO 1M5RA 4FIZA 5FL3A 1UXGA 5JCJD 4X90A 1H8HA 2OXIA 3N6RA 2EZ8A 2PUAA 1JLSA 4HZIA 1KFBB 3KZKA 1QHNA 3CUEF 1R18A 3FSJX 4CQMA 4INPA 3LXMA 3TO5A 3IERA 5DN6D 3NDPA 4ZYXA 2F9MA 3LCVB 3MN1A 4OB8A 1GM5A 5L3QB 5DK6A 4GI5A 2VK2A 3FYHA 3QK7A 5KQGA 5TJ9A 2J0UB 5EMMA 2ZBRA 2H8GA 4RHFA 1AMOA 3UHAA 4JHLA 2J46A 3AG5A 1IXSB 1PO7A 2XEDA 3ETHA 2PY6A 4V0RA 2EGGA 5IXYA 2GH1A 1P45A 2ZR9A 4X65H 4IUCS 3M89A 3M4XA 3TKAA 4Q4CA 1CNMA 2O05A 2C2XA 5ITVA 3OIWA 3TECE 3RFUA 3L8YA 4IGFA 2PMKA 3HKDB 4HVLA 4EITA 3CBGA 3E0XA 1I6UA 4RD0A 4MUKA 5K0SA 4CM1A 1SOMA 3W04A 3OHBA 3RJ5A 4OUKX 1ZOLA 3HVHA 3N0RA 2E3JA 2ZR8A 2H92A 2NW6A 3PCTA 3PRKE 4ZVTA 1X9NA 3EA5A 5BR8B 7REQA 4OXXA 1L3CA 4P3NA 3SFTA 3HXPA 2IIQA 3U19A 3QVUA 4C7VA 1NMYA 4JYMA 3DWEX 1SBYA 4YRLA 1MXFA 4O7NA 4MUJA 2WM3A 1WB6A 4U63A 1R7RA 1Z4PX 1ORVA 1WHSA 2GK6A 4I3FA 1IM8A 2NU7B 2DBVO 5IDXA 3RC3A 2DERA 1Z2EA 5C8YF 5BV0A 4LGYA 1BW9B 5DT9A 3OX4A 5C1OA 4L75A 2OOKA 3W2TA 5BQFA 3ZGYA 4JUFA 3CKLA 2PGDA 1JSRA 1R5JA 4YUWA 1YHYA 3EMBA 4JELA 4DR6H 1UXHA 4KYVA 3CSSA 3RSSA 5DYIA 1RCFA 1JI0A 1GAJA 4GWKA 4IXNA 5GIOE 4NYEA 1GO2A 4R2IA 5HNKA 4BC0A 5HUJA 1K5DA 3EZGA 3A1EA 5B36A 5B7GA 4BNXA 1ZN7A 1HFEL 1EUDB 1Y82A 2AOTB 2I65A 1V7CA 3OFNA 1NXTA 3AY7A 1UANA 1E1QA 4Y2VA 4L5YA 2ZUFA 2BAGA 4PGFA 3WWPA 2Q5JA 3HP7A 5B5SA 3EGCA 2G88A 5TS3A 2BRUC 1WO8A 4LRXA 3TVTA 4LK3A 2FMKA 4L85A 2BRUA 1WPXA 4YAJB 3H2GA 4Q02A 3ISJA 2R92G 4Q93A 3QI7A 3O95A 3QPAA 1SVMA 2OILA 4JJ8A 3Q3IA 3ZKWB 1H9CA 2W0SA 1AU9A 3U4QB 2YZ7A 1EA7A 3K35A 1ILWA 3SM9A 2CXSA 4QAJA 4V03A 3DMNA 3GAFA 3UK1A 2WSBA 2IE8A 5FH9A 3FFXA 4UBIA 3VU0A 3LVFO 1P73A 3ROEA 5E2IA 3SIPA 4FMPA 5JCXA 3F8NA 4P7FA 1CLUA 6LDHA 2BUBA 1GPKA 1YK1A 4QZVA 1KQFA 4IAOA 1REQA 2X9LA 1UK6A 4P7KA 2GJAA 5D7BA 3K5HA 