1UC8A

Crystal structure of a lysine biosynthesis enzyme, lysx, from thermus thermophilus hb8
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
280
structure length
254
Chain Sequence
MLAILYDRIRPDERMLFERAEALGLPYKKVYVPALPMVLGERPKELEGVTVALERCVSQSRGLAAARYLTALGIPVVNRPEVIEACGDKWATSVALAKAGLPQPKTALATDREEALRLMEAFGYPVVLKPVIGXXXXXXXXXXXXXXGFQHQLFYIQEYVEKPGRDIRVFVVGERAIAAIYRAENCPLTEEVARLSVKAAEAVGGGVVAVDLFESERGLLVNEVNHTMEFKNSVHTTGVDIPGEILKYAWSLAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lysine biosynthesis enzyme
publication title Crystal Structure of a Lysine Biosynthesis Enzyme, LysX, from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Biosynthetic protein
total genus 71
structure length 254
sequence length 280
chains with identical sequence B
ec nomenclature ec 6.3.2.43: [Amino group carrier protein]--L-2-aminoadipate ligase.
pdb deposition date 2003-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08443 RimK RimK-like ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.80 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 1uc8A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1uc8A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1uc8A01
3BSWA 3VPDA 1KJ9A 1GGOA 2P0AA 5KKNB 2R7MA 3HBLA 4MV3A 2DWCA 2VHEA 2V59A 1EUCB 2VQDA 3BSYA 5GONF 2NU7B 2YS6A 2YYAA 3U9SA 3LP8A 3WNZA 2DLNA 4XYLB 4ZI7F 1W96A 5LOVF 5CB4F 2VPQA 2GPWA 1KJIA 3I12A 1UC8A 1AUVA 4XZ3B 2PN1A 5C1PA 5H80A 4MA5A 2NU8B 1BNCA 2R86A 3JRXA 1AUXA 5I47A 2CZGA 2YZNA 5J2TF 4HNTA 2GPSA 5LYJF 1I7LA 2W6PA 2Z04A 2V5AA 3E5NA 4IHJF 3R5FA 3WO0A 1EYZA 4C5BA 4QSHA 2R87A 3VMMA 2ZDQA 3TIGA 5JVDF 3Q1KA 4C5AA 2W70A 2DIKA 5HBRB 1GSHA 2FPPB 2IP4A 2W6MA 3U9TA 2YZMA 2W6NA 2YRWA 1GLVA 4MAMA 1KC7A 4EA7A 2W6QA 4MV4A 1I7NA 3Q2OA 3RV4A 3MJFA 1C3OA 1PK8A 3K5HA 5JVLA 2V58A 2YS7A 2FB9A 4EGJA 1DV2A 4ZQIA 1KBLA 2YW2A 1C30A 1WR2A 4I50F 3G8CA 4DLKA 2YL2A 3JRWA 4IZOA 3HB9A 1JLLB 1KJ8A 1CQJB 4M98A 1JDBB 1VKZA 4O2AF 2QF7A 3OUUA 4DIMA 2FPGB 1EZ1A 3AW8A 2X0SA 1SCUB 3TW6A 5CA0F 3VA7A 3TINA 3SE7A 4EABA 4ME6A 5CA1F 1KJQA 4MA0A 3UFXB 4I55F 2DZDA 2R84A 2FP4B 4M9UA 2I8CA 5D8DA 3RFCA 2NUAB 3JZFA 3N6RA 1M6VA 1GSAA 1EUDB 2NU9B 4J6EA 3ORRA 5IYZF 2OLSA 3LWBA 2I87A 1E4EA 5JQWA 3GIDA 4MV6A 4O4IF 1KJJA 3R5XA 4YJ2F 2HJWA 4C5CA 4YB8B 1CQIB 2R85A 3R5HA 4EAAA 4YAKB 3RV3A 2R7LA 3N8DA 1B6RA 1A9XA 4MV9A 1BXRA 3GLKA 3BG5A 1T36A 3VPBA 3QFFA 4HNVA 2W6OA 1GSOA 3MWEA 4YBZB 2SCUB 2XCLA 5C8YF 3G8DA 1W93A 1JDEA 3JZIA 5BPHA 2YRXA 3WO1A 4EG0A 1B6SA 5KX5F 3BSSA 2NPOA 1JKJB 5LP6F 3ETHA 4YAJB 4FU0A 1KEEA 3V4ZA 2R7NA 5BPFA 4XYMB 3R23A 3AX6A 4IWYA 4E4TA 4ZHQF 4YJ3F 2CQYA 4O4HF 1IOWA 5C1OA 5BMVF 4I4TF 4MV8A 4RZQA 4WD3A 2R7KA 3ETJA 5LA6F 4EGQA 5DMXA 3HO8A 2J9GA 5CAEB 4ZOLF 2NU6B 2XD4A 1UC9A 4TV8F 1VBHA 2ZDGA 1ULZA 4TV9F 4L1KA 3RUPA 3K3PA 2QK4A 2PBZA 2FPIB 4WBNF 1VBGA 4XX0B 1CE8A 4EA8A 3TQTA 3K5IA 2W6ZA 4HNUA 5HV6A 3ORQA 2W71A 2ZDHA 4M99A 3MWDA 4HQ6A 1DV1A 4O2BF 4GGMX 1E4EB 2R6FA 4EA9A 1IOVA 3V4SA 4TUYF 5EZYF 2YZGA 3TIIA 2I80A 2GLTA 2R82A 4IWXA 3VPCA 4MV7A 4MV1A 5K2MA 3OUZA 5LXTF 2PVPA 3VOTA 1DIKA 4M9CA 5J2UF 4Y8VB 1CS0A 5JH7F 2VR1A 1EHIA 1PX2A 2C00A 4HR7A 3BFPA 4O4LF
chains in the Genus database with same CATH superfamily
5HGXA 5D3QA 1RYSA 3P2OA 1Y6JA 5ICFA 4RMIA 5LCXA 1S5PA 2VZLA 4CJXA 1R0LA 1J1UA 1WY5A 3FBTA 2YYAA 4XR9A 3TOSA 5KAPA 4GSKA 2QX8A 4BB9A 3GJ5A 3DYVA 3F8WA 4UPEA 1E3QA 2JFXA 3EA0A 5C5IA 1NRJB 1H6BA 3OIGA 2UUBH 1KYIA 1QSGA 1EVLA 1P9NA 1HMYA 2VEOA 5I8WA 4QVGA 4U6PA 1Z6ZA 3RIGA 5BXYA 3RSGA 3NDBB 3N2KA 2VK1A 4DSTA 3SM3A 2V4MA 1THGA 4NRDA 2PH1A 3MRSA 4FWIB 3RVMA 2QPLA 2ZIFA 4LDRA 3MF4A 3A11A 3GH1A 5GINE 3MR2A 2IV7A 4EL5A 2LR0A 2DIKA 4WVFA 1PFQA 5E6SB 1TU4A 3MAJA 1ODTC 2Z2YA 2COUA 4DJ5X 4CTNA 3BEDA 3VPFA 1SYXB 1FLVA 4RKEA 4OGLA 4BNJA 5DLEA 3BAZA 2ZVPX 1TK3A 5L3RA 1TQ2A 3NTRA 2EFJA 3QBTA 1UZUA 3ZC3A 2W6JA 1RKQA 1ZD4A 4CFYA 2VDQB 2OGUA 3JVEA 1TYCA 4Q18A 1Y5MA 2JAOA 5IKPA 2J3DA 2HVRA 5ALKA 4KUHA 4BBZA 4HFNA 3ZE7A 1ECPA 1Z18A 2I4IA 2ZSKA 3FB1A 5EJ5A 3RS5A 1MGOA 2G5PA 5HM8A 3E0QA 3K9HA 3DC7A 4IAJA 1YVEI 2DB3A 4YBRA 4IF6A 3MMXA 4WBSA 1I8TA 2FN7A 5H83A 1X0XA 3U44A 3VPSA 1RXCA 2X4GA 1OIXA 1XLVA 2PGNA 2FG6C 3JW8A 1QYCA 4RYDA 4EUEA 1VBKA 4ZZ2A 4IS3A 2JNWA 2J4FA 2CVPA 4AYBE 4PCUA 4BE4A 3I2YX 2PL1A 3WLLA 1PSZA 4ZRMA 2KM1A 5D1OB 1XZEA 4CIVA 3KJNA 4FX2A 1DRVA 1W0KA 4UOEA 2H11A 3R3WA 1Q6ZA 3R5HA 5BWMA 1RCTE 4DS3A 3EGEA 2IEYA 4D8WA 4JBYA 1HDEA 3DBRA 3DKKA 1U0GA 3DTTA 3LYAA 5CD9A 2UXCH 1FFEA 2P79A 3A3YA 2Q07A 2EG9A 3OD1A 1HDCA 2PR7A 3IX7A 2JEJA 2CBZA 3HXOA 3L04A 2VP9A 4EMBA 4XGNA 4L75A 4DDVA 2C96A 5F7OA 4JP5A 2C04A 3SDBA 1BJKA 2QNBA 1JQEA 1TB4A 3S8EA 1Y3AA 2RGEA 4Q7EA 4RVDA 5K01A 4D98A 2LIVA 1FYXA 3CLUD 5GMOA 1U7HA 4Q1AA 4GO1A 4P6VF 1KDRA 3ABSB 4KH1A 2OHGA 4QUIA 1Q84A 4L4SA 3BRWA 4S1TA 1XD8A 1BA3A 1U1CA 2BEVB 5DHFA 4JASB 3WGYA 5HGJA 5AVSA 5EP3A 4PVDA 2DUMA 1K92A 3I8OA 3ZHRA 4WXYB 4BJ3A 4DV7H 4WBXC 5AW1A 1PQUA 2R0QC 1P7PA 2EFHB 4N7BA 1F14A 1A48A 4TTTS 4HJXA 2FEKA 3TW0A 4R1SA 1SCBA 3HB0A 1G63A 3DTFA 1ULBA 3EQ9A 4OXXA 1SMKA 4MR9A 4AMUA 2P5SA 4COKA 3N3BC 4R1LA 4AKEA 1EDZA 3O6VA 2OCAA 3F6PA 1NXWA 4EGFA 1L9KA 1E32A 