1UC9A

Crystal structure of a lysine biosynthesis enzyme, lysx, from thermus thermophilus hb8
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
280
structure length
256
Chain Sequence
MLAILYDRIRPDERMLFERAEALGLPYKKVYVPALPMVLGERPKELEGVTVALERCVSQSRGLAAARYLTALGIPVVNRPEVIEACGDKWATSVALAKAGLPQPKTALATDREEALRLMEAFGYPVVLKPVIGXXXXXXXXXXXXXXXXGFQHQLFYIQEYVEKPGRDIRVFVVGERAIAAIYRAENCPLTEEVARLSVKAAEAVGGGVVAVDLFESERGLLVNEVNHTMEFKNSVHTTGVDIPGEILKYAWSLAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Lysine Biosynthesis Enzyme, LysX, from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Biosynthetic protein
molecule keywords lysine biosynthesis enzyme
total genus 73
structure length 256
sequence length 280
chains with identical sequence B
ec nomenclature ec 6.3.2.43: [Amino group carrier protein]--L-2-aminoadipate ligase.
pdb deposition date 2003-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08443 RimK RimK-like ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.80 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 1uc9A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1uc9A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1uc9A01
4YB8B 4C5AA 4O4IF 4E4TA 1KC7A 2QK4A 4EA9A 5LOVF 3K3PA 4M9CA 5KX5F 3Q2OA 2PBZA 3TIGA 2GLTA 3U9TA 1GSOA 1EZ1A 2W6MA 3ORQA 3TW6A 5JVDF 4M98A 4ZI7F 3JZFA 1UC9A 1W93A 1EUDB 4HQ6A 3JRWA 2R7MA 2W6PA 3SE7A 3VMMA 4TV9F 2YL2A 3OUUA 4I4TF 5C1OA 2FP4B 3TQTA 1GGOA 1E4EB 2R7NA 2W6NA 5C8YF 5CA1F 2I87A 4HNTA 2NPOA 4RZQA 1EHIA 4DIMA 4WD3A 3VPDA 1A9XA 1SCUB 3R23A 4MV1A 5CAEB 2YZMA 1GLVA 2VR1A 2DLNA 4FU0A 2HJWA 2X0SA 4YJ2F 4MV8A 1PK8A 3ORRA 1I7LA 2YS6A 4IWYA 3G8CA 2W6OA 4ZQIA 2GPSA 4YAJB 5LXTF 4HNVA 2YW2A 4MV9A 4O2BF 1CS0A 4HR7A 4MV7A 5CA0F 2R85A 2PN1A 3JRXA 4IWXA 4M9UA 2NU7B 1IOWA 3Q1KA 4O2AF 1KEEA 4M99A 5J2TF 1KJQA 1M6VA 2DIKA 4IZOA 4XYMB 4MV3A 2XD4A 3RUPA 4Y8VB 1JKJB 