1UC8A

Crystal structure of a lysine biosynthesis enzyme, lysx, from thermus thermophilus hb8
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
280
structure length
254
Chain Sequence
b'MLAILYDRIRPDERMLFERAEALGLPYKKVYVPALPMVLGERPKELEGVTVALERCVSQSRGLAAARYLTALGIPVVNRPEVIEACGDKWATSVALAKAGLPQPKTALATDREEALRLMEAFGYPVVLKPVIGXXXXXXXXXXXXXXGFQHQLFYIQEYVEKPGRDIRVFVVGERAIAAIYRAENCPLTEEVARLSVKAAEAVGGGVVAVDLFESERGLLVNEVNHTMEFKNSVHTTGVDIPGEILKYAWSLAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lysine biosynthesis enzyme
molecule tags Biosynthetic protein
source organism Thermus thermophilus
publication title Crystal Structure of a Lysine Biosynthesis Enzyme, LysX, from Thermus thermophilus HB8
pubmed doi rcsb
total genus 71
structure length 254
sequence length 280
chains with identical sequence B
ec nomenclature ec 6.3.2.43: [Amino group carrier protein]--L-2-aminoadipate ligase.
pdb deposition date 2003-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08443 RimK RimK-like ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.80 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 1uc8A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1uc8A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1uc8A01
2HJWA 3GIDA 4C5BA 2VPQA 1UC9A 4MV9A 2OLSA 3VPCA 5CAEB 2R7LA 1JDEA 2YS7A 4MA0A 1AUXA 2FP4B 3WO1A 1B6SA 4O4IF 3N8DA 1EYZA 3WNZA 4C5CA 1CE8A 2ZDQA 3VMMA 4YAJB 5HV6A 3ETHA 3TQTA 3K5HA 3QFFA 5H80A 2VHEA 2W6OA 4I4TF 2W6MA 5J2TF 2GLTA 3JRXA 3OUUA 3VPDA 3VOTA 2FPGB 4EABA 2R6FA 3JZFA 1EUDB 3BSYA 2YZNA 1GSOA 1W93A 3RV4A 1BNCA 4EAAA 1KBLA 4O2BF 2DWCA 1KJJA 2I87A 2R85A 4M98A 1EUCB 3TIIA 3LWBA 2QK4A 4DIMA 4IWYA 4YBZB 1T36A 2NU7B 4I50F 4HNVA 5C8YF 2FPPB 2V5AA 2I80A 4MAMA 3HBLA 1W96A 1CQJB 3TW6A 2PBZA 2YYAA 3MJFA 4MV1A 3TINA 2R7MA 4FU0A 1KC7A 3OUZA 4O4HF 5LOVF 3RV3A 3V4SA 1VKZA 5JQWA 3N6RA 2R7NA 4ME6A 3HO8A 2YRXA 3K5IA 4WD3A 1KJ9A 4ZQIA 4I55F 2FPIB 1GGOA 5CB4F 5LYJF 3G8DA 2R7KA 5HBRB 2YS6A 1DV1A 3JRWA 4RZQA 2R84A 4IHJF 1IOWA 4IZOA 5I47A 2W6QA 1EZ1A 5K2MA 3AX6A 1WR2A 2CZGA 1GSAA 4ZHQF 4O4LF 2J9GA 2NU6B 2DLNA 2VQDA 2VR1A 2YRWA 3GLKA 5LXTF 2SCUB 5KKNB 4GGMX 1M6VA 5BPFA 4HR7A 3WO0A 3HB9A 5GONF 1JKJB 2XD4A 3K3PA 5CA1F 1KJQA 2DZDA 2W70A 4HNUA 5JVDF 4EA8A 3U9SA 4Y8VB 1C30A 3ORRA 5JH7F 4M9UA 5BMVF 2W71A 5IYZF 1PK8A 3E5NA 4WBNF 4MV6A 2W6ZA 1UC8A 2ZDHA 4MA5A 4XYMB 1IOVA 3MWEA 3VA7A 2YZMA 3RUPA 3U9TA 2R86A 3Q1KA 4E4TA 4EA7A 1AUVA 2NPOA 5CA0F 2YL2A 1GSHA 4MV3A 3R5FA 4EGJA 1B6RA 5J2UF 4YJ2F 1JLLB 2X0SA 4ZOLF 1PX2A 4C5AA 2XCLA 2PN1A 4MV8A 2NU9B 4EGQA 1C3OA 5LP6F 4J6EA 1DIKA 2PVPA 3I12A 3R5XA 4XYLB 2C00A 2V59A 2P0AA 2W6NA 3LP8A 4O2AF 1JDBB 4EA9A 4L1KA 1BXRA 3AW8A 3BSSA 4YB8B 5BPHA 4QSHA 2FB9A 4EG0A 3MWDA 4MV4A 4XZ3B 4M99A 2YZGA 3VPBA 2R87A 2QF7A 2YW2A 1VBGA 2ZDGA 3SE7A 2R82A 3BG5A 1KEEA 3UFXB 5JVLA 3BFPA 3R5HA 3V4ZA 1VBHA 3ORQA 3TIGA 5D8DA 2W6PA 4XX0B 1DV2A 1I7NA 1KJIA 2GPWA 5C1PA 5KX5F 4HNTA 4MV7A 4TUYF 4M9CA 3Q2OA 1KJ8A 3BSWA 3JZIA 3RFCA 2CQYA 3R23A 2Z04A 1E4EB 4HQ6A 5C1OA 1A9XA 1CS0A 3G8CA 2DIKA 5EZYF 4TV9F 2V58A 2NU8B 1E4EA 2I8CA 1CQIB 4YJ3F 5LA6F 1GLVA 2IP4A 1I7LA 2NUAB 4YAKB 4ZI7F 1EHIA 1ULZA 5DMXA 3ETJA 2GPSA 4IWXA 1SCUB 4DLKA 4TV8F
chains in the Genus database with same CATH superfamily
4O3QA 3X2SA 3K4PA 4XWKA 1ZQ1A 1XTKA 4HX9A 3W5BA 1QPZA 3O8QA 3FDZB 2XZOA 4DT1A 4AG3A 1FXUA 2ONJA 3GTLA 4PWZA 5FFFA 5AWFC 1TWFA 3K15A 4R1SA 4F4XA 5ER9A 5JAMA 3EEYA 4CMKA 3K5HA 1NVEA 2C04A 4FB4A 5EJ6A 1GNPA 4JUBA 4IH9A 4YV2A 1E3SA 1HSOA 2GF9A 2HBYA 3WGJA 4RDIA 2R6FA 3TOXA 3RU2A 4JI2B 3K92A 3LNTA 4TMZA 4IVNA 3E48A 4FI3C 1FSFA 4Q9AA 4R1NA 4EF4A 2WUVA 3ICEA 1U0NA 4PTYA 1E2IA 2DQZA 4DL2A 3T1OA 4ZCIA 3W4KA 3UA4A 3VVLA 4MX8A 1YFZA 3HSSA 1ZI6A 2YH2A 3O47A 3LX6A 4BRZA 1EP1B 2M05A 1GTZA 1GGNA 2GR9A 4HDAA 1W75A 2PNFA 2QTVB 2VQ3A 2WAXA 4WCFC 2HV8A 3R6DA 5ALNA 4EECA 3H9CA 1PZMA 3RUEA 2HA7A 2AOUA 3OCJA 3QVVA 4FYJA 3DXYA 5AVXA 1V4YA 4CKBB 3COVA 3ZK8A 5HCNA 3L49A 1E9VA 4IUYA 3JWIA 2JAWA 2NU6A 4Q21A 2C4UA 4Y2GA 5EP4A 5EKSA 4D26A 2G7ZA 3O1HB 1PVVA 3IYLW 3BZWA 3E2MA 4ZHQB 3D3WA 2ES4A 3CXUA 4XGRA 4YCBA 2Z2JA 1JIJA 4X5OA 1S2DA 3T3IA 4CCSA 1Z4OA 1SXJD 5DI3B 3NAMA 4AVYA 3ZCSA 1A9SA 4HX5A 1WTAA 3ZQ4A 5IT9A 4ZDKA 3FMAA 1RPTA 4P92A 2G9ZA 3DDCA 3GP5A 5SZKB 1E1KA 1T6XA 1I7QB 1KO7A 2QZ9A 1H2HA 1TIPA 3K3PA 3FIUA 4KX3A 3ZHVA 1EG7A 5I9MA 2ZCJA 2B5VA 2VSQA 5LQUA 1L4FA 1XEXB 2OO5A 4BTLA 2F9FA 4MV6A 1GDHA 1JH8A 1VG8A 2NSJA 3HGQA 3DBVO 4IKEA 3UJAA 2GAOA 4C3UA 2AG1A 4FGSA 5JU6A 4I1PA 4NFLA 1GZ7A 1KI7A 1MN6A 4J91A 4LSMA 2I1LA 3NNSA 1L3IA 1KAHA 1S97A 1YBFA 2CXPA 2E5FA 3NLLA 4RZXA 4YQEA 2D0DA 4G1UC 3U3RA 3UXEA 3UMYA 4D25A 4MAFA 3LX4A 1L5ZA 4PHTA 4EW6A 3SF0A 1AURA 1PKXA 1DKOA 3N2KA 4KI0A 3BT7A 1E9CA 4M36A 4WBSA 5ANRB 3MR5A 2SHKA 4B48A 2JBAB 4KXNA 1PK9A 2R79A 3DHNA 5AW2A 1KH1A 2P41A 3G85A 2ZROA 3QGMA 1ABFA 4G36A 3H5VA 2XIQA 3I8SA 4EY5A 4KYUA 4F72A 3SSNA 3K2QA 3WK8A 5B1SA 4AN0A 1SZDA 5GADl 4D6PA 3JZMA 4G2TA 2UXDB 4X00A 4KR6A 1P1IA 3OZFA 4OKNA 2CYAA 3JR7A 4KUGA 3K35A 2BMWA 1E7QA 4TTQA 2FLNA 3FYDA 3T7KA 3O2NA 2PAAA 3JQCA 2DFDA 2VF5X 1NNUA 4LFCH 1UJNA 3SOPA 4DR4H 3ELUA 3GLIA 3R6WA 1FS6A 4KNYA 