2LKDA 1BC5A 3CLTC 4BUJA 2Z57A 3FROA 3BJYA 2B8WA 1Z38A 3JS5A 2F1IA 3H9BA 3OEHA 2ZJTA 3PFCA 4TLMB 1YS9A 2Y77A 2ZSEA 4KITB 1EKXA 3LG2A 4JX8A 4F12A 5EWJB 5AK0A 2ADOA 3SXJA 3OTOH 2MJLA 4FFLA 4RIGA 1WULS 3FGNA 3C3MA 4AWAA 4XIYA 2H4XA 4LWZA 1Q57A 3ZWWA 4K5QA 1U7ZA 2D62A 3TH5A 4CF4A 2CMDA 3PC3A 2ECPA 1T2AA 1GM5A 2E4AA 2J30A 4D3DA 4RTSA 1FMTA 3QH4A 2BBSA 1XALA 4UU1A 4E5MA 2EZ4A 5ERYA 5JFGA 2RJOA 1TTQB 4LZNA 2EQAA 2PS1A 4H18A 1A71A 3GDOA 4JI0H 3AKYA 5FCDA 4XWTA 5BUQA 4QYXA 2P6MA 1H1DA 4FR2A 4XX1A 5ES4B 1A77A 4QRIA 4ESEA 2A0XA 3O5AA 4HQOA 2OR3A 1CEQA 3PXDA 1HYEA 3K9LA 3TEFA 2IL1A 3KVRA 1UC5B 2ZR8A 1I7NA 2R92A 2BFBA 2XIGA 1V6SA 3K16A 3OJLA 1T34A 5HOQA 4NNOA 1M1NA 1N2JA 1DAMA 2N0SA 5GIOE 1V8ZA 3J81k 1PGQA 1Y5NA 4YDRA 4N9WA 1UOEA 3QE3A 4ZYYA 2AA3A 1R9NA 5KJCA 3BQMB 3WMWA 4QEDA 4CL0A 1XCMA 1F0PA 2VHVA 3DFZA 1O6GA 5LLTA 2RJNA 4QYIB 1DKMA 4TT3A 3LF1A 1F5SA 3GPDG 5FPTA 4WOKA 4HXFB 2FY8A 5AK3A 5AXBA 2A9VA 5KT6A 4MUXA 4MJ7A 2Y0SE 1PT8A 4RQUA 5L53A 1K4YA 3QJYA 3IQDB 3A4YA 1OFTA 4EJ0A 5EP1A 1KP2A 1EFTA 3U5ZB 1OB5A 4FMCF 1HTTA 3RHTA 1SHKA 1VG1A 2Q6TA 2L82A 5E1MA 4H3HB 4RD3A 1NZDA 4C1BA 1NC1A 3RIYA 1DIGA 1T5LA 7REQB 4MV9A 1RHMA 1E58A 3W5IA 2E4VA 1YQWA 2J7PD 3IRUA 2DT5A 3VNUA 3H9UA 3RAGA 2IX9A 3QNMA 5KFQA 4J9MA 2JLAA 3UMVA 1CF2O 4OP3A 5EUQB 3TEMA 3TQHA 3OZVA 3SDSA 5H3CA 3IOMA 5HFNA 4XJTA 5I3ZA 3EGVA 4N41A 1PZEA 1AE1A 2HR1A 3ZKWB 4H7JA 4IXTA 4L7VA 4HGQA 2HHFA 4I66A 1V7ZA 1I0IA 5LC1A 1QAMA 4BZWA 3GFTA 4R5HA 2OBFA 3F3MA 4EJMA 3RSCA 4OQMA 3BJZA 4UPVA 1QQ6A 1ECGA 3RBXA 1MJGA 4RTPA 5HE9A 5FUYA 1U2ZA 5KYYA 1XTZA 2H5JA 4KMRA 3KT8A 4FYPA 3BWVA 3ZV6A 2AK3A 1YZGA 4GPD1 4WBNF 2FEPA 2D2FA 1SPBS 3R3XA 2BJVA 3PKZA 2WJYA 4DXDA 4ENSA 4TMXA 1SXHA 2DLDA 2O48X 5JLJA 1DIAA 4ED1A 2DQYA 2P4QA 3MBIA 2R5WA 1Q44A 4M83A 1FDTA 3OLCX 3LPNA 2QEQA 2B1JA 2IA5A 1IXSB 4URFA 5FTNA 3QKUA 6PFKA 5AOAA 4LI0A 3ZDAA 5JDCA 2W9BB 4FYHA 2ZU0C 2GPBA 5FWYA 1ND5A 1WPRA 4HCJA 3EASA 1RFGE 1WCMA 4CDMA 1YNSA 1C50A 2IJGX 3LF2A 3C4JA 3DMDA 4I55B 2VQ3A 1KL7A 4YV7A 2EZ8A 4MMXB 3A31A 2XXBA 4X65B 5ALTA 3GDWA 2V0CA 3MVEA 4HPJB 3UK6A 2ZRDA 2HHLA 1WF3A 4U2FA 2IXBA 3CR8A 3EZFA 3GVXA 2ZW9A 2AFVA 4M49A 1AF4A 2HBQA 3ZV5A 4QHTA 4QIWE 4NSNA 3TFOA 3AEKB 2QAGC 3OWXA 3AVOA 7ABPA 4W1QA 3FNEA 4RNMA 1DJNA 4EYIB 1EDDA 2E9SA 2W22A 3L1HA 3HBAA 2VOJA 3E18A 3WO0A 3IAXA 2QN9A 4V3BA 1WMFA 3L5KA 4QTXA 1G18A 2A2ZA 4ZRNA 3SQWA 1RW4A 2GK6A 1G20E 4I4TA 2DSNA 3KKOA 5SZKB 1IAQA 1Y48E 1IXYA 2W6NA 4BQIA 3NYRA 4YRRA 1II9A 2XTJA 1DU4A 3N6XA 2BFFA 4U7FA 5FJ8G 1ACJA 1B3BA 1VBFA 3L06A 2F62A 4DT1A 3FTQA 5AKGA 2ZSIA 4FCCA 3ZCVA 4KQFA 2QAGB 1DBVO 1ZUNB 5TF0A 5K3BA 2YJTD 2QU8A 4D9MA 1E8NA 4DLYA 4ZV7A 2WAQE 5ICSA 1QHSA 3GLVA 3N58A 3KJIA 3GV8B 1D04A 5HCNA 1VKZA 1E3SA 1RQRA 4FS2A 3AW8A 5JXIA 1FP6A 4LX8A 3OC0A 3AHHA 3CUEF 4KW7A 5AM4A 2Q4BA 5EIXA 1Z5NA 1XMJA 2W7PA 2J3JA 4DSNA 2YZ2A 4HY3A 3ZOZA 5E2IA 5I9TA 3TL6A 1Y7LA 3IP5A 4YMWA 3HKBA 5KTYA 4GC9A 4GQAA 3I9KA 1DKPA 3KKKA 4W5NA 4GSYA 1NQOA 3NFRA 2XBMA 2O54A 5LM3A 4H7PA 3SCZA 5G0SA 2HWYA 2HBRA 1LPSA 4B17A 3X43A 3K0CC 5EXXA 3JAKA 2BMEA 3DL7A 1WHTA 3RU3A 3R7FA 2KBFA 3BT7A 4MQFB 1VJDA 4W8HA 1T36A 4LYAA 3LXMA 1N5MA 4Q24A 1RQPA 3VR5H 2NQTA 3R6LA 5CH8A 3ESZA 3BCHA 1RHJA 3D4LA 3IUEA 2NVUB 3PITA 1I50A 3AIMA 3NOOA 2EZUA 2ZIGA 2VNKA 3DOUA 4O7NA 1ZH4A 5B37A 3AR7A 3IIIA 4HTFB 1N3BA 1XQVA 1N6NA 5AO9A 2I6UA 3F8SA 5B53A 5FPQA 5DBOA 3R0VA 3CFYA 4GL2A 1ZK3A 5SZHB 3KQPA 421PA 1XQ1A 3EIQA 1FJGH 1I1NA 3DLTA 1DWUA 5DAAA 3QIAA 2CNKA 1LPAB 5L3SA 2VPWA 2HMAA 3D0QA 1R00A 5BWOA 1C8LA 4N3GA 3NEYA 2ZE5A 2WJHA 1UBOS 2GYYA 3BXGA 1PZNA 3TLBA 3G9QA 4FONA 4LJSA 5BSUA 5FL7D 3FHCB 4OB8A 3K0HA 4KO2S 4Z1MD 2HCBA 5BSWA 2YIDA 4HN4B 2QLLA 1JAHA 3U61B 4S1WA 3NASA 4P32A 1MIHA 2BSXA 4GRIA 2P11A 1FS4A 2JBAB 2FWNA 1C7FA 3TY9A 1L5LA 5A5DA 1B74A 4JN6B 3ACDA 2QTLA 1A2KC 1EA5A 2D0OB 4CMFA 3DT8A 4YIKA 2BJWA 3ZGNA 3IDOA 1LDNA 4OJYA 1C1XB 2VR1A 1XEWY 4HF7A 3QYAA 4EM6A 3UN1A 4QU8A 2GXAA 4G5XA 2JK0A 2DSTA 4HN2A 2R3SA 5BURA 2DXIA 5E6RA 3FB4A 4AROA 1Z33A 4X5OA 1RP7A 5KTSA 1R0ZA 4JJ4A 2V54A 4DUGA 3LVRE 1SZCA 2C2RA 4B76A 3LPCA 1NW9B 1SOVA 1N2SA 2HQRA 4JYAB 1NNI1 2AB0A 2G83A 1U0LA 1L5YA 4GNRA 2PCLA 2NT4A 4PY2A 1HUQA 1W0JA 3OX4A 5T3YA 1XVIA 3DLCA 4EJSC 3N1UA 1UM9A 1Z9BA 2GD2A 4UBIA 2Z1DA 2YJGA 3BE8A 3AESB 2GSDA 4GOKA 2A9PA 1NAHA 3F96A 3MTDA 1RC1A 3FXAA 3QYJA 2AEMA 2F7SA 2JA5A 3EXFA 3PQEA 3OF3A 3Q1KA 3TW8B 4DDTA 4TMWA 4LTMA 2QUAA 1QCZA 3PUYA 4CLXA 1FLNA 3WK9A 2FG7C 1GZ4A 4X1YB 4KMSA 4B3MH 1CRZA 4EJSB 3DXXA 1JEAA 4QUHA 1AT1A 2HRDA 1TECE 7YASA 4MPDA 3ISJA 2H2AA 1BCSA 1W1IA 3H5VA 4OUDA 5LQRA 3UWPA 2ROQA 4V39A 2HRZA 3G0GA 1AK2A 5HPYB 3IP9A 3AR6A 4RB0A 1YVDA 4HRVA 1KH2A 1IAVA 2Q99A 4WCFC 3UA3A 1DWPA 3GDEA 3PUJA 5F3WB 4WKCA 3G59A 3ELWA 4XFKA 4NOJA 1XMPA 4ZYTA 3UT0A 1JUDA 5K05A 4EB3A 2C3PA 2WTBA 4Q01A 3HB7A 5I9BA 4E1AA 5IUKC 5AHKA 4A4DA 4ZJUA 1SKAA 1D09A 3BQ0A 2JL1A 3D7KA 4TYPA 3LKBA 2HA5A 3W2HA 2BGUA 2FETA 2BFMA 3BJMA 3FKJA 3CQ9A 4WCFB 2V96A 2ZULA 1EI9A 2PUWA 2EIHA 2HWWA 1A72A 2EW2A 5TRTA 1G5PA 3HHPA 2ID9A 2C2YA 2P9EA 3EJ6A 1DQRA 3SFVA 3CF0A 3Q8KA 1NKVA 3O7WA 3NDRA 1CHNA 2VRWA 3TW4A 1LBIA 4AAYA 3H75A 2QP3A 1AUQA 1WS6A 4EUKA 1EUZA 5AVKA 2F1RA 