2YZNA 2Z04A 2VQDA 4YAKB 4QSHA 4L1KA 2FB9A 2GPWA 3TIIA 3R5HA 1DIKA 1C3OA 2FPGB 3OUZA 2ZDQA 5D8DA 2NUAB 3BSYA 2W6QA 3VPCA 1PX2A 3WNZA 4EGQA 4XZ3B 2R6FA 3ETHA 3U9SA 3N8DA 3MJFA 1VBGA 2FPIB 1C30A 1KJ9A 3LWBA 3RV4A 2PVPA 2ZDGA 4ZOLF 2W70A 4O4HF 3UFXB 2QF7A 5CB4F 2V58A 1W96A 4WBNF 4C5BA 1DV1A 2SCUB 1B6RA 4TV8F 5JQWA 1AUXA 3RFCA 2FPPB 1DV2A 2IP4A 1EUCB 3RV3A 4EABA 1JLLB 2W6ZA 5BPFA 2VHEA 2YS7A 1T36A 3R5XA 1VBHA 3E5NA 2DZDA 3N6RA 1BNCA 1KJ8A 2V5AA 3ETJA 3K5IA 1CQIB 4I55F 1EYZA 4EG0A 1GSAA 5I47A 1WR2A 3R5FA 4MV6A 3HBLA 3GIDA 2NU8B 3TINA 3VPBA 4C5CA 1KJIA 2CQYA 1JDEA 5GONF 2ZDHA 1AUVA 1CE8A 3BFPA 2YZGA 3V4SA 3HB9A 2XCLA 2NU6B 3MWEA 2J9GA 3QFFA 5BMVF 2YRXA 5K2MA 3GLKA 2R7KA 4YJ3F 5H80A 3WO1A 2R7LA 4MAMA 4XX0B 3V4ZA 2DWCA 4MA5A 3HO8A 5HBRB 4EA8A 4GGMX 3K5HA 5KKNB 1BXRA 1E4EA 2R87A 4IHJF 4MV4A 5BPHA 4YBZB 1UC8A 4TUYF 5IYZF 4EGJA 1KBLA 5HV6A 2OLSA 3BSSA 2V59A 1JDBB 2YYAA 3BG5A 2W71A 4I50F 4ME6A 4HNUA 5JVLA 2C00A 5LYJF 2I80A 3AX6A 2VPQA 1I7NA 5J2UF 4EA7A 2R82A 2R84A 3LP8A 5EZYF 4MA0A 3BSWA 4XYLB 2I8CA 5C1PA 5DMXA 1IOVA 3AW8A 1ULZA 2CZGA 1B6SA 5LP6F 2YRWA 3G8DA 2NU9B 1GSHA 1KJJA 2R86A 3I12A 5LA6F 4O4LF 3JZIA 4J6EA 3VOTA 1CQJB 3MWDA 3WO0A 5JH7F 1VKZA 4DLKA 4ZHQF 4EAAA 3VA7A 2P0AA
chains in the Genus database with same CATH superfamily
1KIAA 4F9FA 2XI4A 1QP4A 4Z4EA 1KAEA 4X1YA 3RRNA 5JHHB 3UYYA 2C4NA 4LSAA 1G20B 2GZAA 2YYYA 1CUHA 3BFKA 5SV2A 2P4QA 3U3MA 1AKEA 3TQFA 3EZFA 4X7PA 1Q0QA 2P6PA 4BWSC 3TO5A 4ARVA 2QY9A 2WTEA 3NHWA 3BULA 4ZT5A 1JBEA 2H9AA 3DBHA 5SYAA 3OZWA 5FHQA 1T35A 2ADOA 3ZIAD 4YRTA 3NCTA 4J4HA 3SR4A 2OV6A 3FLBA 2V9CA 3I34X 2XB9A 3OUUA 2FG5A 1CQIA 1JHMA 5U1PA 4K2AA 3C3EA 2O0KA 3PCRB 4A4DA 5IYCG 4BMCA 5M7EA 4NK4A 3HEBA 2WWHA 1SVOA 3F5SA 4QRDA 1G0NA 2AKEA 5BWTA 1XFAA 1AO3A 3AWDA 1T2VA 5T4FA 2PO7A 1H2AS 3A4IA 3UAZA 3BXPA 4FONA 1OLOA 3CUSA 4RIGA 4R2WA 1U3WA 3WLKX 4FD3A 4WLUA 4Q9DA 1WL8A 3STYA 4P32A 