5I4KA 3RO7A 4JU9A 4ZGGA 2NO6A 3Q7QA 1TT5A 2VQ6A 1K4KA 1E6EA 3JU3A 1THZA 1I13A 4ZMSA 2VZLA 2QL5A 5HRCA 1ULHA 2Z9BA 1NYQA 1VSTA 1B0ZA 1Z6AA 5IM5A 4IYJA 1V51A 3DCJA 5H70A 5ALQA 2ZJOA 1V7ZA 2XUGA 3KKZA 3JQAA 4BVJA 1V95A 3LMKA 5HX7A 4XCQA 4HDKB 4M0LA 2ON6A 3N76A 1I94B 3ZBPA 4IIEA 4W9MC 2UZAA 3DE7X 1Y5MA 1ZIOA 2GLUA 2XNDD 4DVGA 1RABA 4X9XA 1XPUA 5AXAA 5LNK6 2Q6OA 2WFZA 2XH8A 4LQDA 3JAMW 1FRNA 4HNSA 5CK4A 2IS4A 5IP7G 2HRZA 3F5FA 5DRTA 2R6HA 5ILOA 1WIWA 3CZRA 3ZKAA 5C7YA 1RWXA 1P0PA 1B0PA 3TPCA 1W75A 2DPLA 2WUGA 1W35A 4IL5A 4WK4B 3I9NA 4J9RA 2C2WA 4LMRA 4IIJA 4LN1A 3NHMA 2XSZD 1M7BA 2GPNA 1JDPA 3GTQA 1DARA 1AD2A 3I34X 1RE1A 3QE3A 3BD9A 4YDSA 2V65A 3LP5A 1JL3A 2PD4A 3OJXA 1E64A 1IBCA 4NDNE 3RVBA 2I7CA 3LS2A 2PMBA 2M6RA 4WERA 2IZ6A 5KJFA 1Z4NA 2B20A 4EI2A 2CDAA 3A6FA 4FYXA 1T10A 1T4CA 5JAUA 5ES3A 1U81A 4TMYA 4BFUA 2QNBA 1UKEA 3G79A 2PUFA 2ODWA 3FDZA 2VH2A 4TSFD 4LXXA 5KAMA 3GIDA 4LWOA 2OG1A 4PYRA 1U2PA 3QQMA 1IHYA 4KMOA 2B25A 3KX2A 4LYGA 2B4TO 2CBXA 5IK2A 1FLAA 1V26A 2ADFA 3RUDA 1MF7A 1BYIA 2BW0A 1BS9A 2GVZC 3MCZA 3BHIA 1O97D 4AAYA 2WOOA 1KVSA 2I4MA 1L5HB 3DE3X 4YO8A 3PS9A 4C3OB 4I2VA 2XZLA 1TEHA 2ZBFA 3VQTA 3K09A 2E82A 4OB6A 2VKTA 5AXCA 3LNCA 1KAQA 5CVJA 4O7ZA 4WKPA 4KIWA 1XAHA 1XWFA 3BREA 4LDJA 5T3YA 2FJZA 1Q3KA 4IEFB 5ALNA 4HEHA 3BZWA 1UBTS 4K9SA 4DCNA 4LMPA 4HQNA 5B57C 5ALKA 2ZBGA 2GK4A 2BHRA 4X7PA 3GQVA 3WIVA 1ZM2A 4LFBH 2XVMA 1ZJZA 2W8ZA 5LQMA 5FKJA 3UKDA 2GLXA 1SU4A 4F4HA 4G8CA 3L8MA 3SN6A 4JJ7A 4PINA 1V9PA 3I0ZA 2V0GA 3PXEA 2ZDHA 3AKCA 2LCQA 5JSFA 4A0HA 2RI0A 5ALJA 2R7ZA 2GFHA 3A32A 5CFQA 4HB2A 5BWVA 4FE7A 1MEOA 5ALZA 3O1JC 1LRLA 3HEAA 3SMVA 5A5DA 3B12A 3QEOA 1ZCZA 4P0QB 3CF4G 2P9YA 4BHTA 4IDAA 3ABOB 2P65A 1O96B 4P98A 1ZCBA 2ZGIA 