1UC8A

Crystal structure of a lysine biosynthesis enzyme, lysx, from thermus thermophilus hb8
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
280
structure length
254
Chain Sequence
MLAILYDRIRPDERMLFERAEALGLPYKKVYVPALPMVLGERPKELEGVTVALERCVSQSRGLAAARYLTALGIPVVNRPEVIEACGDKWATSVALAKAGLPQPKTALATDREEALRLMEAFGYPVVLKPVIGXXXXXXXXXXXXXXGFQHQLFYIQEYVEKPGRDIRVFVVGERAIAAIYRAENCPLTEEVARLSVKAAEAVGGGVVAVDLFESERGLLVNEVNHTMEFKNSVHTTGVDIPGEILKYAWSLAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Lysine Biosynthesis Enzyme, LysX, from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Biosynthetic protein
molecule keywords lysine biosynthesis enzyme
total genus 71
structure length 254
sequence length 280
chains with identical sequence B
ec nomenclature ec 6.3.2.43: [Amino group carrier protein]--L-2-aminoadipate ligase.
pdb deposition date 2003-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08443 RimK RimK-like ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.80 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 1uc8A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1uc8A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1uc8A01
2XD4A 3V4ZA 4E4TA 4EGQA 3LWBA 1KJIA 1T36A 2V58A 2DZDA 4TUYF 4I55F 2YL2A 4MV7A 1KEEA 4IWXA 4ZQIA 3VPCA 1PK8A 2GPWA 5HV6A 1C3OA 2DIKA 4YAJB 2QK4A 3SE7A 2NU8B 4ME6A 4HNVA 5CA1F 2W6PA 3WO1A 2VR1A 3G8DA 4EAAA 3K5HA 1DIKA 4XYLB 1VBGA 2W6NA 2ZDHA 4YAKB 3HBLA 3MWEA 5BPFA 3OUUA 2FPGB 1GSOA 2HJWA 5KKNB 1GSHA 3RUPA 5I47A 2J9GA 4MV1A 1JKJB 4M98A 2NU7B 1VKZA 2DLNA 2R6FA 2FP4B 3R5XA 2SCUB 4L1KA 4O4IF 1DV2A 1JDEA 4YBZB 4C5BA 3TW6A 3JRXA 5K2MA 4O2AF 1AUVA 4Y8VB 3TINA 4I4TF 3R5FA 2VQDA 5C1OA 3LP8A 2NPOA 5IYZF 4M99A 4EABA 4I50F 3ORQA 5JVLA 1I7LA 3WO0A 5D8DA 4ZI7F 3JRWA 4DIMA 2GPSA 1E4EA 1EYZA 3BSSA 1CQIB 1VBHA 2I80A 3K5IA 3MJFA 5LA6F 2CZGA 1B6RA 1EUDB 2R7MA 2R87A 4HR7A 4J6EA 2OLSA 1EZ1A 2QF7A 4EGJA 1E4EB 1C30A 4EA9A 1SCUB 2FPPB 2IP4A 5GONF 2R7KA 5LXTF 3RV4A 1I7NA 4XYMB 1KJ9A 5LP6F 3HO8A 3N6RA 2ZDGA 2YRXA 4O4HF 3BG5A 3RV3A 5BMVF 4MA0A 2PVPA 1CE8A 4MV3A 3BSYA 1AUXA 4WBNF 2W6OA 2YS7A 2W6MA 5J2UF 2R82A 5LYJF 2CQYA 2W70A 1IOWA 3TIGA 1CS0A 3U9TA 1PX2A 1CQJB 4EG0A 4ZHQF 4C5AA 2DWCA 1KBLA 2YYAA 4IHJF 3GIDA 2PN1A 2R85A 3I12A 3K3PA 2V59A 1GSAA 3TQTA 3WNZA 4QSHA 2R7NA 3VPDA 4FU0A 4DLKA 3JZFA 3AX6A 1JLLB 2YRWA 5JQWA 3ORRA 2R84A 1GGOA 4M9UA 4HNUA 5JVDF 2R86A 3BFPA 4EA7A 4YB8B 3U9SA 1JDBB 3VMMA 5HBRB 5CB4F 2FB9A 1KJQA 2FPIB 2XCLA 4MA5A 4YJ2F 5JH7F 2NU6B 4HNTA 1UC8A 3VA7A 3N8DA 2Z04A 2R7LA 2W6ZA 3JZIA 3VPBA 4TV8F 5DMXA 2W6QA 1BXRA 3ETHA 3G8CA 2X0SA 1W96A 4MV4A 2NU9B 5LOVF 1EHIA 4WD3A 3OUZA 3R23A 3BSWA 4TV9F 2GLTA 4ZOLF 5EZYF 1B6SA 3VOTA 4O4LF 4IWYA 4XX0B 1DV1A 2C00A 5KX5F 1A9XA 2W71A 3MWDA 3AW8A 3Q1KA 2V5AA 3ETJA 3R5HA 1UC9A 1W93A 1GLVA 1BNCA 3HB9A 3E5NA 4MV9A 1ULZA 2VPQA 5C1PA 3QFFA 4EA8A 1IOVA 5BPHA 4HQ6A 1KC7A 2I87A 2YZMA 3Q2OA 2YS6A 4XZ3B 3V4SA 2PBZA 1KJ8A 3TIIA 4MAMA 4IZOA 2NUAB 2P0AA 2ZDQA 1KJJA 2YZNA 2YW2A 4M9CA 1EUCB 3RFCA 5CAEB 3GLKA 5H80A 5J2TF 4GGMX 2YZGA 4C5CA 4O2BF 4MV8A 3UFXB 5CA0F 5C8YF 2VHEA 2I8CA 4MV6A 4YJ3F 1WR2A 1M6VA 4RZQA
chains in the Genus database with same CATH superfamily
4G0ZA 2OAEA 3STVA 3WGLA 1Z4NA 2PJUA 3A8TA 2QX9A 1E69A 1GNTA 1N7HA 2XIQA 3DTVA 1QWSA 3SSOA 2QT1A 2ISCA 5E6RA 2WNHA 3LF1A 5H0IA 3STXA 5KEIA 1YS1X 3LDGA 2W93A 1HEIA 2FGKA 3HU2A 2XQGA 1N6RA 1YQGA 4LFCB 2XEDA 1LA2A 3TQFA 3WC4A 5MFZA 1CW2B 3R5KA 4ML3A 3AUKA 4Q47A 2JEIA 2PGIA 3I52A 3ELYA 4KIUA 2WAMA 1H1DA 4LUCA 3M6UA 4BB5A 5EUCA 4EKIA 3RSGA 3FFBA 4DNOA 1X1AA 3PNYA 2ACEA 5LU8A 4X44A 3D4PA 3HUEA 2GBFA 4B3DA 2AOTA 1F4PA 2SCUB 1QUFA 2PEYA 2QAIA 2RSLA 3M34A 3JRXA 5HF6A 4EFKA 5E3IA 1QIGA 2O0JA 4EDHA 1P77A 1KEVA 3JQ8A 1J5PA 4BMNA 2GSDA 1YKSA 1B00A 3HVKA 3MMZA 3JR3A 1HDZA 2CN1A 2QXYA 3HYLA 1RACA 2FWBA 5D8DA 5G1PA 5A05A 2C3YA 3OLYA 1BAPA 3MTAA 1OXBB 1PQWA 3I1YA 1UBKS 3SYRA 4EENA 4X3CA 3QA9A 2VQEB 1NV9A 1E5XA 2Q4RA 3RFXA 4HV4A 1FP4B 1GNSA 1DE0A 3AI2A 3BQNB 1AKMA 1DELA 1PO7A 2SKDA 3FKSA 4JGGA 3KPYA 3PRKE 1Y9EA 1KH1A 4ZODA 2X0DA 5ITZB 3IUSA 1HKHA 3EB9A 3KZVA 1PP4A 2FQWA 4LYFA 4UEWA 4Q4JB 5AVWA 3COPA 2JH9A 1OYWA 1E3WA 3D9QX 2D1TA 1L7PA 2H1HA 5GY7A 3EDQA 1OXUA 2ZBFA 4Z7OB 1WB6A 2JA5G 1K3UB 1Q1BA 3ETDA 3NEYA 3ZQJA 4YQFA 2V7WA 1JHVA 1TX4B 2UZ0A 4RKYA 1EEHA 3RKRA 4ZCRA 2Z8ZA 5KOYA 3OZEA 3U4MA 1PZEA 2GAAA 4K05A 5DGXA 5HF8A 5LVAA 3IEPA 4I5DA 4HXGA 4X6UA 1XPUA 4BJHB 5GIOE 2C92A 4MWBA 4QFDA 1YWGO 3KXDA 2AZDA 1RWKA 2DEUA 4ZXFA 1LI4A 1D8TA 2R48A 4RAOA 2ET6A 5DNVA 4TYNA 2XCLA 2IRWA 4PHTA 1EX7A 4IS3A 1ZHSA 1P6UA 1ZOSA 3NCTA 1I6UA 4GMDA 4KNWA 4B82A 2ZJTA 1ZA1A 4FBUA 1A5AB 2R25B 3PTLA 2A7XA 5HKOA 2WD7B 2MSKA 3NHYA 4R8KA 2RGDA 1BDBA 1M1YA 3FCCA 3LT2A 3AL0C 3JD3A 3GWGA 1UQRA 2N0SA 3EUWA 1QVZA 4MJXA 1MT0A 2BFFB 1JH9A 4K46A 2V7TA 5EVCA 1DWQA 1U0FA 2YN4A 2R6GA 3KX2A 4UU7A 3CPHA 3HJAA 4KAXA 4FXOA 1KY2A 3IUEA 3IQWA 3Q1KA 4NYJR 1K6JA 1NL3A 2PT9A 3OQ6A 4YP9A 5HF9A 2R1VA 4QRIA 1K6EA 3TTTA 3DHWC 3EGXA 4YPVA 3DTVB 3IJPA 2WIGA 1A0OA 1ZD2P 1MZBA 4QFMA 1K5GA 4DRXA 1VI2A 4JFRA 2FUG6 3OQHA 2PQ6A 4EBFA 1BVUA 1C30B 4NJEB 1NKSA 3CRW1 3EQ6A 1GT6A 3KTAA 