3VTZA 3WHLA 4NXMH 2JJYA 2Y27A 2LRHA 3TVYA 1I6LA 3C0FB 3WSWA 4M9UA 1G2WA 4FWTA 3NDJA 4K0KB 1K8XB 3I23A 1NP3A 3RE1A 3TFQA 4RSMA 4G23A 2PRZA 1SPBS 1Y8QA 3R7SA 4DDVA 2CD7A 4PFKA 4E5UA 3TTTA 1D9ZA 4K9QA 3SZGA 4N41A 5L1KA 1C4XA 3VUEA 1GJRA 3DZIA 3CFYA 1IBLB 1PYGA 1PT5A 5ESXA 3CEHA 3E2PA 2IBKA 2NU7A 3ESYA 2HCFA 5DAAA 2KYRA 3ZEIA 2PA0A 2XMRA 1VYVA 3AFOA 2PY6A 3QVGA 1U3VA 3ESQA 3GMTA 3W90A 5ARDA 1Z4MA 1W36B 4H7PA 3GRPA 2OP0A 3W3AA 4MW2A 1ZAUA 2V45A 5E2AA 4ASUD 3PR4A 2JFFA 1WEHA 4JUAA 3UVEA 5COAA 3UMMA 1HOXA 3OWOA 2CE7A 5B3LA 4KK4A 1T8UA 3AI1A 2CMGA 1IMOA 1J8VA 1QGUB 2NTJA 2P2CA 3LCCA 4JZYA 3ZJ4A 5B7PA 1EVZA 2FMTA 4OQ4A 1AZWA 2O9JA 4EI2A 4Q3OA 3AUJB 5KT3A 5EVCA 2C97A 4DA6A 2H8KA 2HK9A 2W48A 3LLCA 3CUVA 3VHLB 3BFPA 3U26A 1YBVA 1GYFA 5CT5A 4LYHA 4EKDA 1NQAO 1LI7A 5JXHA 1ZIDA 3K0SA 1G8SA 1ORTA 3AESB 4HKTA 4RL6A 4ECZA 2AG8A 2ZRGA 2FEOA 3SOPA 4BUJA 1V5FA 2YWJA 3NM4A 1U3TA 1I01A 1XRQA 2JIMA 3WFZA 1RVDA 3EW9A 3L6CA 4URZR 4CZ2A 2ZBEA 3L7KA 4OB7A 4V0QA 2VTBA 2O8DB 5BSUA 5JC8A 1NJGA 5AYVA 2FEMA 1PKXA 4HDSA 2RH9B 2XUDA 1OOEA 1ISHA 5TMEA 4I55A 1A2BA 1N8NA 1GRVA 4KQCA 3KX2A 3JYPA 4A2QA 1UBKS 4B33A 1BGVA 1K97A 2Y0PA 5KFNA 3ED5A 4H7KA 4Q82A 3AW8A 1DBVO 4F71A 3OZIA 5JATA 1T0BA 1FVOA 3JAWA 2HGXA 1P45A 1P0QA 2H7YA 3MTGA 4PAMA 2VYNA 2GPYA 1IULA 2B3DA 2JLQA 2DB3A 4PFSA 3T7EA 1ULBA 1Y7TA 1YB1A 1H93A 1M67A 4GSKA 1C3VA 2DHRA 1XTJA 1Z35A 4JV0A 4MYUA 1EWKA 1A3GA 1N2XA 2HPHA 2JFXA 2XE6A 3OKAA 4QYTA 4RVDA 1NWHA 4AY2A 4DA4A 2WYWA 4E4TA 4BO0A 4EA9A 1CNEA 1R9MA 2RHBA 1X7ZA 2H16A 2ZVQX 3L79A 1E58A 5EJEA 3VSEA 1HNWH 3K31A 1NW3A 2YW9A 4QGGA 3D81A 3HBFA 4PNPA 2CNWD 2JGJA 2JRLA 1XEWX 3INRA 2QM8A 4NQZA 3CSWA 2A2ZA 2DFLA 1FYFA 2BELA 3HA2A 1WDWB 3ROQA 1KDTA 1QQ7A 2B78A 5LOVB 2Q50A 3MSCA 4O29A 5BWOA 5KFEA 2EFEB 3L8YA 4IVPA 1D6SA 3ZZMA 3WHKA 2AOWA 2PKRA 3QEOA 5JUWA 2QL9A 3PEUA 1B8UA 3U3DA 2H4FA 1QCZA 1E4EB 4FB5A 1RZRA 1GT91 5C8XA 4E2YA 