2FLWA 3A6PC 3R9RA 5B1DA 2N46A 2EW8A 3IEMA 1WHTA 2QNIA 4F11A 5KYXB 4XYMB 3BG5A 1MCZA 4RNCA 4DDTA 4I14A 4ZVUA 3SXJA 4HZUA 3QBEA 4OJYA 2F1JA 3B60A 3IAHA 4PQGA 2XOKA 3SI7A 3IX7A 2X8WA 1YRAA 1L7XA 4ZEVA 2NPOA 3EVBA 4C6HA 5KNDA 1BQEA 2XRZA 2QVXX 4NTZA 3JXEA 3O8QA 1BKYA 3CO5A 5E6UB 4BLSA 1MG5A 3E3AA 4H7HA 2UYGA 4LX8A 2Y9MB 4MMZB 1Y1VG 3ASVA 4IWNA 1E9VA 4RY2A 1VIYA 4G26A 2JI9A 2PA0A 2H63A 1VHWA 3COVA 4UM9D 1DOAA 4E14A 2UUPA 5DLEA 5B3AA 1EP3B 5FPKA 2CDRA 2FWIA 4TV9F 4IWXA 5BV1A 3HACA 1I3NA 3K20A 4OQFA 5A4MS 4IIVA 4GFDA 1E69A 3E4CA 3CS3A 3QLJA 2RH9B 2Q2VA 4GGPA 4HGQA 1BU8A 4YT2A 3OETA 4WASA 1NP7A 4YACA 3OWHA 2R1TB 3H4IA 4DA6A 5UKDA 3TVDA 1NBHA 3OM8A 5C2JB 1UEXC 4DVJA 2H5EA 3ER6A 1BNCA 1M0WA 1R6UA 3WL6A 2Q6KA 3N7TA 3SK0A 2QTGA 3H9CA 4G9BA 1EQ2A 1Q83A 1VA5A 3CCBA 1KEUA 2JIBA 2TSYB 5KYUB 2FKLA 3OEEA 3UG6A 2I4IA 3DONA 1E8DA 3ZVMA 3KKQA 2A33A 2J6UA 1IJKA 2BDTA 4QWDA 4L74A 3ZDFA 4LG1A 2W8LA 1ONSA 4F4UA 2O8BA 2B0JA 4MUMA 4DIBA 3KCQA 3EQ9A 1VPWA 1XRNA 2F3QA 1RMYA 3ET5A 4UBNA 5C7IO 2G04A 1HWYA 4PAGA 4JJ6A 4UAVA 3E4DA 1PJTA 2PL1A 3WK9A 2JK1A 4B48A 5BYBA 2KSQA 4P3KA 1T2DA 4BP3A 4ND4A 4PG4A 1ZINA 1A82A 5AICA 3BVPA 1FS6A 4D44A 3C4JA 1F1JA 1T3SA 3ZCUA 1LPBB 2Q99A 3NRJA 5TRTA 2HU5A 2O7VA 1AQNA 3IIEA 3A4YA 2CW5A 5D86A 1QIGA 4I55F 2VVTA 4KN6A 2L69A 2AX4A 2Z5FA 2O3QA 2CVPA 3VJLA 1ET0A 2IDJA 2A9QA 3DKVA 4O7RA 5T6BA 4BVBA 1YJXA 1HLFA 1TW3A 3JD1A 3TIFA 1AURA 5FO0A 1UFRA 3MGAA 3W3AA 2MDTA 1T9BA 4PIMA 5TQ2B 2X5RA 1FSGA 1XCPA 1WXWA 1XXLA 3UATA 2VHUA 1RJ9A 2ZYIA 4RZUA 3K6RA 3ESCA 4KGZA 5CNMA 3ZBQA 3AB7A 4GKBA 1CQIA 5TIIA 3M1LA 3M5CA 5EGNA 2CL5A 3IN5A 3RT7A 3WKAA 3H42B 4YHBA 2PL3A 5JNUA 4G37A 2GZDA 1UDBA 3LQYA 4DAOA 4EUHA 1K6IA 2QRLA 5AI0A 3S7ZA 4CG2A 2O1XA 4FFPA 