1UBRS 4INJA 3RF7A 1TEHA 2Q50A 2ALZA 2C2KA 1NQTA 1TD1A 1UFRA 3MAAC 4HQ0A 4KAAA 4R9NA 3WGMA 3UWSA 1NNEA 3BWMA 4EW6A 2QD3A 1NUSA 2PXHA 4L8GA 4L8FA 3A7EA 3SYMA 3R77A 4XD7A 2JL1A 4FMPA 1JAXA 1I3NA 1SBTA 4R5HA 5HOQA 3TOVA 3UPTA 3HVUA 3GROA 2JKYA 7MDHA 3COVA 2QE6A 2WJ4A 1TM7E 2NXEA 3DAFA 4G0PA 2FN8A 3A1NA 4J0IA 4PYKA 5CUQA 4D8XA 4F38A 4O3RA 2HXGA 2O07A 3VFDA 5L9AA 3FSEA 4K9SA 3T1VA 4F0JA 2QRVB 2VJPA 3NNDA 5DWVA 4RKRA 5D51S 2GPYA 5MDHA 3I01A 2CC2A 2ID8A 1RP7A 4DB2A 3VH1A 2GN1A 1YR6A 3RIHA 2IUSA 3D43A 3EGDB 1KO5A 1JNYA 1GYQA 3FNIA 3HDVA 3IOMA 1C29B 1EA7A 1TYEB 3HABA 1XAJA 3RYTC 2QJWA 1TI7A 4R68A 2YVUA 5B3JC 2G70A 1LNQA 3CSDA 2C2OA 1ADBA 2QI9C 3GUYA 4MB2A 4TKVA 1FF9A 1ENPA 1QRDA 1LPPA 3KEQA 1E5LA 1UKAA 4OP2A 4HQLA 3UW3A 1RPNA 3AHJA 5JALA 1E2GA 1U65A 3ANTA 4EGJA 3AYHB 1FNCA 1CRLA 3HU5A 4R6WA 3ZGXA 1Q1ZA 4CLRB 5A6VA 3D3QA 5EYPB 2JATA 3MT9A 1DGSA 4Q1VA 4YAFA 3X1YA 5JZVA 4KQIA 1YD7A 3F3MA 1EFKA 3T3OA 1Y5NA 2Z9CA 4A3LG 2AN5A 3HSYA 3BGVA 1Z4IA 1G2OA 1PT7A 1I2LA 5AKLA 1I33A 4HN9A 5DCLA 1HSZA 1KIMA 5BORA 2X9VA 3TIVA 1ZMOA 4OF4A 4DHEA 3VH4A 4D45A 3WWJA 2BZ1A 1JLLA 3CJQA 4UAVA 2Q8QA 2CVOA 2PRYA 2HQBA 3OQIB 3W8NA 4BVJA 4BUZA 2RHCA 1E79D 1XBTA 1QQTA 1ENOA 1YI0A 1EXWA 2JFXA 5GOTA 5H68A 3DULA 3VSDA 3VR1A 3MM4A 4AFNA 1TYZA 4XDHA 4BZPA 1BEZA 5EXSA 1B16A 3QE3A 1NURA 3CINA 2ZJ7A 2NVYA 1DEHA 1Q92A 1V9LA 2I76A 4Q01A 2W8BA 1Z62A 3GDWA 3DTFA 4GR5A 1NSFA 4MK4A 2J0SA 3BULA 2JD0A 3HOVG 4GC7A 4P5EA 1M5RA 4GICA 4B9AA 1VPWA 2QORA 3DNMA 4UEQA 1G8SA 5TNXA 4J0MA 3E1KA 4ZWNA 3N8IA 1WCWA 3NETA 1QVAA 3NOXA 3FUVA 1SXPA 4Z4GA 1BGWA 1S8AA 1UMCB 2YXPX 4KR9A 3H19A 3ETJA 3L8HA 3X1WA 1O0SA 1Z0UA 2ZAIA 1DDOA 4R2IA 5JPCA 1P5FA 4ZK2A 1USGA 2D00A 5FI0B 4YMLA 4YLEA 3ANXA 1OB5A 3DNPA 2G83A 1VDMA 1PR5A 1TC2A 3AHCA 1Y0BA 3SBDA 4DLSA 3SNHA 5FYQA 1U3TA 5HE8A 3L7KA 5C32A 2VXCA 4DL3A 2QU8A 3CTPA 1NMXA 4G01B 4QQNA 1XRRA 2Z6QA 1U2GC 3H97A 5IJ0B 1X8XA 2IOHA 3R1IA 4OFZA 2P2CA 4X1IB 4HNHA 3E03A 4Y2PA 4HDRB 3O9MA 2F62A 1HT3A 4GPIB 3R75A 2QVXX 3SZLA 3VBEA 3ADDA 1UPTA 1OTYA 4P3PA 2XXAA 3WLRA 1FC0A 1E3WB 5LQJA 1XUOA 3OF5A 4BATA 4CJXA 1GKLA 4G0XA 5T6BA 4HATA 2PS3A 1C81A 4P54A 2P6PA 3SEFA 2QTMA 3IDAA 1PV4A 1XPRA 4KDFA 4APMA 1KI7A 3AL2A 3D31A 4MMXB 4UVIA 4B6SA 3GN1A 4ITRC 4TVKA 1PX0A 2H4WA 2VNJA 4KIGA 1ZO8A 4LY0A 4OB7A 2EW1A 1R8SA 3Q2KA 3S99A 3T5DA 4EW3A 5KQPA 4N48A 3UB4A 4J9LA 3I23A 1PFQA 4ZDKA 1OJLA 1Y1VA 3BERA 1WZEA 1GTVA 1N6OA 2P3LA 1V1MB 4U6SA 4EHFA 4PGFA 2X42A 3EWSA 2Q9UA 5SZHB 3DF9A 2FPXA 2HJ9A 2O2YA 2JJ1A 5DISC 2O03A 2E18A 4ISCA 5B6PA 3W5UA 2A9KA 2GXUA 3E3NA 4D44A 3IMKA 1VE7A 1LS1A 4J0EA 4NAUA 3Q8PB 3OTOH 4O7SA 1JIIA 2H3HA 4PVCA 3AZOA 4Z9BA 5HRCA 1DAAA 1DC4A 2Z4SA 4M99A 1VL2A 1IY1A 2W2KB 2Y66A 3PPVA 4QRDA 4XB1A 3ORQA 1AE1A 4YUAA 1SCQA 2QY6A 1OBFO 1QFZA 2PX6A 3C8ZA 4EHAA 4P7FA 4E7OA 1NP7A 2PSEA 3DFKA 3G2QA 3NR2A 2V9WA 1US8A 1DQNA 4EMSA 5BVGB 4P53A 4CUJA 1FVFA 5C4XG 2CHFA 5EHZA 2BR5A 4EUSA 4ZO4A 2IQIA 4R1NA 3RSLA 1R0BA 1ZIPA 1XVIA 3BK2A 4ARCA 2NTJA 1U8CB 4C05A 1QCYA 4ROTA 4YRLA 5FLMG 4RVUA 3NRJA 2W6JA 4WLVA 2EBWA 1L5RA 3RC9A 2G71A 1PUIA 1S89A 1C4OA 5EHGA 3DE3X 1VLJA 1AC5A 1PJLA 3QXXA 1FOEB 3ZWBA 1D2HA 1P9OA 3DF7A 1U7WA 1T4BA 3LY8A 5CH3A 1MF7A 2B8NA 4YJHB 3T7RA 4F2WA 3ZGZA 5F76A 4CG2A 1UT5A 2HRRA 5F2NA 3Q8RB 3R7NA 1FTYA 1EB8A 1I5EA 1PL6A 4BV2A 2ZYIA 2Z2IA 2HCFA 3RB4A 1QYXA 3KZMA 5G4KA 2AEEA 2DFPA 4MWSA 1DAFA 2HX1A 3B6KA 2BSXA 2VZ0A 3O38A 5IC6A 2J3EA 4KFCA 3UW1A 1KDVA 4PPNA 3RS3A 4AO7A 2G1AA 4EO4A 2NZUG 2AF4C 5CYPA 1NJ1A 3S7TA 1JQKA 1NVUQ 2GEJA 2QRVA 4G1UC 1UDAA 2GYYA 3K4QA 5LL6P 1JFVA 3Q5EA 3EF3A 1XELA 2LIVA 4RO0A 3W04A 5I8PA 1WVIA 2ODBA 3PI6A 1E92A 4U2FA 4XTRA 2PM8A 2CFCA 2G9NA 4D3ZA 4CF7A 1RBZA 1YR3A 4CCWA 4CKCB 1WXEA 4F3KA 4Q9NA 2QYOA 1BNCA 4H3KB 4CF6A 2IPNA 4HH0A 3SXJA 3MNFA 3O8BA 1JTVA 3I0NA 1QGZA 3ICOA 1U8XX 2D2XA 1E3DA 1FDWA 4Z1MA 1N1DA 2VP3A 4JI0B 1KOFA 1N7JA 3H42B 2GXAA 2YW2A 5BQXA 4PSCA 1H8HA 1NUAA 2HV8A 2PZJA 4NNOA 4PZ9A 3IT3A 1IY0A 3OFNA 2GUGA 1ZNYA 5C8XA 3PN1A 1VE6A 2H85A 3JV7A 4X45A 4EKGA 1JEYB 3F46A 4GBGA 2IA6A 3QWBA 5LOVA 1VLVA 3MXTA 1GR0A 1HH4A 3EODA 3OZRA 4GSLA 4HMOA 2D4AA 2R6HA 5IDYA 4WK0B 1DOZA 4LH6A 4O81A 4L5BA 3BXPA 3ZOKA 2OM6A 3W5BA 1HC7A 1N2HA 4DL7A 5IX8A 1XMQB 4BY1G 5TT1A 4OHYA 3IH5A 1SHTX 1VIAA 10MHA 1VKRA 3QA3E 3FPKA 1JF8A 4X91A 3DCIA 1RRKA 2HJGA 5ABPA 1JLSA 1OH8A 1ZUIA 4HDSA 4JB3A 4XYGA 3HDYA 4DM3A 5KFCA 1S0NA 1QCCA 1RFGE 1QAMA 2DYKA 2SHKA 3JD1A 4JCCA 1S68A 2CK3D 4ND1A 1LZKA 4QJ3A 3O26A 4NCXA 2ZTVA 4YRBA 1CKOA 4D02A 1II9A 1L5ZA 4YN3A 2CNBA 5CITA 3OD5A 5M29A 4U8GA 1DBPA 2O1WA 4RW0A 4X1KB 2M9MA 2HGWA 3OIVA 3ZNPA 2OXEA 2XGGA 4MIYA 1Y9ZA 3S55A 2IZ0A 2OGSA 1OPXA 3IESA 3N2GA 3ZU2A 3GEGA 3H9JA 4KKXB 1WY7A 1UBJS 1S0MA 2VAWA 5LCXA 4A91A 5JAZA 3RFFA 2JA6A 3E9RA 1W36D 1CKNB 2NWQA 4FGSA 5HGJA 4I0WB 2JBHA 1EGMB 1SEVA 4BNMA 4XSHA 1JAZA 1JMVA 5K3DA 3LBFA 2RK4A 2EQ5A 1W85B 3IDFA 2EHDA 3OSZA 3C6ZA 3SNOA 2AL7A 3BEOA 1EFPB 4JWKA 1KAQA 5AJTA 4NE9A 1FFCA 1UP6A 2AJBA 2PD6A 5KU7A 2ZOSA 2GRJA 2HCJB 4LMYA 1MD9A 2OSBA 3A37A 3QMWA 2O6HA 3QXGA 4CUKA 2C35B 1VA5A 1YBAA 1UKZA 4E5KA 3N0VA 2WWWA 5LMUH 3DR5A 4O29A 1F8GA 3OSUA 2AKAB 4B6PA 4C04A 5K01A 3LQFA 3QM1A 4YWHA 4IIBA 