2P1RA 2NO4A 1CUDA 4XRRA 4KFCA 4MGHA 3GPLA 1V4VA 3SI7A 4RENA 4C3VA 1P62B 4HB2A 1XAIA 3DUFA 3M1IA 2F8TA 2PGXA 4B3MB 1E1QD 2KW5A 4PCLA 1X7WB 1IXZA 1WCYA 3H99A 1B76A 1E0SA 3L7NA 5AW9A 5IT4A 1DZIA 4UE2A 4CMFA 1J7JA 2CNBA 4DQXA 2AB0A 1XPUA 4R9NA 5CVVA 2Q21A 1DKQA 2IE8A 2DHDA 1UJNA 1YVDA 2J48A 4RS4A 2YJNA 5HF9A 1QFMA 3ASUA 2E2IA 3IP7A 1FU8A 1YJAA 1CNFA 3RWMB 5FNZA 2W98A 3O9ZA 1PW7A 2CLOB 1FQOA 2ECFA 2CKDA 2I78A 5EXTA 3W2EA 3KK0A 4XXHA 3HCRA 2EQ5A 5KT7A 4BMSA 4WCFB 1VLZA 4NESA 1AKYA 3VYRB 4C3OB 1FU7A 2AE1A 1BX3A 1ZU4A 2AVNA 4GXTA 3RW9A 4EYKA 2C2OA 3B60A 1KF0A 3ZVLA 3OETA 2AH5A 2GRUA 1T9BA 2C5AA 5KFGA 3BMOB 3KQPA 2XTZA 5HKKD 5HP4A 5DF1A 1FNMA 4FGLA 4F8EA 2P41A 4RPJA 1JG4A 1OAKA 1FZQA 1AC5A 3H13A 1I3QA 1ULAA 2HLHA 5DYTA 1Z0KA 4D57A 4LRXA 2GB4A 4XVUA 1KJIA 1FA9A 1ZA2A 3V32A 4PIMA 3HY6A 4GLBA 3ODGA 1O0SA 2JANA 2ZUUA 1WG8A 3H2GA 4LY6A 4QYIB 3HZRA 4EZEA 1YDGA 1EGAA 3DCNA 5DH9A 3KV3O 1JH8A 2XGSA 3FUCA 3IUEA 5DLYA 2HF9A 3E3MA 3TI9A 3K5HA 5DHPA 4X66H 1NNLA 5BWUA 3HV0A 3K05A 4DMKA 1QVAA 4P34A 3ZY5A 4L76A 5GTDA 1FDVA 3DVLA 3VR2A 4I9HA 3USZA 4A73A 3JQPA 3KWFA 1P1CA 2CJWB 4UD2A 3MQFA 4WESB 1HV8A 1RWKA 3F97A 2ORED 2AWNA 3M8KA 4HNHA 4MMZB 2I8CA 3AESA 3NFYA 4UPVA 5H4HA 2VWGA 4CIAA 2RAFA 1NKVA 2ZVPX 4LF4H 3DV0A 5HX7A 1F2DA 4HX2A 5HEKA 1SG0A 2PWPA 2XGMA 5ESWA 5HCNA 1XYGA 4QX6A 3UCEA 4AECA 2XHEA 4Q18A 1C80A 1YT5A 5FI5A 4JVOA 4DV6B 2ACWA 2FK3A 1FYXA 4TMVA 1M7HA 2C99A 5K0SA 5HIMA 1KPHA 1XNJA 2J5KA 4PY2A 4TM8A 4ZAGA 1NW8A 5CNIA 1BXGB 2QOEA 2Z98A 3ZBTA 4KR0A 5F3RA 5GGYA 4MW9A 3RSGA 5JADA 4FS8A 3DQQA 2ZZKA 1MQSA 4WE3A 3BCUA 4DIUA 3IHTA 3H5IA 3KT0A 4BE7B 4J0JA 3PSAA 4WLFA 2Q7OE 3BT7A 3VNUA 3RRMA 1UADA 4DLXA 5FUMA 5C1OA 4M7RA 3D7KA 2XWBF 4HDRB 2Z1MA 3EARA 5BWCA 1ST3A 3BILA 3ANMA 3DMTA 5I7VA 2XZOA 2I2BA 2OYCA 4F84A 3STXA 4BGEA 1FF9A 5BYBA 2AEEA 2IS2A 3I9NA 2XF8A 3RSLA 1N5JA 1F7UA 3FN4A 3BA1A 2GPSA 2NUPA 2ZJOA 4NOJA 1QGOA 2C7OA 