2IYEA 4A6EA 1U2EA 2NQ8A 1ATZA 1Y9AA 4R6WA 1KGSA 2DPYA 2V9ZA 1D1PA 3C45A 1ZZEA 2KYRA 4MV8A 5KKAA 1M34A 3A1DA 1XU4A 4L07A 1N2JA 2BEUA 3AW8A 1TD9A 1E3WA 2ZYTX 3TDNA 4YCCA 1GGVA 2VNKA 5FL7D 4XVRA 2ZU0C 4IFEA 1XKQA 4KPUA 1GUBA 2OAGA 3HEMA 4GYJA 1JHMA 3TLYA 3LCJA 2BY4A 3AETB 1W0JA 2A30A 3BWEA 3O8LA 2WYUA 2HHHB 4CJXA 2G71A 1ISGA 1DWUA 1JFSA 1OXMA 4R5HA 1PP4A 2GPSA 4FFNA 4RK5A 4RAYA 1E2BA 4U9UA 4DCCA 3WGJA 5LIPA 4L4YA 3UXMA 4ALLA 1SH7A 1JVBA 5KFVA 1MFZA 3PO3G 2E4UA 3T8YA 3GG2A 5DYNA 5CXXA 3AQIA 4EI9A 3AF3A 2BEWA 1ZUNB 4IH4A 4IW3B 4BN0A 1JG6A 4GDFA 2P3OA 3RWOA 1M0EA 2CLOB 3IUYA 3DS8A 1SD1A 3GFPA 1DAAA 3DE5X 3TM5A 5JCJA 3K70B 1K5HA 4C6SA 3SQMA 1B0AA 4BQRA 1SBZA 3GFTA 5JNTA 1XZGA 3N39C 3ZWDA 3VDRA 1QYRA 4EG3A 3RF2A 1P81A 2CFTA 3DLTA 1X2EA 3ZY6A 3AEQB 4DQXA 3RK4A 2AG0A 2Q27A 2AA3A 2BFBB 1RI1A 2VSFA 4EKYA 4QWCA 1IM5A 3IRUA 2F17A 3GZTB 1AZLA 3VKFA 1KI7A 2XWBF 3SQWA 1EUZA 2YWEA 3FCYA 1Q1NA 3A14A 1KJIA 1SUBA 1ZM9A 4B44A 2PKQO 5BWCA 2VQDA 5JRJA 1SZCA 4I4LA 1NYRA 2BEKA 4TV9A 2IH5A 5D3ZA 3BK1A 4TT8A 1RAHA 4RH1A 4ZHSA 3QXGA 4IBOA 4Q7MB 2FN3A 5JD4A 4BMSA 2W4QA 3VR1A 2R84A 5ALEA 1ZK0A 1TK2A 2XCTB 2ZAOA 1AUXA 1TOAA 1JEYB 2V6FA 1W36D 5CITA 3TBKA 3VHQA 2O3TA 4G86A 2PUTA 2PXHA 1UM9B 1RPZA 3PQ5A 3IE2A 3C8UA 2Z95A 3OLZA 3ZK9A 3VAAA 1Z28A 4DWVA 3BD8A 4OOEA 3DO6A 5CNJA 3W79A 4D5GA 3D3JA 3C3WA 3I8OA 3UV3A 2BGWA 3L82B 4DV7H 1KUTA 3BD6A 5FPHA 2PQ0A 2XBUA 3A10A 3WGTA 3PTLA 1F1BA 3FAKA 3TOXA 2B1QA 3FTQA 4ZWNA 2OB2A 4YUAA 5CD1A 1T91A 1PE0A 1EDZA 4C5AA 3P9IA 3PICA 5HK9A 4N39A 5CUQA 1AK2A 4OHUA 2QUKA 3KQYA 3RWMB 4FFDA 1TFRA 3FYDA 1N33B 3C7KA 3IQHX 3TQFA 1QFXA 4FOOA 1FUEA 4FHFA 3HYLA 3BA6A 2VRCA 3FE2A 2Q0XA 3M33A 1I0IA 1JJBA 3HUTA 4DZTA 2D5IA 4G0UA 3RS8A 3FBGA 1RK5A 