1M6YA 1VJ0A 3CUUA 4IWXA 4QBGB 5E6RA 1KYTA 4LKRA 5AK6A 3WGLA 2C82A 3TZHA 1AK9A 2BFAA 4E13A 4NOKA 2OH2A 1Y9EA 2QU7A 4IFIA 5KNBD 1VE6A 1ZGJA 3RSOA 4OXYA 1WVIA 3Q9UA 3ADOA 2O03A 4LNHA 4DRFA 3PQ3A 4OBEA 4AM8A 2E48A 3FFWA 3QZUA 3Q1LA 4OX9Y 2IS4A 5KT5A 4PG4A 4M0MA 2IYWA 1GPYA 5CVCA 2CNQA 1RCUA 2VPXA 5F33A 3Q40A 4YVFA 5F3DA 4EH1A 3JAMA 1CEYA 4BNJA 1NDUA 1BEEA 4WESA 1KDZA 2YWHA 3BSYA 1JIHA 2IYNA 2PDAA 1VRCA 2XSZA 1BNCA 4EG6A 2OUKA 3G6XA 3BK1A 2QK4A 2CLDX 3L7DA 1KQPA 2E2HA 2J0EA 2J0UA 4FN4A 1UF9A 4MV0A 4RV5A 1KHTA 3GRUA 2P2DA 2V5AA 3Q4GA 5IHXA 4ZYXA 5EHXA 2YYAA 1CRZA 2P65A 4KNVA 4U7GA 4CM4A 2FKLA 2UUCH 3O8RA 1R4MA 2ZR9A 1CZOA 4F4FA 1QP4A 4QW8A 3BWVA 3H2BA 3OC6A 2OXCA 3T7RA 5I7EA 5F98A 1U5BA 2G88A 3BRSA 4ZARA 3RK4A 2QL5A 3TEFA 1RRKA 3DKIA 3HO8A 4L0MA 2JLVA 2HU7A 4EZEA 1X86B 3W8EA 3PDIB 5LM3A 4EY6A 1VL5A 3G8DA 2EFYA 3BE4A 3DVAB 3B1ZA 3V6KA 1J8QA 1F51E 4BP8A 2ZUEA 1D1PA 2QX8A 4JYCA 4WFQA 3HJRA 1Z63A 3EBPA 3I3SR 3SQXA 3BJZA 4IIYA 1AGXA 3GRYA 1KYZA 1LLDA 1PZHA 4I4IA 1Q0PA 2OD7A 4FTWA 4UDYX 1I94H 1TUGA 1XP5A 2J6BA 3VX4A 4POOA 1EUQA 4UBIA 3UKDA 4JEHA 1X9HA 3T5JA 1F06A 2RDMA 1S9DA 1SVSA 5JAPA 1LDBA 4UBOA 2GNAA 3EXFA 3RHTA 5KOYA 4YXFA 1RAAA 1JB9A 4WBNF 1RJEA 3ADKA 3VR3D 5JQGB 3I6BA 3L1KA 3NX4A 4K6NA 3FOFC 3ZLJA 2SKCA 2WTMA 2RE8A 1WV1A 4ZU6X 4Q01A 1QAOA 4YX9A 2HDKA 1M83A 1FTQA 1NKTA 3WYAA 5A9SA 1YZFA 1U31A 3CSSA 3QX9A 3JPYA 4B3XA 1H1TA 4RPJA 4BN4A 5F9FA 1KWKA 3C5EA 1L8QA 1V47A 1I3MA 3ANTA 2AR9A 3RR2A 4AICA 2DHQA 4FYYA 4ZVSA 2IV2X 3ZY4A 4I3GA 5LIPA 4UXIA 1GNRA 3C5HA 4YCDA 3QU2A 5IABA 1P75A 3WK5A 5K2OA 4AKIA 4DQUA 1XJQA 3X44A 3V55A 4O7VA 2V5VA 4MZXA 1H0SA 1DKRA 3CUEF 3MCVA 2ZBEA 4GO1A 4RHUA 5D3KA 3U3XA 4DIUA 1SHTX 2Y0DA 3NHAA 4D4KA 2LKCA 4HFJA 3SBXA 5AKJA 1YHNA 2DECA 2DWPA 3EDCA 1KJ8A 1T3NA 1P1CA 3IMGA 4D92A 3GA7A 2ZVPX 4PXAA 3PVCA 1CZLA 2FPMA 1LI4A 4Q03A 4URWR 4S24A 5IAKA 2CMDA 1U7ZA 4HZGA 5BV7A 1ULBA 4YPFA 1N9KA 2PYIA 3SJCA 9MHTA 3Q87B 1QVVA 3K9LA 5CBKA 4HH0A 2ID7A 2WUEA 4DCJA 3W3AH 3M3HA 3JZ6A 5F5LA 3ZIUA 1O0SA 3KQWA 4ARBA 1IWPB 3BF7A 2C84A 2BPOA 4LJAA 1VI6A 4KXMA 2NO5A 2HMTA 3CKKA 3DAHA 2QBYB 2W8BA 4ZMRA 1T4BA 1C4XA 3TDNA 5FDFA 1NR1A 2UZ1A 5BP7A 3ZU3A 1IXSB 4E51A 1NMSA 1O4VA 4DL3A 1R5JA 1Y8RA 2IOQA 1CZHA 2OHJA 4J8PA 3DMTC 1L8XA 3JWGA 1ZRSA 4FC6A 3IHKA 1D09A 1XVAA 3EEFA 3KZ1E 5BY2A 2XZTA 2HK6A 2QNBA 3DFIA 1UQTA 4NABA 5GIPE 1J1IA 2P1ZA 3AVXA 4PZ6A 4J49A 2DUNA 1K1SA 4O81A 2VXCA 2AOUB 4IF4A 1N5OX 5F3WB 1RE1A 4AQYH 1GKLA 3IMFA 3H1PA 5KT4A 4LWOA 1EH5A 1DTSA 4LCBA 2NXNA 1FVOA 2CCGA 2Z08A 2R00A 1OYVA 3VQTA 3JX9A 4O33A 1YS9A 2YN4A 3G02A 3IUEA 1EXVA 1H65A 1CHDA 3P27A 5H4HA 2K5UA 1OLUA 3KEFA 4KQIA 1CYDA 4G9GA 2ZWOA 4A8TA 3D6AA 4G5XA 4N8EA 3PNOA 1AD2A 2XMSA 4ZT5A 5JNVA 1XD8A 3KB6A 3ZD7A 4PG5A 2Z2IA 3G1WA 4F6CA 4KQ9A 5EQJB 2OFFA 2CVPA 3DM9B 1TTHA 3OCXA 2CWWA 4TZKA 1CD5A 1T3ZA 4JV0A 2LE0A 5BW5A 1TZKA 3DXZA 2XTZA 1WDLA 1U8YA 3GLKA 2VSNA 3GPDG 4J1QA 2XDQB 5DAAA 4QGBA 1J5EH 4Z1MD 3ZQ6A 1W2HA 1NATA 2DFPA 3HRKA 3RNLA 4L27A 5BSTA 4D98A 3PPXA 4AJ9A 1GSIA 3WGMA 2GPJA 4LV5B 4OGFA 3BIOA 3PF8A 3ZTYA 1SY7A 3KCQA 3ESRA 1S3GA 4IHAA 5ALRA 1QZUA 3DP7A 1M0EA 1QIEA 4O83A 4CKCA 1JDZA 1KC1A 4E4TA 2X6RA 4K0RA 4C1NA 3EXG1 1BA3A 2RB4A 2Q4BA 4NYMQ 1W73A 3H65A 4ADSG 4J16A 4B4KA 2YJ3A 4Y9UA 1IAQA 4NYEA 2Y1OA 4M21A 3F9RA 5GWXA 2EGGA 3DV0B 1NU8A 2WD9A 4GE0A 3WJAA 4G65A 4K6MA 2WOJA 2FWBA 3ZUGA 1FDIA 4BB6A 4BNVA 4C87A 4E4RA 2C3OA 3CEBA 2LGJA 3DYBA 2WYIA 4QFCA 4IXMA 3NOOA 2QV7A 3LQFA 2HY7A 4UAUA 1QHIA 1R9MA 3KELA 4JB3A 1XXHA 1VC2A 1OXSC 3ZWAA 4D4LA 3S8YA 4F3CA 3O0TA 3L18A 3MGCA 3N2YA 4LOLA 4DLSA 1P8LA 3GIPA 5CNMA 3RYFB 4ZVVA 1HETA 1X15A 3NHYA 1E5XA 2XECA 4XVRA 1UMDB 3PB3A 4TYQA 1RC8A 1ZEMA 4CCYB 3OCYA 3LDUA 2Z04A 2KPOA 2J45A 1Z74A 2RHOA 3L0SA 4RV4A 3CCBA 2ZKIA 4G0NA 4QOJA 3WP1B 5FLKA 2OECA 3HA7A 2ZSBA 4P0TA 1JLSA 4YJ3F 4BKQA 4D9CA 3G8BA 1EU1A 1XWIA 1Y8QA 4UMFA 1SIWA 3KHUA 5FEMA 1HK7A 4TTAA 2R7LA 5DHRA 1BN7A 1ORHA 1OI7A 2A94A 2CL7X 4RYDA 2IKQA 1ZCZA 5HW0A 1LC0A 5GZ6A 3GIWA 4TXHA 4QPCA 3RAPR 3WWDA 2D5IA 1XQ1A 4TLCA 4PYJA 1I33A 3QKSB 3UWKA 2QL6A 1L7VC 1TYZA 1WXHA 3EVDA 1ZH0A 3FDZA 3HHPA 3LRXA 2D5LA 3U13A 1T3HA 3KE9A 1MAVA 3V8BA 1H4TA 5DCLA 2NUPB 3VUFA 3BQ1A 1QZTA 1X7XA 2BKEA 1GXSA 4R8RA 5E9QA 5A2QA 4MI3A 2B2XA 1OIWA 2P3LA 1ZUHA 4NCBA 3E3AA 1AA9A 1CJKC 4XQEA 3TMKA 1U5CA 2BQRA 3UAZA 3PICA 3U9LA 1G7CA 2EX4A 3D9QX 2C59A 1QUFA 4JVLA 3W4IA 2FLWA 3R7WB 4DSAA 5DFAA 3Q6IA 3WGHA 4HLCA 4LMBA 3ZHTA 1GL7A 1C5KA 4MIEA 1LPOA 1CQJB 4NONA 1WDWB 3GRPA 5LZ2A 1YNOA 2HXYA 2PKQO 3GDGA 5J1TB 5J2UA 2EJ0A 1PIWA 2VSXA 4ENUA 1SOMA 2IELA 3VR2D 3WGNA 3AM5A 5DBHX 3CSDA 3KJNA 4J0HA 3B3JA 5H16A 3OPVA 1HF3A 1TWGA 4GLBA 4M7PA 4ZAFA 3SJUA 1TO2E 4YB8A 5IF3A 4BIMA 2HRBA 4CLOA 1XQWA 2P5UA 2Q9UA 5JJBA 4IZOA 2W9BA 2IRWA 3LQRA 2C20A 2HCFA 2PNJA 2CUKA 3DV9A 3Q15C 5F1OA 3C70A 4AUEA 5E3HA 1KS9A 4LXQA 3WV5A 2SCUB 4UE6A 2Q5HA 4LZOA 4ACBA 1O3YA 3SF8A 3A9VA 4UEQA 4EB6A 1XNHA 1CDEA 1NBMA 1SEPA 2RGRA 1Q16A 1PGOA 4DL5A 3MW8A 1T3SA 4LXUA 4E0BA 4CTMA 3HM9A 1KR5A 4QD3A 2ENUA 4L9WA 4AG6A 3RHZA 4RTNA 4EYOA 1C4OA 1G21E 3ZZTA 3RKUA 2H4WA 4EF6A 2ECKA 3IKVA 5EE0A 5GJBA 3EZFA 5I5VA 3LCUA 4EEQA 2AFHA 4RCNA 4QWBA 1I5OA 2XYQA 