3AFMA 1WF6A 2NXWA 4EYOA 5EE9A 1E8MA 4LRTB 1M2NA 4AMYA 4C2TA 1HT2E 5EKDA 1OVGA 1WS6A 3D7SA 4LJ7A 2BI4A 3FH0A 3IMCA 1CCWA 2FQXA 2PUVA 2R5WA 5KFYA 1BXGB 5AHRA 2PRKA 1XLWA 2X19A 2HMYB 3ZBTA 4CT5A 5A7FA 2Y2VA 4JP1A 3TQQA 4KW7A 3UMFA 1JDBB 5DM70 2H5EA 3IN5A 4XIJA 4LH7A 2NXCA 5CW1A 1URPA 3WIEA 4DBLC 5AM1A 1WO8A 1X9NA 2JDID 1FFSA 1V1JA 3MMNA 4BVLA 2R6AA 4Z53A 1KBZA 3T5MA 3V3TA 2GFQA 4F9TA 2QN1A 2B63G 1V5WA 2B21A 1NNUA 4OH7A 1VSQA 4XGQA 1XJQA 3KTFA 2D54A 3H86A 5B57C 3Q5GA 3VX3A 4N3CA 4XX0A 2I91A 5EXEA 5I8ZA 1Z4LA 1JSZA 1FRZA 4QAJA 2OYRA 2IKSA 4J9RA 2F8TA 3LL7A 1P44A 3VBCA 4ZZ2A 3P9SA 1F0PA 4ZFNA 2WQ7A 2BKXA 1Z15A 3AKYA 4U5QA 5AKXA 1P1FA 2WHEA 3BRWA 4LJ8A 3RYHA 4C6TB 3Q6IA 1U0NA 1TGVA 3M3PA 3ST7A 4CL3A 3DMTA 2WT9A 4NZYA 1YVUA 4I4TB 5AESA 3E7DA 3KU1A 1ZGBA 4F3NA 4UU0A 4TMZA 5B7GA 4R8UB 1WE2A 4EBEA 3ZYZA 4RZRA 5FPRA 5J2TF 2YV5A 3CNBA 3KYCB 4WK6A 3RT9A 1GZ6A 3WI7A 1PUXA 1Z63A 2XGOA 2PFGA 3FJOA 4I08A 3E4DA 4Q15A 4OI1A 2ATXA 2HNKA 4IICA 4HX9A 4W8HA 1T5IA 4HLUC 1C3JA 3VPXA 3GLIB 4WZBB 2Q6VA 4FZ5A 2L17A 4IIJF 1BOFA 3GNTA 5B1EA 2VP4A 4ZJPA 3GYBA 1EG7A 1DIHA 4RPJA 3WWPA 4XGKA 3IA7A 3A1VA 2FE4A 4B46A 4A0RA 4GO1A 1KS2A 1GPLA 1BD3A 1ZMRA 5KUTA 1IBMH 1P61B 3EAGA 1EKVA 1W0CA 2YXLA 4DEVA 1FNSA 5CG2A 2OEPA 4DV0B 2P9EA 4UUOA 1XOIA 1E2NA 2WZCA 3DCNA 5DYWA 4CIBA 1OXKB 1DDGA 5CA0B 4I1SA 3H8JA 2ACVA 4AMBA 1ULHA 1R27A 4BBZA 3CURA 2YWJA 5BW5A 4ZYYA 1BFDA 5K0SA 1XK6A 1XO1A 4WFKA 2GZDA 5ES4B 2ZR9A 3DV0A 4E5MA 5ADUS 5DG9A 3GJTA 3PL1A 4UVGA 1FDTA 1Q7CA 1W4AA 3FSJX 3QRWA 5JMPA 1TIPA 4FHCA 5KNBD 3OIFA 3KKEA 2HLNA 5ALNA 3AFIA 1E58A 3NIBA 2B5WA 5J3JA 4R83A 5K7SA 3EG5A 1TDJA 2AJLI 4YR0A 1XQ6A 2B25A 3PQ3A 1JPNA 2QTVA 4TLDA 3F47A 4FJ1A 4TWIA 5DNWA 5ALVA 3FWZA 3H3XA 1V5EA 3NWEA 4UCWA 4QKQA 3AWIA 3ZY2A 3WA7A 3S24A 2JH3A 3VC1A 4ED6A 2EX0A 4J0CA 4JL6A 2PXAA 3QLVA 1RI3A 3CGGA 4LBZA 4R40A 1VL5A 1RIIA 4LI0A 3FLBA 2W6MA 3DEZA 5C37A 3RIMA 1IVYA 1U9YA 3LO8A 2C7QA 2XDQA 2ZBGA 3DOIA 3U1VA 4BKQA 4PLWA 1E3EA 5JS1A 4GXQA 1TJPB 1JHYA 4TQAA 1P7ZA 4QXPA 5BOSA 5HZMA 1WKVA 5CDFE 3P0RA 5GPBA 5CB8A 3HP4A 3OO1A 5JECA 5KYYB 2O2JA 4LZPA 1XTTA 4CEIA 1JDUA 3KUXA 3R0JA 3OE7D 1OT5A 3CRMA 4WFQA 1SU8A 3U17A 5CURA 5LJIA 3I2GA 5HNKA 2RDJA 4PAMA 3OT1B 4JBWA 1OTXA 1P74A 3AVXA 2WIKA 4IDAA 1P2DA 2DBVO 4K81B 3W78A 4M8IA 1S1MA 1SC3A 3DE7X 1XZMA 3K73O 3N39C 4RDIA 1CRPA 3MTEA 3OX3A 5BQOA 2LCFA 3TOSA 3I0MA 5IZ4A 4MUIA 3AK4A 2UZ4A 3AR2A 5JLAA 1I3OA 2YR0A 2D7CA 4Y6LA 2NVWA 4RMJA 5FWNA 2AXEA 2C94A 4WLFA 2QIPA 4AMVA 4IRUB 3REQA 5KFSA 4KN6A 3FNFA 2EG9A 2UVQA 3PENA 4AK9A 1YJAA 2J7KA 2WABA 1K0FA 3O1LA 1HG1A 2CCGA 4QPCA 5FFFA 3VR6A 2ODEA 3MTBA 4BMVA 5B12A 5BV0A 3O8QA 3HI4A 2W58A 3DE5X 4HSEA 4LQDA 2E4UA 5K3CA 4BCDA 5DLPA 2JA8G 4M7OA 3ROEA 2ODPA 5KFIA 1EFPA 2X2EA 3PUWA 4P86A 5JSUA 4FFMA 5BSRA 3RAFC 5E4FA 5JNUA 3V2UA 1UBTS 1RWWA 3G1UA 3CZ9A 1X2BA 4D8VA 4L08A 4JXUA 2IYZA 3VR5A 4MGYR 5KREA 2OC4A 1E61A 1S8FA 5ALZA 5KFNA 2VDVE 3E9DA 2ZGIA 4O7ZA 5DWQA 2ASEA 3DYVA 3R4VA 2DT8A 2NQTA 3CH4B 4LMRA 5E3JA 4EVSA 3W2GA 1T5DX 3BT7A 1SUPA 1DEKA 1P2SA 4F8EA 1A97A 2FEOA 2ZT7A 4XPIB 5TQ0B 2WWIA 2I54A 4CMCA 5B3LA 1F06A 1DBRA 1EFVB 2HG8A 1ZVJA 3O1IC 1MV8A 1QV9A 2C4UA 3N74A 5PNTA 1MX5A 2GPJA 1SNYA 3A31A 4BE7B 5DVZA 4PYOA 4LZZA 5LMNB 1FXWF 2VK1A 2HREA 3V8BA 2W6NA 1WZIA 3PLRA 4G65A 5BPFA 2FX5A 1JSLA 4J2TA 1AKQA 1W48A 3J80W 5ESDA 1ORRA 4R84A 1CIPA 2UV8A 2JLSA 4XM0A 2ZRAA 5AUQA 1GDDA 3VYUB 3ZEAA 3ZWOA 3NANA 1SY7A 1P8AA 2F9FA 1RXYA 4ILEA 1T8SA 4JHXA 4OQPA 2R4QA 3TBFA 3NBUA 3P2EA 3T5GA 5IJ9A 4DR1B 2IBMA 2PVSA 4JJZA 2YOHA 5JCOA 3KZ1E 4KE8A 2JIQA 1CF9A 5AJXA 3DEJA 1Y7LA 4P32A 3FMPB 5EJAA 1YXMA 3CPSA 3RRZA 4NESA 3LFTA 2CFTA 1SUSA 2R93G 3EWNA 1F20A 3E9CA 2QLTA 4NOLA 4UZEA 4HFRA 5EXDA 4QJIA 2CJXA 5KJ6A 5E4JA 1GVNB 4CV1A 4NPAA 1NUPA 1QRAA 3VC2A 2DG2A 3L4BC 2CLSA 2OE2A 2VNHA 5KCZA 4CGYA 4RCZA 4RPIA 1W5AA 4WBNF 5G4LA 3EY9A 4NFYA 1U8YA 2HU2A 5KFVA 4QEKA 5EIXA 2H8KA 1IOWA 3HUUA 2DY1A 4FD3A 3B85A 3PSAA 2FQYA 2ZSHA 4Y6QA 1J0DA 1JEDA 4DIKA 1I5RA 3CC8A 4YDHB 1SBZA 4BO5A 3G6YA 4EZIA 2EP7A 4AG6A 1FU7A 3MR5A 1X6VA 2ZRIA 3R20A 3TDKA 1JWAB 4TS4A 4AJOA 1WCMG 4WZAA 2KWIA 4M9UA 3FMOB 1FTQA 1YZGA 1RR6A 4J9PA 1Z22A 2XZPA 3EIFA 1GPYA 4HDOB 1UFQA 4YJGA 5AVUA 2GILA 4PLZA 3TFOA 4LJLA 1U0EA 5BN5B 4BLOA 4QU5A 4EJ6A 2R5FA 6YASA 1QHNA 1SOVA 3E2MA 3DMTC 1ISSA 2MSCB 1JHOA 5I60A 3D8SA 2JH8A 3R24A 4C89A 1JG1A 5FUVA 3EGDA 4FR2A 4PGHA 4EI8A 3H17A 2RH5A 1TZBA 2P6OA 3AEQB 4QWAA 1BC5A 1WP4A 3KQOA 1NATA 5CT4A 3VR6H 4E46A 1GQ2A 4O2BB 4V1CB 3L2PA 1SVNA 1BDMA 3HZRA 4NOMA 4TKVB 5TPWA 3VYRB 5HQ3B 3TJMA 3A4TA 3AY0A 1MJHA 4MDHA 3SFTA 3WL8A 1N3IA 3CEMA 3OJOA 3BL5A 4B6QA 2DUNA 3C14C 1KRWA 4BY7G 4JA0A 2G0NA 2P68A 1X39A 2VWHA 3EPLA 2HEIA 1AURA 3RVSA 4B84A 2MSDB 3P9CA 4LG1A 3GJXC 4MAMA 4CIWA 5T67A 2UVVA 3EPIA 1V16A 5B1HA 4CR6A 1PCXA 5JXHA 4RGBA 1Y1RA 2NTNA 2ZBPA 3THWA 1DAKA 3C3JA 5EINA 3LKBA 3WKBA 3EGEA 4I50B 1JB9A 1HM5A 2EC5A 1GILA 3OQ1A 3BOSA 5BSEA 4A6PA 1QGUA 1CDEA 1M6VA 4O82A 3HVRA 3C3DA 4DAOA 4Z4QA 2XD4A 2YWGA 2WILA 4RE6A 5DM4A 3ANMA 4Q1AA 4Y6OA 1EFHA 4WX2B 2ZW9A 4YBZA 4ZZ1A 4BQOA 4L0DA 4YP6A 3TFWA 5SY9A 3TUJC 4XVHA 3QYJA 4DLLA 1NNSA 1WUTA 4FILA 3FN4A 5KQSA 1GU1A 1VLHA 