3I5YA 4LJKA 4X0EA 2WTNA 5FA6A 2NXNA 4RD0A 3GLFB 3G5UA 4JR2A 4YIKA 4D0RA 1U0BB 3EXG1 3VSBA 3ZY3A 2FTKE 2RGNA 1D5CA 2XH8A 4PBRA 2F4VB 3HMQA 4N6NA 1MO2A 2X5NA 3VOSA 4N3NA 2H2AA 1W0KD 2FF5A 1NQVA 1MRZA 1YRWA 3NHAA 5K6AA 5CXSA 2OXCA 1X7ZB 1B1AA 2EJ0A 2O5RA 3F5DA 1RWBA 2GHQA 2ZW9A 2IW1A 1WZUA 3JWHA 3HHPA 4K6OA 4CPDA 4XTRA 5DNEA 2ZSHA 3PR2B 3FCEA 1FS6A 5HE8A 3O8RA 4RA6B 3SIPA 3I62A 2CDBA 2QAIA 1VMDA 3EN0A 3DXFA 4B3RB 1C30A 1SH7A 5CVEA 2Q1XA 3BRWA 5AI6A 4LMPA 1X94A 3BHIA 1PIWA 3VISA 3VYSB 4JQYA 3I92A 4B1FA 4DC9A 4I0WB 2V7BA 1CY4A 1VBMA 2WJAA 4BX9A 3WKAA 2BZ1A 4WBNA 4I3HA 1X1SA 2E9SA 2RGEA 2WU8A 5I5EA 1T5SA 4KRGA 4PYRA 1NI3A 1J0XO 3AY6A 1KSHA 4URUR 5KFAA 5C35A 4RTKA 2JCXA 2Y0CA 1GQYA 2UZ3A 3E9EA 3PVSA 3WZLA 5A03A 3N8HA 3TAUA 1G8AA 3GDWA 4ALKA 1GAJA 1MW8X 3P4YA 2AR7A 3L77A 3RBZA 3T7RA 1DKOA 2J45A 5GONF 2DBRA 1PJAA 2JH8A 3P26A 1JL3A 2Q2NA 2FOXA 3DMYA 3LAWA 1Q19A 5TMDA 1B8PA 2FX3A 2GARA 3CUKA 3IMCA 3KUUA 3PQDA 3U37A 1F06A 4JB8A 1OVMA 2WKPA 1TAGA 4MUMA 4NV1A 4GL2A 4OXNA 2UYOA 4R7RA 5JSYA 4XX0B 1SHJA 3TN7A 4F4CA 3TLEA 1NXWA 4WLVA 4ABYA 1LD3A 1LPNA 2G09A 2G36A 2VPSA 1I3OA 2CK3A 2YMLA 3FH0A 3L6DA 5AUPB 1QGDA 5FTWA 8ABPA 1RCTE 4HD8A 2QBYA 2X5XA 4ZODA 5IT0A 1M8PA 4YROA 3WL8A 3LXXA 4EB6A 3B6IA 3GTJA 2JLRA 4U6QA 3L0ZA 5BSRA 5M5BA 2QEQA 2R82A 1G6OA 2R6JA 3EF0A 5K3SA 5JALA 5FV7A 4NK5A 1K27A 4GMKA 1R9NA 5AOCA 4TQUS 4JI3B 4TV9A 1EINA 4LJSA 2C2XA 1A7UA 5E9WA 3TX2A 4I1YA 4FBLA 4J6EA 2C9MA 1LX6A 2HBZA 3JQCA 2D54A 2AFIA 1RM5A 5DNDA 621PA 5E0OA 5IXSA 1CWUA 4J9RA 1IG3A 4NYMR 1XCMA 5FWNA 3S1AB 3VR6D 4G0WA 4DCCA 1AUOA 2C4UA 2OZEA 4RDIA 3R7AA 3KV1A 4C7OB 3LP5A 3CW8X 2WYVA 4H7JA 3OZUA 1NFQA 1N3IA 3LHDA 3ZQ6A 5JI3E 1KZ7B 4UCFA 1VRWA 3F71A 2DPGA 3IEIA 1LDEA 1IQPA 3RVQA 4OUDA 4ZOEA 4QPJC 3REFA 4OLBA 4D0SA 1G2OA 3RFUA 1RXWA 2FR8C 3MXTA 1Y1RA 4PPYA 2HK7A 2CFCA 4G1EB 5T4BA 1RHMA 4YREA 1FP6A 9LDTA 2N42A 5LQJA 5DB4A 1UJ4A 2C3MA 