4DA9A 1XZMA 1KFEB 2BMEA 3I9NA 2XUFA 4MV8A 1W19A 2XX3A 4DJDC 4HDMB 4HMQA 2IOFA 3I3OA 3SVZA 5CVDA 3SAJA 1Z35A 4A23A 1WUKS 1YBAA 2D59A 1SBZA 4I3FA 4BO1A 4CG0A 1X1TA 4ZI3A 1TGVA 4D9BA 3AV3A 4PYKA 5BUQA 1KZHA 4BYMA 4CV1A 5K09A 3HDGA 1ZD3A 5BXQC 2QVXX 4DCVA 2VP5A 3HKEB 3UWSA 1ZOIA 4YAIA 4EGSA 3AUUA 1GCUA 3STXA 4EUFA 4DWVA 3EH1A 3SWWA 1IHUA 3C0KA 2RGAA 3TNJA 4CUZA 2UZ1B 2WOOA 3BA6A 4UDOA 1NP3A 4IXTA 3S1AA 4P5PA 1MB0A 3LK7A 4L5IA 4W7IA 5CH8A 1IUPA 1K8QA 1JFRA 5KFVA 1VOTA 4H31A 2B4TO 1UMCB 3K31A 1SH7A 1CS0A 1SQFA 5EVJA 3L79A 5AIAA 5TARA 2JJMA 2KLBA 2QD1A 1V6CA 3FOCA 3RSHA 3M8KA 2JVIA 2C95A 4GFDA 4R31A 3P4XA 5T57A 2GPSA 3BKXA 3FTPA 2OAEA 5LBUA 3INTA 3P9QA 4P9NA 1BEUB 1FFHA 3D3KA 1E2BA 2XMBA 3QYJA 1XV5A 4HH3C 521PA 1A96A 1NUHA 2FI1A 4CUKA 3C3BA 1NRWA 3NHBA 2KSQA 1U81A 2HKIA 3RK1A 3EDQA 5F2EA 3ZX5A 5BOSA 1DX9A 2XDAA 4RKEA 3T7SA 2IT1A 3ER8A 4QDTA 5EHIA 1A8UA 3KTAB 4O7ZA 4PTZA 4DWWA 4EI9A 2JFOA 3R8FA 1I3OA 1YR6A 1Q12A 1ZOSA 3FLMA 2E7ZA 2VHYA 3WB0A 5DQIA 1KBLA 1Z6QA 4KYVA 4JLNA 4ODIA 2YJ6A 3EOAI 2B4RO 4O2LA 4RPIA 5JDCC 4J0QA 3DB2A 4ED9A 1L0BA 2C2EA 4JP2A 1YVUA 1AXEA 4J6FA 3RK0A 1IM2A 5UKDA 1MX3A 2Y67A 5NLLA 4C0WA 1AVTA 2RHMA 3LYLA 3R3VA 2WNSA 4WN9A 4UCUA 5DCUA 3SDZA 2P9YA 4CR6A 3KX2A 5CNIA 2JGLA 3EF1A 3RYTC 2ATXA 5L3QA 2G25A 3P97A 2V7EA 1VZ3A 2QTFA 2QBYA 4GWLA 3K6SB 1CR2A 3HCRA 4MUAA 1WY5A 1GUDA 3BQ9A 4PCLA 1PN3A 1YJXA 2SBTA 2IUFA 3QI2A 4LRQA 2DY1A 3RS5A 3FZQA 2X9NA 3ZWVA 4PR0A 1GPBA 1DVRA 1WABA 2ZR8A 3GJTA 5FKJA 3UAVA 2P68A 1ZLYA 2QWXA 1T1RA 1NW5A 4A3GG 2ZKLA 4JGBA 4A0FA 4EEKA 5HM6A 2WE6A 1CVRA 1L4UA 2CL6X 1EFAA 4OA8A 1I36A 3V9AA 4C20A 1C7FA 3HSKA 4R2XA 3OO1A 1MOSA 3A37A 1SHZA 1YD7A 1CY7A 4X84A 1JQ5A 1C30A 1K3TA 1QKIA 2AC2A 3AETB 2Q62A 3F49S 3R4VA 2IS1A 4MMZB 2AJLI 2FZCA 5KTPA 2Z6QA 3KKMA 5H59A 3VA7A 1CJSA 3NHFA 3OSNA 2WM2A 2JIBA 1PWYE 3JD0A 1IZ9A 4QQKA 2NO9A 3KAPA 5KBYA 2EATA 1ZJ4A 4IDCA 1FEZA 3PFIA 5KC9A 4JSYA 3SQDA 3O31A 5KG2A 3C3CA 1Y8ZA 3TUJC 4DPMA 2JIZD 2AWOA 1PYGA 3E82A 1X6VA 3GG2A 1QM5A 2CWDA 3LLSA 1CETA 4TVOA 4F9TA 3ZDAA 1A72A 3ANLA 1KMIY 4ASUA 4QSHA 4AN4A 3TE7A 1BW9B 2Q5JA 2XTNA 5I5XA 1E3TA 3MERA 4J4HA 4Y2PA 3TLGB 4N8SA 1Z0ZA 1M34B 1BE6A 2G72A 1I01A 3B1JA 5IKMA 3V7UA 5KFSA 1P81A 2QZPA 3ZG6A 2D6FA 4ALKA 4P98A 4G0UA 2BZGA 1WB5A 4HATA 4YXWD 5CEJA 4GDMA 2XNHA 4RTSA 1X94A 3AKEA 4WY5A 3P2EA 1BOOA 2NXJA 3I1YA 4NBKA 4R01A 4MQ6A 4E7PA 3RADC 4DNOA 2UVVA 4DMKA 1IJFA 1IHPA 2XAAA 4QATA 3WL8A 3L8GA 1JXMA 2IY7A 3G9QA 3QQMA 4GLOA 4WZBE 5HUJA 3WK4A 4TV8F 4C03A 1U8EA 1I3QA 4G1BA 2FSPA 3EXHA 5FA8A 3DC7A 2NP7A 1WZUA 1CWUA 4JJAA 4L74A 3M6LA 4RTJA 4RZHA 4DV7H 1LWNA 2VQEB 1PL7A 2XZDA 2Z8YM 4Q4JA 3CNQS 2HA6A 1HNWH 3SXPA 1TEHA 5SY4A 3OI7A 4EYEA 4F2PA 1E5TA 2HF2A 3SQMA 2ADOA 3P1JA 3TZLA 2CEKA 2O2HA 4ER0A 3QBEA 4I4TF 1ZO8A 1U7WA 2VP4A 4JH0A 2V7PA 4JLWA 3KOWA 3BAFA 2OCGA 2V4UA 4ENTA 5A3RA 1RYNA 3JQFA 3ELDA 3I2JA 3ET4A 1W4LA 3DAYA 4J9NA 3GQCA 3GTPA 3I42A 1PZNA 3CKLA 4RA6B 3HXQA 4R41A 4BVGA 4Y6QA 5AR1A 4MVJA 3U80A 4BVLA 2XVYA 5FL7A 1CY0A 2Q6KA 4NMHA 4M9SA 2QZSA 2H59A 3ESDA 2OV2A 1O0BA 4RIFA 3U4HA 5HE8A 2ZBVA 2XE4A 4X91A 2D1QA 4M0EA 1VCMA 4QA9A 1J0CA 2C4NA 3FCCA 4Y2TA 1Y3AA 1XNGA 3WIBA 4BQQA 4XGIA 7YASA 1JE1A 2P4QA 2HHHH 2MR6A 4UNIA 3K32A 4OYHA 5BMVA 2OL4A 4NFSA 2REBA 3CMMA 3NT4A 4P2GA 3W2IA 3MCZA 5EXSA 1HQDA 3A4IA 1OH8A 1EDDA 2EJTA 4PNPA 3DG9A 3W78A 4S1TA 3S2YA 3TEKA 2E5LB 1X80B 4H59A 2WG0A 2F1RA 3THOA 1GKUB 3A1CA 1P0PA 3GCGA 4CTNA 1YFKA 4CLEA 1GADO 3A4VA 3N2GB 2VQDA 4HEQA 1HLDA 3ITNA 2VDJA 4FE7A 1RZVA 4IWNA 2FE3A 3BH0A 2QUKA 3JYQA 4AF7A 1NF9A 5BV1A 3WYBA 1ZISA 3F5SA 3IE2A 3TPCA 5L3RA 4BLOA 1XTQA 3HVJA 1VJ5A 4H16A 4QBHA 4L5JA 5KFIA 3TBHA 2VDVE 3C43A 4X60A 5CT4A 1TZJA 5EIWA 2C7BA 3AGQA 3VH1A 5DU2A 4FM9A 4I1SA 5CB4A 3NDJA 3PFGA 3VC3A 2ZZMA 4FMBB 1E1CA 4J90A 2VT7A 1CRQA 5JE8A 4AUNA 3T1NA 1CB7A 3RB0A 4P8RA 4YWHA 4AJPA 2XCLA 3QSGA 1PDOA 4GMGA 4K8RB 3D7KA 4RFSA 2N3ZA 3K16A 3HI6A 3SHOA 4NV1A 1M34A 4Q9NA 5CFOA 5EXTA 5CITA 4FOPA 2C00A 5CMLA 2A35A 2NTVA 3RUHA 4A4DA 1AGPA 5AESA 2CFIA 2E9SA 4ALIA 1PUXA 4DQLA 4F85A 2C2MA 5FBZA 2ZP1A 1M2EA 1YI8A 3B8HA 2EJVA 4WOCA 5K51A 4YRIA 4YV0A 3TRFA 1BKSB 1G17A 1YMQA 1DFGA 4TLMB 2FN7A 5TS2A 3W34A 5JVLA 3IP5A 2Q5LA 2ZRDA 3PHJA 3R5HA 3FKIG 5A7GA 5B36A 4DV0B 3DMRA 4ZRDA 3KKOA 1DC3A 3WWIA 5KG1A 1J33A 1LKZA 2AMVA 2CXSA 1A7UA 1QH8B 2O1EA 1OWPA 1J2UA 1GA4A 1QQ7A 2QTGA 3CUYA 3I0ZA 4LY9A 4PHHA 1MW9X 3VNBA 1CNMA 4DUPA 4Y0VA 4DR1H 1XAJA 2YV3A 1C9NA 4BO8A 1AUOA 4ZEVA 1N2BA 1U8TA 3OTWA 4ES6A 3LS2A 4WMLA 4UHFA 4CTJA 4DV3H 3OKCA 2JCBA 1N6OA 2YX1A 2QSYA 1FMFA 3OC0A 1G20E 1MJGM 3QXGA 4F06A 2Q6TA 4AK9A 2G8NA 2O0MA 2ZJ0A 1JDEA 2E6KA 4LRSB 1NMYA 1PWHA 4R1MA 5AHXA 2NAFA 2DPLA 4ZAWA 3TFWA 2O8CB 2XH8A 3BB1A 3JAKA 4DIFA 1QFZA 3V1NA 3L8CA 3FNEA 4QDOA 2FN8A 2QN7A 2NLOA 3TUZC 3WLHA 3OE5A 3OOYA 4HUJA 3HKZE 1RT9A 3LBHA 3ZWXA 1W36C 3T4PA 2AG5A 1BX1A 2WMDA 1KZ9A 2YBDA 2DTDA 4M1QA 2PL9A 1EFDN 1E94E 4J7CA 1C3OB 1CCWA 3REQB 4IINA 4R71A 5JR3A 5JXWA 2ZU0C 1ENZA 1E6EA 2PGAA 1SM4A 4JMPA 4BDTA 1LQTA 4AO6A 1DQPA 3DLTA 2TMGA 4J16C 5HRUA 3E22B 3CX4A 1OZFA 3VSBA 1OH5A 4RF2A 4YO7A 2WB4A 3DLPX 3HBLA 1G3RA 4PS0A 2P6OA 4GHWA 4ALJA 4OA5A 3T9FA 3FDSA 1JYFA 3H40A 