1QYIA 3F6CA 4JC5A 5ULLA 4EZBA 3QUSA 4FFVA 1FW8A 3VDQA 1FVOA 3AC0A 1N1MA 2Q5QA 2VHYA 3EMVA 2FSVA 3NGMA 3OU6A 4R98A 1ZI9A 3D8RA 1USVA 5KKNB 2Z98A 3PRYA 1ISRA 3B9RA 3IIEA 1MC5A 2MINB 2H0AA 4N7BA 3R5XA 4OUKX 1HNNA 4Y8VA 5ALMA 3GJXB 2EJWA 4BNJA 1B2LA 2CB0A 2VKQA 5AI6A 4W7IA 3AILA 3R7SA 1FDRA 1JP7A 3SR0A 4NU0A 1AB5A 1O94C 4F4YA 1G9XA 1SQFA 1PG0A 1H9BA 5F64A 3T15A 3ZHTA 3KOXA 3NTXA 3PXEA 1ZR4A 3FDZA 1P3Y1 1KFBB 2I5PO 1K5PA 5JSYA 1C3XA 1JG2A 1YZYA 1Q7GA 1WULS 3OZTA 3GQBA 1IYEA 2WOOA 2UYYA 3PXXA 4M22A 3MJHA 1SHKA 2MYNA 2C84A 4LYEA 2ZU0C 4YRGA 1FEZA 2QD2A 4EOGA 1I5OA 2GEKA 2NADA 3V4FA 4MKZA 3IEIA 3FKIG 4LTMA 1MN6A 1E6EA 2VAVA 1EX9A 2FPIA 4EW2A 3DE2X 2ZQ5A 1T15A 2Q3HA 2L19A 3N7AA 4GWLA 4CMFA 1VMKA 4JEIA 3S5JA 4A6XA 3I8XA 1J22A 3GWZA 3LA8A 1AMOA 4GIBA 1UJCA 3P2IA 4HFNA 3J81W 2WJPA 1NZDA 2QTFA 3GL9A 2EIXA 1AZTA 4R3NA 3GRCA 1EFLA 4REOA 4D9EA 1QQ6A 2CHGA 2XGSA 4TVBA 4B81A 1H66A 4O4IA 4BFVA 1RYEA 4RY0A 1B8NA 4B7UA 2X5RA 2B3DA 3JQAA 3TD6A 5LZ9A 1R6BX 1QQAA 1J8MF 1N34B 3UK0A 1LPMA 3ELDA 1DO2A 1PI3A 4C7BA 3MB5A 3RGGA 2JIZD 3I9FA 4ED8A 2HHFB 1R0KA 2AFIA 3TECE 3IBGA 1T4MA 5DTIA 4E0BA 4Z6KA 4RIEA 2CF6A 4G8CA 4AYBA 4EMBA 3FWHA 1JX4A 3QXJA 4D6YA 1BXRA 5HKKA 3G8CA 1ODCA 3IB3A 4L73A 3VI3B 1NULA 1IPFA 3FSGD 4CU5A 1W59A 1GM5A 2QUAA 5IANA 1QTQA 1SMKA 1IBLB 3F6SA 1RXSA 2BEJA 2A2ZA 4DV1H 3SR3A 2EL7A 1XP8A 4RXTA 5EJ6A 1AT1A 1OLSA 3BQ0A 3OZWA 4Q7MB 3EXHC 1ZICA 3QFFA 4JQCA 3FBWA 4HLQB 4YX9A 3GU3A 1GLGA 5KTYA 1N9ZA 4E6EA 4MW7A 1PJRA 3QVXA 2IUFA 1HZJA 4I5IA 4IF4A 1U04A 4R05A 1Z34A 2ZB3A 4W8OA 5CYOA 3VUFA 5JZSA 2WF5A 2UXDH 1FYXA 3KAQA 3QYFA 5SY4A 1GUBA 2BHRA 2BKAA 2IU4A 3GFQA 3HEMA 5FKJA 4QRHA 1GGFA 3GZ4A 2VQ3A 3JQBA 5IASA 1A98A 2D2FA 3STHA 2AQ4A 3LRPA 3G8AA 1DZ3A 3P5SA 3KQUA 3W05A 4RF3A 3QTLA 3TS1A 1Y8RB 3EFHA 2IDZA 3IQZA 3OM1A 4JI4H 5U4QA 4RZSA 1CT9A 3VTKA 2FYTA 3NALA 4C06A 1MBZA 4TQUS 4LC9A 4BNWA 4TLEA 1U3VA 5EN4A 4IKOA 3C87A 3EEBA 3CUKA 5AI8A 3TRDA 2WF9A 4RHXA 2RIRA 4GP6A 4KWIA 2X22A 3FKSD 5EJ4A 2IZ7A 5B55A 1CZKA 4B1FA 1B8PA 2YH2A 5COBA 1YQEA 4FE2A 2CVPA 2Y92A 2IU6A 1KZ1A 2GWRA 2ISQA 4S0XA 6AT1A 2PG3A 2NU7B 1X7XA 5F12A 3W0LB 2Q41A 4NRDA 3VXKA 4CM3A 1NHWA 3QUAA 3MJTA 4N40A 2GM4A 3DFZA 1O94D 1I4OA 4P35A 3ZQKA 3LQRA 1ZONA 3DL7A 4IUDS 5DYGA 5KOHB 3R0QA 4FDAA 4PANA 3ZDFA 2FK8A 5FPHA 5LU9A 4A36A 1I30A 3K0KA 4GBJA 4F9EA 2JI7A 1X3SA 2YFQA 1WAMA 3HHPA 1CUGA 3K1JA 1NXWA 1WOMA 3OQIA 1GGJA 3DKKA 1FU4A 4PLYA 5JCPA 2QRGA 4UM7A 1G3IA 4R2MA 4MS3A 1GGNA 3PC4A 3NTUA 1C0LA 3ID6C 1M76A 2C0PA 4W5QA 2B4TO 2H08A 4MA4A 2A0YA 4LXIA 1VJDA 2QLNA 1E2MA 5JR3A 3I5XA 1IYZA 2YHBA 3IELA 4LE2A 4QGAA 3LI2A 2GLUA 2AOVA 2QG6A 3H1AA 3HPQA 4RB3C 1T2VA 1D7AA 1QVWA 2CD9A 4TMWA 5KFKA 3NWJA 3OE7A 2CMDA 3NGDA 2DWCA 3GJ4A 4BTEA 5D1PA 4RULA 3IEUA 3DNFA 3IR7A 5ICSA 5LQCA 3RU7A 1XLTC 5C8VA 3LS2A 2F64A 1W6UA 5KYTA 2CZCA 3QEOA 3GLSA 4J7XA 3L06A 3MCAA 3K70D 5K0FA 1J23A 3BTUA 2C1EA 5JWHA 2X1HA 5EPUA 3R5TA 3LCRA 1S2IA 2A78A 3T5TA 2XDAA 2VCHA 3PITA 5KT4A 5KT3A 3I04A 1SR8A 3KELA 3C41J 4G1VA 1I50A 2PH7A 1XNQH 3N2GB 4KP7A 1DT5A 4ENUA 2NU9B 2ECQA 1DQSA 4Y9TA 4OHKA 2EJ2A 4WD3A 2Q3MA 2WHXA 4LS3A 1X7DA 2E0IA 2XAAA 4IXDA 3N7TA 4W6ZA 1W4BA 5CNMA 5TR9A 3WADA 4N8EA 2ZYAA 4CLDA 2CHVA 2IYOA 2W00A 4K6NA 2CUTA 3I42A 3ISJA 4XPZA 2P41A 4AWXA 3RYIB 3CB2A 1ZCAA 1VAJA 1ZU5A 3EZXA 3FDJA 1G6HA 2AZ4A 3A9SA 2E4WA 2O1SA 4FS3A 2D59A 3RG8A 2VDRB 4IFBA 3UATA 1HNZB 2PWAA 1ATZA 2G28A 4JJIA 3AVUA 1DWPA 1RMTA 5C7IO 4BGDA 1YS4A 4WOCA 2CB9A 2XUPA 2QOEA 1JEAA 2YV4A 5FD6A 2C78A 3IXMA 3L8DA 3GLRA 5EUBA 1LPNA 1OF1A 2Q07A 3WLPA 5LP6A 4F4WA 3G0IA 4L0CA 5IEJA 1DPGA 2XUGA 4JELA 4IGIA 4YJ2A 2GQ0A 1DRJA 1RJGA 1ULTA 1HRKA 2VWQA 4LXGA 5J47A 4BKPA 5CT5A 1RBMA 2Q3DA 4XB2A 4CC5A 1JQBA 2ZB4A 1KETA 2PRJA 3HKCB 4LXTA 2EKLA 1XZJA 5FFMA 2X2OA 1LK5A 1VMDA 4V24A 1ETHA 2IDKA 4L07A 4KUEA 3HB5X 4GI1A 3R9IA 1V43A 2C2XA 1UP4A 3C0FB 1WPRA 2VP2A 4OQLA 2IEYA 3NDIA 4CIYA 2QPLA 3R9RA 4YAKB 1YTLA 2MDTA 3IOCA 3A1WA 1TPZA 2JFYA 3M9LA 4N4AA 1IJKA 1Z45A 2ZJYA 4RVNA 1N2IA 5FNVF 1OR8A 2OHIA 2PH5A 1S3FA 3R3JA 3RC1A 1KMHA 2WK1A 3U31A 1T36B 3KKMA 1M0WA 1ZS9A 4OAOA 4FE7A 1L1QA 4A3CG 16PKA 1A4RA 4G4SP 3U81A 1QKIA 1Y8CA 5LQMA 5JNWA 4PN3A 5HF5A 3ANSA 1T25A 4J4HA 3OPYI 4HGYA 4JC4A 5JVLA 3O8QB 1G3QA 4ECYA 1PNVA 2X0NA 2RHOA 1QE0A 2AK2A 2ST1A 2ZRCA 3BB3A 4WEOA 4WJKB 4B31A 4IR9A 2QUIA 4NHEA 1I4EB 1IE3A 4A2AA 2VYVA 3GRAA 1IK6A 1KKUA 1WXIA 2UVPA 1KERA 2R8XA 1DDIA 2A9VA 2RGWA 2W2LA 4JLVA 3K0SA 4WTOA 3QVGA 4MV0A 4TROA 4B6EA 2LPMA 3F7OA 1VIMA 1I4DD 1NONA 1FX0B 2GD1O 1PJZA 2O2SA 3L1UA 4L9RA 2GHTA 3VU1A 1NUTA 3SGIA 3AM5A 2FW0A 3G0DA 1QO9A 1VZ2A 4HN4B 4NOJA 4O63O 2JA1A 4OD0A 1BN7A 1MEJA 1Y3CE 2AW3A 2VPSA 3UO8B 3HWWA 3QUTA 5FL7A 4D4LA 4F8JA 2UUAB 3QSYA 1N5OX 4LDQA 3QP9A 2JJQA 4LY9A 4AY5A 1LGYA 1T2UA 2CLLB 2PL5A 1LPAB 1M3SA 3ENNA 3ABZA 4D6PA 1WXHA 3C3XA 3UB2A 3VR3A 1NY5A 3KSZO 1VCHA 2VT3A 1O1YA 2R6R1 1TEZA 1EKXA 3GGSA 2NU6B 3UB3A 3MFIA 3CVUA 2DABA 3SNKA 5FL7D 1K5HA 2B4AA 2HCTA 2HDKA 5J1SB 5EMMA 1CQXA 2NV2B 2XCPA 1S2DA 4RAZA 2IW3A 1YJBA 3JVVA 3N05A 4ZCIA 1TYDE 1T9DA 5IRCD 3BHNA 2QN8A 4KPGA 2F67A 2W6CX 4Y1GA 3DW3X 2OILA 3DO6A 3CZRA 4G9BA 4X6XA 3ZK7A 3E84A 4H77A 5EWLB 2IXAA 