1LNQA 3MJSA 3MLAA 4Z4CA 5K8CA 3HMQA 3TSWA 4OM7A 1JEQB 4J1QA 2QQ0A 1SVWA 4M6WB 2A0FA 1CLEA 1FMLA 2YV1A 2WM8A 1QQ5A 1ZGHA 5BQ3A 1V8DA 1ESCA 4W9RA 2R60A 4P4TA 3RB8A 3JWEA 1P8LA 3R6GA 3MD0A 3L01A 3PHIA 4DEXA 3L1IA 3AERA 4XX0B 2IE0A 3WDSA 3VNVA 5UKDA 4LYEA 4DV3B 3DP7A 3Q3JB 4BYMA 1OREA 5JWOA 4KN8A 3VVCA 8LDHA 3DA8A 2D2EA 3OC6A 1VRWA 3WNVA 4BNIA 3CIOA 2ZIXB 2JAUA 1FRVA 1SWWA 3MWDA 1UL1X 1XKXA 3G3EA 4ZODA 2WVHA 4RSMA 1BVYF 3EPRA 3PRYA 1YFZA 1IOVA 4L4ZA 4O7TA 1OLUA 4YMVA 3ZUGA 4XWOA 4D8YA 2WJPA 3TTVA 4BE7B 4JIGA 3IJ5A 3ZZUA 4JYAH 1JSRA 3VYSB 2FMHA 4MS4A 2PL5A 1QQBA 1DARA 3SFZA 1E3LA 3DFUA 3DLPX 5BW8A 2PKXA 3T15A 4G0VA 4J0HA 4YT8A 5IW8A 3WTBA 1KBQA 1BG6A 2XUQA 4GRAA 5HS4A 1U5CA 1WU7A 2VZ0A 2NP7A 3HB1A 2JJMA 4J0QA 4GX5A 2HWXA 1R4AA 4AZ0B 4D74A 3MD9A 4DNXA 3PPWA 4UVHA 3MA0A 1F12A 1ULSA 2P90A 3CVWA 5REQB 1DJOA 2PMZA 3CVYA 4F3YA 2Z9BA 5J1SB 4E6NA 2G3YA 1MJHA 3RJ0A 3A28A 5ENZA 4PC2A 1CJVC 4B3SB 2AOTA 2M1XA 2AV6A 3HADA 1ZM2A 3PE4A 3W1WA 2IS6A 1OH6A 3HJFA 4LSXA 1HZZA 1GDDA 3DONA 4FLMA 2DULA 2I7DA 1G8KA 1N9GA 4MIEA 1JKMA 1EJ0A 3N86A 5JZBA 1XA0A 2IA6A 4P38A 3PDHA 2OGZA 2BM1A 4D0GA 3H1PA 2Y2VA 3SS8A 2ZYTX 1N36B 3KV1A 1CV2A 4I50F 1EGMB 1VKOA 3H2GA 3GMTA 3NRJA 1P6UA 5J5AA 2FP4A 5J5CA 3QUQA 1OLSB 3A1SA 4EJ2A 3J80A 2EX1A 3U7QA 4J29A 3WYEA 4GXNA 3QXGA 2A5DA 1R66A 3U4CA 1N9ZA 3HEBA 2JEYA 1YH3A 4RH0A 3R0ZA 4J03A 1NR1A 2ZPAA 4EZIA 3L92A 4D9IA 4YA6A 5F78A 3UK1A 2I8CA 2CXSA 4K9PA 1EG7A 4YRCA 1VZ3A 5IFLA 2P9BA 4E14A 3T7RA 1F0KA 4U4AA 1PI3A 1XEAA 3SQMA 2Y99A 2JG3A 3QVGB 1XDSA 1FFDA 2IYTA 4HNAA 5AW9A 2I4TA 4NE9A 1TUBB 3A10A 3U7IA 2EF0A 2Z9DA 3C1UA 3JARA 1G6KA 1U7TA 4GLFA 1SC9A 4NCKA 4P7FA 3JQFA 4GU5A 4N65A 2J59A 1J9ZA 2W8KA 2EDAA 2G1AA 3V9PA 4JUFA 4EPVA 3G2LA 3P5SA 4XDGA 3MT8A 3AR3A 4J9QA 1QG6A 3Q5DA 4KVZA 5H1YA 1DPFA 3IE1A 4V1CA 2EP8A 1RLTA 3BGVA 2ETVA 4NMLA 1JZTA 3PKIA 1UDCA 2XCLA 1M8JA 5G1NA 1W93A 4PQFA 1YV9A 3AK4A 1KWGA 4FIZA 2AYZA 3K1AB 1J7JA 2PFKA 4PWQA 4ACBA 1YQGA 5G02A 2JCVA 4YASA 2QG9A 3D1VA 4CMGA 3BMCA 5THKA 3MPOA 5L3QB 3Q12A 5FL3A 3A26A 4NCNA 3DKVA 1JPJA 3M9XA 2OMEA 3S5JA 1IEXA 2PYDA 2JDID 2EL7A 4MUEA 2AUMA 2YWRA 1ZG3A 3LX5A 1ZIYA 3RRZA 2YXNA 2UAGA 3LQFA 1K98A 1FMJA 1I36A 4PYQA 3VV3A 1RE1A 1OX5A 2FEOA 3LYLA 2VVTA 1U1GA 2D5CA 4PYNA 1PR0A 3I42A 1B8PA 2PKQO 3HCBA 4CV2A 2XWJI 1Y3DE 4ITVA 1HQYE 3SZGA 1WA5A 4CR8A 4J9VA 4YP9A 1GZSA 4EA9A 1RMTA 1FDSA 4V2UA 3CMMA 4RGBA 2B4YA 2C3YA 4RACA 4NBUA 4MWCA 1GPKA 5DFAA 2ENUA 5KSWB 2AG1A 1P2TA 3AU9A 4O2AB 4OBXA 2GPNA 1HRKA 1SD2A 3ER8A 3DD5A 1HFEL 1CC1S 4R2WA 4DSAA 1NJ6A 3ZDDA 4OATA 4OB7A 4C2MA 3QJ5A 3R3VA 5JNUA 1QJ4A 3BSWA 5J4KA 2XIQA 2K6GA 2FQYA 3VU8A 1UBKS 1SCIA 5U1PA 3VJLA 3N28A 1TD9A 5J9FA 1UADA 3G2MA 4X6YA 5A6VA 5KFWA 2Q27A 4ZU6X 4QT0A 2NUAA 4FE2A 4AQYB 5B6IA 5KNBA 1UEXC 4NICA 3FLAA 4FJ1A 1KZHA 3NEJA 3EIWA 4H6PA 2X1HA 3ENZA 1M74A 4W1SA 4MW9A 5EL0A 3I12A 1NG1A 1G59A 3A6EA 5B3JC 3C16C 2OZLB 3E9CA 1BS2A 3NUZA 2R86A 1W87A 3K92A 4ZCRA 3O8OA 4PW0A 4JYCA 2B1QA 4EBDA 3QBDA 1JX6A 4C6HA 1M2KA 1YKSA 4AKHA 4B4DA 4XE5A 3RTCA 3LFTA 5JRDS 1R9MA 3HKZE 1GA4A 2GVZC 4DNOA 4D9NA 1EKPA 2Q1YA 3A1UA 3O8DA 5IZCA 1TCCA 1W7AA 5DP2A 2GJ4A 4ENRA 2QZ4A 4EHFA 3E58A 1ESMA 1TTPB 4BQRA 3IFSA 4E2YA 4KWTA 4AF8A 4U9UA 3IA7A 4GEGA 5HRUA 3GH3A 2EWVA 3HKEB 1E1KA 4B33A 3E1KA 1KKMA 4FHCA 5DSZA 2OLKA 5ED4A 4U7HA 1CUSA 3TOZA 3O47A 3MPUA 4AQDA 3B1VA 4E07A 2C4MA 1VE6A 1V96A 3V8VA 2NW6A 1RVDA 4X7BA 1Y1LA 1N4AA 3IA2A 4LX0A 1P0CA 1S8OA 1GU7A 5E7MA 4Q9HA 2QVYX 1LWOA 2Y8EA 3ADOA 5IK2A 5AHWA 2KLBA 4P54A 3RBZA 3FCCA 4B7ZA 1NUTA 2DH6A 2WIFA 1WQ3A 2VYVA 3DPSA 1WMBA 1UFKA 5TVKA 4P2BA 1X3SA 4IQGA 1E1QA 3OOYA 2UZ4A 2OZEA 4ZIRA 1J22A 1Y14B 4YJ2F 2IY8A 4C08A 2O8VA 3AB7A 1A27A 2CKMA 3C3PA 5I7WA 2GJ8A 4EKYA 1N2GA 1B23P 5TF4A 1KEVA 3JVIA 3KUUA 5EZSA 3LCCA 4KN6A 2R48A 1F9AA 4R0VA 1RPNA 1EG2A 3OLXA 2VHZA 4QQRA 4PN3A 3W8RA 3I4LA 3RVOA 1SEPA 2GN0A 3CC8A 2JCXA 4DANA 5KFPA 3BH7A 4AJLA 3GTGA 1SKQA 2JGEA 2ECFA 2HCRA 1LPOA 3S70A 3RC7A 4MVJA 2PZKA 2RG1A 4ZI7B 1ODCA 3OE4A 4XEHA 1U8FO 3TNJA 3TECE 3NTXA 4D1YA 3C7TA 2AI2A 1MW9X 4EUNA 4INPA 1FFWA 4I46A 3PVXA 4PSUA 2FPWA 4I99A 5ERGB 1QHFA 1GGFA 2YYZA 4MCIA 2AD5A 1E20A 3TRFA 4NU8X 2H2GA 2ALJA 2GF0A 5D85A 3QOFA 1MP0A 3FVVA 1FIUA 1JQ3A 3U44B 4O7ZA 1AGPA 4CEIB 3EEFA 4HQNA 3A06A 4HJRA 4W7HA 1MX5A 4MS1A 121PA 1SD5A 1K3TA 5TY0A 2A88A 2ZYHA 3URMA 5ITZB 3A04A 4B3TH 1XJQA 3GPCA 2PXAA 4CMAA 4AQYH 1WMEA 1I2DA 3CEMA 2ARKA 4GX0A 2OAGA 3FAZA 3V4PB 1U2DA 1VE5A 4LHEA 1QOPB 1NPYA 5DN6D 1GKUB 2C2KA 3O26A 3TIVA 4GKJB 2Z2ZA 4ZA2A 3LVFO 3IEIA 4NYJR 2JCSA 1ZIOA 2Y9MB 3NC0C 4ED3A 4GP9A 2GAOA 5I5GA 1SUCA 3E3OA 5EKTA 3NYQA 3PDJA 2EJCA 1W9HA 1A8IA 1DGQA 3OOWA 3PWSA 1OKKA 3GJZA 3OWOA 2ZATA 3ZQUA 2A9QA 5K51A 4IIYA 3HUTA 4FYVA 3KSBC 1GTRA 5AKEA 2IH2A 1AU9A 1CQXA 3AI1A 1SZPA 1ZJ4A 1KHTA 1MRSA 1Y8QA 3ZU4A 1T6ZA 4I8IA 2VHQA 2B99A 1HE3A 4I6JA 2XQVA 1OZGA 1P7VA 1YQUA 4IV8A 4D0NA 4KV9A 3DR3A 1ONNA 4PV7A 2YC4C 1BOFA 2XA1A 4S04A 2HPAA 2XNJA 5DM0A 1J42A 1OZFA 1E1YA 4G0UA 3CX3A 4AZTA 1NLFA 1VXOA 1SK8A 1GCUA 3GG2A 3OM9A 1FK8A 1K68A 2CXUA 3U7GA 5EJ7A 4U6NA 3N2ZB 4MR9B 3KCNA 1H94A 4PC1A 1DHRA 2C31A 3OP4A 3Q3IA 1NUHA 5HIIA 1N2CA 2EATA 4X3OA 5E3JA 1WF6A 