2XGGA 3F2IA 4R2JA 8ABPA 1YCHA 3ST7A 2DFKB 2W6IA 4M0DA 3FMGA 2Q6LA 1OVMA 3KVVA 2PKRA 2WD7B 1U6JA 4FYVA 4DVJA 4XX1A 2YV5A 3G9ZA 4TROA 1CFZA 1NULA 3V34A 5C46F 3GROA 5TY0A 5E6UB 1EVJA 4X62H 1E6CA 1SWWA 5MN4A 3LIPA 1JGTA 4GI5A 2R6GA 3ILXA 3IXLA 1U3UA 3UN1A 4BJ6A 1VMIA 3RS9A 4D9MA 1D6JA 4XSVA 5K3CA 1U1EA 3Q8RB 1USWA 1P6QA 3GGOA 1NBAA 3F74A 4XX0A 5GONF 1QJ4A 2J3HA 4UFPA 2HLPA 5EZYB 1KJQA 4WY8A 3SZRA 3L06A 1H2FA 1S2GA 4Z9YA 4HQFA 5TDHA 2ROQA 2XZPA 4R3WA 5CIYA 4HXYA 2ZWMA 2OBNA 1S0NA 1OYYA 2P9ZA 4B3RH 3TTUA 4DV5B 3NASA 3QPUA 4OSPA 7REQA 3J81k 2RGBA 3AEQA 3O73A 3WA7A 2EERA 1RIFA 1MGPA 3I2YX 3PENA 4OCZA 5HILA 4FN5A 2BE9A 2P9EA 2F8LA 5SY6A 3E35A 3TAXA 4E1VA 3V6MA 1CUEA 1GEGA 1VYVA 3Q7RA 3R6TA 4G4SP 1Z2OX 1DAGA 2QLNA 2Q0XA 1G291 1PYOA 3R5XA 1ZINA 4NQRA 4RHEA 4XARA 4Y2HA 3T7TA 3ZBTA 5I9IA 5JS1A 2FW0A 1Y89A 3DFMA 4CIDA 3IEXA 2TRSB 4C4ZA 1C2TA 3UYKA 4BJHB 5KNCH 1DC8A 3IUJA 2QL7A 3AIOA 3ZLVA 1JQDA 1JYSA 2HCJB 2ZIGA 3D8HA 3F2VA 2EFJA 4GT1A 3K9HA 4MEJA 4RD0A 5H82A 4ZXPA 1XUOA 5HTKA 3UT0A 5IEJA 3I4NG 2EARA 3IAM6 3LD9A 1Z4IA 2CNKA 5LQCA 4TWJA 3D1JA 3CJQA 4M9CA 2HSGA 5TQJA 3FWYA 4WNCA 2ZYRA 3VNQA 1X39A 4BAUA 1GOTA 2I66A 1FL9A 4OB7A 4ZCMA 3LOQA 3DR3A 5C9ZA 3R7SA 1O97D 3R75A 3RAQA 3N0RA 1CZUA 2CMHA 2CKMA 2PWYA 4LNUA 4TMKA 4AO8A 1NHWA 2FFAA 1GTG1 1NIPA 3BTUA 4GD3Q 1QHNA 2IPMA 4JASB 4ZOCA 1ZCFA 2A78A 2QRNA 2Y4OA 2GBLA 3RF7A 2EZ4A 5LOVA 4QVKA 3B3FA 2AT1A 2AL7A 2CJWA 3IT0A 4FS8A 3TY8A 2NO4A 4QEKA 3P0JA 3R20A 2LTAA 5TPWB 1UP7A 3BGIA 3N2IA 3WQBA 2DBQA 4B7ZA 7MDHA 1QB8A 2JJYA 5KYTA 2OHXA 3IERA 4YAEA 2GM4A 1L4KA 1COWA 2DXIA 2MINA 3B5IA 4NPHA 1UZMA 5JD3A 5I7SA 3S5JA 2BM8A 2XSZD 4M9ZA 5AIBA 1MX1A 4C7OA 4PSVA 1SC9A 2B3DA 4R8VA 3LC7O 3WQQA 3CXRA 2IBTA 2BW0A 2I22A 2IP2A 3HXKA 4POAA 1OV4A 2J67A 1CUHA 1H6DA 4CWAA 1DFHA 5B6JA 3CINA 1S2NA 4NLLA 3L43A 5IUNC 1G5FA 1S2OA 3TFQA 4NV3A 3RNOA 1TM4E 2G6TA 1Z2EA 2WU1A 4EHAA 5ALYA 1U8FO 2NNLD 2Y77A 1CZNA 5TNXA 4DSTA 4TSFA 1MUUA 4GZ3A 4V2UA 2QV0A 4OO3A 3CZ9A 2GERA 1GXSB 5DSTA 2P9HA 2X4IA 1RJFA 2R7MA 1BQ3A 1MXFA 2ZBRA 3RKRA 5ICFA 5IAAA 3A2LA 5KFOA 2QR3A 2JI4A 1E7MA 4NJEB 4NE2A 3X2FA 1QF9A 1A8QA 1GZ5A 1DZ3A 1Z2AA 4L8YA 4LRWA 4N9WA 1D07A 4ZQIA 3IDQA 2AFIB 3PGJA 4IJWA 5HUHA 1F0NA 4JVSB 4RZQA 2R0QC 3L84A 3H9EO 2Q7DA 2C97A 4HFNA 3PLAE 4AZVA 1O96B 1U7DA 1U3GA 3RFXA 4TX1A 4CQMB 1RLTA 1C9DB 1NU6A 2YIMA 3L8HA 4KQJA 4EA7A 4B6JA 4CHTA 3A1FA 4XDZA 4XJVA 4XWWA 3ICQB 5CPFA 1C7ZA 1NLFA 2YXPX 3PW0A 3OPYI 4GX5A 4J94A 5BRNA 3MYYA 4JOBA 3SEQA 5DHAA 1EVLA 5LMZA 1SD2A 4YNBA 5KT2A 3B7PA 3EMDA 4UAGA 5KNBH 1VAJA 5KFRA 1XI2A 3NDRA 1UMDA 3WNCA 3GYGA 3RBZA 1MF7A 5IBQA 1F0KA 1B00A 3ILVA 3AHJA 3KR9A 3PWSA 1PFVA 3EGWA 3N39C 1EA5A 2W9AA 2BOVA 1U3VA 1J39A 1D2RA 4JK3A 2ISQA 5KFFA 2W6ID 2X40A 3E4DA 1VFNA 1YNSA 4TN1A 1C3OA 4BQSA 1LV7A 1WDTA 1GT6A 4JR0A 1OWTA 4G63A 3LVRE 3TLJA 1HYEA 1RK6A 2F55A 1MOZA 5F9MA 2C31A 2CNOA 3M9LA 4IJQA 4LXYA 5AUPB 3Q8PB 4JVNA 2VF2A 2NAPA 1OC4A 5T41A 3P2IA 1TL7C 1SUSA 1W87A 2YDYA 3K1ZA 4LOJA 4RANA 4TL6A 2VQ6A 1ITZA 2DFVA 4QVGA 1IZ7A 1XLWA 4WX2B 1H8ED 2VEDA 3DV0A 4OQXA 3OQHA 4BTVA 2NUTB 5IXYA 3FVQA 4B33A 3ABIA 3Q0IA 2L82A 4MNTA 2FMUA 3BILA 4GSLA 4LYDA 1C30B 1S8NA 1M2GA 3RJMA 4V02A 4RCYA 5FOVA 3ZGOA 5E4FA 1UK8A 3G5TA 5ITSA 4GYWA 2VHWA 3SK0A 3EGVA 5DTJA 3R23A 1SBNE 3AF3A 2VNHA 1YE5A 3DZBA 4PU0A 5HF5A 4UM9B 2QRMA 1HSZA 1RCFA 2NTEA 3HDJA 1FU8A 3CT6A 1K88A 4PICA 4YJ2A 3BWXA 4EEYA 3FCAA 2JEIA 2PFKA 1XVTA 4KOAA 2QR5A 4YAFA 1WXDA 4MROA 4C9BA 5BV2P 4MDEA 2BTEA 1SNYA 2V3VA 2XDQA 2ZTSA 3OQIB 3QY9A 1II9A 3S5UA 1WS6A 3ZQKA 1B93A 2XNSA 4NR0A 2QM7A 2DUUA 4JL8A 3GEIA 5FPYA 4RACA 1NVVQ 2XUAA 1B14A 1POXA 4QWAA 1RWQA 5CK4A 3IAEA 1PV2A 4PYOA 3R7LA 1ZSVA 3TTTA 1LW7A 2XXBA 3M9NB 3KQHA 2VWQA 1GU1A 1S5PA 1Z5PA 4PGHA 1UOPA 1YV9A 2A5GA 4BLTA 1QK5A 4U9UA 4PONA 3U19A 4MYTA 4YUVA 5GM1A 4YCMA 1IHYA 2GPAA 2IYFA 4J9QA 3KYIB 4QO8A 5HFNA 1E9DA 5BN1A 2RAVA 4KZPA 3GLSA 3TN7A 3QMWA 2BD0A 3GVXA 2VRCD 1X7ZA 5CURA 4U0JA 3UK2A 1PJCA 3GTGA 4GKKH 1LTQA 3W06A 2VXYA 1J0DA 3E9MA 4CYMA 1NQXA 1UXJA 1V37A 2E82A 2WWTA 4K81B 4YAWA 3NGMA 1XO1A 1ENYA 3FHJA 1KO1A 5J2TA 4OUDB 5T4BA 4RULA 2AC7A 4FQ7A 1Q7GA 3FJOA 3UB3A 2R8HA 3N6RA 4E12A 1P44A 4F9GA 1FU7A 1NVBA 1CUDA 3WSTA 2FJUA 4UUQA 3NWOA 3LI2A 1COWD 4BRUA 4NCHA 4S04A 1MIHA 2HIVA 3C0FB 1Q74A 1T4MA 3IRUA 2C9BA 3UOAB 1Z17A 2CNDA 5CDGA 4Z1MA 1Z4KA 2GZ2A 2EYUA 2EBUA 1A77A 4HLNA 4QIHA 1NPDA 2ZVJA 4KU4A 4GR4A 5JEEA 1V5WA 2A7XA 1V8DA 2VR1A 3OWOA 4TSRA 4ZVKA 2R1VB 4Q1AA 3F3YA 3G0BA 4R40A 1ZD2P 1BJRE 1ZW6A 1KS2A 4K6CA 2HYIC 4I3HA 1JKJB 4TKUA 3DAGA 4CIWA 2ETXA 3UIEA 1G4AE 4HH1A 1RPZA 4F92B 3O3OB 3G5UA 4DDTA 2D5BA 2Z0MA 1RYEA 1L5QA 1B42A 1O7JA 1XT6A 5JSFA 1WTCA 2YZ7A 3K0FA 2JAUA 4NMLA 4DYVA 5EPOA 2X0KA 3V33A 3CF2A 2WTFA 1N1MA 2EHJA 1YJAA 4P3KA 1NMEA 2F2TA 1B33N 1FDUA 1VIAA 4OAPA 3WLNA 4CG1A 1QE5A 1Z28A 3M6IA 4YJ2F 1QOZA 4IGIA 2ZI5A 2RHCA 5EFZA 3TB4A 4FZJA 5MN6A 1WBBA 4IDPA 5TMEA 2E5WA 2REOA 4IIDA 4HTAA 3RF2A 2P1RA 3KHSA 3OQMA 2HGSA 4M1SA 4FLFA 2AFHB 3SX2A 3AW8A 2ZT7A 4PGAA 2HWWA 5I7HA 5BPHA 3LKZA 1T0IA 2GEKA 1IM8A 1JL3A 1QS0B 3RKSA 2EGHA 2X41A 2BFFA 3IQGX 2VA2A 5EHNA 4BMVA 4QVIA 1MU0A 3CY6A 3KKZA 3P20A 4REMA 4MVCA 5TXGA 3SKVA 5JSUA 