4Y2SA 5EC8A 2FX5A 4I55A 4BU0A 3WGHA 4CCYA 3VAZA 3F2IA 4MV5A 5A7HA 2A84A 3SHQA 2FUG6 1IQ0A 3DQQA 1XU7A 2NO0A 3GN2A 3UJ8A 1X7ZB 1BS2A 4Y8VA 2W4IA 4FFBB 2J9RA 2I1VB 4BPRA 2OCGA 4HAUA 1Z68A 4Y9DA 2GHQA 2OLJA 3U3DA 1BROA 5IDYA 2W8KA 4DXDA 3ELWA 3H9UA 3D0RA 2O8FA 1BHQ1 3SE7A 1BVYF 2RGYA 3HI6A 2RC6A 4ARVA 3R3JA 4YCAA 4ENSA 3UAVA 1OTYA 5KS2A 3T5HA 1U0HC 2XUFA 4B43A 1NY5A 4J9SA 3O0TA 1XZBA 3F7TA 1ZSVA 5DQIA 1ZAYA 1RZUA 2GEVA 3OE5A 5AUPB 2QK4A 4FQ7A 3WX0A 4AY5A 3GVCA 4RNNA 2JFBA 4PR3A 5C34B 4PZYA 1Z63A 4JV5H 3WB1A 2ZYAA 1P3Y1 3PENA 1ETUA 2F43B 3G89A 1R9JA 1EG7A 3UCEA 4RQBA 2NX2A 2JJ2A 2QTRA 2ORVA 5LYJF 1Y8ZA 5K05A 4JR0A 5GV7A 4RF4A 2VTBB 2UUCB 4K81B 5DDIP 1AQJA 3LECA 2Y76A 5DEOA 4QUJA 1S97A 5JDIC 4HI0E 3RUFA 3HM2A 3I5YA 4N7RA 3MUFA 5DBGA 3R1IA 5J3JA 5JDIA 2HLPA 2PQ2A 2MOKA 1SBNE 2BMAA 2J59A 5EQTA 2ZJ5A 5E2BA 4Q3DA 5A05A 3HJTA 5JQGF 4NR0A 3U1BA 5JVDF 1KIMA 5TGDA 1DBPA 1BJRE 3EHEA 5HZGA 3UKJA 2GN1A 2ZT6A 3PW4A 1XT6A 3HBLA 5JV5A 8ATCA 3ADCA 5AKJA 2C07A 4LI3X 1IHPA 3ZE8A 4UM7A 5IKPA 4ALMA 4WFIA 3W8NA 3GFQA 6REQB 1EUCA 2BVNA 2YHUA 2VDKB 1KY2A 4QQ8A 3CBQA 3AO0B 3O1HB 2JGLA 4A8JA 4ED1A 2AZXA 4HWKA 1O6ZA 3DBLA 5EWLA 1S2DA 1ZKDA 3X3HA 5BN4B 4B4KA 4D6YA 1NVBA 4NULA 3UH1A 4EPWA 3L43A 4EQ6A 2FF5A 3ED1A 2ZBEA 3OHMA 4RNDB 4J1SA 3S8EA 4M1OA 2D1QA 3GV7B 1VHJA 3MD9A 5JMTA 3EIFA 4HMOA 4G1EB 3ICOA 2EP7A 3WRVA 4EPYA 1VSUA 4DCJA 3B2EA 3OCVA 3DZIA 4EW1A 1T5LA 3L0CA 3EZFA 4FFRA 5IP5A 1JHOA 3AHGA 2YINC 3KT6A 3WO0A 4LYFA 4WAUA 4WFKA 3P0RA 4KOAA 2WKWA 3DXZA 5I7FA 1G5PA 5KEIA 1X80A 4TSFA 2O1WA 5A0FA 4D9MA 3U3RA 1NZFA 4EYEA 3L8CA 5DE3A 1JR4A 5JBQA 1UBUS 4OL0A 3KZXA 2QJTA 1O97C 2IFTA 2XCOA 3ICVA 4R7ZA 1GPMA 2PKRA 4GE0A 3EJ6A 4L76A 4X54A 2H4JA 4DHEA 5DGXA 5DCLA 1VFPA 