4QGFA 3MSCA 3HFSA 3WLOA 5AKJA 5EMHA 3TXAA 3VDMA 2D3WA 3OWOA 5E0KB 4I5EA 2H1SA 3BIOA 3DAOA 3NB0A 3O2SB 1GDHA 2QUZA 3EIOA 4FGWA 4ISBA 4KQEA 1TE2A 5BSTA 4CQLA 5IT4A 1UM8A 2UUCB 3JTEA 1S8NA 1WSWA 3GGPA 2ZZKA 4FMBB 2WWXA 2FPGA 1Z56C 5IJAA 3VU0A 5KSOA 5KG1A 1TQHA 1A8SA 4NNJA 2SCUA 4B87A 4BZWA 1ZIOA 2XNSA 3BHJA 4QELA 5CVVA 3ZEIA 3V8RA 4ZMRA 5DCWA 2F90A 4DARA 1RE1A 2GBGA 2K87A 4FHGA 5K8TA 4YQZA 1LLFA 2XOKD 3PXBA 4RUKA 1G20B 2NZJA 2YNMC 4KO8A 1E2BA 1T5OA 1YRLA 2A30A 2IDJA 3EXAA 1LLUA 3M49A 3MIZA 3TSOA 3DOUA 1EESA 3VPCA 3A11A 1E9RA 2ZJOA 2V7PA 1ZGCA 4YIKA 4J7AA 3IPLA 4PCLA 1QH0A 1P7PA 5DKFA 1HYQA 3D7LA 3R4CA 4X95A 2QMQA 4FFPA 3SZMA 1IUOA 4A73A 2MJLA 1RXCA 4X6LA 4OB8A 2H4HA 4UNRA 5INTA 4OLAA 1KK0A 2CL7X 2GJSA 4M98A 5I9LA 3H2BA 5HS4A 4JITA 2IOQA 2QD4A 4C3OB 1DHTA 3QKSA 4P31A 4QICA 3K6SA 1KFCB 4AX4A 5A5EA 2WAQE 1SULA 4JUBA 1BMFA 1Y4ZA 3E8SA 3I1FA 1QNLA 4BMZA 1ABBA 3G7UA 1B0PA 3DCJA 4QDXA 3FAKA 4GQAA 3I4CA 5EIBD 2E6KA 4BC0A 4BZXA 5BUZA 2ZWPA 3CNNA 1PT6A 3JRWA 2CHUA 3KE8A 3A2MA 4G0YA 2OFXA 1BE1A 1FCJA 1V2HE 2R97A 5D87A 3O7MA 1R4MB 3KVOA 1QIEA 1GXSB 3NAGA 1DP4A 2GERA 1YHNA 2R2GA 3I01M 2Z6AA 2XE7A 2JJYA 4HNAB 4A3BG 1E7SA 2WD7A 3P5BA 4JN6B 1MPXA 2WZBA 3EZ2A 5LDDC 2PRSA 5IAAA 2ZPAA 3HC7A 4F8YA 1KORA 4KPUA 5I7OA 5KDDA 4R16A 1K3TA 1ZNXA 1C0EA 3C97A 5ALLA 3WISA 4DQDA 4F4FA 3AXTA 1T8YA 3DMNA 5CCEA 4N3GA 2VP0A 3O92A 4DBLE 1XZ8A 3A04A 2O2ZA 4HUJA 3QEMB 3U7QB 4EG0A 3L7IA 2BUBA 3MILA 3FMFA 3IHLA 4ETMA 1XQYA 4GYJA 4PZ6A 3DPSA 2WF7A 4FEEA 2Q2TA 2OVBA 3ABQB 4BFSA 5AKHA 5FNVB 4DCMA 4DZRA 2PE5A 2G8NA 2VLBA 2NUTB 4G5OA 5E0OA 5JI2E 3CVVA 4K0KB 2JAOA 1MRZA 1KEEB 2BF4A 5CDYA 1ZMXA 4CGZA 1N34H 1XZLA 1V35A 4Y1RA 5CJJA 1N57A 4FYMA 2FQ1A 4YHHB 1CIJA 3DMDA 4UHCA 4AC9A 3F7NA 1O97D 4JR2A 3FNQA 4PFJA 1UDBA 4HWRA 3V7YA 2ZB7A 1WQ1R 4LVCA 2F1KA 1PSWA 3C8MA 5IXJA 5JASA 4UZFA 1GUAA 1V5FA 1ZD9A 5JSKA 1L0BA 3GG2A 1Y48E 4JV5H 2BFCA 1QFMA 1L1FA 2JRLA 4GWKA 3T52A 5JY1A 1DEAA 4KGDA 1SURA 3TW8B 5GIPE 4ZOEA 3OPYA 2NSLA 2VJAA 2XNDA 4YMWA 3WVNA 3GK3A 3U3MA 5FPYA 5ECDA 4Y2UA 2OYCA 3SY8A 1TYAE 4B44A 5IT0A 1C9DB 5GM2A 2WI8A 2XQKA 4RDXA 1CJKC 2P91A 4H4EA 3MS2A 4Q3BA 4QNNA 2YV3A 3DWGA 2RK3A 1STOA 2NUAB 3THYA 4IOJA 4DQXA 3V1UA 3IUJA 4IINA 1W2GA 4DVGA 2JEOA 1R0XA 2BBSA 3TRJA 2IOFK 4RTOA 1D2RA 1QB7A 1W34A 3LCJA 1YBMA 3LOPA 4TTSA 2IYUA 1V45E 3WB2A 5IF3A 1EJ6A 1ZY2A 2IUEA 2HXSA 4MV6A 4YJ3F 4GX5A 1B74A 1I0IA 3UA4A 3NBYB 3N8GA 1WXXA 3SBOA 1LC3A 2ZM6B 4RCYA 2X6RA 1GL6A 1SXJD 2NVUB 2X77A 5KBYA 2O52A 4YWJA 1MC4A 1V7QA 3F5QA 5EJMA 3NDBB 1MB9A 2QW0X 1W44A 3ANYB 4V0OA 2ZT8A 3EG9B 1LU9A 2CSUA 4YRSA 4RH3A 1CJSA 1A9YA 3QLUA 4XYLB 4QYMA 4EJSA 3TY9A 2XYPA 2J32A 3GBPA 3QUQA 2J5XA 3IPRA 4FPXA 1P6XA 2F00A 3NFRA 4HJXA 2ZSFA 2GESA 3LL4A 1GSHA 4YRQA 2YU9A 2CHQA 3C1AA 3SC6A 2OBLA 4UJ3A 5I4CA 6ADHA 3ZR4B 4NAVA 1T9HA 3AGQA 3OZBA 4LVNA 5DH9A 5CFLA 3UYYA 1OT3A 1XLUA 2DUUA 2I2AA 1T8RA 1R8XA 3IVXA 4GKJH 4KXLA 2XT0A 2ZRJA 3UUEA 1HDGO 3U3OA 3TLGA 3Q98A 2X4DA 3SLRA 1EG2A 3M6XA 4CCSA 4W5NA 5CT6A 2HF2A 1FBTA 1Z2CA 1ZK3A 3FNBA 3N3AC 4DLBA 1Z39A 1W94A 1X8KA 4JLMA 1B73A 2MOKA 1Y9JA 2O7SA 1EUDB 2DPHA 5A04A 5TS3A 2KI5A 1ZSVA 2BL4A 2AOUB 1JAYA 1XEFA 2CVFA 3G2PA 3IHTA 3KXKA 4TRNA 4FMCF 3CZ4A 3W5IA 3H2YA 1V95A 3ONFA 5HZHA 2QLMA 3JYOA 2PUHA 4WXYB 2JFGA 2I7XA 3HEBA 2JFZA 1OWOA 2DERA 4ZKDA 3QV2A 3PUYA 5EZYA 4RK7A 1HTTA 5BMOA 4K26A 1I1LA 3JZMA 1Y8ZA 4IUBS 1FQOA 4QT0A 5KTRA 5F3WB 3JD2A 1WKCA 3OWHA 4WK4B 2RBKA 4IDBA 1LI5A 4P82A 5F78A 3REQB 4EATA 1OH7A 3R9XB 4A8JA 3OQNA 4R1PA 3L0SA 3GPIA 1V51A 1T3HA 3Q72A 3WIBA 3C85A 3SKXA 3KWMA 4OP3A 4KO3S 1XQVA 1OLXA 4W9MC 3HKCA 2BHSA 3PICA 1CK4A 2ZYWX 2NQ8A 2C5GA 1BQEA 1IEVA 3D6FA 4GM4A 1FFXA 1T8UA 1YA8A 1FDOA 3FMAA 2JGAA 1PLLA 2Q8NA 3ABOB 3TCKA 1TO2E 1LV8A 3DKVA 3K9QO 5TPZA 2OQVA 1A7KA 4Y6PA 2QY9A 3RS4A 4DWJA 5JS6A 5K3FB 3GV7B 4R8UA 1L4BA 4TV9F 2IHKA 3GGJA 1VE9A 3H5RA 3NFYA 3P19A 4OHFA 4BFTA 1YJCA 3FPEA 2FEMA 5L51A 4RK4A 3VNSA 4L76A 5CK5A 2D0PB 1PQUA 2Q5EA 2XQJA 1UC9A 2V7UA 2YNMA 2H57A 2O3JA 2OCXA 2DSNA 2GPTA 1E2HA 3IT1A 3PA8A 4G09A 4BJ5A 4CT4B 3BN3A 2DFNA 4IY1A 4AECA 4BUJA 4MW1A 2ZJ8A 5GTDA 1WUIS 3TGLA 2C2HA 2GKGA 1I3QA 3ORFA 2V9ZA 2V6MA 4ZARA 3NI2A 2AG0A 1MEOA 2I3AA 5E9QA 9LDBA 1IZYA 1C50A 2ZT6A 2RMKA 3PFCA 2IYTA 4N3AA 1YU9A 2Q1SA 2QN3A 1P8LA 1PW7A 1U3CA 2EWWA 2O4UX 4H18A 2NXNA 4ND8B 2G9VA 1HGXA 1KZYC 3EK2A 3IR6A 3U1TA 4DG8A 5HHTA 5HFNA 2Y4OA 4P92A 3K30A 4ZYVA 1NPYA 1J09A 1QSGA 2JCYA 3O47A 4DIEA 3EIWA 2P1DA 3ZDEA 5IZCC 4RANA 3R7WB 3V4ZA 3T7EA 1NW8A 1YACA 2QJOA 4Q1FA 2QVZX 1SJ9A 2J6IA 3BORA 4QUBA 3EGIA 2GZMA 4MQ4A 2QR2A 5I48A 2HJHA 3OTHA 5FV4A 1AIPA 3KSBC 4KMOA 4Q3LA 2AN1A 4RJJA 2NU8B 2XQIA 5B2ZA 2OWOA 4KN8A 3ZCTA 2GTPA 2QWXA 4RL6A 3ITKA 5BSKA 3T9EA 5BWRA 4D97A 4BMOB 3LULA 3MMSA 1EUDA 2GM3A 3B3QA 5E1DA 3VOAA 1XTKA 1S01A 4B3RH 1RKXA 1TKRA 5FI5A 4RNOA 1DOAA 2P4UA 4R1MA 5ICGA 3BCUA 2BWJA 3HDTA 3HGTA 4TRMA 4QYSA 1UBNA 3S70A 5A1TA 4ARZB 4C7VA 1ZVQA 1YS6A 1NVMB 4HRVA 1BS1A 1F8UA 1WPXA 5DHRA 5ALGA 3RHZA 2HCRA 2V0NA 4DS3A 4NCNA 4DLXA 2W2MA 1SB9A 4TL9A 2J0UA 5ICCA 3MJSA 4EPXA 2BI7A 1KE2A 2PX3A 5LA6F 3CT4A 1GP2A 2BFPA 4PNEA 4FFSA 4XVUA 2V1XA 4EUEA 4OX9B 4NYMQ 1L5HA 1SXJC 4D0NA 4JUDX 