2NX2A 4X1YB 2MYTA 1ZITA 4Y0NA 3RLIA 5JUWA 221PA 3IMKA 3NH6A 1MH1A 2Z6UA 2W8KA 1G7SA 3NM5A 2FMHA 1P62B 1KH2A 3Q2OA 2BY4A 2ZG6A 3ETLA 4JT2A 5DBEX 3ZE8A 2X0EA 4Q9JA 3S29A 2C99A 4HQ6A 2FLLA 2BSXA 2R44A 5KG5A 1AN9A 3FI0A 2PX3A 3GFRA 1VJCA 3GFPA 3OCCA 1RKQA 2IY8A 4MUMA 3RS3A 1E0JA 4JQYA 5JNRA 2ZB3A 2EZUA 3CRNA 3LWDA 5HUQA 2QTHA 4XUDA 1DAFA 2XHZA 3H04A 4YJHB 2VEOA 5A03A 4QLOA 1NY6A 5B3JC 5HF9A 1G8HA 3H2SA 2GEJA 4BVEA 2HQOA 1XYYA 2YWBA 4IDGA 4WLFA 4HNGA 5AOCA 3QEBZ 1QGZA 1JSCA 4YAGA 3CSWA 1RYHA 3EVNA 1IQ0A 1H8EA 3FHOA 5KG3A 3EHDA 3KSUA 3A6GA 1PL8A 4MKXA 3WLFA 2H85A 4QG7A 3KC2A 1P7CA 1Y80A 2BAGA 2BR5A 2FHSA 2SKDA 2XE8A 3BJRA 3C87A 4PC3A 3AVVA 2FETA 4R2HA 3T1HH 5ENZA 2V6IA 3U5ZB 2YU9A 1ISSA 4QDZA 1OZAA 4XCXA 4CR8A 3MHTA 4E70A 4W99A 1VLZA 2FSFA 5KIAA 1SZCA 5D1OA 1AGYA 2VUTA 3CWZA 3RRYA 1EUCB 2WE7A 3U3JA 5A04A 2XEDA 4TM7A 5LQAA 4JLAA 2YXLA 3OICA 3QPCA 3MFYA 2H2HA 3U7QB 1C0LA 5CDFA 3AETA 5FRDA 3GJZA 3NAZA 3Q0EA 4IHQA 2G06A 4PHGA 3TINA 1LCIA 1OWLA 1XWWA 1RM0A 1TVKA 4NI5A 5L7WA 1QK4A 1U4NA 4NQZA 4R2KA 3JD1A 4BWYA 2ZGVA 3OLVA 3FPEA 3GGJA 3H1TA 1MT3A 5GONB 3GAMA 4ROTA 1M3SA 1ZNYA 3D6NB 5J9FA 1KJ9A 1V9PA 2ZVQX 3B2QA 4TYPA 4IAJA 2BTQB 3Q11A 1DXYA 1MVLA 3C6YA 4RJIA 4WLEA 4BP1A 3IL2A 1I7DA 1NNEA 3PW5A 2J3IA 1IXZA 1JSRA 3CQZA 3TI9A 3V2IA 3GZTB 1H2AS 2W6QA 5KTRA 2PL1A 3OZVA 1GFIA 3ZDEA 3N76A 4D6XA 3GHYA 4TVBA 5KOIA 3K6SA 1PZEA 1XDGA 1G63A 4WNAB 2I03A 4RENA 4JLKA 1ORDA 3DBOB 1H2EA 4HR7A 4F93B 2F1KA 2NZWA 3C4JA 5LMUH 5ESRA 1X1DA 2I34A 2QE7D 3O8OB 3EARA 3NTOA 4TQ9A 4WCVA 3RYFA 4M9UA 4LA4A 3OE4A 4RW0A 3BE8A 3O93A 1BWRA 3SIXA 4YHHH 5DG8A 3F6YA 3TDMA 3I61A 1AB6A 4EJ2A 2DSTA 3WAJA 1ICEA 1J0AA 1R1DA 1F2UA 3A8TA 3DE3X 3L7CA 3CS3A 4LY3A 4JD5A 4UDNA 2DWQA 1BOFA 4OHFA 2HPZA 4D0NA 2NVYA 1QCZA 2JAOA 3E15A 3H18A 1XK7A 4YRPA 3QXJA 1J90A 3TW4A 3QG1A 2DWOA 5ALKA 1L4YA 1SQGA 2JFHA 2Z4RA 3CF4A 5C31A 5JD6A 4F9FA 3BRQA 4R9NA 3L7AA 2FRXA 5JXIA 1XRLA 3BXGA 3R2JA 2M1XA 1L7DA 2YICA 2HLDA 3AVPA 3KJGA 1PVOA 2IK8A 4MV4A 4CVNA 3NIBA 2H3EA 4LFBB 2OHGA 4OHUA 3PGA1 3TBKA 4G1MB 1KEVA 3UFXB 2H1FA 3PPWA 1YKFA 1R0ZA 1UPFA 1T4DA 2XXJA 3B51X 3E9RA 5BW8A 2OCLA 1IOLA 3IOCA 4AZSA 2R8BA 1DKQA 1E4FT 2WWFA 1IWBB 3ZV7A 2LDBA 4ECXA 2YYZA 1SQ5A 1W4RA 5BQFA 2Q5OA 4CKWA 1FW6A 1FU4A 4NNPA 1X3SA 3DOOA 1BXZA 2I1WA 4DR5B 4JA2A 4WADA 3I45A 1UMCA 4E2WA 1PFGA 1FVHA 4PX3A 3E3OA 1RIIA 5DM0A 3RYHB 2HWYA 4M0JA 2NNWB 3D0KA 1MMFB 1XNQH 2E1PA 4FFRA 1UBJS 4RBNA 1QXSA 1X74A 2WJAA 5C34B 4AWXA 3FLBA 5JNLA 2N1MA 4KR3A 1WXQA 1VS0A 8ATCA 4DRXB 1K7CA 3IMEA 3WO1A 1U5AA 3O38A 1U0LA 1AKMA 2ZTLA 4RA9B 1GRNA 3GV0A 1R8QA 3GUHA 2DABA 5FP0A 4B74A 1V95A 2E5LH 1F0YA 3CRVA 4BBJA 5EC8A 1TCAA 1F9EA 3TLBA 1RNLA 2XT0A 1F8XA 3OF3A 1UKAA 4MQLA 1ISJA 2WF9A 2FK2A 1Z75A 1PF7E 4CIXA 3PLNA 3FOEC 4CLRA 1TK2A 1Y1QA 4OTZA 1UJ6A 2W8ZA 5AW1A 3R09A 3BMOA 2GS9A 4TTPA 3RBVA 3WKBA 1GTVA 3HXLA 1XMIA 2P3SA 1Y7IA 2XUKA 3EVZA 4RLQA 1CR4A 2JGIA 1RQNA 4JI0B 3N2LA 2N75A 1EWTA 1H8HD 3HJUA 4QUIA 2X5XA 4RZUA 1C8BA 2FMFA 4GEGA 4ZOAA 3WV4A 1XNQB 1PBTA 1UPAA 2R5FA 2CLMB 4UHEA 3GMTA 5DEOA 1DCFA 2PA0A 1CPYA 1HLPA 3HU5A 1ZK4A 4GXRA 1WB6A 2XGQA 2XHEA 2J5RA 2ZBUA 3AR8A 2QN1A 2X2EA 4Z8YA 3CISA 4X1KB 2MTBA 2DB3A 5H9VA 5KAMA 3OJEA 5AM0A 4G5RA 2CSXA 4BV8A 3I58A 4UULA 3VSDA 1E3JA 1YL5A 3JARA 4PIMA 5DG9A 1HM5A 3VHQA 3QXCA 2YMQA 4LFBH 2XWSA 5JAOA 4LF7B 4KHPB 2H4YA 3CEHA 1CJTC 3A6KA 3FCEA 3TMAA 1HNWB 4AN1A 1Z5ZA 1DDIA 1RYFA 2P7HA 5DM60 4LC1A 1BYUA 2RSLA 3CFYA 4MKFA 3UA3A 3HRIA 2C3UA 3WJ1A 1TIKA 3H5WA 2XADA 4Y1GA 3SC2B 4DJJA 4NYMR 1Y5MA 2QSZA 4OM7A 1KI4A 1JI3A 1YH3A 4Y8VB 1ANKA 5DM4A 2ERYA 3M89A 2YHSA 3P2YA 4IP0A 3R9IA 1E7RA 2NQ8A 2PKQP 3PHGA 1QSGA 1EK5A 3R3JA 4KFTA 3BJYA 3NI2A 1M2HA 3NCHA 3E4CA 3QOWA 4M4SA 2P7IA 1XVLA 3NOXA 5BSRA 1DEKA 2P62A 4BUCA 2Y68A 1VB5A 4DKJA 3LUFA 2JFXA 2OCYC 1LLUA 4D1YA 1SXJC 1S01A 4ASUD 1E98A 3H4IA 1T29A 1NLZA 5KI6A 5CFNA 3K0CC 3H4MA 4IQ4A 4KOEC 2HO4A 1ZXBA 5KFYA 4CU5A 3G9TA 4OHWA 1XZKA 4W1RA 4DLWA 1N8SA 3ZR4B 3T3GA 2YZGA 5KWJA 5JSHA 4ZGGA 4FMCB 2ZDGA 3F4BA 2ZTVA 3FY4A 3ZXYA 3LCCA 5KFBA 3CUWA 4L51A 3A3KA 1OX5A 3P45A 3WX0A 1O97C 4NJMB 5FHQA 3HR7A 3O03A 1SD1A 3ZCUA 1FJHA 1T26A 3VYVA 1OVGA 4IEFB 1RRMA 2QRUA 1YRHA 2DSNA 3QVLA 4IIVA 3VR5D 4DJFC 4ESEA 4MSUA 1ZIDA 1RKUA 3PA6A 1ZUWA 2FSVC 3EDRA 1A3GA 3K30A 4FC7A 1ZQ9A 2I8AA 2UDPA 3X43A 4WKGA 3T7AA 3GTJA 2J3DA 2V58A 4ESHA 5A6SA 1FVIA 1M1YE 3SIWA 5EIBC 4CE6A 4XRGA 3OPMA 3B7WA 4MVJP 1V8FA 3L9WA 3UMBA 2NXEA 3KWFA 4JUCA 3A6PC 1WXWA 4K40A 4MV9A 3FLAA 1TCVA 1VJRA 3G8AA 1AX9A 3V8RA 2EX0A 2C1XA 3T1HB 1IPFA 1FZTA 3H8JA 3V4FA 4QPNA 2BI8A 2ZRNA 1G2OA 5ALLA 2ZXEA 1ECJA 5A5GA 5BORA 3M82A 2CBZA 1YCDA 3G2LA 2RMKA 4OAQA 3RRXA 3GLIE 1OXTA 4PVCA 1C1XA 1G6KA 3OSZA 3P0IA 3G17A 4O6VA 5EMKA 3T95A 3WTBA 3NBFA 3STYA 5DGXA 2Y1DA 3T7JA 5E6SA 2VPSA 3CPHA 2XUPA 3KHGA 1IN5A 1NN5A 3PFBA 3MR6A 5CT9A 2XCQA 5HF6A 4B3MB 1DSSG 1N2CB 4L6IA 1BZYA 1M7HA 2DWCA 2FMKA 2P4HX 3EVTA 3ZTTA 4A82A 5IUJC 4ALLA 1K9VF 4F56A 1GA6A 5TR9A 2IIQA 2GBPA 2Q0QA 4LJYA 3IIKA 3HRHA 3TW0A 1OPXA 1ZONA 4TTJA 5JMTA 1P60A 3AK4A 3JQFC 3EEQA 1B73A 1IHDA 4R1QA 2G70A 3HVRA 1W96A 1MJFA 2WDZA 5KFDA 3UMSA 5E1OA 3KVOA 3AIMA 4BRWA 3DE4X 4INAA 2XBUA 3PIDA 4HADA 