1RSZA 1Q3KA 2WHYA 2Y1FA 1PHRA 3A3PA 1XJ5A 2GLUA 4CTOA 4KB5A 3A1CA 2GEKA 4YUZA 5T4FA 4RHXA 1E2EA 3BA8A 4UCOA 1H4QA 2K2QB 1PJ2A 2OYRA 1T1EA 4EECA 3GAFA 2EAUA 4NF2A 1SVOA 4Y2UA 1S8AA 3HV0A 2AJTA 4I6GA 2QX9A 1Z3CA 2PU7A 5C1IA 4M9UA 2Q4OA 2XZDA 4LGYA 4B79A 2X5JO 3UGKA 1FMFA 4M8NE 3DNMA 2D8AA 3DO6A 4CNBA 3THYB 2HFKA 2GZDA 3S27A 3PDCA 1E66A 1JQBA 4G23A 3RYHB 5AH0A 2YMPA 2A7XA 4TXMA 1CHDA 4BGIA 2DU8A 4QDXA 4QG3A 3AONB 3KC2A 4WZAA 3IUQA 1DKQA 4FB5A 2Y0PA 1EFVA 1NVBA 3R76A 3TQCA 4RD2A 5TLSA 3JQAD 4R9UC 3C15C 3PQ2A 1USVA 2GQ0A 3E7XA 4UZSA 3ZBQA 4GOJA 2HOQA 4JSYA 4TQ9A 5LSAA 1U80A 2R1VA 4LTNA 4UEJA 3O4JA 5T57A 4LWPA 1INLA 3D6AA 1UDAA 4FE7A 1L7RA 5JS8A 4RTLA 1VQ1A 1JLSA 2RHJA 3G82C 5JHHB 3LCUA 3S5UA 2JA6G 2HV8A 5C35A 2ATVA 2ZJ8A 2V9PA 1XAHA 1U3UA 2GMWA 3TG8A 1B4DA 1MB3A 1S6YA 2QTBA 3BIFA 2WEKA 2IPNA 2CQYA 2XMPA 3U60B 1GGMA 2Y92A 1DHTA 3K0BA 3QWAA 1TIPA 2X0DA 5IHPA 1FJXA 4TM8A 5ENVA 1QRAA 2IZ6A 4EW2A 4ALKA 4Q1EA 1MHTA 3RH0A 3T1YB 2HA3A 2PUFA 4K9DA 3I2HA 3QU7A 3D6UA 4BVJA 2CJWB 2PKQP 4R68A 2R66A 2CHUA 3KKZA 2O3UA 4YFYA 2F8SA 2XH8A 2IPLA 1RLIA 2A3NA 4G1VA 1IUKA 1KARA 4TTVA 1GGJA 1Y5LA 1LPMA 3BWBA 3SSAA 2H63A 3F5FA 2YC2C 2J0QA 4EKNB 3MS7A 1KO4A 1Q7CA 2QD5A 1ZO8A 2V4RA 1Z6AA 5IN5A 3V42A 2VK2A 5B58C 3LWZA 1S7GA 4JB2A 2VQFH 2VF4X 1A4IA 5H81A 4TV8A 4EFMA 1PTKA 4KXWA 4WERA 4N5DA 4UEKA 5BWXA 1H2EA 1X15A 1U1IA 2CFCA 4K6FA 4RMHA 3D3WA 4MV5A 4LFCH 3RAJA 5JANA 4KAFA 2WF8A 1JBKA 1KI6B 3FTEA 1Z88A 4YR0A 5CBKA 4BO4A 2EJ3A 4YYEA 2PFSA 3F5QA 4M1QA 1E6MA 4Y2HA 1JDPA 3MFYA 3N6VA 3EBPA 1VZ2A 4MI1A 5C5EA 5HR5A 1BKDR 5DBIA 1JJBA 4IUDS 2EFDB 5CPBA 3D6MA 1LC3A 2ZOSA 3WAJA 3RYIA 2CT8A 4C2UA 4L0CA 2BKVA 2W37A 4MHTA 5ITWA 1ECLA 3F49S 1DG1G 1V8PA 5HBRA 4PXAA 1ECCA 2N9UA 3FWZA 5CVUA 2OZVA 5J4VA 3P94A 4QBIA 1SXJD 1GZUA 2I3GA 1FFHA 1RWPA 3QKTA 4UC0A 1I2CA 5JDCC 2PUHA 4KKXB 2X5OA 5GZ1A 1E2JA 2C9CA 3TRIA 3NNNA 1VCMA 4UQOA 1VGRA 3NS7A 3T5TA 5EWFA 2VNIA 3ND5A 3MQ4A 1LUAA 2IOYA 1UWVA 3C6YA 2JIZA 1NXXA 3QELA 2OH2A 4MV4A 3EXIB 2BOVA 1W1WA 4Z9AA 2GWHA 3ZHXA 3CPHA 3ZEIA 3ZWXA 3ABZA 5E8JA 2CBGA 5T3UA 3GJYA 4KN9S 3CVXA 1QO0A 3H6GA 1XD2B 2FQQA 1U6IA 3T3DA 4TRMA 1UODA 5FWYB 2AJBA 3D7RA 2BUCA 3W5DA 4OIMA 4MYHA 3ZNNA 3W3AD 4YP0A 3MBKA 3WK4A 2O7SA 5SYAA 3EZ2A 5CNIA 3ST7A 1Z15A 2OBNA 3V7WA 3U6KA 1QTNA 2WTMA 1ISGA 5JD5A 4ZZ1A 1F6BA 2IZ5A 3FAKA 4EI7A 3TNFA 3T1VA 4B6FA 1AZLA 3QP9A 1KJWA 4N6GA 3AGQA 4Y2VA 2H4WA 1QYVA 4N82A 3PN1A 3TRJA 4EWLA 4D9GA 1EKVA 5KMGB 2WBLC 4MS3A 2J5BA 2O2GA 4YAKB 4LF8H 1U4NA 5EN4A 2BEWA 1BE0A 1A7UA 5HK8A 5DBEX 4ERNA 4AS1A 4HGNA 1Z12A 4X61A 5LIPA 3VR3D 3WBJA 1YB4A 1QTIA 2PGJA 1UDBA 4WMLA 4BCBA 2ZYVX 3R8FA 1M2OB 4B34A 4IDHA 4Y0AA 3OT5A 2QBYA 2IP1A 1ZI8A 5I7HA 3G13A 1RKXA 4X1IB 2BFFB 2FEWB 1IDN1 4AY4A 5TJHA 1JWLA 5DOZA 2G70A 4KXLA 1PGJA 2HSGA 3RREA 1H69A 4AUMA 4BMXA 3SHQA 2XCOA 1QH8A 4J9RA 4HWGA 5GY7A 3B1KA 3IMCA 4ZAVA 4RH1A 3PXAA 5DHQA 3SY8A 2Y76A 1QR6A 2LCIA 1BKSB 2P8SA 4CC6A 3R5SA 4JD5A 2E2IA 1TO2E 1NY6A 1W30A 3O8BA 3AWDA 4O2LA 4CQMB 3C85A 1LQ2A 4TYNA 3NP9A 1TGVA 1VBGA 3NLLA 2P5TB 5U4QA 4UFOA 3ORYA 1DDIA 1AN0A 4FWBA 1EK1A 3HKBB 6NULA 4D6XA 1J0XO 5IVHA 2J5RA 2CV0A 3VNBA 3IHKA 3UPDA 3CPSA 1GAWA 4LRTB 5E4FA 1N8NA 4G63A 5C46F 2DE0X 4UHCA 2B7CA 2Q3EA 4JSTA 4J1TA 2OUIA 1NASA 5ICEA 2GBIA 4W7SA 1QYDA 2VSOA 1MIOB 4G09A 4AY5A 2XSZA 4NOKA 2COGA 1KBZA 5HSGA 3FCEA 5HILA 1NUSA 1T36B 3ZWVA 2RHMA 4XWKA 3JWPA 5KNDD 2F9LA 1U2QA 4DMUB 3OFSA 3S1SA 3VZRA 3MUEA 5FR1A 4CM8B 3E5HA 1XBTA 4CHGA 3ZXYA 1NQVA 3I2GA 2WD9A 5IF3A 3D8HA 4GBGA 1N6KA 3TFQA 3MWKA 5DULA 1QS0B 4GYJA 5HVNA 3ESCA 4O29A 3FPGA 1OPXA 4CMKA 4NCJA 3ZCSA 5BSEA 1Z8HA 3NTOA 3SOPA 2ZQ5A 4G4SP 3O84A 3AVPA 1E2GA 4F38A 1TA0A 4IOJA 3WX0A 4YRMA 3JWGA 3QU4A 1V9PA 1EYZA 1N2OA 1K6IA 4JJ6A 1FU7A 3MG9A 4M7PA 5KZMB 4X63A 3U1BA 2G5GX 4K9KA 2E87A 4UD2A 2GKOA 4UJ3A 2HQ1A 1GLVA 221PA 3VHXA 4GGOA 1PJAA 2H08A 3KALA 1ZLXA 2AR7A 4HEA1 4R9VA 2I7CA 1TWCA 1PJSA 5BOSA 1GYQA 5EKDA 2JGNA 2NZ8A 4KQXA 1RMQA 2JFPA 1WR2A 3QKIA 4P3PA 3QLVA 1U0HC 1DDOA 1WKBA 2BHSA 3HXTA 1CWUA 3W34A 1IHDA 5J58A 3LUJA 3QPVA 1HLDA 4D3XA 2CLIB 2QX6A 5JC1A 1U0JA 5LQNA 4C7XA 4U63A 2PCJA 3LKVA 4WVLA 3TAXA 1TYEB 1KYTA 4RKQA 5CEFA 1SBQA 1RHRA 4EQ6B 4JT9A 2XBUA 1RWVA 2QJWA 3OQVA 2XODA 3RSZA 4ZU1X 4GLXA 4GLOA 3KNZA 3KXLA 1UQUA 1P3Y1 1G20B 1FFGA 5E9QA 3BXHA 4QTTB 2JFYA 3SKYA 4TUYB 3WYGA 2XHEA 5E1BA 2GHTA 4BMNA 1YKFA 4R2MA 4Q8EA 3CSWA 2AE2A 3CONA 2O1WA 4PICA 2VT6A 4UE3S 1PVOA 1ZVVA 3UICA 2AGPA 2HXSA 4ZQFA 3CB2A 1QFJA 2DR3A 2IYFA 4X6XA 1ZQ9A 4X62B 4WOJA 3HA3A 1QCDA 4U2GA 3SBDA 2HKIA 1G0OA 2GBCA 4N40A 4D0LB 5FLYA 4F5EA 3KPJA 2XUOA 5DCWA 3QFFA 1GSOA 1JYEA 1EWQA 4IQ0A 5IVDA 5BRJA 2VJMA 4B80A 5EHZA 4C06A 4E09A 3JZIA 1UMKA 2DJ5A 5HUHA 4M4SA 1R64A 2BGLA 3EMDA 3SQDA 4ZEVA 4MI3A 1AKYA 3NM4A 4QNMA 1XZPA 4M53A 1F7UA 3NAQA 4MDEA 4W99A 1XK7A 5M2QA 5EHIA 2C4HA 4YJ3F 3OOSA 5IN4A 5JY6A 1DJMA 3STXA 1IHUA 2FK3A 4LC9A 2JFHA 2O2XA 1NBOA 2YINC 4B44A 1KORA 3H0EA 4YRIA 4KQ2A 2ERYA 5G0VA 1UJ6A 4FGZA 1JHPA 1O94C 5K0TA 2NSYA 2R6JA 3MR3A 2Q5FA 4EA8A 4Q8FA 4Y2XA 4HDQB 3ZJ4A 5HK9A 1ZEMA 3R40A 1YBMA 5IWCA 1E5LA 2E5LB 2NAFA 2WKSA 4NPHA 1U4OA 4KEAA 1YAHA 3O4RA 4QGBA 2B0CA 1IN6A 2CNWD 4LRSB 4KVAA 