5CT9A 4Q3CA 3BRSA 2B4YA 5ITZB 4RM2A 5EMJA 1AHNA 1EWKA 4XA8A 2BGJA 3V1LA 4JI1B 1CUIA 2H7VA 5EE3A 3KDSE 1R0ZA 3CZMA 1KAMA 4L02A 2V3CC 3NHAA 3ZTTA 4IXMA 3MRVA 2F1IA 4R1QA 1UWLA 4FX5A 4XOIA 3QU2A 4MWZA 2AFHA 3ZXIA 4O4HB 3HCWA 3PFFA 3SYRA 1PFQA 1KC3A 4Q4HA 4U2DA 5AJZA 2PMEA 1XZIA 4RHTA 5FI1B 5IVHA 3IEVA 4CDGA 4EHDA 3B9RA 4KIUA 2LGJA 2NZ2A 3DFFA 1WMEA 1OBGA 4M46A 4D9BA 2H7XA 4ZCPA 3KJHA 3T3MB 4DCOA 1VLLA 3FI9A 3MPUA 4BVKA 4ECZA 1E3DA 4IWYA 4ND8A 1IN6A 5M2QA 1MO3A 4CCAA 3VR3A 5JLAA 1MX3A 2NUAA 1TAHA 4ODIA 3CLUD 4JOQA 4XIGS 1PEDA 2O7NA 2Q2QA 1PS9A 2HCFA 1E7RA 3MWEB 3HVIA 2TMDA 3SY8A 3CW2A 3E8XA 4DE5A 5EE5B 1GCAA 4IXDA 2ZATA 4V02A 5GZ6A 2C54A 1M54A 4WCDA 2JA5G 3N53A 3PSHA 1ZU5A 3O8OB 4QYTA 1RI2A 1MOZA 4HRVA 3GX1A 4BQQA 1E77A 5AJTA 1SKYB 1GNVA 3Q0TA 4D8XA 1RWMA 1XEXA 1I4TD 5E8JA 1NVEA 2XNJA 2V4RA 4HWRA 1KMQA 1RRCA 1PJCA 3O2SB 4HJRA 5I3CA 4QQRA 1ZH2A 1I2ZA 4OQMA 4DW8A 4U3JB 4WLFA 3JRNA 1NNSA 4WZBE 2RHCA 3DTYA 4MJ7A 4ZAWA 1Z5PA 2PGNA 2FJ0A 1KYZA 1X77A 5KPDA 3UCFA 2DM6A 3BSFA 1NE2A 3GUUA 2OB1A 4Q4LA 2QROA 1E6CA 3CEJA 3P0FA 4ZN6A 2DHDA 2QEQA 5TPZA 5LJLA 4UCSA 1PJAA 1GPLA 1A7AA 1TMGE 4EZIA 3IELA 4MEJA 3OKPA 4P83A 4CEJB 1BCRB 1QV6A 4I1YA 2C1ZA 1ZVJA 4IZHA 1H0SA 3WQSB 3NM4A 4INZA 3IVMA 3ZCSA 2HQ1A 3HOYG 1WXGA 3UWOA 1AKEA 1DX9A 3HDVA 5DX8A 4PM4A 5CP8A 1E1DA 4OXNA 5HQ3B 1RLTA 4LSGA 1LF5A 2FA9A 1U1DA 2PSEA 4NH0A 4HAOA 1PVDA 4LV8B 3HL0A 3FMIA 3A9UA 3SF0A 5JQGA 3WRYC 2WTMA 2EJWA 3I5XA 3JATA 1JHUA 2ZT5A 4JOSA 1GV1A 1JG3A 1YAHA 1DTSA 2ZSUA 1QK3A 5LUAA 1YB7A 3PNKA 3ZBTA 3OZVA 6AT1A 1NBIA 3AUAA 3KAPA 2O4CA 1STOA 2CW7A 2I67A 3C6YA 4EFLA 3P9RA 4N0QA 1SRRA 2JEFA 2CCKA 3B7WA 5NULA 4U7FA 3HVUA 4LY6A 2WFLB 3WFJA 4UJ3A 2IEAA 5AKIA 4ZEOA 2PJRA 4IOKA 2I2FA 4TKVA 