2RK6A 3Q3VA 3F46A 4JT9A 4XWGA 1CVLA 3ZIUA 1JEQA 3QGMA 5BWRA 3MILA 1KUTA 2A6PA 1SOVA 2VAPA 4X9XA 3T4UA 1O87A 1ZM9A 2V7TA 3K20A 5FIUA 2WG2A 3KJNA 1EP3B 4OU5A 2N9UA 3KD2A 1DS6A 3B13B 1JAYA 5KQMA 2IXFA 1DQPA 1XEAA 2EKLA 2XTNA 2YXEA 3A2MA 4TLBA 2WICA 2VP6A 4G4SO 3T38A 5KTKA 2ZP1A 1NDQA 4NHOA 2A92A 2REOA 3Q8SB 2KPOA 3K94A 2Q3LA 1JQAA 2Q4RA 5AJWA 2WWWA 1WDTA 4JKYA 1XMOB 4GOOD 2OC4A 3PQFA 3ILXA 1V0JA 1XQ1A 2GBGA 2QRMA 4TXJA 4KO1S 3NWJA 3H0KA 1QV9A 4CFZA 2AE2A 3WP0A 4B46A 3S2IA 1UMKA 2M98A 2XADA 2QAGA 3TB6A 4EPXA 1VA5A 4ZV7A 2PSFA 2PDAA 2ZIVB 2GZ2A 3C7AA 1W4RA 3NV9A 2LD4A 5AVWA 2ZB8A 4NZZA 2IHTA 3T5JA 4BIIA 3S2UA 1T2DA 3RTDA 4D4JA 1JHVA 1X8KA 4IDDA 2A5GA 1CV2A 2JCGA 4LZPA 4PLZA 3R9IA 3UAGA 1B15A 4DGSA 1V4YA 3CUTA 3H2SA 1VI5A 3U7QA 5FBZA 3Q8XB 1RWWA 4Z0HO 4ACAA 2MR5A 1CRWG 3VR1A 3BGIA 3EE6A 2XMBA 1YWGO 3BXFA 1YA8A 4BFZA 3AINA 2BZSA 5DNUA 5DQGA 2VH5R 4O3SA 2D1FA 1CYEA 5F1YA 4IRXA 3SHQA 3EPGA 2P3SA 2WWIA 3SHOA 2QLBA 5H9VA 1XQVA 2BR3A 3SQOA 4YV1A 4H7EA 4MIKA 2N1BA 2WM2A 4IFTA 5FADA 1FMFA 2R7KA 1V9CA 1Q50A 2H59A 5HQ3A 1JQEA 3G9UA 4BQFA 3RVBA 3MRTA 4L72A 2HGWA 2ZE5A 3GXOA 2WIBA 4M6WA 4RFLA 4C7KA 1AH2A 5HVNA 3ZJYA 4YBZB 3K9FC 2ZITA 2FPRA 2HHLA 5BQ5A 1XCJA 4Q47A 3I2JA 1HH4A 3IBYA 2FLKA 3LPAA 4MR8B 4D92A 5HKAA 5LKRA 1RBYA 4EA7A 1ZK1A 2OZVA 2R2GA 2ZYWX 4P82A 4S0XA 3UJNA 4MYHA 9ABPA 4B83A 3AP3A 3K92A 5JANA 5L3SB 4PWZA 4CYMA 5CA0B 2J30A 2O2IA 1NUSA 2SICE 1ZOPA 3QM1A 3MFQA 3OIVA 1KI8A 1RMYA 3KTAB 2GD6A 3ZZTA 2P9ZA 1EHYA 1SCDA 3FROA 4PBSA 4EAAA 2V7QA 2E1PA 5MFPA 1UJCA 2X8LA 3GLIE 1W581 2QK4A 4ASUA 4UFNA 5BWLA 1XQ9A 4AF6A 3OQNA 5B1SA 4WKGA 4QIWE 1TAEA 1UC9A 5CYOA 4B6QA 4P36A 1DWUA 3U44A 2UXBB 2Z9BA 2HNAA 4X6LA 4EX7A 5IZ4A 5KJ1A 2DH6A 4KCGA 3R9RA 3KYJB 2GWHA 3W3ZB 3TZKA 4CV2A 2BEUA 5JSKA 2QD2A 3CISA 1AS2A 1WF6A 1LVHA 3ROXA 2J0UA 4AP6A 5CT4A 5D1OA 2AZDA 1LS1A 5EXDA 4GC5A 2C2EA 3WRYA 1V11B 3W1WA 1V1RA 4YRRA 1HDEA 