2WNIA 2QRNA 1XVTA 4RB3C 4G1FA 3HOYG 1AK9A 3UT5B 3VYUB 4UEOA 2OYCA 4BFXA 3ESBA 2YWDA 4AZ3B 3GCZA 3PFBA 3U3OA 1LPBB 3CLVA 1EUCA 3MJ4A 3NYWA 2OA0A 2BF4A 4TYMA 1N4DA 3FCUB 3LBYA 4GLLA 2ZSAA 3K0KA 5EYPA 4REMA 4C20A 4LMPA 3CNNA 2ZIAA 5TPZA 4DQVA 4YRKA 2DMRA 5KHOC 2ET6A 3B3JA 3VR4D 4PLYA 3DOOA 4R2HA 1XN1A 1Y8CA 2VS1A 3BL5A 4GKAA 4XCVA 1QYXA 3EFBA 1YDFA 3PGLA 2QT0A 4PSVA 1MOQA 2CK3A 3EAGA 2VJDA 1O58A 1JLHA 3FZGA 3REFA 1P2GA 2CB0A 1LX6A 4J9LA 4EGAA 3H4BA 5HTKA 3G02A 1RQ7A 1SU4A 5BWBA 5CVJA 2OZPA 1OBHA 1S2NA 1C8KA 3H1GA 2QRPA 1S02A 3TTUA 1AQJA 2AXPA 3KOMA 1IBLB 4F4FA 3RVLA 3T0FA 4G67A 4LJ6A 3VKFA 2LP4Y 4APMA 1LFDB 4A27A 4ZARA 3PDWA 1UANA 3LMKA 2QJFA 3IHTA 5FBZA 4KSBA 3AERB 5EGNA 3ILYA 1O54A 4QE3A 1MMFB 2WYVA 4MUIA 1Z0ZA 4MAMA 5IC5A 1X1TA 1ZITA 1UKAA 3MWDB 4FFWA 1NF9A 3O9VA 3KLMX 5JVLA 3LC1O 2FB9A 2ON6A 1LVGA 4DIOA 5ALYA 5IPFA 3IP8A 1WKCA 1J49A 1C7QA 3E7DA 3BQNB 3EEIA 4W7IA 2QTHA 1MEJA 3JSLA 3GRPA 2OESA 2F4VB 2Q1UA 4C6SA 3FPKA 1YMQA 1NJSA 1P5FA 3AZQA 1XLWA 3DP9A 5K03A 4Q00A 2AKAB 2NXNA 2IV3A 5K8UA 3AXSA 2VHYA 4DUYB 4NPAA 4ZYLA 3C3BA 1QKIA 1HZZC 1YVRA 4KE7A 3Q0IA 4X62H 4DBVO 4C3UA 4LECA 2CHFA 1FUUA 5F7XA 3PEEA 4R83A 4Y9TA 1EUDB 3HYNA 4PIMA 1ZMBA 3F0TA 3ID6C 5K8IA 1XPRA 3QEMA 1SA0A 3P4YA 2CE2X 4TMZA 4DLUA 2M2IA 1RRFA 1NN3A 3OG9A 2ZTVA 1NBHA 5DTRA 2G08A 6ABPA 3JTMA 4QU5A 1E2LA 3WYFA 2VSXA 2AOTB 2Q62A 4XM0A 4OV6B 2IYZA 3O21A 3N7AA 4QLBA 1UPCA 1D7OA 1I4OA 1NBMD 4BATA 3IN5A 4X65H 1FVFA 2ZG6A 1QRSA 4OY3A 2QX7A 4FILA 3PUVA 3OEED 3TAHA 5FPKA 2HDNB 1P1CA 3MIIA 3V48A 2ONYA 4TVIA 3K15A 5E95A 3JSXA 1YQDA 4II7A 1SUPA 5JEDA 4HFJA 2QGZA 1AY0A 1VMIA 5KWSA 2FVYA 3CG0A 1CR2A 1F8YA 4Z1OA 1KE1A 5CTJA 2E5LH 1NJGA 1GADO 4G1BA 2R47A 2NUPA 1H8EA 3BB3A 5GWXA 1XVAA 4IX9A 3SEFA 3MJTA 5ITVA 3U7QB 4R1PA 2O2DA 4HVLA 1WLYA 5SZIA 4BTEA 1QIDA 3PXEA 4D46A 4RC9A 3L7IA 2YJZA 1N57A 1DT5A 1VRVA 1T0UA 1YZKA 4DCJA 4NEQA 4WEQA 5L9XA 3AVVA 1VFPA 1GG2A 3PLAE 4G36A 3NJ8A 1AZWA 5H0IA 5K0NA 4G2TA 4UBLA 1HK7A 3FFBA 1X87A 1Z16A 2EEZA 3NB0A 4Z0PA 1V1MB 4OHXA 2BELA 1XDGA 1PYGA 3ROGA 4NY1A 2PMZE 1GO2A 4B47A 3ACCA 5THXA 1HC7A 4G5GA 3I04M 5LLSA 2NU7A 1FSPA 2VLBA 4BZZA 1DRWA 1HDGO 3DUFA 4BKPA 2FWRA 1U1EA 3WGQA 4V1CB 4CUZA 4JV2A 1KDPA 4TQUS 4W9NC 4JI8B 2QPOA 4TQAA 2GZ1A 4ID9A 1LK7A 2X8BA 1QE0A 1OT3A 4Q03A 3JR3A 3BQ2A 1XOIA 2NV6A 3ZZ1A 5EP4A 1E1MA 2X0NA 2IYQA 2HQSA 2EG5A 3P9QA 1IXRC 2DLNA 4XYLB 1L5HA 3K8YA 1NT2A 3BMCB 1XVLA 3IR6A 2B0JA 3QSYA 1E4YA 3GD7A 2ZUSA 5EVJA 4MO2A 2BBOA 4H17A 1ABFA 1GG5A 3I23A 1FW8A 2W6PA 2IBSA 1M2GA 5KJ1A 2ZFUA 1S1CA 4JVLA 2O9JA 4NHEA 5B4VA 1NF8A 1AZSC 3ZY6A 4BTLA 1OGIA 4I36A 1R3DA 5K0FA 2H65A 1JF8A 2XYRA 3E9QA 4YBZA 4GQBA 1RQNA 3T1HB 3KJHA 5KQSA 3LU1A 1N56A 2Q2OA 4RTJA 1EGQA 2DT8A 1R10A 4ER3A 1K9VF 2X58A 2XCAA 2IODA 2AW5A 4X44A 2HH9A 3COJA 1PNOA 4EBFA 4DUYH 1L7VC 4BP1A 5F7ZA 4NLGA 3BFVA 2GXUA 3U48A 2H52A 1O95A 3TIXB 3I73A 4E70A 1KC1A 3CPEA 2C99A 3LY7A 4HX9A 5KT3A 2B20A 2A7QA 2AHOA 2O0LA 4DDKA 2P6RA 4HNSA 1L5GB 4EA6A 3B6KA 3WIDA 1C9YA 3M6XA 3JZFA 2NUAB 4KUGA 4AMVA 1R37A 3A6LA 5AW7A 3WJ7A 3MQFA 1GYRA 5EOYA 1NQUA 1I7SB 4AZSA 3SC6A 2MCTA 1ECJA 3JZMA 3N87A 2OK7A 2HT6A 2J46A 2IOHA 2WDZA 2YCLA 3WB0A 4ZAWA 4EEZA 2ZCJA 4HXYA 4OQYA 2NXCA 1Z2NX 2ILVA 1XV5A 4DWWA 3C6KA 1P2VA 3KV3O 4IICA 5GGXA 1Z6QA 4BZQA 3U3MA 4Q93A 1Z47A 3IEKA 3IBFA 3H5RA 4QU0A 4Y3UA 2F2TA 2WVJA 5E9AA 3DMTA 1QH9A 4WHMA 3EULA 2FKLA 4CNQA 5IM4F 3CX7A 4LCEA 3B3GA 3IBCA 2JIQA 2C9ZA 4E21A 4URVR 4CHIA 3COZA 3EXEA 4FW9A 2FRDA 4HUQB 5HWSA 2DCMA 1NVUQ 3PP8A 3MFQA 4OL0A 1KT8A 1T9HA 1P33A 3IE2A 5J2TB 3WR5A 1XNGA 3RF6A 3ZR4B 3F97A 1TA8A 4V38A 4E3ZA 1KSFX 1LTHR 3ANSA 4UOQA 2Y0BA 3LECA 2O8FB 1E5TA 3KXDA 3GNQA 1CF4A 1U0FA 1VSTA 3CXUA 1UOOA 1SR8A 1IYZA 2A33A 3LRPA 4A5OA 4RVHA 1KRWA 1VJGA 5KYWB 3LTNC 4O2BF 1IHXA 2GEUA 1CY6A 2C97A 1ESEA 2IKSA 1R0SA 5EZ5A 3NKVA 3RUEA 3G9TA 3AEXA 3L3BA 4JI6B 5IZ4A 1Y5IA 3HKDA 2YYYA 1HEYA 3TJMA 2A92A 1BWQA 3CINA 4MTDA 4X54A 1UZAA 1N0VC 2F1KA 2VP4A 4TKZA 3RR2A 1YRLA 1O87A 3LPMA 5TB5A 2VXYA 3QJGA 4KSYA 2LWIA 3DEYX 3RAPR 1GFSA 2JAQA 5F98A 3A05A 4L51A 3R3ZA 3OKAA 3QLUC 1WP4A 2UZ0A 5IP7G 4OQNA 2FZVA 3DAFA 2JAHA 4HP8A 2VDNB 1F60A 5FOUA 3VH1A 4K6HA 3FCOA 1ENOA 2X0FA 4YWHA 5PNTA 3QEJA 4MQMA 1H8HA 2DBVO 4A3MG 5JHGB 3HB5X 1VP3A 5C8YA 3LK6A 2FPSA 9GPBA 3OX3A 4UNQA 4YQFA 1MRZA 3PW0A 1UXGA 1Y1RA 3WZMA 3IDSA 2XRZA 4MEAA 3TKYA 3E03A 2X9VA 4OBWA 2WILA 3H42B 2V5AA 3VDMA 1IZYA 4ZJZA 2DEUA 5TSDA 3UJDA 1U2DC 5KQMA 4E7OA 3DZKA 3MOGA 3CX8A 3F2IA 4DMRA 1QC5A 1GSHA 1KA9H 4ND8B 2QROA 4MR7A 1JXAA 1GQOA 5SY9A 1ZJZA 1XKTA 4O4LB 2H29A 3VDQA 3UMCA 3RCBA 2RARA 1T2NA 1W34A 1L0BA 3IIJA 4MS1B 3WDMA 3G5LA 2RSLA 2QLFA 2LZ0A 1NXVA 1NQWA 1JR4A 4OGFA 4PLTA 3H13A 5DG7A 1QZ3A 3EUEA 1FA9A 2PT7A 1EFRA 5DM2A 3UJBA 1U8ZA 3KEGA 3RGZA 1X8JA 3FLEA 3X1XA 2C57A 5CLIA 3VPGA 3AKDA 5FI0B 2XA9A 1T29A 3KOUA 1U9JA 4ZU3A 1O4VA 3BORA 1C3XA 4BO2A 3GGPA 2FZ5A 4DV3H 1MX9A 3EH1A 3N2NA 4P08A 2F55A 2R6AA 4OI1A 4ME6A 1ZVMA 3I37X 2AG6A 1P4GA 2ZRHA 4QGAA 2J5XA 3KSDO 3ICVA 3LDGA 2BWJA 4Y6LA 2XD9A 4FCTA 3SSOA 2ZIEA 3FZNA 1CDZA 4NL4H 1HDRA 1GPLA 1P2UA 4MVJE 4F3KA 2CKZB 3EHDA 1MORA 1H93A 4B6PA 4J1SA 3NV9A 3SC4A 3B6ZA 1W94A 4XOUA 2FRVA 4D82A 