4DG8A 4LCEA 3IILA 2QTVB 4ZMBA 2NU8B 2Y1KA 4QG3A 2QW8A 2ATIA 3CXUA 1CNFA 2BJHA 1U0SY 5FYDA 4JJ4A 1Y3CE 2Y1WA 4PAWA 1C0LA 4ZARA 3IDAA 3CMCO 5LCXA 2IEDA 3ULKA 3GYGA 5AW7A 3HVRA 4CQNA 3V8PA 2BGIA 3MFQA 1KBLA 4C7JA 3PDIA 1NTOA 4JBGA 1E20A 2C3UA 4H15A 3RYIB 3VOAA 4NENA 1L4MA 5B2EA 4TXNA 2PGLA 4XPIA 1XZ8A 1OLSB 3DXYA 3MWGA 1WCYA 1VJ1A 1OXXK 4R68A 4WEOA 4D96A 1TX4B 1RS0A 3GD7A 1E4YA 4NYMR 2K7FA 1DO0A 3FGOA 5LLTA 1T0IA 1C3XA 3ELUA 4NY1A 3RSGA 1IN5A 3U7GA 4TVBA 1X1RA 4IS3A 3VI4B 3AJ8A 1N2CA 3TTYA 2FW0A 1ZONA 5KDOA 4EEQA 4CVNA 1DJQA 1E4EB 1L7MA 2FSHA 4PBTA 1UEIA 3CWZA 1GYPA 3RSQA 2FE3A 4J4HA 3L5OA 2CLHB 2B7LA 3NHKA 4F9GA 3FWZA 1QF7A 1CS0A 4ZCIA 2Y4NA 1U99A 3E7XA 3QWHA 3K32A 3GVXA 1F8YA 1CFZA 2YYYA 3UW1A 1Q74A 2Q4TA 1T3NA 2H2DA 2XMPA 4JLPA 3JALA 1E2FA 2LW7A 4MQFB 4B8ZA 3Q6MA 3ROFA 5EP1A 5CCXA 3H1AA 5FL7A 1OSNA 4RXUA 2AMVA 2P9TA 2ALZA 3WAJA 1UAYA 4M83A 3GGSA 4YASA 4F06A 1P29A 3V6JA 3GFBA 2E5FA 2GYWA 4URFA 4ATNA 4PC6A 5CH8A 4EY8A 2YDXA 2V45A 2GASA 3V8BA 1KMCA 2AZMA 5BW5A 3D6VA 3C5WP 2IX3A 4EG8A 3G9TA 4PDBA 3UY4A 2WU4A 3RG8A 1YZLA 5BMOA 4AL4A 1W4BA 2CKDA 1GOTA 4BMXA 2PH1A 1V4YA 3EG5A 1M8GA 3ODGA 3I28A 4RPCA 3WQRA 4B5KA 5JTTA 3C98A 4UTOA 3O3MB 1E5VA 2WLTA 4QWMA 3A1VA 1J70A 4FUQA 4A3KG 4GMFA 5HGJA 3TKLA 5FPQA 2JGIA 2Z83A 4LJ6A 3TKYA 1Z4OA 5LL6b 4D6PA 4TXLA 3WIOA 3QV1A 5KYVA 3ZE1B 3A9RA 4OAOA 2I6XA 2R86A 3BE5A 3SQOA 3Q8SB 2J6TA 2HBZA 1R8QA 3BZUA 4OH7A 1FF9A 4FYJA 3OM1A 3MWDB 2P2ZA 2I71A 3PQDA 3H16A 4NZPA 2YWFA 4G41A 2CV1A 1W8IA 4PHCA 3GPCA 4KO2S 3TR6A 3VZRA 4DL4A 1CT9A 3G23A 3LXRA 4F5DA 3BCRA 3JX9A 4KODA 3C15C 4E94A 5TS2A 1DU4A 2V55B 4GQAA 2B92A 2IYTA 1A4UA 1SCJA 5LZ7A 4MVJE 2CYBA 3HA2A 3C6KA 1C3VA 1E3MA 4XWKA 3Q1KA 1CY8A 4KH1A 1ISRA 1EJ0A 3T7AA 