4BO3A 4X6LA 2PFSA 4MO2A 3DONA 3DQQA 4DJ5X 2PZGA 3DOEA 4I4TB 4M7OA 4DPLA 1FLDA 2VTEA 2WFLB 1EE9A 3E81A 3T12A 1DJQA 3PXUA 5KTOA 3TTSA 5ICCA 1LNSA 3C7DB 1MAWA 1M5TA 1E64A 2LIPA 2PMDA 3R3SA 1DJMA 1KDPA 1C3VA 1FRNA 4HRXA 2OHFA 4FJ1A 1WXIA 1ZWLA 4M89A 5JO9A 2CLLB 3AONB 3VFDA 2GM5A 1GCOA 3Q3VA 2PGXA 4HDSB 1G2WA 3MS7A 4I55B 3SYMA 5KSZA 5KNDA 1L1EA 3USZA 3O8BA 2PS9A 1UUFA 3QM1A 4TL9A 1M6NA 2FTKE 2JEZA 3VPGA 6REQA 1V4NA 3EQZA 2DAPA 2C5FA 5G02A 3V3KA 2P9BA 2HA3A 3B3QA 4I9GA 4DLPA 1M34E 2V8BA 4A6PA 5LKAA 3JQRA 1YFLA 4RO0A 4TL8A 4F2HA 4YRKA 2ZOSA 5KS2A 5ALOA 1KY4A 3Q8LA 4AU1A 5B64A 2EFDB 2FJPA 2HRQA 2LW7A 3ZGLA 5G0TA 1X7YB 2IZ6A 3AEUA 3B2NA 3RRNA 4EPVA 1KF0A 3O83A 3NBYB 2H54A 4RGQA 2OGWA 1KIFA 2CF6A 3K0AA 3PFFA 2H9IA 3BXXA 4WK2B 2JH3A 1YBMA 2R97A 3BERA 1TC2A 4WZ6A 5CUQA 4EBBA 4YLEA 2ATLA 2Q1YA 1U2QA 1GLNA 1H5QA 4TQUS 1GKIA 4DQDA 2A1TS 4PAGA 6YASA 3L0PA 3PEWA 1JRLA 4PC7A 3LZDA 3KAKA 1JSZA 3PQ5A 4ZCLA 5T4EA 1NLMA 1BDIA 3EJ6A 4Y1EA 4ND4A 4WOPA 4QXRA 5JPIA 3ZBPA 4OREX 1N9GB 2YFYA 4DR7H 4GBED 1KP2A 4FOLA 2EBFX 5AVOA 5JCOA 4C3ZA 5B3KA 4JWKA 2AFVA 3GMIA 4RE5A 5C52B 2HMSA 3K6KA 3KDSE 4URUR 1Z0KA 1TKCA 2ZCVA 5YASA 3RVJA 5T8KA 3P2OA 5EINA 1SBCA 3DE0X 3OQVA 1KETA 4CPDA 3WAGA 3JVVA 2H51A 2UZAA 3I5AA 4QXOA 4R2WA 3WBJA 2VA8A 3PRYA 4C5BA 3GTOA 1DX4A 1ZD1A 1KYIA 1J22A 2I71A 4KLCA 4MUHA 3RB8A 2EX1A 4YIHA 3WMFA 4BNFA 2CYBA 4B6RA 4ECEA 4JV5H 3FNGA 2XXAB 1EK2A 4L9SA 3GILA 1AQ6A 1E3DA 2H0QA 3S4YA 4BMSA 4RMIA 2V97A 4MP3A 4KQEA 1F0PA 2PGJA 2XQJA 5H80A 1RCTE 4U6PA 3WGUA 1KY2A 4RNMA 3A04A 2RGNA 2O06A 2XGSA 2CHGA 1FP1D 4HAIA 4JBYA 3LQQA 1PZFA 3PKJA 1NJGA 4QNMA 3SN6A 3IP6A 1JEOA 3KYDA 4GZ6A 3ZH9B 2WJYA 4F86A 5LL6b 2RHBA 3G0GA 3VR5A 3RRBA 4KHZA 4DIOA 3PUZA 1EGHA 4EKGA 2B6NA 4Q66C 2K4MA 3UMGA 3D1VA 4J0CA 3X1DA 3Q3JB 4L5AA 3GJ8A 3KWLA 4XQCA 3AHEA 2DM6A 3NGLA 4JWTA 3RT7A 4BQNA 1NZJA 1JEAA 1UZUA 2IFTA 1DO0A 1L7NA 2P4UA 4MUKA 1LSJA 1PR2A 1JTVA 2PM8A 3SM9A 1JKXA 2FXVA 2OFWA 3PHIA 1QRSA 4JC8A 2IEYA 5CCBA 3DDNA 2GQSA 3WVNA 3AYHB 3QKRB 3HBJA 1JBQA 1DBSA 1DBVO 2HQBA 2X4LA 3C3JA 2HK8A 4LQLA 5B1YA 2FW9A 1L7XA 2PK3A 4LZLA 2ZRHA 5EA2A 3CZPA 5THQA 4B9AA 1U02A 5C53B 4DUYB 3KXLA 1C0KA 3QW2A 4ITVA 4M7WA 3E3NA 2G5GX 4ZREA 4B2IA 3CVXA 1R9NA 2GK7A 2JFGA 2QRKA 2WVAA 2G28A 3VPSA 1OH7A 2UYCA 1GVHA 3E5MA 5JY6A 3AJEA 2QT9A 2I8LA 8AT1A 1EJ0A 4Y8VA 5JALA 3LKVA 4MITA 1O4WA 4NG4A 4AG5A 2GUWA 4F71A 5FPRA 1U0FA 3B82A 3COYA 3P9SA 2ZREA 1XRMA 1W0JA 3M33A 4X65B 2QT0A 2J0UB 1WUHS 4EUEA 1I6LA 4N01A 3R3ZA 4A2WA 4EGJA 4CGYA 1ODIA 3LJKA 4MQFB 5KCZA 5L7YA 4ENWA 5C5DA 4OLAA 1SCQA 2QAJA 4G6ZA 2IEGA 2ZRQA 1IBLH 2OPBA 2O7QA 3GAZA 2UZIR 3CT4A 3EDMA 3HEMA 4JI3H 2OAGA 3KVYA 2ZWVA 5ECWA 1RQ2A 1SRRA 1ZDMA 2AOVA 2C5AA 3UV7A 4F2DA 3IESA 2VAXA 6Q21A 2OV4A 3JYPA 2B30A 3F5QA 3OIDA 1AHIA 1PR4A 5DX8A 5EP3A 1JVSA 3CX8A 4RHFA 2D62A 2GN6A 3SGLA 2HLNA 3AI3A 4JYZA 3C3KA 4R5HA 4K7JA 4TTVA 3MXOA 3REFA 3P9ZA 4MV7A 5C1PA 1SVLA 5DYWA 3OZBA 1YZHA 5TQ0A 1WNFA 2C2BA 1YDWA 3ACBA 1VPWA 1X1AA 4S12A 3ICWA 4YA6A 4MR9B 2OZEA 1IN7A 1DIHA 3KZMA 3UAXA 2IA5A 3H75A 1W2GA 5C3MA 5L53A 2PD4A 3PEFA 4R9RA 3RI3A 4ZI7F 1SCBA 4ZKEA 4JI1H 3H6HA 3I52A 3KKPA 2P6UA 3RGZA 1E4VA 3L3BA 3QVKA 4OMUA 4XWTA 3VU8A 5H9WA 4LC0A 3DVLA 2XRZA 2B99A 3DOCA 3LFHA 1SN7A 3AKDA 1LBHA 4J0FA 1N5KA 4JUDX 3ZW9A 4F12A 1SUFA 3TVDA 4AJJA 1AKEA 3OZUA 4V0RA 4RTLA 4YAJB 3S24A 1KOJA 2D1TA 5EZQA 1N5RA 3QKTA 1DQNA 2C5BA 2P6NA 4IOMA 3ZE0B 1NNI1 5EXDA 5A62A 4IBOA 4L76A 3WHLA 1Q21A 2IGBA 8OHMA 3SZMA 3TSOA 1W46A 3VJKA 4JXJA 3OEED 1M9NA 4MQUA 5AVSA 2VDWA 2RC5A 3HP7A 5FBLB 3C15C 4KAAA 5IARA 1TPYA 1NJ1A 2ANBA 1CY4A 1YA6A 3DF9A 4NEGA 4U7FA 1VXOA 4IHJB 4PN7A 3SBEA 3EXIB 5DBIA 2OAP1 3S2GA 3CLRC 1Y7HA 1W35A 2JZNA 1WMAA 1V16B 4EHHA 2AUTA 4LDRA 2FXIA 3VZBA 1WRBA 3FAKA 1X0VA 3NYIA 3PCRB 3WS7A 3NV9A 4GM0A 4MWOA 2Q0HA 3GG9A 2K2WA 5LU9A 1QGAA 1W4AA 1P7YA 3GH3A 4GNRA 2BEVB 1Y6JA 1YB6A 1YIOA 4DV6B 1IN1A 4QJ4A 1W49A 1CYEA 3D43A 4GPBA 2VA9A 3K8QA 1OLUB 2GVDC 3OIYA 4IG9A 5HFAA 4YFVA 3AZQA 3GXBA 4W5WA 1XEWY 2NU6B 1UXOA 2CUZA 2E4VA 3NHPA 1LVGA 5CFLA 5T64A 4QZVA 3JSLA 3MBKA 1FX0B 4HDSA 3ZX4A 2VRNA 3NT5A 5JXJA 2E3JA 3X1YA 2YY7A 1EB8A 2G76A 4PFKA 4RC9A 4YMUA 1K8YB 1BS1A 2DPHA 2VQEH 5L1IA 1CY6A 3CA8A 1W9HA 1AA6A 3BGSA 3ESZA 3FBGA 5EIOA 1TJ3A 4MZDA 5IASA 1TRHA 4I50B 5I4BA 4P0QB 5EMJA 1CUFA 1JG2A 2I7TA 1ZC4A 2WZDA 1U8UA 3N8KA 3PI7A 5DNWA 3ZU2A 3ZGZA 1AK1A 2OGZA 3DEZA 4UHHA 1X8XA 4X85A 3WG9A 5LBIA 2BTQA 1NYLA 1PT7A 4GLLA 2NU9B 4KGVA 4A1FA 1DAOA 1P4HA 1CXZA 4X62B 2BKXA 2C57A 2J4FA 2Z1DA 3RC2A 1YC2A 3I4CA 1QJCA 1XVUA 2GI4A 4R8MA 4YHHB 5E0OA 3HCNA 4FFBB 2FSUA 4GC6A 1QG2A 1TT5A 3HKBA 4EEZA 3K9FC 2H52A 3U49A 3UAWA 2Q21A 5ILOA 3O3MB 4Y9SA 4E2ZA 1TA8A 1NKSA 1T8YA 1QOPB 2ADFA 4A2PA 1DB3A 3M5WA 1BS2A 1DAIA 4DQKA 1I7NA 2AQIA 3LT1A 1E3LA 5I51A 1DQYA 1QHSA 1SB9A 4PCUA 5D51S 3U3KA 3QNUA 3WMRA 2IXTA 4OXKA 1A5ZA 4D8YA 5B57C 4L95C 1JEQB 3BJMA 3R76A 4DYHA 2G4LA 3FYUB 5AKZA 5AQ1A 1EBBA 4LXXA 1M1NA 3EAFA 3FCXA 1LTKA 5KYUA 3DMPA 1T2AA 3TG2A 1C3XA 4QLAA 2KE5A 3DP9A 2YJ5A 1MJHA 4H7IA 3N40P 1RZ3A 2NPIA 2YHAA 2UVUA 1E7SA 5E9AA 1CF4A 2OZVA 3DQPA 2A5LA 4B0OA 2AZ4A 2BN4A 1XMQB 1N6RA 3MYRA 3GLQA 1JHOA 5T6BA 2QZ4A 3ZQUA 2A67A 