1B6GA 2VK4A 1Z06A 2CCGA 2R4QA 1W36D 1QP0A 3QVJA 1SIUA 3GJ7A 3DLHA 5F2KA 5ABPA 3UGJA 4UUOA 3OU7A 3E8SA 5KTMA 1I5OA 2PT6A 3H2HA 5D86A 1R16A 2OORA 2JA8G 3SOZA 1YQQA 5ESXA 4NYMQ 4C3VA 3EOZA 1SRQA 3BSSA 4X1KA 1XDUA 1JAIA 2VDPB 5KT4A 5G2OA 4XM2A 4B3SH 1PEDA 1HDZA 1R8QA 4J6FA 4HNGA 1Q3TA 1UBHS 1N2CB 1D6MA 1NSTA 4L50A 2PO7A 1N77A 4LSGA 1Z4QA 2EX4A 4WW0A 5EWMA 4W8OA 4JA0A 4XCQA 5DK4A 3PX7A 5CAEB 1KEEB 4JI6H 1YRHA 1YC5A 1ZJ5A 3JQQA 2R8OA 3UJ8A 4QUGA 5KCMA 2TYSB 1T24A 4C7MA 2HCFA 3QZ8A 2F17A 3GPBA 1FVHA 2GCGA 3DZHA 2XOXA 3TTYA 2QRVA 3KBOA 3I1IA 3KOXA 1ZCAA 2UXDB 3S2EA 2JLQA 1N36H 4A8TA 2B94A 4C0HA 2RCYA 3HBJA 4B81A 5HQ3B 4HVCA 1E6UA 2GD0A 2ZJ6A 3CPJB 4JI5B 2N3ZA 5ER9A 1P7WA 3M9OB 2QMZA 3GUVA 2IUSA 1OWNA 2B1IA 3OUZA 4CMJA 3STHA 3VNQA 2WHXA 2HHCA 3IHLA 1UDRA 4U7DA 4HYQA 1RZRA 4LXTA 5KFNA 4PFJA 1JBQA 1ZCFA 5F1OA 3JRNA 1G3IA 3IO5A 1RMYA 3ZOKA 3LNTA 3VVBA 1ADJA 1NHGA 4OX9B 3EXG2 1AKTA 3WK6A 1ISJA 1Z22A 4IZIA 1S7CA 2N1BA 2IX3A 3PJGA 2PJUA 4M0LA 1KI3A 3VBCA 5FLKA 4AICA 4QFMA 4BRZA 2GFIA 4N3CA 3HU1A 5KT2A 4QUKA 1OYVA 2BY4A 1MA3A 4FCVA 1V16A 3FOAA 2V8BA 1BXZA 3DAPA 1N2CE 1DAAA 4B5LA 3J80W 2WJJA 1SCNE 2IE8A 1LY1A 5DM1A 4RVFA 3ZE2B 5HUJA 5B12A 2ZDQA 5EJFA 3C6QA 5LDDC 2B92A 3WIOA 4WK2B 3V8RA 4GHWA 2DBQA 4LMRA 4LJ5A 1N7IA 2CEAA 3KUXA 1A76A 1VIDA 3N2KB 4RF5A 4F1JA 3OP1A 1GXSA 3O8LA 1DTWA 3DC2A 4CIDA 4HAIA 1SCJA 1QP4A 1ZNQO 3FBWA 4ND6A 3IAEA 4J2OA 4L02A 3UNXA 2CMHA 4MVCA 5FDFA 4CVNA 4IIDA 5FD8A 4TV8B 4WZAE 1JI3A 1ABEA 3QZUA 5HDBB 4WLUA 1A2BA 1G4UR 1GDHA 2HMTA 2A14A 2JGRA 1LDMA 4MLPA 3FDJA 1B42A 1DXHA 2DTEA 4QJ3A 4HYEA 4YO7A 3I1YA 3SG0A 3T3HA 3LH5A 4EYEA 2IPMA 5JQGF 3EG5A 3QK7A 1JXQA 4LGCA 3LT2A 4NX2A 3WTCA 4EY5A 2VPTA 5AW6A 3RYIB 1TPYA 1PT9A 3NBYC 2A8YA 1MV5A 2WU3A 3MELA 1QFXA 4HZUA 2IV2X 4IIGA 1YDEA 3QWHA 3QOXA 1WY7A 4BRSA 1E0AA 3WISA 3AFHA 2GEVA 2H2WA 1OHHA 2MSLA 2C9BA 4Q44A 4P80A 2ONKA 1CUDA 2WIJA 2PPLA 1AV6A 4MRMA 5JNLA 3DBRB 3FR8A 2GM4A 5HW0A 2J9ZB 5I5SA 1E3JA 3QELB 2MR5A 4U7PB 3ETHA 1VM6A 2G09A 5DXAA 3NBYB 4HFMA 3GA0A 4Q15A 4RHTA 4WCVA 4YACA 2VF7A 1U7WA 3TXAA 2CLOB 5AJUA 1AGXA 1B8VA 1HNWB 3DBOB 1NP6A 3PD1A 1TADA 5CX1A 4WD3A 3K8ZA 3BMNA 2UXDH 2MINA 2C83A 3ZE9A 3NOXA 4V3CA 3A9VA 3UW1A 3TOXA 4JI5H 4OM8A 2VF8A 1G64A 2IC5A 5JU6A 1J70A 5JPCA 3B1XA 3CWZA 3CBGA 4ONEA 1R4ZA 1OZAA 1J2JA 1F4LA 1PK9A 4INOA 5HIMA 3SEAA 3W05A 4KGDA 4G4SO 5KFDA 3ICWA 4UPDA 2VP0A 3GL9A 3NC0B 1GZ3A 1UT6A 3LFHA 3PC6A 3B1FA 4JXXA 3GZNA 4FFOA 4YP7A 2ATEA 3AM3A 4G5SA 4IWXA 4OX9H 3N0VA 4OQXA 2V7WA 2EP5A 3ENVA 2HTFA 521PA 3DKIA 3SR3A 2IYUA 3PBKA 5FORA 1C4WA 2QP4A 5KBYA 4P5PA 4QOGA 4XRRA 3SQNA 2BEWB 3ZWYA 3KOWA 3RANA 1ISRA 1BMTA 4RM2A 2JGFA 1IN8A 2J31A 1P44A 1II0A 1DUIA 3T7JA 4UNRA 3OE5A 2I4LA 1WM1A 1R88A 1WXIA 3ABIA 1ICIA 2VQDA 2ZRQA 2Q1XA 3WWPA 1BMDA 1D3AA 2V7UA 3WMEA 4G9GA 1A98A 5AVWA 4IKEA 1KY4A 3FKSA 5HIAA 5AOVA 4P0TA 1XSEA 3FSRA 4LHXA 2Q4RA 3OZAA 1RWNA 5CK4A 3GCWA 3WGJA 3C3KA 2XUGA 4Q9JA 3SZLA 4D42A 2VAMA 3LTEA 1QH8B 4B4UA 4CV1A 5CT5A 4EW3A 4QWAA 3NU1A 1CNFA 3IYLW 1UJ2A 3ZCRA 2OHXA 4J1TC 5K0GA 4M1TA 2ZJ5A 1RWWA 4DV5B 1U3TA 3MQ2A 2H92A 2G40A 1FSSA 1R8YA 4JJ8A 1S4QA 5JFTA 1A8SA 1Y4UA 3KQSA 4FQ5A 5CLLA 3CUWA 5FR9A 4KE8A 4HAUA 3FDSA 1OYOA 5EY5B 2QTZA 4J0DA 4UASA 1NDQA 1MFPA 5HUQA 4UU8A 2Q5QA 4PANA 5A4KA 1EE2A 5F73A 1RBYA 5IASA 3BXPA 3Q8SB 1MG0A 4MRSA 1C14A 1SOMA 3A32A 4CUJA 4YMHA 5AW0A 4LF5B 1S9HA 3BIOA 4M89A 4NZMA 1HE4A 4H16A 1PK7A 3UK2A 3O1HB 2C5SA 2C4TA 3M5WA 2BFBB 4UNIA 4QELA 1EWKA 3H17A 5HFAA 1T15A 4EABA 1M1NB 1DBWA 5F77A 4KLRA 2OV1A 4K6GA 1USWA 2ZB3A 5EKXA 4YHHB 2VC2B 3D3NA 3TSAA 2PGDA 2H0AA 5SY6A 1SPXA 5JJLA 1NAIA 1G8GA 4XOIA 3DMRA 5IYCG 1B1CA 2HHAA 4B3XA 4F9TA 1XF9A 4ALIA 4HDMA 4MAFA 4W5WA 4RU1A 5K0ZA 3WWIA 3V2IA 4LXHA 4HK4A 4GKJH 1D0VA 3I01M 2JCBA 4RL4A 3KPYA 4UVGA 4Z7QB 4WPGA 1GKKA 3L0SA 3R9WA 3BG5A 1M2WA 3SI7A 1G7TA 4L07A 2FG5A 4TSFA 4TL6A 5DHUA 2CLHB 1IK6A 1MKYA 2JA6A 1QHNA 1GUBA 3ADBA 2QI9F 3SS7X 3LI2A 3VHXB 1H2WA 1YWGO 4EF5A 3KR2A 4BFWA 1VJTA 1X8XA 2HK7A 4ZDIA 1FFXA 4FU0A 3DM5A 1VKHA 5ELXA 2I91A 1L7DA 3C7CB 1QVAA 5BOSB 1OVMA 1DX9A 5K4HA 3SIRA 4TVOA 2GJKA 4A92A 5ALRA 3AUAA 3OCVA 4WN3A 4W5TA 2A0WA 2GR9A 3MGGA 5HXAA 3EPGA 5K0LA 4PTYA 2ZJBA 2AMJA 2HHFB 3EMKA 3V1UA 1NQAO 1RJWA 3THOA 1A8HA 3MJDA 1EM8A 2EL9A 4Y0NA 2X5XA 1FEZA 4TZTA 3AVXA 4P7GA 5KYYB 3DMHA 1HFKA 1JU3A 3BABA 3O73A 4YTEA 2X14A 3JQ8A 3VH4A 1XTKA 3HGTA 3GROA 2CUNA 2GLTA 4GMHA 2W42A 5LIRA 4X92A 4E1BA 2H7XA 4D02A 2C2ZA 4ZV9A 1DVRA 4FBTA 1H9CA 3CVUA 5KDLA 2WE6A 1H85A 3IQGX 1NU6A 5KFCA 5FD5A 3Q15C 4Z51A 5DI9A 1AUOA 5JO0A 1C7JA 4WNCA 5A4JA 3V4LA 1ZH0A 3NTVA 2W2XA 4NJEA 1NG9A 4B0OA 3R9RA 3COWA 1FFYA 5BR8B 4U0JA 1R4NA 1C4KA 5C53B 2RGGA 3FX2A 2Y1OA 1ML3A 3WGVA 3CLHA 2J87A 3HBMA 3QXCA 2G06A 4K3UA 3C5HA 4Q7LA 3CB4A 5JZSA 4EW6A 2FMXA 4XSHA 5ALNA 2HU8A 4OQQA 1UBTS 1D9ZA 3ANNA 5LQKA 1SG9A 4MULA 2C8KA 1Y4AE 2HLDD 5LYJF 1EFCA 4RE6A 3X2SA 1LK5A 2NG1A 4OPMA 4PPYA 4JJAA 2KW5A 2W2LA 3GGGA 1R9JA 2P68A 3B12A 2IZZA 1L5WA 3PXGA 2DC1A 2I2CA 4J7UA 1U3WA 1S96A 1U8EA 1SQ5A 3V7YA 5ALZA 4MKGA 5I9NA 3D81A 4FYYA 2F9MA 2FN3A 3H4DA 2UVPA 2EVWX 5JCJA 4WFKA 1FXWA 4XYEA 3K0EA 3ZEAA 5KWJA 2I8LA 4LVOA 5DN9A 1RDFA 1Z4PX 4U9IS 