4KMMA 4CQLB 1UH5A 4HAZA 5TV2A 1NBEA 2PMFA 2QAGA 4H27A 4RHEA 1G8HA 1ZD1A 2OENG 2PGDA 2QPTA 5IP7G 3AIIA 4GVXA 2D1QA 4F9GA 1Z5WA 4EHJA 1C9NA 4OXQA 4DQUA 3BWCA 2ZXUA 1L7NA 4FYIA 4M86A 2OLJA 2AG8A 1JU9A 1VCIA 2LE0A 1SIOA 3EW9A 3MFQA 4IXMA 3UOWA 3TZBA 1SKYE 2PQMA 2PVCA 3I5YA 1JLLB 1L5GB 2PLAA 4ACAA 2R8PA 4DKXA 4KRYA 4PCAA 5E2AA 4PCUA 3UJNA 1T3GA 2PSSA 2V4RA 2YXDA 3GBSA 4FGLA 4N03A 4WXHA 3DT8A 3GAFA 3AUAA 4G2TA 3ZN2A 2G25A 3KV1A 3HBNA 1L7VC 4F60A 5KG6A 5EL0A 5JATA 1TA0A 3REGA 5KHAA 5FUWA 5EWFA 5DQIA 5KOJA 4CKEA 1EUZA 2QZ9A 3T9CA 1AUOA 3F78A 3PNBA 4FC6A 5J40A 1EWKA 2AX4A 1PR6A 4GI2A 4IGEA 1EEXB 1GO2A 5KFLA 3O74A 3KXYT 2EW2A 5TGDA 1KSGA 1JT2A 3OHMA 3UNXA 5BSFA 1KVRA 5G0TA 2DFKB 5CVUA 3AJDA 1Z3CA 3ROTA 3HP7A 5BUCA 1M8KA 3INTA 3DVRX 3F6EX 3QGMA 1CY0A 4DEXA 3HVIA 4FWTA 1GQOA 2YZMA 4IDQA 2FZEA 2XRFA 2GRAA 3H2HA 3P1JA 4GOKA 1GG9A 5HFJA 4D81A 2XLCA 3RW9A 4E5PA 5IKXA 2O8EB 5L3QA 1O6ZA 1ACJA 1KDRA 3E48A 3UFXA 1OMOA 2PHZA 4A2PA 5JMOA 3H2KA 2F4NA 4PZYA 4X0EA 3ZD7A 3A0RB 5BV7A 2ZG6A 3JZDA 1XRSB 1VCMA 5FOUA 1U8EA 3DV0B 3IE0A 4UBNA 2IU0A 4ZJUA 4OQDA 4YREA 2BF7A 1Q0TA 4D6XA 4RZ2A 1AOXA 1M6HA 2QL7A 2WHQA 4J2OA 4MQLA 2C7RA 4GRIA 1Z68A 4RFSA 4YAWA 4MPPA 1VG0B 3S28A 4GBED 3LO5A 1Y3FE 3A6HA 1T2EA 3E05A 1ZR2A 3K9WA 3O8LA 4JH0A 1P4GA 3AXSA 3PHIA 1EK6A 3CY6A 1IQPA 2EW8A 3F7MA 2NO4A 3FFXA 2YV1A 3PRJA 5T6MA 3GLQA 1JG3A 3VJLA 1OC4A 4H7HA 3GZNB 1POWA 2VBIA 4EHIA 2I1LA 1OWPA 4I3HA 2H7XA 3B1VA 4TWRA 5ADWA 1H3EA 5CXXA 3QPDA 4RV4A 4F5ZA 4A2BA 4X1YB 3I30X 4WCDA 5AWFC 3OU2A 4PIMA 3G23A 5ALEA 3SLGA 4QDTA 3UFBA 1HLFA 2JAHA 3OJWA 3PX3A 4EABA 2ZR8A 4KXFB 1QHSA 3AOEC 1X9GA 2HA3A 3L0ZA 3AR7A 1IPHA 2P9ZA 4QQKA 2ZVQX 3EX7C 3PIRA 2VSOA 1YIOA 1ZVVA 1GV1A 4PHCA 2OHXA 5DLEA 2ZUTA 1OGYA 4RV5A 2AFHE 5I5GA 2QNBA 3TQ1A 3VR5H 3A1EA 1SCUB 1WSCA 3L6UA 4FYPA 2R66A 4CF3A 1F1BA 4Y6GB 3TZHA 1YC2A 1SCNE 1U7ZA 1TMYA 3GIIA 1UINA 5KIAA 3N58A 1G5TA 2P79A 5KYKA 1HYBA 2CNUA 3D3WB 3ND5A 1CS0A 5C5JA 4OXIA 1KTIA 3KSAC 1P5RA 1VG9B 3WIDA 4E2FA 4EG3A 3CBGA 1ZI8A 1E1RD 1ZNZA 2C5SA 2IS4A 1IY2A 3ZWNA 1QVRA 1UWKA 4JJAA 4M0EA 3F3SA 5HQ3A 4KPEC 1ZH8A 1QF6A 3VPFA 3WGQA 5KYXB 5J2TA 3OX1A 3ZK8A 1WMBA 4RABA 2OLKA 3UANA 1PEYA 1CRWG 3EZ9A 4I4TA 2C2YA 3N2KA 4OL0A 2FEWB 1RM5A 4D9BA 5GMOA 2B34A 3ROPA 2GF9A 3GNSA 3HHEA 5T41A 4RJIA 1PQ4A 3NT4A 4O7RA 4QULA 2BGLA 3G3EA 1K4KA 1KMHB 1BMTA 4E2YA 1GAJA 4TV8F 1DU4A 1UPFA 4GI7A 1DOHA 4KQCA 3ASVA 1E7WA 4EEZA 1P29A 3DZCA 2WWRA 3RQIA 2V6IA 1WF3A 1AD2A 3PE6A 5C53B 2O5VA 1M75A 4LMAA 5AMXA 3K3VA 3BAAA 5LYYA 1N5LA 3H13A 4M9QA 5CDUA 5FHQA 1Y3IA 4PYJA 1QQBA 1DC3A 3P4YA 4BKMA 4X3PA 1L3BA 1YZQA 1ULSA 2LR0A 4X8HA 2D5LA 4D3YA 2IS2A 3BXEA 4WFJA 2EDAA 4MS4B 2HQSA 4UCXA 4WVLA 1W8DA 3IHKA 4RFSB 1FYVA 5B4VA 4BJ6A 4MB6A 4BB6A 2R11A 4GC5A 4FS8A 4PC7A 2HWYA 4ZANA 2W48A 4U7CA 4DL2A 1NTOA 4ABTA 4MARA 2Z5VA 5GVSA 4CKYA 3U3RA 2PU7A 2R00C 2COJA 1FLDA 4RB0A 4UNIA 4AF6A 4ZJZA 3CEBA 1H6CA 1CTQA 3AERB 4G0OA 2G76A 1F2UA 4JUAA 4QO7A 4WASA 5E38A 2P11A 3OSPA 4DLVA 1ILEA 2FK2A 3X3HA 2QHXA 4Y2RA 4JYMA 2F1RA 4KV7A 9MHTA 1P2TA 5I5SA 4DR2H 2VUHB 2EWMA 3QKRB 4H1TA 4HWGA 2ERCA 4C88A 1KEEA 2OFPA 4COOA 4F4ZA 1YTUA 1BE6A 3V8QA 1SCJA 1C8LA 4TKLA 1IBCA 3ZUGA 4BKOA 4MUKA 2XWPA 3FPJA 1PT8A 3LUAA 1VL8A 4N0DA 2XHEA 3IEXA 2IKQA 3O91A 3R7WA 2GT1A 4BBPA 3N41B 4H9GA 3EVAA 1ZJ6A 2H8GA 4BX2A 5AUPB 4IXNA 2O8DB 1T35A 3CQ9A 2HU8A 1JR6A 1C1DA 2NO9A 1ZRMA 2RDIA 1QV7A 2VBGA 2VF7A 3GXOA 1F0YA 1G60A 2I3BA 2PH1A 1XKLA 3DEYX 1CVLA 3IKJA 3LPLA 4KOAA 4MQUA 5I7SA 5FA5A 4QOJA 2RJNA 4V3CA 3BC1A 4BWGA 1PR9A 2IUUA 2LD4A 3IRUA 4DY6A 5AJWA 1YRYE 5B30A 1MIOA 3RU3A 3I2JA 4EKNB 2J85A 4CTMA 1K75A 4MW0A 1BW9A 4IO0A 1HNXB 3H1EA 3OD1A 1OZ0A 4IZHA 5EESA 5IT9A 3KDSE 4PAQA 4QGBA 3EULA 3RB8A 4OBBA 2BBTA 4S2UA 2R8ZA 3UK2A 2Q0HA 3KWFA 2M6LA 5EIOA 2J3QA 5FBQB 5KNDD 4CMAA 1DX6A 4IDDA 5CYFA 3HXLA 5I9MA 5I45A 1I94H 1Y9AA 4QARA 3DBIA 2EOAA 2FW9A 4NDAA 4Z9XA 2JAUA 2GNOA 1OKKA 3SKVA 4E6PA 5K09A 3AV0B 1T6NA 2WUGA 5LD2C 1CZLA 4R54A 1EFTA 4DDWA 4Y3UA 2D1RA 3PQCA 2DP4E 3D2CA 3U61B 4Z4FA 4F6CA 4L5JA 5JS2A 1U2GA 2QTGA 3P96A 2VDLB 5EXXA 1IAVA 5TMEA 4IS2A 3VR0A 1MB0A 3PW0A 3WNZA 4CQNA 3NUQA 3BILA 2A59A 2UVDA 4J4TA 2R6CA 4YRZA 4L5CA 1MGPA 4WXEA 5IKMA 4OM8A 5AHXA 5LYJB 3VU9A 4HTFB 4B3TH 2FCRA 3A3OA 1ZC4A 3ANLA 1XVAA 4KWEA 4Y1EA 5DHSA 4RM2A 2XBUA 1Y1KE 1R1DA 2F1JA 1NE7A 4TL7A 4IMIB 4PYLA 4MGIR 4RTRA 3AVPA 3KSUA 5CDHA 4J7UA 2H17A 2F4VB 3OF3A 4P80A 3W9SA 3LQSA 1GPH1 3M1YA 3DHYA 1IJEA 5M5BA 1H8ED 4ONEA 4B0PA 4QW9A 1T4DA 1EHIA 3BH0A 1TW3A 4KDEA 1MVOA 1Z6PA 1P1RA 3GVHA 4IWYA 4XX0B 1V8BA 1NUUA 3UHAA 2CDBA 1N5RA 4C7KA 4A82A 1UDRA 1N8NA 1ESZA 1T9GS 2JA6G 3D8HA 4POAA 1L9XA 4KQXA 4PDBA 5K3WA 1ZH4A 2C9DA 2CE7A 2CJYA 4PR0A 4FGJA 3CIFA 1PJBA 1MX3A 3I9JA 4RKQA 2NPFA 3RC2A 3MIIA 3SF0A 3ZWVA 3BFKA 1SXHA 4MUFA 3PPWA 5AIAA 2I6TA 3FROA 2ZRPA 1P45A 4P8RA 2QQGA 4IMRA 2J3HA 4YP5A 1M5UA 3MWLA 4CLOB 3TTXA 4G5RA 3HM9A 2ZRFA 4OHWA 4PZUA 3OJEA 4ZU1X 2UYCA 2JLBA 3I8OA 4TKZA 4UUBA 3TOZA 2Z1DA 2H16A 1JJAA 4I14A 3ZWDA 3LQ2A 1TIKA 1V26A 3V33A 3GEEA 1FBNA 1PFVA 3RS9A 3NONA 3WZ2A 5KVSA 1R0SA 1SKQA 1ZEMA 3HYCA 4O02B 1U8ZA 3LPNA 3GLIA 2RGNC 3ZLUA 4QYXA 4UE2A 3GG9A 4UKDA 4HX2A 1AXRA 2JGJA 