3ND9A 2AD1A 3V00A 3PGKA 1DUVG 3C3MA 3FFTA 1VS0A 3W5CA 2DF8A 1UJ4A 1N92A 3FRHA 3GRCA 3UPTA 2OEPA 4A0FA 1W36C 2FH5B 4Q18A 5IX8A 1W48A 5BRAA 1XRJA 2XJ9A 1E3LA 4E33A 4XUCA 1FTYA 1LXCA 1JNXX 3REGA 1EFTA 3ZJTA 1R64A 5FPTA 4KQWA 1O4VA 2OV2A 1JQJC 4XQCA 4EB0A 2PEYA 1I10A 1NSFA 421PA 1L8OA 3KDAA 3G0IA 1A97A 2QVLA 4Q1AA 4JLMA 2QT9A 1Z8HA 4Y0VA 2EP5A 5TQ0A 5L6MB 1VGVA 3GWZA 3DTGA 2I6FA 2WBLC 2CXXA 1V8OA 4PVCA 2ACKA 2QTCA 2VNJA 3DW3X 1FP6A 2E0IA 3WISA 6Q21A 3OPYB 2H29A 3L0BA 5JARA 1ECFA 4YMSA 1NXVA 4EX7A 5H83A 1MDBA 4Q3NA 3RSOA 2WM9B 1TECE 5TX7A 3T9FA 2BGKA 3WHLA 4KAJA 1V8FA 3SDZA 5KG4A 2YICA 1NSYA 1ABBA 4PZCA 2CHVA 2RBEA 4B87A 3VR4A 1CXZA 5H3LA 2R8YA 2NYUA 3VTKA 1J9EA 4BLUA 2CVZA 4EMUA 1HQKA 1MB9A 2VRBA 1P1IA 4B8YA 4V24A 5K8VA 5IT0A 2XIQA 3KLNA 4TGLA 1X2BA 2QRVB 2G09A 1N5OX 1IQPA 2C4NA 2WJJA 4L6AA 4Y2XA 2WJWA 1MT0A 1H2EA 2HWUA 2IGTA 5KFGA 2BE9A 1ECGA 2I2AA 2Y0BA 3NB0A 2VJOA 1BOOA 5HNEA 1YB4A 3NEJA 2C94A 1ODIA 4IIJF 1V71A 2YASA 2NU9B 2B83A 3TZQA 1FYVA 1Y5RA 2CL7X 1E79D 5FTNA 2J9ZB 2Z3WA 3F3YA 4C4OA 3EFHA 2C1XA 3QYPA 4KE9A 2R11A 3S6JA 2TRSB 4TWIA 2B0CA 2YQZA 3STVA 4UEOA 4J6FA 2ZSIA 4Z2AA 3LYHA 5IUNC 5BR8H 4ZYZA 4Y6SA 5KFMA 4FGWA 5GAJA 3S2UA 2CF6A 5CPFA 3DNPA 1ZZGA 2VP5A 3CHYA 1Z13A 3OSNA 4BO5A 4QPCA 3CR7A 5I9TA 4AVYA 1XDZA 2A14A 1PQUA 5DLQC 5BVHB 4YAKA 3I1JA 1N9ZA 2FDCA 3AIOA 4PLFA 3QVGA 3C1UA 5J9FA 1XNRH 3B70A 3I8XA 3L8EA 2FK2A 1KDVA 4UC0A 1BX3A 1B14A 4LDRA 5KTRA 2ST1A 1U1CA 2GZRA 3FMAA 5KT4A 4RF3A 3A1SA 5IABA 4PWQA 4RS4A 4G1BA 1TC2A 3BRCA 5BMVF 1XCOA 3T06B 3G2OA 3PKZA 1IJBA 3R3VA 4II7A 2ZYUX 1SD5A 4PRYA 4GLXA 2ZZNA 3M9MB 2ILVA 2V54A 2GZ3A 3RGZA 3O82A 2ASVA 3WV4A 1HRKA 1M2VA 2PMWB 1WRBA 5D2CA 3HB1A 1E2QA 1N4AA 1VLJA 3IUMA 1D2EA 3PL5A 1P3DA