4I4TB 4QUJA 2WOOA 3SIXA 1GR0A 3KYJB 3EZLA 2O8CA 2DUJA 2ATXA 2X19A 5CNJA 4HXGA 1T0HB 3T1YH 4DT1B 1RHKA 4TXNA 1B26A 2VPPA 3WE7A 2RHWA 3AV0B 4M8KA 1RC8A 3W1EA 2JF0A 3EH2A 5KSZA 4X7RA 3U1TA 3CUUA 3K2EA 2H5LA 1UZNA 1FOEB 1DAHA 3ZU5A 1M6VA 3RSOA 1A5TA 2BDTA 5LLDA 1I80A 5CH3A 5JFOA 3KQHA 1LEHA 5DYWA 4R2JA 3O4GA 2AEJA 1T43A 5I6DA 4EY4A 3H0GG 3DVAA 4WASA 4U00A 4MRPA 1V35A 3ZY5A 1F3OA 3DCIA 1GLNA 4I3HA 2V6FA 2HX1A 3KWJA 3GRRA 4M1KA 4DJDC 2IP2A 3RRJA 1PR1A 3SMVA 1XQ6A 4MJ3A 5ENDA 1PEAA 2F3SA 4RAZA 1VCIA 2IYAA 3CRNA 3RTGA 3O1JC 4FI3F 5IP5A 2UYCA 3K5WA 4HLDA 1QMPA 1RWQA 1RWXA 5BV1A 3SX2A 3JAKB 1GL9B 3QPCA 5KFMA 1PEYA 5H7XA 1WHTB 3ITKA 1IN1A 3FYTA 3ZU3A 1NW6A 2E89A 4KX5A 2VXBA 4NLLA 3KL2A 4LTDA 1HL7A 3DW1X 3TZLA 1L3BA 2Q7XA 5KKAA 3TMAA 2QDKA 5A3RA 1DKUA 2LIPA 2GPJA 3ABQB 4UU7A 1W88A 4C21A 1NP3A 2JEFA 2AH5A 3LYHA 2JCGA 2HIVA 4YO8A 2H5EA 4LHZA 3NVDA 5I3CA 2OFPA 2B6HA 1FTQA 4L8LA 2JGMA 5AM0A 3JQPA 1SIWA 1TF2A 3WWJA 2A78A 4TLCA 1MQ8B 1H3NA 4DDMA 2ZT5A 3ZGXA 5GPBA 2IUEA 5B3KA 4B3RB 1DC6A 4KR7A 5L3SB 3MUOA 1YJCA 1DV1A 4RVSA 1ZK0A 1CDEA 3ZDEA 4O4JA 1GNTA 2JFZA 1SA0B 1GRCA 4O6VA 1AVTA 2CFOA 2K2WA 2OYSA 2R7ZG 3L6CA 1G5HA 3QVKA 3T5GA 3WNQA 3UAZA 4TXJA 4HMPA 1CS0A 2GUGA 1F17A 1YZVA 4LC1A 4V0LA 4O4IA 4RY9A 1NRIA 1IJBA 1VLLA 3SR0A 4WLEA 1GGOA 4LXGA 3RBVA 3ZI4A 4HX2A 3ZZNA 3QUAA 4IUYA 2NXWA 3CIFA 2X23A 1PLLA 5KFOA 1ZIPA 2XVYA 4KYTA 1TKRA 3GC6A 1G60A 4XDZA 5DHPA 1S2IA 2UVRA 3C7DB 1J0AA 1QXSA 3D9QX 4US2R 1ZMTA 2R8XA 6GPBA 3DHNA 5E6RB 4YRTA 3WAKA 5CRIA 5KYVA 4YUXA 2W8LA 2W2NA 3BQ1A 1AXGA 2WWGA 5H80A 5ARBA 3ODPA 1YIAA 4YUAA 3EDOA 4JI3B 3FPSA 3VYTB 3O03A 5F2NA 2ZBFA 2YZ7A 3TLGA 4R9RA 2OLJA 3M89A 4RZXA 4IOKA 3MYRA 5JALA 5AICA 2C78A 2BMVA 2FHPA 5JC8A 3FOBA 1N9KA 3IS3A 2QT9A 4U2DA 2REQA 1FFAA 3KZCA 3V80A 2RGNA 3QV1A 2IHBA 1OJLA 4OHUA 2ZI5A 1UM9B 2RHRA 4FHGA 4O3NA 5JS2A 4F85A 3NEAA 4WOBA 1X19A 1N6HA 5IKXA 3TE7A 5D1NA 3I1JA 2WWVD 1A9SA 4TV9A 1F8UA 1U98A 2I0FA 3LGAA 3BAFA 3IIMA 3EXFB 4X8MA 2YX1A 1SBTA 3WGTA 5CBPA 4TN5A 5C8DA 5DNEA 3HDJA 4ETNA 2JJ2A 1QVZA 1USGA 4LVNA 2UYQA 1R2QA 1SQ6A 3TW6A 4FD3A 2AG0A 5U9CA 1URPA 3G1WA 4W1RA 1N75A 3D7LA 1BCSB 1XWIA 3NWBA 4OUDB 1HLFA 2BR0A 2VDOB 5LJIA 3B9BA 1KGDA 3P2KA 4LC0A 4PU0A 2HMVA 1H1TA 3W04A 1J8MF 2H9IA 1WCXA 3H5LA 5DCUA 2WP8J 2ZZMA 4K6NA 3T4PA 2QN1A 5L9AA 1K8XB 1NV8A 2R25B 4US0R 4YJGA 1MENA 1S2LA 1DX4A 4ZMSA 1EWRA 1QV9A 3CEBA 2YWVA 1ZPDA 1XMSA 2Z3WA 4NXNB 4A3KG 2L18A 1M3SA 4WY8A 1BQEA 2WJ6A 3K09A 4XXHA 1USUA 4Q4HA 4MPRA 3V3TA 3LUPA 4OMFG 1FRZA 2FKNA 3SIPA 2V0GA 4GI3A 3PGJA 1ZJ6A 1N5KA 2DPXA 5D87A 5HEKA 4YBZB 4TQRA 5JADA 1Z74A 1I32A 4KRYA 1IXKA 4XRGA 1EE9A 5B5SA 3H9CA 1B6SA 3RHSA 2FK8A 3ZS8A 3OQPA 2H2DA 2ZTLA 1KIAA 5DTEA 2AGVA 2ORIA 1FYFA 2H2IA 4L9WA 4FOLA 2RI6A 1D2MA 3ZLUA 4B3RH 4IFIA 4WLFA 1WSCA 3NHWA 1Q21A 2H00A 3KTAA 4YCLA 1M2EA 4DMFA 2D06A 3C70A 1CZOA 1F9EA 1A82A 2O06A 2QR5A 3GD5A 4F6RA 1TW2A 3KJZA 1ULZA 2GF9A 4XSVA 3E9YA 1JFVA 1U90A 5YASA 3DWFA 1EB9A 4DQ0A 1JEYA 2C03A 1D4OA 3GNLA 3FWPA 2OCDA 4LN1A 2XCPA 4XUEA 3S55A 3QVVA 4QTZA 1OGJA 4RULA 4JK3A 5TDHA 4DCPA 2P0EA 5KG0A 2JC3A 2QJRA 2QZZA 1GILA 3O0TA 5ARCA 2BT4A 4CKBA 4V2IA 3THRA 4C30A 4BNLA 1Z37A 2XWQA 2FRDC 3GXOA 3CA8A 2E5WA 2GKSA 4R8LA 4KFRA 4JLDA 4Q3BA 4F60A 4YAEA 2NAPA 1OLUB 4I8DA 1ZONA 3VR5D 4JI3H 5A2QA 1KGSA 2HJRA 1HYGA 5CEEA 2F48A 3E27A 4XIGS 2P9GA 5FNVF 3OZGA 3HKCA 1R6UA 4NYIQ 4XYBA 4MS4B 4K05A 4BO6A 1HL3A 2Y67A 3V4FA 1N2BA 2LCFA 2ZBEA 3IUMA 5CB4F 5BT9A 1T1JA 4LAFA 4J0FA 2CB9A 1PV4A 2OO3A 2CZGA 2AJ8A 1I7LA 1YMUA 2PX2A 4F45A 5KJEA 2UZIR 4KQCA 3KWMA 3T9FA 3GEPA 2JBWA 2ZIUB 3U40A 4DMCA 3BZBA 2ZJYA 1HO3A 2E4WA 3EIFA 1D1TA 1X92A 5CU7A 5BWVA 1UPXA 2W0SA 2FW9A 1RWOA 2O0KA 1V9CA 4RV9A 1UBGA 3QGMA 3UB3A 3WL6A 3SM9A 3IMGA 5TNXA 4PZ8A 2O2JA 1JA0A 3P19A 2AC7A 2D74A 3HJCA 1UBUS 1KI7A 3L4BA 1WZ2A 4ZDJA 1N9GB 2ZQYA 4WFJA 2DPJA 5DWDA 1ONSA 3ZDZB 3R6WA 3AY7A 2W43A 5J47A 1BRTA 5I7FA 1I51A 2R8RA 3EPLA 5KFYA 1ZD5A 4F2DA 3L4EA 5F1PA 2R751 4K46A 9ABPA 1CQWA 3ZDXB 5G53C 1X8KA 2QNIA 1B2RA 3BIXA 2G77B 2QD3A 3TINA 4IJ5A 1GTJ1 1Q74A 3RW9A 2Z6QA 4NTZA 5TIIA 4NJMA 1Z2DA 2F3QA 2WUDA 5KG6A 3RBEA 2X77A 2E49A 2FP4B 3KYHC 4K03A 1NW7A 4P86A 3WWCA 3C6BA 3JQFC 3PL1A 4ZVQA 3PEVA 5MN4A 4XWYA 4P81A 1RS0A 1CUBA 4MZXA 1SBNE 3ZN2A 4URHA 3U4HA 2Q3BA 3ETCA 4FP9A 1RAHA 1P29A 3ZXSA 3L6DA 2J6TA 4C5CA 2XNCA 3Q5GA 3TLYA 4YGYA 3E1SA 4NMWA 4LYGA 1XKLA 3R7WA 2EKZA 4RW0A 3G2PA 1ZX1A 5AP9A 3WQHA 5I4BA 5IVKA 1UFQA 5F9FA 2AN1A 2DWQA 2PAFA 4BPRA 4GRDA 4HNAB 4BLUA 2NZXA 1Z82A 2YWCA 3JARB 4L7QA 1AJEA 4H0NA 2Y0EA 3GVHA 2FKAA 1AN7A 2OXCA 4UUPA 3TLZA 2ZAMA 3LWDA 3PT5A 1RWBA 3C3CA 2PYIA 1QC5B 2FJUA 5JYEA 3E61A 1E62A 4WWHA 1T9KA 4NMMA 2P2NA 2GB4A 3ABRB 4DJEC 2E2WA 5K0SA 4PLZA 1RYEA 5KOYA 1XRQA 4LRYA 4GOOD 5DM4A 4LIPD 1RAAA 1LX7A 5A0VA 4RXMA 2OP0A 3T5MA 2Z0MA 4OX9Y 1IBLH 4HDOB 2JLUA 4WGFA 4I1VA 4URYR 1BDIA 4JB8A 1W52X 2EGUA 1TDJA 2J9GA 5EP2A 1Z7WA 4R71A 3E4DA 3VNAA 1JG4A 1QO7A 3D3QA 4E6PA 1O8CA 4RJKA 4D57A 1L5SA 5DBFA 2HUNA 3GIQA 2HADA 3CW9A 3V33A 1UBJS 1DO0A 1E59A 4TRJA 3HA2A 1RXIA 1C8BA 3PENA 1UJBA 4DL4A 4KIUA 2OORC 2ZE8A 1P77A 1FDWA 3LXUX 3RIHA 3EPIA 5CA1A 1DAPA 1PF7E 2ZRGA 1JG7A 3BMOA 1T5DX 2F4VH 