1BS9A 4MWGA 1JEYA 3ML1A 1NM5C 4XEHA 1MZPA 5JADA 4UTRA 3IAXA 1DT3A 1LC3A 2NZXA 3ZC3A 5B6IA 2PRSA 4WL0A 3PVXA 2HU8A 4ZQEA 5D00A 3PXCX 1GSOA 4LSGA 3RV4A 4CE5A 2VP6A 4ND6A 3ROQA 3DEHA 1PR5A 1H9CA 2C2RA 3E22A 2XI4A 2K87A 2QMEA 3ENQA 3EZGA 5E3JA 3TR0A 2CHUA 3TOZA 2L0XA 3O5AA 3UICA 1ZJ5A 4DSNA 4HGOA 4NCIA 1XVIA 5AJVB 1PTJC 3RF6A 2HD4A 3DMTA 1P0IA 2EJ3A 2ORED 1IOZA 2J9RA 5DEIA 3I6ZA 2DHCA 1G5PA 3SHVA 4RIGA 3EMVA 1D9XA 1X2BA 1R9JA 4GKJH 1KFBB 1AC5A 2WVHA 2X58A 5FLYA 2AJ8A 4X1IA 1YJQA 4F11A 1PK7A 5I8PA 1E2FA 2O0JA 4TLLB 4DMHA 3CF0A 2DG2A 1NVKA 2JHPA 2ZULA 3LP5A 4OJQA 3IP9A 2DJIA 4LRXA 3N2KB 1CKNA 3AERB 4DA8A 3CVVA 2DPIA 3KU1A 4EWLA 1ST3A 3SC2A 3GIMA 3PUHA 5T3YA 3MTDA 3GUZA 4QJ3A 3G23A 4DMLA 5TT0A 3IIMA 2PKCA 3JWPA 3TQFA 1YDEA 3VZQA 1JKJA 4TKUB 3WJ2A 5DGAA 2OORC 2XTJA 4M8IA 5GOZA 4EBDA 3ROZA 1WMDA 1DBWA 5EFOA 4Q1VA 4C01A 5ICEA 3GLFE 5FB3A 2R1VA 2I6TA 1NXQA 2XVMA 3FUCA 4JLPA 5IAEA 3H11B 4PHCA 1HV8A 1TQ4A 2NO0A 1Y1PA 1M66A 4B3TH 2OV3A 3L0YA 4MTLA 5ALMA 4ENPA 4YCNA 4DQNA 4RK6A 5DGHA 3MG9A 1ADFA 1W5TA 4DMRA 3KT0A 1KTVA 4AJNA 1UJ4A 5L9AA 3TRHA 1GWNA 3LV8A 2ZXFA 2QD4A 5DI3A 3PT5A 4G4SO 2QAGC 3L6EA 3WL3A 3GBSA 2JPDA 4JB2A 3CLUC 4NKRA 3GGCA 4MKHA 1Z0JA 5D84A 4YROA 5CBPB 1NQOA 3N0WA 5AI8A 3ABQB 4DG5A 1WRVA 4G0MA 4OI2A 3VVBA 1ZS9A 2F4VH 1T9ZA 3GRFA 1TAGA 2I76A 1RLUA 1G5IA 4BUZA 2NZJA 1QGDA 3DZDA 1DRVA 4HDQB 3EF3A 4A2AA 1E1MA 1YOBA 3VC2A 5LZ9A 3D3NA 1QS0A 1VRWA 4XPZA 1XC7A 2ZUWA 3LVBA 3M6FA 1I3NA 1O08A 3IGFA 4R1OA 5EWMB 4EPRA 4WBNA 1WKCA 5K8LA 3PQFA 1XCLA 4DRXA 1IUNA 4H0FA 5E1BA 2GEUA 4AB1A 1Y9JA 5BWWA 4ZQFA 3NKVA 5DHFA 1YB4A 5KYGA 5C51B 2P2CA 3HHEA 5IH3A 1NXSA 1ZD9A 1II8B 5KKAA 1WSCA 5ELLA 5A7FA 2XPCA 3PYMA 1V16A 3OKPA 3TLXA 5JAUA 1I9CA 1EYZA 2X42A 3G2NA 2L42A 1LD3A 2A5DA 4LSXA 1CDZA 3NUQA 1BDBA 4G4GA 4MINA 3HXOA 2O3JA 1GEEA 1REQB 3FKSA 2P90A 1SIBE 1O03A 5FQNA 2O7NA 4LMAA 4W8OA 2R6CA 2WABA 4GGOA 4TQSA 3CUKA 2XJ9A 3CR3C 4YBZA 3OD1A 4HAVA 2ZBQA 2ICAA 4JQCA 1AS2A 2ZJYA 3PQCA 4MVYA 1P2VA 3FMPB 1E60A 3UMCA 3E6AA 4FFDA 1JNYA 4J2TA 1OWOA 3EGDB 4NESA 4KWEA 3IALA 1EJ2A 4MARA 3CVWA 4W6QA 5DM1A 1ZMBA 3V1UA 2H1WA 3COPA 4XGQA 1Q7EA 3FOZA 2RARA 3QFRA 4K9KA 2JI8A 4FZRA 3PQDA 2HK7A 3UB4A 2ZK7A 4XJXA 1BFKA 1YL7A 3HBNA 3TTWA 4PYLA 3ZZ0A 2CYCA 1GTRA 4TS1A 4NBUA 3L0IB 3R9RA 5C1IA 3MWMA 1F2UB 1TVMA 3QMPA 4FWBA 4JLJA 1UDCA 3K6RA 4HS4A 3RJ5A 1NVFA 4IH1A 1OT3A 4B3DA 3C7KA 4D0LB 2PL5A 4PPNA 3HOXG 1NN1A 1Q17A 3MD0A 5AXBA 3SZGA 3DVRX 5CJ2A 4DE5A 4F3RA 3IT3A 3LGSA 1QCCA 3TIVA 4F97A 3I6QA 1L5YA 3R3WA 1AXGA 3HK2A 2ETVA 3IQZA 4II3A 3ECAA 3U7IA 4D44A 4E14A 4EFKA 5LSAA 2JNWA 1EWYA 3TECE 5BWBA 1W5SA 7GPBA 5J5VA 4RHXA 2DUWA 4NLGA 1CRWG 1SCDA 1VMEA 3BRWA 2C2ZA 3LL4A 4TL7A 3S1SA 3S2FA 4H4EA 4C29A 121PA 5K8JB 3FIJA 1VBNA 3GZ4A 2Y05A 3ZZNA 1U9YA 2W6ZA 1QWSA 1PGPA 1JEYB 3E8SA 3QUSA 5ALXA 4EO7A 5FPQA 2DQSA 2VYVD 4YRNA 2PGIA 4GL2A 4Z4EA 4X61A 4ECVA 3TXYA 1KRXA 3J81W 3TLGA 4YCSA 5GTDA 1FMJA 1Z39A 2HLDD 4KR7A 4KLZA 3VJMA 2BCGY 3WXMA 5KYUB 3HGMA 5LD2C 3PO2G 3CWQA 2PSFA 2R62A 4BC1A 4A2BA 4XWOA 1J2YA 4KMOA 4YMTA 1M2VB 2JKZA 2A3RA 1C14A 2J85A 4Y9DA 4NCKA 3T9EA 5JCJA 3PD7A 4HDCA 4W7SA 5JMWA 2KX7A 3T7IA 4BN0A 2PUFA 1LXCA 4G5FA 2C7QA 4CQLB 4MGIR 5JSKA 4GOND 1Y3FE 1X8KA 5I7VA 1B1AA 3L05A 4X7MA 4A93G 1J42A 1PT5A 2CNWD 1GDTA 5EP2A 1N5MA 4MW1A 1P1RA 5D5PA 3BIWA 3A3YA 5LC1A 4N82A 1D2HA 4OXIA 3RB6A 1FP6A 1V4BA 2I29A 1M1XB 2XR1A 1L5FA 1OBVA 2A1TR 2Z8ZA 1GUAA 3K1AA 4KKVA 4XR9A 1C7IA 3CW8X 2QR2A 2G1UA 3IUBA 3L5OA 4TTSA 2C1EA 4K46A 3D4LA 5EE3A 1FW8A 5FBRB 2FEKA 1Z82A 4G0YA 4BO7A 3GCZA 1I13A 2DR3A 3GJ4A 1CJBA 3NEAA 5LBTA 5C5JA 1A9XB 2XWBF 4O2AA 3ONEA 1RC0A 1MDBA 1ZGHA 3FGNA 4Z4CA 5JATA 1KU6A 4E7OA 1QIJA 3TQIA 1QPGA 4UPEA 3WB9A 4HAWA 4NU6A 4J3JA 1P5ZB 5FJ8G 4O4JF 2G7MC 2ONCA 1FMCA 3RYIB 2O9JA 3H5LA 3VDNB 4E2FA 2G71A 3HU2A 4LGVA 1Q3TA 3LUPA 5EEHA 3H9BA 1P77A 2HJVA 1Y3HA 1SUAA 4WA7A 5B12A 4MP8A 1T24A 5JBNA 4FE3A 4BO5A 4ARCA 3QG5A 4QBKA 2Z58A 4MOWA 1RWMA 5FTWA 1O5OA 3VU1A 2IYZA 1Q1GA 3WB1A 1CRPA 1P0QA 2VT2A 1FFAA 4RESA 5JIBA 1VJDA 1VI5A 2HF8A 4EAQA 3OIGA 3BWYA 5IWCA 1SVIA 4BGDA 2FZ5A 5BNTA 1WCMA 4KVGA 5CFRA 4LF9H 3LC1O 2GK3A 1NF8A 1NMZA 4LXIA 4HGPA 3WYCA 3M9OB 2WYOA 4CHIA 2GN4A 5C7IO 5MFPA 2WAOA 1VKZA 5G41A 4DSZA 4D56A 5EJ8A 4BFCA 1SUWA 3H9GA 5IJ9A 3QV1A 4DF3A 4LF5H 1U7HA 3BWCA 3UXYA 3HQ4O 5FWYB 1H94A 3P0EA 4KG7A 5KFCA 3W7VA 4EF5A 2PBLA 3NMUF 1UMBB 1WJGA 2A0FA 3CLSC 2OHHA 2ZUCA 4MRVA 4A8HA 1HT3A 4GYYA 2BFNA 3HKBB 3DZ8A 1PFUA 4B85A 3TQHA 3IOYA 3WOHA 3EQ7A 1HDYA 3GD7A 3D5QA 3AHHA 3ERCA 2SICE 1FSPA 4RX1A 4BX9A 1Y9DA 3MJSA 1L5NA 3ZEIA 1JV2B 1UMKA 1TW3A 2PWPA 5KX5B 3EXEB 3QLUC 4JIGA 4LQDA 2O7VA 1UBGA 1PI3A 4G23A 1Z3IX 4FJ2A 1T43A 4NZZA 2JFFA 1IY9A 3AILA 3BD7A 3GD5A 3RC9A 3IJPA 1QPBA 1VKRA 3IEUA 4W9NC 4F3KA 2F43A 2ZJ1A 1D3AA 1NVXQ 4OUDA 5LQJA 2EP7A 4RDHA 4NH4A 1NG1A 3KLNA 4I6JA 4XKJA 3I37X 4L50A 4CJXA 4KDFA 4B5KA 3BBLA 5AW4A 2KBFA 4RD4A 4ZEWA 4IRDA 4DHWA 3M6MD 7ABPA 421PA 4H9GA 4AJEA 5LN1A 3OLWA 4N5NA 1ZM7A 3BSSA 3PEYA 4EYHB 2ZM6H 4IO1A 3U1VA 5KTSA 4P38A 3X1MA 4H7HA 3L8ZA 4RPLA 4Q39A 3ONWA 3UMVA 3IIIA 4IV5A 3NTRA 3OPYA 2VK8A 1OI4A 3BE6A 1MABA 2GGSA 2QVCA 3LBIA 1L5LA 4C0QC 5L45A 3URMA 2UZ3A 1RABA 