3L0DA 3FVQA 1ESCA 4O3MA 1QR6A 1E4GT 1U6KA 4CQJA 2XTAA 4BNIA 4P81A 5I7FA 5LLTA 1KQFA 1DAPA 3KKKA 4D9HA 3CKMA 3UWOA 3P2YA 4KRXA 1KEWA 3W7AA 4W6QA 5DIZA 2ZIGA 2PAFA 2UZ3A 1WETA 1HKUA 4GM1A 3QWAA 1OI2A 5BWWA 4GWGA 4EY8A 3PNOA 1DKMA 2G82A 4F2DA 1YA6A 3BF8A 4JOQA 1EVZA 1KMIY 1KYWA 3DC7A 4Q9AA 1IY8A 4XUCA 3SF8B 4ROSA 1XZAA 3EUAA 1E8DA 1X7YB 3M2TA 1PFKA 3G5UA 3VGPA 3BIFA 3NYRA 2XC9A 4N3BA 1QRTA 3HP1A 4B4UA 4WDQA 2EAUA 5IDWA 2CWDA 1YONA 2EYQA 4BB0A 4L6IA 4QG7A 3ES9A 1T2NA 2ZT5A 3F5FA 3ZJ4A 3TR6A 4D9KA 3L4EA 4BNYA 4YR7A 3KWJA 5I5TA 2BFEA 3E3MA 2PO5A 3ESXA 4AQ7A 2PCLA 2JD2A 5DB4A 3EVFA 5C0OE 1P2VA 1Z6YA 1PBTA 2JANA 1QMPA 2XMRA 3F6PA 3L7JA 2ONJA 3RNLA 1JHDA 1CS4C 1M1UA 1ML3A 3GA7A 1PR4A 4CQMB 3K9LA 1V71A 3UV3A 5TPWB 1M33A 4RQUA 2OP0A 3H4BA 4QVKA 1EE9A 3ZD9A 1UCFA 2CUNA 4O6VA 1GKIA 4LHWA 5J58A 3VR4H 3W7BA 3AKEA 4ASUD 5C5EA 4G5GA 4HH4A 1IM8A 4H1VA 4DVJA 3W34A 3CW9A 3AX6A 5CXUA 2IYXA 3KTDA 4K03A 1GZ4A 1M2KA 1JIHA 1TKCA 3U3ZA 1L8AA 3ACCA 5AI9A 3ESAA 4II7A 5A3SA 3TKLA 1N6LA 4J0JA 2DPIA 3HE3A 2P8JA 3FTDA 5ESWA 1RXWA 3O2QB 4IX1A 3SS7X 3A05A 2YWEA 5F51A 2WF8A 4P3NA 3VO2A 4AVYA 1P31A 2ZE6A 1S03G 4RVGA 4H60A 3A6LA 2Z8XA 4DV5B 1WDKA 4N12A 5EJFA 3RK4A 3UG6A 1QRUA 4IF6A 5BOVA 3ZJUA 3R7DA 2PFKA 1H42A 4PICA 1ARZA 4QVGA 4DRYA 1FLVA 2J07A 5LMNH 3CCFA 2OBNA 3HOZG 3ZX4A 2PUDA 4MDYA 2GM9A 1BVHA 4PPYA 1BU8A 2ZWOA 1OX5A 1E1YA 1VE5A 3EOAI 4MKFA 5FWAA 1X9HA 2O7QA 4GZ6A 4K1XA 4NJMB 3IP9A 3VI4B 1L7EA 3DE1X 3GLGE 2BGUA 3FUUA 5FORA 4GT1A 2YYYA 2G9RA 4Z4IA 2V7BA 4G4IA 1MVNA 4CLEA 3JQCA 2RH4A 2MSWA 4MS1A 2FSFA 2IYYA 2ZSBA 5B64A 3W2EA 3TF5A 5BXQC 4RAYA 1NBOA 1PJ2A 1OA0A 1F60A 2QGZA 4EF4A 4EY6A 3U16A 5CGQB 1D2GA 3AVOA 3TW4A 3QU9A 4I19A 1I1QB 4N7RA 1CNMA 4JVSB 2JLYA 3HXOA 1N3BA 2Y1FA 3WYNA 5JH7A 2OK7A 4Q6WA 4WK2B 1NYLA 1GGHA 5K5EA 3SCZA 1X7ZA 2I7TA 1LQ2A 3L82B 3CFYA 3QBVA 2A67A 3SC4A 4D57A 4MV7A 1YI1A 2I9KA 2ZUBA 3RSZA 2C82A 3ITNA 2CLMB 1I4LD 3OFND 5EYPA 2J3DA 3RT1A 1A2BA 1E4OA 4LTNA 4PTZA 1A5SB 2XA1A 4D42A 1ZN8A 2Q2WA 2Y3IA 4F2HA 1GXSA 4Q4HA 3T4PA 2PK3A 4JBNA 5REQB 2Q5IA 4IQGA 2FN3A 3D0KA 1BYUA 1Z8NA 4BXXG 4O4IF 2WRZA 3HRKA 1HL3A 3KQPA 4FZVA 4P36A 5L4SA 5KO2A 2BDTA 4TYYA 4C5BA 4GHWA 4U6QA 1U8AA 1U0GA 3O3CA 4D9FA 3MR2A 3A06A 5L3ZA 1V11B 1QZUA 5E6SA 1PKXA 3KS9A 3MYRA 4JD5A 1VHLA 4ED7A 3IPAA 2YUTA 2VTBA 3GZTB 1U99A 3OFVA 5FLXW 1I6WA 1MDBA 1Z47A 4NBSA 1IWBB 4PQRA 3LBAA 4YP0A 1QCDA 5KTMA 3EYYA 1JVSA 3TSZA 3PNQA 4X71A 4BU1A 1OSNA 3DKPA 2EJCA 1YZHA 2YUIA 3KLNA 3TW0A 4DMFA 4H7EA 1V9CA 5HIMA 5JG7A 5K6TA 2YXNA 2NUPB 4BBAA 4O1IA 3QWIA 3S2YA 1E5TA 1NX6A 2DR3A 1E96A 3BKWA 5IZCA 1MR3F 2JEFA 3UJHA 5JZBA 1WUYA 1RJQA 1L6RA 4YAIA 2UXBH 5EY5B 1WQ4A 3S1LA 3ZOZA 1Y1SA 2DU8A 1AQ6A 2W7OA 1HFEL 2PIAA 2QLBA 2WW8A 1G41A 1ZM2A 4L4YA 1KY5A 2ZLBA 4YVFA 1LY1A 2FZLA 2CQYA 3OCWA 3SS9X 1EH5A 2PBRA 1CQJB 4OH1A 4WLUA 4QZVA 3OESA 3GYGA 3K3PA 1IJBA 3R76A 2JIRA 2O2IA 2C2ZA 4LF4H 4RD4A 2VH5R 5EWJB 4TOIA 1RJEA 5CLLA 4ALLA 1CRZA 1BE8A 2JFPA 2XUFA 3K09A 4YB8B 3HMQA 4B43A 3QFTA 3JAWA 1ZGHA 2JBAB 1OGJA 2PGOA 5TJHA 3DKRA 2WJIA 4GEGA 2UYOA 4GVLA 5DBEX 4KVFA 4U7TB 4WL0A 4LV8B 4M0CA 4UCRA 1N7IA 4NE7A 5D1HA 1P5ZB 1YZNA 4XR9A 3RTBA 2QUKA 4DLPA 5ILGA 5TIIA 3HBMA 1I0ZA 2P4HX 3IR5A 3DE4X 4BNZA 2HOQA 1RC1A 2YHUA 3SEQA 2AN4A 1R0YA 3BGWA 4ZTZB 5JJIA 4TVIA 2ZSKA 1Z0KA 2GBLC 5CVCA 3OQMA 3OBBA 4ERNA 4H6VA 3OTOB 4Q16A 3G2IA 3UGJA 3LYLA 1GFSA 3M82A 2VDUE 5BR4A 1WLYA 1X80A 2PYZA 2R7AA 3M5DA 1QG4A 4F1WA 1LUAA 3GILA 3GLHE 4DR1H 1E0JA 4L4XA 1HOTA 1P7CA 4I2VA 1TVKA 1Z2OX 4OV6B 1E8NA 3KQSA 4AP5A 2XUDA 3AQ4A 2FF7A 1ADYA 5B5SA 1RQ2A 4GGMX 5LOVB 5KSPA 2QRUA 4M1WA 1FS4A 1NP6A 3H9QA 5DYTA 5AXAA 1CJBA 1C7EA 4F85A 2JIBA 2ZIXB 4K8RB 1QP4A 2YCHA 5FHRA 3UXEA 3E5RA 2O14A 2H2IA 4Q7QA 4PZEA 3UGQA 1QFYA 3A0UA 3BZWA 4JASB 3WTCA 4C4YA 3LKZA 1U2DC 2O2DA 1XGKA 3UCEA 3EPHA 1C8BA 3DH0A 5JCJD 2YJ5A 1DL5A 4N7JA 1W47A 3M7IA 4Y1FA 5L53A 1WG8A 4ME6A 3A6DA 3FNHA 4DM7A 2PYIA 1EFUA 3KYDA 3DWEX 3QU7A 1EVEA 1UJBA 3C70A 3ETEA 4M9ZA 1LKZA 3OZGA 4WXPA 1E32A 1OHHA 1PJSA 1JHPA 2WYWA 4PHHA 4QBHA 4TZ6A 3GMTA 5LLDA 4MQ5A 5G0VA 3A3YA 2GNPA 2VT2A 1ORTA 5I3CA 3WWEA 3TXYA 2QN9A 1U2PA 2QV0A 1AS0A 4U7DA 3AUJB 4Y8VB 1HDCA 3HRIA 2J87A 3HYSA 3G7NA 4W1RA 2WJJA 1FL9A 1SVWA 3AB7A 2LDBA 4IIVA 1QQ7A 2IX9A 2XVZA 4RYDA 4AYTA 2V7EA 1NVGA 1L8XA 3HNOA 4OHCA 3O0TA 3QKIA 5DU2A 3RVLA 3E9QA 3ENWA 5ALOA 1TPYA 3LX6A 2R8JA 3MJFA 4DHWA 2VA8A 1LPBB 4MQBA 2R87A 3FOAA 1FRVA 4KIFA 1ZVMA 5GONB 3EY4A 1TZKA 4QWCA 3AJRA 3DFIA 4BVGA 2RGBA 4K5QA 2ZRHA 2OHFA 4GKKB 4OYYA 1JS1X 1YB7A 2IIBA 3WICA 3EWIA 1H5QA 4D0LB 3F96A 3NJ4A 3BJRA 1XVTA 2YWVA 1PZXA 1ZWKA 2QSJA 3ITEA 5ERXA 5GV7A 5THXA 3RHFA 3UOAB 4EQZA 4O7NA 4Q8FA 1Z33A 2QYTA 3NUZA 1A88A 4J3FA 4LJ6A 5A3VA 4DOMA 1TCCA 2HTEA 4BMPB 4Q8EA 1DEOA 5JMTA 5DGCA 5EGNA 2VT7A 5HA5A 1Y7PA 1EINA 4OGKA 4XGNA 1E3LA 2Q6LA 4NZNA 1S3IA 5CNIA 4EZEA 3B2EA 3NVDA 2AW5A 2NG1A 4IRXA 2CYCA 1VJRA 1YGPA 4DL9A 1BXKA 4FHDA 3W5CA 2BT4A 2MYTA 1J21A 1J00A 2QI9F 1EUYA 3B5IA 4YJ2F 4EBBA 3DONA 3HR4A 4ENWA 1JSXA 1XKXA 3LP5A 4TSFD 5LKAA 3SVZA 1JFSA 3VJKA 5HCUA 1HETA 4KYIB 3M3DA 4BNVA 1QPZA 3OX2A 4EYKA 2J3JA 1ISJA 4CLRA 1XMOB 1D1SA 4ECVA 5BP7A 3CH7A 2R8YA 4R81A 4DXAA 