4TXLA 3E23A 3A1DA 1XZNA 2V7TA 3SZRA 5K8TA 4JI4B 1F0YA 2IU6A 4I08A 2VCYA 1QVWA 1G5TA 2XV1A 5CXSA 4I9UA 3ZJUA 3EIHA 3C8MA 1GCIA 1XU7A 2POCA 1PJZA 5JG7A 1HT3A 2QLTA 4RGQA 1BDHA 4KYIB 2I1QA 2ZKLA 4F5YA 2BGJA 4DR6B 3PCXA 1KDZA 1W85A 5BYKA 1DRKA 2CJYA 4LK2A 2X8LA 5TEVA 4D3SA 3OTQA 4TVKA 2WIGA 4S1PA 2E55A 1HDOA 3SI8A 5JV5A 1L4MA 3ROZA 3MNFA 4X1KB 2WAYA 2CV2A 3UXHA 3KB6A 1X86B 4ZT7A 1MA0A 4R2KA 3T95A 4PC6A 3S8MA 3M6MD 3AEUA 1YE3A 2IMWP 4P93A 1KHHA 2GXSA 1KFBB 4RVCA 3ZV7A 3JRXA 5IARA 3INNA 2Z04A 5IZCC 1LH0A 3LP5A 2ZZKA 4YLGA 4COOA 3KKEA 1ZW6A 1UXKA 3GBPA 4HDKA 1PL7A 1Z2EA 2B2CA 1JMVA 3TPZA 2QXUA 4JLPA 1JIUA 5ESRA 1CY2A 1EXDA 3W8DA 3CNHA 1N5RA 3OKCA 4LSMA 1T4CA 2XDYA 1QGOA 3GZ4A 5A1TA 2ZXFA 1SHTX 3O8OB 1QHXA 3RADC 1XRPA 3B1JA 1X2EA 3LPDA 3QA3E 1IMJA 4IHAA 2ZCUA 1ZJYA 1BN6A 3WWDA 3IUBA 2ZRPA 4PX5A 5KQRA 3P9IA 2PTHA 4UHDA 4QHSA 3ER9A 2QUBA 3KEQA 2HWKA 3DQQA 2PRZA 1RM4A 4AJ1A 2WA1A 1IJKA 1W5FA 4F8YA 2QF7A 3TLAA 4P7BA 5HQJA 2XGPA 4N8DA 1D2CA 5JD6A 3H3VH 2ZWVA 4KUEA 1WLSA 1FLDA 5CDGA 1M2HA 4M38A 4K9LA 4DR3B 1L7XA 1OPRA 4OHWA 1H2FA 1JDTA 2EGGA 1C7ZA 5C9ZA 2ZYSA 1CU1A 4ND3A 3WGOA 2CVZA 4S3MA 1U6KA 4F4JA 1L5RA 2BGKA 2OGTA 2ZTMA 4Z3KA 3HV2A 4M22A 2NX2A 2O8EA 2YMQA 4KN5A 3QPUA 1ORTA 3GGSA 5LQJA 2XADA 3ILHA 5EJAA 4EB8A 4Q1VA 4A3GG 3RO7A 4PO9A 4Y2YA 4CU5A 3N8HA 5J4LA 1GGKA 4JI8H 2WYIA 2D2IA 5E7QA 1GPMA 5CT6A 1SBYA 4TTJA 1BS9A 4ZIRB 1J5PA 3FIUA 1UQTA 5I45A 2RGYA 4K40A 1K6MA 2WRZA 3NUGA 1XRLA 2FVXA 4OI4A 2H0QA 2ISQA 2AK2A 1XCJA 4QWEA 1QGED 2AMVA 4EYKA 3FF4A 1KJZA 1XP8A 2NACA 1P0MA 5C5JA 2VWHA 3E05A 1GXSB 3HRHA 3JAWA 2FE3A 5EXEA 4HXEB 1CF9A 2YN4A 3QEKA 2QPAA 4BQSA 4IQFA 4IIJF 2XCIA 4CUKA 1AMOA 2PX8A 1MEOA 3W6ZA 5WRFA 5C37A 1JHQA 4U8GA 4B6EA 4KXMA 2GGSA 2YZLA 3DXFA 4BKOA 4MITA 3T1HH 5K3FA 3KRTA 3NHZA 3OSPA 1RR6A 4NYIR 1DGSA 4G5YA 4QBFA 1OI7A 1PZFA 2J3KA 4JI4H 1P2BA 4X90A 5K3OA 2Q3FA 1XJWA 2C8JA 1IMOA 1VI2A 3UV3A 5AVTA 2IQ5A 1WBBA 1D2HA 4QFDA 2W71A 3AOGA 1TVCA 1IEVA 4EG4A 3X2FA 1CK4A 1S3IA 5CT4A 4R8VA 2JJQA 4EGSA 5EZYF 4OGWA 1JDNA 1UK6A 4MMZB 4Q47A 5TS2A 3BFKA 5ALPA 3UTDA 1PHPA 3A1WA 2PGLA 4E0BA 3NHBA 4DVJA 4UTRA 3IBYA 1PGOA 2GS9A 5BN4A 2Q3MA 2WIKA 3KB2A 5A4FS 3MOIA 3EEOA 4EG6A 3BSYA 4GECA 1Y33E 2Q1TA 2QM3A 3F7MA 2M9MA 1YNOA 5IXYA 3KKLA 1UWKA 3DDCA 1LJ8A 2XKKA 1W96A 1YB2A 4V0QA 3M3HA 2JLRA 4YB8A 3IXQA 3V8NA 1GRNA 1B6TA 3FTFA 3E22A 5CX1B 1O75A 2WUFA 2D5AA 1M0WA 5EMKA 3OAAD 5MF6A 1S01A 2X8JA 3Q8MA 1KAGA 2X9GA 5MFZA 4PQGA 1QDEA 4A3JG 4DW8A 2FWAA 3A4NA 3QKSA 2FN4A 1EK5A 4RS3A 5B1DA 4O4HA 1WETA 2JIMA 3E8MA 4KI7A 2OKGA 1Y8QB 3K96A 4MW2A 2VWPA 1XZDA 1P9OA 2JS7A 3P27A 1CUXA 1TQ8A 2PH7A 2RBGA 1QHGA 4PNEA 4CMIA 1OAOA 4BLOA 1DKLA 2OXEA 3JSAA 5FLXA 2XVAA 3ELBA 2FJZA 4P7JA 2DPLA 3ZE1B 2Y1GA 1Q1NA 4Q21A 2Z43A 3OHAA 1ORDA 3WLNA 2CC2A 5K09A 1QGUA 2HDOA 3ORSA 4DYHA 1M76A 4G3IA 1HY3A 1Q0TA 1VSQA 3MIZA 4O7WA 3T4UA 3LLCA 3FZYA 3WL5A 1N5OX 4CTKA 5EGSA 2IZOA 2CJFA 4FC6A 5DLDA 3RPEA 5HIJA 3IAM1 2QL5A 1XN4A 3B5IA 3GUCA 3S81A 3HU2A 4A2WA 2D1RA 4IJWA 2O5RA 5KT5A 3RIMA 3AR8A 4G65A 3DZIA 3NG1A 2ZWPA 1SU7A 2YJ6A 3H1AA 1Q7EA 5HF8A 3EA5A 5T4BA 2LDBA 5I51A 1Z8DA 1BOOA 3ZDQA 3WI7A 1A8PA 3GRKA 4KMMA 2C4KA 2B3DA 1S0OA 3VOAA 5H82A 4JDPA 1JKJA 3A6DA 5JNRA 1PYOA 1I6MA 1RI5A 3OQ1A 4CI9A 4WZAB 5ECDA 1JU4A 3TQOA 4LYJA 4KOEC 5EQTA 4CKXA 1EFVB 3KZMA 4KTVE 1L2TA 3M70A 1C41A 3V2GA 5GV8A 4B1FA 4UUMA 4UULA 4XFJA 2R1VB 2ACKA 1WNFA 2BZSA 4IWYA 4J0IA 4NFSA 1MAAA 1DNPA 2ZCVA 5H59A 2BV3A 1LDEA 1V43A 4TKVA 1VB3A 1T5IA 3C1AA 3GMSA 3D8NA 2HYDA 1OLOA 2I6SA 3EZ9A 3SX0A 4NXMB 3HR4A 4EEXA 2XUJA 1H3EA 4RAQA 3IQIX 2C7QA 5M29A 3R4VA 4JFRA 5KFXA 5BW4A 4Q1BA 3V6MA 2FLLA 2W6ZA 1JAXA 2HWUA 3LC2O 1CPYA 4D81A 1QVVA 2QSZA 8ABPA 1A4RA 4PCAA 3QE0A 1ENZA 1BXKA 3WIBA 1VPTA 4NZNA 1YFJA 2XUAA 3PYXA 1DBSA 1OX6A 3O3CA 3TD9A 4ZVKA 3LJKA 4CETA 5DGIA 4YXWA 4MUHA 5G0TA 4AUEA 1TPZA 4WNAA 1RT9A 5I9IA 2X4LA 5KFZA 4QOHA 5F21A 4NQRA 3T5DA 2HA6A 2F90A 2QE7D 4JODA 4BBAA 4EJ6A 4FNAA 2HNBA 2DPYA 1QLHA 1ULUA 2NTYC 3MGCA 1D6NA 5BO5A 4ZCQA 4HAWA 2ZRKA 1XDZA 3KQMA 3Q88A 2NYUA 3A1FA 3IUNA 3BAAA 1M34A 3Q7QA 1PJLA 1WB9A 2YJ5A 2PAAA 3DAYA 3D3WB 2C35B 5IFKA 4NNJA 4EI9A 3WP1B 5CCDA 4FS8A 3EHEA 3Q3GE 4DHEA 1ZXLA 1HRDA 4CG0A 4M7EA 5BYJA 1QGZA 3T1QA 1V8OA 1FP7A 3MRXA 1F6DA 5IS2A 3CHYA 1X2BA 2X0KA 3RVNA 5EE5B 3L7CA 3UATA 1XQ9A 4P7KA 3UGQA 3V1LA 4IEFB 2SNIE 2R4UA 2YN2A 3BREA 4MQ4A 1FSFA 2PZBA 4JL5A 5GAJA 1D2EA 1M0EA 5GM2A 1X39A 4QARA 4HEA6 2JLVA 5SYMA 3QF7A 2VUHB 3HSYA 4H1VA 1HSZA 3P52A 5HBRB 5ALOA 4OQLA 3Q5EA 4A15A 3LE8A 4O84A 2J1LA 4X24A 1YQXA 1XZ8A 3R1IA 1TD1A 1TJ5A 1H22A 2EJ0A 4C0JA 1JEOA 1Y98A 5ICCA 3C2QA 2Y1WA 1X9IA 3QXHA 1N3YA 3T3GA 1SUFA 3LLMA 4GYWA 4QVIA 3T7CA 3W3ZB 1RRKA 1OW3B 4ZCIA 2RGAA 4M8LA 3CF2A 1LDBA 4HNQA 1F0NA 3HDTA 2B5WA 2GN1A 1NBAA 4GR4A 4B6GA 3TXYA 5FR2A 2B5VA 3CE6A 1XTBA 4ZZ0A 3B70A 5BRAA 2AQ8A 1T4GA 3TL3A 3CVJA 3JWHA 2MTBA 2P6PA 1H0SA 4AT1A 1GSAA 2FJPA 2W2PA 4CWAA 4LRXA 1XEFA 4L9AA 4E22A 3ORRA 1G5FA 3LWBA 2E6UX 2C8VA 4M0PA 1CKNA 3JYHA 3MW8A 4P5EA 4QG7A 4FSDA 4BGUA 3WMRA 4HKTA 5J1TB 2IH5A 3DDHA 3K72B 4QICA 2AYXA 5DX0A 5IWAB 3OPQA 5L6MB 2XUIA 3MMSA 5DV9A 5C8XA 1G98A 3OIVA 2I7XA 2WSSA 3RTEA 2OO5A 3VPBA 1JVSA