1TX4B 3JATB 1J9ZA 2QDKA 3A4YA 3CRW1 3PXGA 4HNQA 1DAMA 3VZPA 5JLJA 1D7OA 3GFSA 2XKJE 3REQA 1QGYA 2WHEA 4FWTA 4JP3A 4PGFA 3K72B 1NXXA 4DNFA 2H2AA 1P9NA 2C83A 4I4NA 5IEBA 5C1DA 2WB2A 1RQXA 1JDPA 3G2JA 3UGTA 3ZI7A 4HGNA 1VL8A 1N6HA 3EQ2A 4IGEA 4Q7MB 2CMKA 4BO9A 3BCUA 5AVTA 3WBKA 4QJFA 1V51A 1AG9A 1H85A 2GEFA 1KSFX 2WA1A 4YH1A 3CEPB 1MT0A 4YJ2B 1R5BA 1AUXA 1TJ5A 2Y76A 4D3ZA 3M5DA 1OREA 2VDWB 3JD2A 1T5HX 2I4NA 3TLEA 3AKZA 4I08A 3HUUA 4EW1A 3AM3A 3DO8A 1TM7E 1UODA 4BQFA 2XAUA 4G9BA 1XMPA 4FEYA 5LKRA 1DAAA 3ES9A 4KXXA 1WWKA 1O0CA 2WILA 1HRDA 3OU7A 4PLTA 2WQ6A 3BFXA 5DW3A 3N58A 1N2IA 2UVRA 3F7TA 1ZU4A 3V1TC 5DGBA 1TYEB 2JLCA 4AZ3A 5EKXA 3BB4A 4MLDA 2R85A 1DCTA 5AKIA 3RQIA 4XE5A 2CVOA 2WPDD 2OR3A 4Q9LA 1KYYA 5CU7A 5D1HA 2A1UA 4EG7A 2FUEA 2HWUA 2OC4A 4AP5A 3F46A 1NUTA 1L5OA 2VNJA 2C35B 2JH8A 3NHUA 3NB0A 2QB5A 2FFJA 4DCNA 1FFDA 2Z57A 4B7XA 3HKCA 1QFXA 3WKDA 3QVOA 1P0MA 3KPYA 5JD4A 1IPHA 3B1YA 3ANNA 2HIMA 3BXZA 4ZP1A 1ZHQA 3A6FA 4PBSA 4AX4A 4CLDA 4ECTA 4JBNA 5T4FA 3W6ZA 2H08A 3OU6A 5A0TA 3NDBB 1N75A 2PGNA 4I2VA 3HXTA 5B4VA 3JVEA 3T3DA 1PNTA 1KJNA 5KCMA 3F7NA 3B6KA 5DLGA 1CEXA 1KKUA 4OHZA 4MKZA 1MJ5A 1EINA 2HYDA 3PJEA 4CZ2A 1CJUC 3INYA 5BPFA 1RDFA 1XRPA 1Y5LA 2IODA 1IG0A 2JCSA 1T0PA 3B5JA 4Y9RA 3IV9A 5CA1F 2FZVA 4JBHA 3ZH2A 4UW9A 1NT2A 2X6QA 5LP1A 4YHBA 1PK8A 4B6EA 3VKWA 2UUAH 3M6VA 2M6KA 2AXPA 4XQ9A 2BHLA 1QIKA 3FCSB 1EFRD 1ODLA 5HDQA 4JI5H 3W1WA 5HK8A 4DEVA 1CNFA 4MRSA 5CX1A 1T3LA 4A3SA 3VXKA 4BX8A 3FGZA 4EQ6B 1NMXA 4EYKA 1MZBA 2EDCA 3UZOA 3OUTA 2WSLA 4J4TA 4NBTA 3T38A 4XDGA 3PC2A 2EDAA 2W6NA 2QN8A 4FHFA 4LSWA 4DUGD 4YC7A 3K0SA 4A3KG 3UMRA 1EM8A 4QSMA 1IUOA 2YY5A 4ZOQI 2QSJA 3MF4A 5BO5A 2HU2A 4J9OA 5AKKA 5I4KA 1NJ5A 4HXFB 3V4VB 3PE3A 2QDXA 4X0EA 1EFPA 3BD9A 3PPVA 1J9GA 4LJ7A 3SE7A 1VM6A 3LXMA 4S1NA 1G6OA 4TS4A 1HDCA 3KOMA 2G9RA 3U4MA 3OQPA 3U4QB 1ZMRA 3AEKA 3LZCA 1YI1A 4KPGA 4KXFB 4RVFA 1YULA 1ZGGA 3L04A 3DXXA 5KX5F 1G64A 2H06A 1VLMA 3DBRA 4BWVA 4DQ0A 2PQMA 2Z9BA 3A3OA 4O7LA 1DIGA 3A10A 4QPDA 4UUGA 1GTSA 1ZHOA 1PNRA 4NXNB 3N9IA 4HDRB 1J23A 3PD0A 4J4BA 3H9QA 1NSFA 5FBKA 4TV9F 4A3MG 1TQDA 2MSLA 2O50A 2PPVA 2VAPA 3EZ6A 1A4UA 3KSDO 4UQPA 4H3SA 1KAEA 4RAOA 1A95A 2HHHB 4ED0A 1NDHA 5TVGA 5CLQA 1SCUB 5EWMA 3MTGA 4EYQA 3OOEA 2QVGA 2XOEA 4D96A 5A9RA 2H7XA 3NO4A 4FHGA 3UW1A 4FBGA 4B4VA 4Z4IA 1J70A 2WY2D 4EFNA 5HK9A 1ONBA 4WJZA 1U2SA 1CE8A 4M1OA 4ZK6A 3KYDB 1XF9A 1E63A 4WXRA 4TQGA 5GJWC 3SIRA 4WH0A 4LAFA 5DN9A 3CLHA 1UQUA 2BKUA 5LYJA 4P83A 3LT2A 2HRZA 3MFHA 2GCEA 3A1UA 3MUNA 2V7QD 3QMVA 4UOEA 1YMUA 1ZY2A 4IR9A 1W581 3FM9A 4DR7B 3Q6NA 1EUDB 3TKYA 1EJ6A 1PTJA 3M0EA 4EW3A 2WR8A 1IY8A 1ZCJA 3LA6A 4AURA 3RAJA 3KKQA 4I55A 2PMKA 2ZT6A 4KFRA 4QXQA 2IIVA 3VR4H 1KAMA 4O2BF 4QW9A 1PLJA 1KO5A 3M1AA 1YKSA 1B8NA 4G86A 2XY4A 1NONA 5ELXA 1EIZA 1MA3A 2ZI9A 2H29A 3AUJB 3I83A 3SX4A 4EENA 1BRTA 1K92A 1JG3A 1QV6A 2JFPA 2RC6A 4WAUA 2CBGA 1A8HA 2AE1A 3H1BA 4ER6A 3HBAA 2AUMA 3Q8XB 2F4VB 1B0AA 4UAVA 5F9LA 1COZA 3L8DA 3ZZMA 4E30A 1YB1A 3KAJA 1Y1VA 1Z8DA 3N44B 4P84A 3PJDA 4YRQA 2VYQA 1HO3A 4U00A 4KV9A 4YJGB 4BEVA 2QD5A 1ZOLA 1U1DA 1VKOA 4Z4FA 4V0ME 5EJGA 4D4JA 1WXXA 1VGRA 3C3YA 2R8JA 2QYTA 3GGSA 1XTRA 3EIUA 2IUUA 3AERA 3TE6A 4A0SA 5I5EA 4IHJF 1GZSA 1XJCA 1YT5A 2EJUA 1VHLA 2GJKA 1IEVA 5C3EG 2I3BA 3N28A 3NETA 4CF7A 3KQUA 1HMPA 1USVA 5EYPB 3RTGA 4L3OA 1DGSA 3WGYA 4BFSA 4BS9A 2BF7A 4FS1A 1I5RA 3NTUA 2WHPA 3HWRA 4HUQA 1ZSYA 3ER9A 3QU5A 4MUFA 5KYXB 1IY1A 3F8NA 2HA5A 1CKMA 1W0JD 1L5SA 1BCSA 2FP4A 3BFJA 3NHJA 4BE9A 4O4HB 4G5SA 2YOFA 4EZBA 5EJ2A 3T4UA 3JQAA 3O4JA 4MW9A 3H17A 3BQMB 3PX2A 2O8DA 3FKIA 2BHNA 2QNRA 1Z25A 5KFJA 2V74B 4LDAA 1P33A 1MTOA 2YV4A 4GR9A 1TM1E 2UYQA 1FDSA 2GXUA 3G88A 4RNDB 5HCIA 1K3FA 1YQ9A 3KQLA 5F3RA 4J0MA 1XKQA 3R9XA 2KBEA 4S1WA 4ENQA 3D7NA 2VDUE 3IBGA 1C2YA 1JLLB 1A2OA 4GMDA 5K4GA 3ZJUA 2C03A 2AEFA 4U0KA 4YRFA 1CUAA 2ZCUA 4B47A 2QOEA 5EGNA 1ZNWA 1BGVA 1FUUA 1C8KA 2WF5A 3BL8A 3PRKE 4LRYA 3H3VH 1QORA 2GKSA 5HQJA 5F21A 2I5PO 3RTCA 3VKFA 1ZESA 4DC1A 1W29A 2C0PA 4IIFA 4J76A 4ZFNA 3E9NA 1KAQA 2FZKA 2F3TA 5L3ZA 5FULA 3HLYA 1IM5A 3OE7A 1XPRA 4KPYA 2NT3A 3CUVA 1KTAA 1C4WA 2R6DA 4J0IA 8GPBA 3ORQA 1KU0A 2W2KA 3P94A 5CA0B 2ATVA 1NTRA 4LTMA 4N39A 4GKJB 3RARA 3KBBA 3IH5A 5MGNA 4LI0A 2OENG 3D4NA 1OKKA 2EP5A 3C4QA 5JO0A 1MIOA 4YMHA 1IH8A 4DMGA 4EUSA 1EFRA 4OMFG 4BAGA 1N34H 3HR4A 2NTJA 1CQIB 2VS1A 3MR3A 1AKNA 2IP4A 1ENOA 1SPBS 5B7PA 2B9VA 4J3NA 1U2DC 4ZC8A 3WWZA 1Y1WG 4HN2A 4IDAA 1KI2A 4DM4A 3DB1A 4N0DA 1DDOA 4KXYA 5TB5A 1H3FA 4XB6B 5BNWA 1NURA 1ZK3A 2VDNB 4M1MA 1LI5A 1B6SA 4C5CA 2YJNA 4PHFA 5H5JA 4AS2A 5KJ1A 1ZJZA 3R40A 1E4OA 3A3NA 4QODA 4C7MA 3DJFA 4NBRA 3UPDA 2HFKA 4B8WA 2RHJA 1WCXA 1V5FA 2P9FA 1HYHA 2I3ZA 1TT5B 3LMKA 3F8SA 2EIXA 3N1UA 4C7JA 2UYOA 1K1QA 1HDIA 1U2RA 2Z5VA 2XYPA 3D3JA 4DDMA 4AJHA 5EWGA 2R8XA 2WIGA 5IM4A 3ESAA 1BGWA 1LTHR 3EZYA 1J00A 1CQIA 1LDGA 2KM1A 4BAZA 3LWBA 1HR0H 1ZPDA 1D4ZA 1WMFA 5E7MA 1EGAA 3WISA 1Y42X 4P80A 5G3ZA 4F7DA 3HYTA 2GN9A 2GK4A 4HZUA 3SC3A 3FFXA 1IBSA 3P0HA 1XQVA 1FRQA 2GPNA 3BMCB 2OO7A 1C3EA 4F1JA 5M04A 2C0CA 4MI9A 5G40A 2XKAA 1BO6A 4IFBA 2BLLA 3VM6A 5FD8A 3THXB 1R0WA 2PX0A 4FFSA 4ZRMA 2I4LA 2JGNA 2P2YA 1UR5A 3U81A 2VP2A