3C7CB 3QZ8A 3MT8A 2ZJAA 3NHRA 2X9NA 4QWWA 3I83A 4J03A 4WE3A 4V2UA 3KT6A 4ZHSA 5JZOA 4P7GA 4XGIA 2VPYA 4IEEA 3PWSA 3C5WP 1GEEA 3GRKA 1W5TA 3RARA 4YYEA 3W5DA 2GJ9A 1XMXA 2HSDA 2A1UA 4JV5B 4IR7A 2XYGA 5IWCA 1O08A 4K8OA 4A6EA 1FNDA 1VYHA 5KG2A 3BA1A 4LCBA 5EGSA 3KTMA 1PJ8A 1T10A 3CNEA 3IB6A 1XTRA 3MRSA 4NFSA 5B7QA 3RB3A 1R6AA 3DJFA 4XZ3B 5KJFA 1JA1A 2GCIA 3HUTA 1G8GA 2QRHA 1NW9B 4TWAA 4ITVA 4YC7A 1Z82A 2Q21A 3FYCA 3U44A 3ZDAA 1V5IA 3J7AK 2VDWA 4FWBA 3UAOA 5BV2P 3I39X 3UMSA 4M7WA 4IUYA 4ZCPA 3Q3HA 4O2BF 3LPDA 2I8CA 3Q87B 4N54A 3K71B 1NVDA 3PUJA 1HFKA 3LV8A 4ZO9A 2PH3A 4QLBA 4RTMA 4QPJC 3G8YA 1RTTA 2VL7A 2BEWB 3DUWA 5EE5B 1KOLA 4C14A 4RB1A 1G16A 1QGUB 3D59A 3LC0A 1WCXA 3S4YA 3DHVA 4EK9A 3V2HA 1KO1A 1G8FA 5B58T 4WEQA 5BY2A 1HLPA 3ZWMA 2ADFA 4HNVA 4N65A 4N7MA 1P0IA 1A2KC 2B69A 2CLDX 2HO4A 3BUSA 3E7FA 4O4LA 3X2EA 3HT5A 3KB1A 1QG2A 3AEKA 1SN7A 3WGVA 1SU7A 2A9FA 3ZLJA 2GVZC 3WWYA 1XDSA 4BVHA 3QEMA 4K86A 1IUPA 4OXYA 4BZQA 3MWGA 1SRRA 1J0EA 1T0JB 3L8GA 1NBWB 1COWD 3TW6A 4KWTA 1HL7A 4X20B 2QTAA 4JI7B 3QYAA 1GDTA 3VU8A 1CJMA 3RBXA 4PQGA 1UOPA 1YRWA 3KQTA 2XCSB 4KZKA 5CR9A 3LCCA 1UWCA 3WO0A 4LF7B 1OILA 2VI5A 4UXIA 1AS3A 3GLFB 3RFUA 4Q5IA 1HMYA 3PC3A 5E7QA 4OIMA 5LQUA 2IX3A 3IA2A 1XVUA 4BX8A 3VPAA 5I5UA 5AOBA 2IPMA 1P1CA 3SKYA 1OH6A 4KE6A 1PLJA 2GDJA 3KR0A 4TYMA 2OXRA 3RSFA 4AJ2A 6ABPA 4HTAA 4LHXA 3ZNNA 2IP4A 5AHWA 3HRHA 1AMUA 1J4AA 2OZKA 5BN5A 2ZRQA 1VJCA 1F48A 2IK8A 3MW8A 3RAQA 1Q50A 4Z8YA 1PU2A 1J9EA 1THMA 1ZGGA 1ZG3A 4XM2A 2HBQA 3LCUA 4JSTA 1N6NA 3K6RA 4B73A 5JZ9A 2DX7A 4I8XA 3R6DA 3TIGA 1KJYA 1CV2A 3TW8A 1PX2A 4LZNA 1BN6A 3ESBA 3OLCX 4GL4A 1YA4A 1J25A 3E18A 4G24A 2CKZB 4M0UA 1X9IA 4CMIB 4D2IA 4ALMA 3RT7A 3AHIA 3GAZA 4US0R 1VP9A 4EPYA 1NF2A 3E8XA 1RAAA 4FX5A 4PXSA 4XVCA 4B6JA 4Z0PA 1A71A 3M9XA 3QTBA 2XNDD 1Q12A 1J6UA 1JE1A 2WJ6A 1UFOA 2ACKA 1YR2A 1OCEA 4M1EA 3CSUA 5D5QA 5CFZA 2AMFA 5I9BA 1W46A 2G8LA 2HMUA 1FFYA 4QPPA 4BMSA 3OETA 3L4KA 3AUTA 3GDHA 1F2TB 2YJZA 4O3FA 1L8QA 2BRUA 3K0HA 2CXXA 2P9BA 4M7EA 3HCNA 3AWDA 1PT9A 1S02A 4CMKA 4Z2AA 4MVJP 5IAGA 2AFHB 2C00A 2X3YA 3LUBA 4HEJA 3NMUF 2XJ9A 5IDQA 2OB1A 4P34A 1XVLA 2FK1A 2WAQA 3Q8XB 3NDJA 4NF2A 5HJ5A 5I7HA 1YFJA 4GKVA 4LRWA 4TTRA 4AN0A 1UPCA 3U4QB 2BFEB 4TWBA 3EGOA 1NOIA 2I87A 4H0FA 1NI4A 4PWQA 3D6JA 3E5HA 3MTQA 4YRDA 2H2GA 5B4TA 2IYQA 1RHUA 3KPUA 5HBRA 5TQ2A 1IDOA 3BWDD 1NVKA 3LT0A 5G0SA 4IFEA 1V8PA 3NHWA 4BNDB 5A7HA 4DCGA 4EMTA 1XTBA 1WUJS 1XA4A 2Z0MA 4AJKA 3T4XA 1D8AA 1S10A 4MKRA 5LLSA 2JCXA 2VYQA 4G97A 1DFHA 1MOQA 1KJZA 1ORHA 2HU7A 3PFWO 2JFOA 2XA9A 3LNTA 1FA9A 1IB0A 1P7YA 2ZK7A 2Q7OE 3TTVA 4MJ7A 1G2WA 2AC4A 1YGYA 1Q22A 3HYTA 4UM8B 3R74A 3OY2A 1ESDA 3KJHA 3QXCA 2XWSA 5I4KA 2GUWA 3DZFA 3MCUA 3ZTWA 4KXYA 1YQTA 4MWEA 4KITB 3IXLA 3HWX1 1BVYF 4TTVA 4ZV7A 1TUIA 3KR2A 1KMNA 1TK2A 4KEAA 4PS0A 1CHDA 4WBNB 3C98A 2ZUUA 1R8QA 1PQPA 1JJ7A 1HNXH 3PHGA 2OCPA 4L6AA 1E4VA 3I2FA 3NTQA 1C9MA 3PZPA 4NLGA 3OCJA 1UBUS 1WSAA 3OZSA 1GTSA 3NU1A 3RIXA 2AX3A 3WP0A 3E9YA 2YN2A 5HUHA 3MK31 1JXQA 2O7VA 2XVMA 3WYEA 5KJCA 3EPRA 3PR5B 5GM1A 4D1YA 2QTCA 2GR9A 2OXCA 2VQSA 4RORA 5BWLA 1GOTA 1JDSA 4MROA 4CDGA 4H4CA 1GD1O 2BKVA 1D07A 2GWHA 2QKYA 4EHKA 1K5DA 721PA 4LECA 4PG4A 2CSXA 3FIUA 2ZI3A 3N0TA 1NW6A 3OT1A 3JW8A 1QK3A 1YH3A 3T0GA 5BNZA 3V1LA 1JR4A 3Q2IA 5DJ5A 9LDTA 2JEZA 2I7VA 4F1KA 1UBOS 3CUYA 1W19A 3IKVA 3NBKA 1KYYA 3IAS1 2HQOA 4L4SA 3FW1A 4BP8A 2E37A 4IIYA 3MHTA 4QPDA 5F7OA 3LY5A 4XCXA 3ODPA 5CD1A 2R7KA 1I9GA 3RIGA 4YCBA 2DAAA 3NC0B 1CLUA 1I1NA 1FVIA 1M2FA 3DZ8A 3BHIA 3NZEA 2AJCA 2YWFA 1U2EA 3LZDA 1UFVA 3AJEA 2F7SA 3UOGA 1TCBA 2WTMA 4AQYB 4C0XA 2PY6A 3GIQA 2COGA 5CE8A 4G0QA 4LPKA 4PW0A 1RPJA 2X8JA 4P3XA 2WIFA 1OIXA 2GETA 3MCVA 2G5GX 3GJ0A 2F4VH 2I8LA 5JAQA 1EUQA 1ZGJA 1T2DA 3K05A 1A95A 3LJKA 5JVDF 1L5LA 3E61A 1CR4A 1CR1A 2NUAA 4YJ3A 5DWDA 1FUUA 5JHHB 1NLUA 2F3QA 1DC7A 5FQNA 1ZCJA 3PJEA 4GPD1 4IFTA 3TNLA 4BQNA 5I6DA 2HYIC 3HXTA 4L57A 3BGIA 1MJGM 1M1ZA 1Q3KA 4UBJA 4G8JA 5DYYA 3K1TA 1MAHA 1Y63A 2FLKA 1YR8A 2G09A 5SICE 3OPQA 1PQYA 2BM0A 2Q45A 2FP4A 3L7DA 2AJ8A 3QTTA 1M1YE 4OFWA 1GQRA 5EUQB 1SFOA 3FYTA 1KVUA 4LWZA 2AI2A 5CR5A 2AMJA 3GVXA 1PHRA 1VPEA 5CNJA 3W9BA 4EX7A 4MV9A 3L8MA 2BD0A 3SZGA 2DAPA 3TG8A 5CFNA 1IZ8A 4D4KA 2P69A 4DA7A 1BGVA 2GZ2A 4PPGA 5KU1A 1J8DA 3PZBA 2NNLD 2CJPA 2V7XA 3EEYA 4ZREA 3GJYA 1AY0A 1H2RS 3KTAB 3VYWA 1GUYA 4QU9A 1JKIA 4ZOAA 3UTDA 5H80A 2W7TA 2PTHA 2QROA 1T34A 2QG9A 3JQGB 5G53C 3TVDA 4E07A 4E5NA 4DR7B 3PFBA 3NX4A 3VJRA 4UQPA 4DCCA 2Z57A 2D06A 3LYAA 2OBMA 3C5HA 2A33A 5JNRA 3OSNA 1EK0A 4EL0A 3X2SA 4EO9A 1XK5A 1EIZA 1OLOA 2AIRA 2X86A 4WOBA 3DXXA 1BWQA 3WLLA 1XDGA 1JWBB 2OAGA 4JJKA 4UOEA 1RYRA 5FLXA 1U9CA 2HJRA 4OI2A 3AP3A 4R3WA 1K1QA 1SVMA 3D2LA 4X92A 2W6PA 2GO7A 2KS6A 2POQX 1UM9B 3AO0B 3FTCA 3QUCA 4W5HA 2ZSEA 4L7QA 1UZUA 2NTVA 4YRPA 5MGNA 5LWHA 1QMGA 4XJXA 4BEWA 3DDSA 3FZYA 3PE3A 4LRQA 2VDMB 3KJNA 1RYZA 3FSRA 4CDRA 3MINA 3U4AA 4EVRA 4X64B 5IBRA 4ZICA 2H2AA 1JDEA 2PSDA 4HQKA 4WOPA 1OX6A 3UJPA 1VLZA 1IQUA 1V4YA 1I0LA 1Z5NA 2XVYA 4RK0A 4ANFA 3DUFB 2BKUA 4WZAB 3HNPA 1G3MA 4LGVA 5AXCA 3KOYA 1XF9A 4JVNA 4AUKA 2IXFA 5E2BA 5TMPA 4J7CA 3A6ZA 5KQRA 1E0KA 3C15C 3CTMA 3MQ2A 4L02A 2AI1A<