1YIDA 4DCSA 4F1WA 3F9CA 4W1RA 1ZUHA 1GTZA 1QX3A 2BRUC 2DWQA 2LKCA 2A88A 4YP3A 3FDZB 3HKEA 4NBWA 4TL8A 1KS2A 2QTRA 1N7HA 3GIKA 5DULA 2B35A 3MWFA 5C51B 4QW8A 2GFHA 1KEVA 1PD0A 2AS0A 4URYR 4HS9A 4UW9A 2UVDA 3UC5A 5BUZA 4DLRA 4QW9A 4YRGA 1GCOA 5K2OA 5A62A 4GWGA 1RJPA 3ZWDA 1A5ZA 3T0IA 2VUUA 3QKIA 3OF5A 3WLEA 1EFHA 2WZBA 3CVXA 1ZW6A 4CC5A 2HEIA 4BP1A 3RS9A 4S2UA 3M70A 1MX3A 5DXJA 4YMLA 1UDWA 4N8SA 5IMSA 1KJ9A 3I2YX 2HLDD 3U3ZA 4IVRA 4A6EA 4IEFB 2X2FA 3TOZA 1JA1A 1Y6QA 2ON6A 1CZNA 3QU9A 3LQQA 4TV8F 4G5RA 4K03A 2H2FA 4CKBA 3GXBA 4JLDA 3KEGA 2MSKA 3WDLA 4UNPA 3FJOA 2VEDA 1K7FB 1OV6A 2PS9A 3OM1A 3WQSB 3I6YA 4TN5A 5LNK1 4DV3H 2EYUA 3K9BA 4R1QA 4N65A 4PRZA 4RKQA 4RZIA 4UC0A 1HSOA 2D4AA 3F2IA 1V4BA 1NKTA 1U9CA 2BFEA 2C0QA 2X0IA 1HUQA 3D6TB 1AUVA 3EVGA 5FNVA 1I2MA 2PBFA 1Z2CA 3DBRB 3QE2A 2P0YA 1NF8A 5A4AA 3QYJA 1P5HA 1UXKA 4CEHB 1T0HB 5ILOA 2PE5A 3GNSA 5FWYB 5EKSA 4RKFA 4J49A 1A5TA 4ZANA 4ZYYA 5KPJA 4X65B 3TL6A 3U3JA 1T4CA 3GP5A 4OVKA 4YDRA 3X0DA 2GJAA 1Y4DE 3BJIC 1GVHA 2CXPA 3K1ZA 4R2XA 4R5MA 2CFMA 4TWBA 4YJGB 1NRJB 3RI3A 2IIVA 2VO1A 4IS3A 1SUFA 4O4IA 4XIYA 4CU5A 4DABA 4ACBA 3I72A 3L1HA 2G83A 4M7PA 2QXUA 3VH3A 2RGWA 4EEYA 3QFTA 3ILYA 3KEMA 4J94A 5CYFA 5F5LA 2SKDA 1R18A 4YUXA 1Q84A 4O86A 1DI0A 4CF7A 3DOIA 3S27A 3OEHA 4S12A 1ZMOA 4G8DA 2XXAA 2R4QA 4ZAXA 2R25B 3EVEA 1UKZA 2I3BA 2FOIA 1VJ5A 4IQ4A 4RVHA 1NQTA 3EF3A 2JI8A 5AXCA 3TLXA 3SBXA 4RTJA 4B3TB 1ECBA 3RJ9A 4DEVA 4WN3A 1W4ZA 2VBFA 2I67A 3DAAA 1K6IA 5F76A 4YQEA 4MKFA 1SUAA 5HRCA 4J76A 1MT0A 4P0PB 1E2EA 1YZFA 4AFNA 4UAUA 4TV8B 2ZBVA 2PCLA 1WMEA 2OM6A 4JFAA 4QQRA 1CZLA 3HC7A 3CEJA 4MW0A 1K8ZB 6ABPA 4JI8B 5HIJA 3DMRA 3CZCA 3DDHA 1SQ6A 4ZVUA 1P7WA 4YEDA 4DM3A 2WR8A 3IVRA 2Q4OA 2GTIA 4KXXA 3NXKA 2GLUA 3G6KA 1KORA 2P78A 4JSRA 2X42A 2PV0A 3FPLA 1YV9A 4HHEA 5BOVA 3NJRA 3LW7A 4K9KA 4RFVA 4C05A 5BR8B 2FLWA 2AFHB 4RY9A 1VPWA 4LCJA 3PIIA 4ED8A 2RI0A 2VAVA 1GLVA 3I4NG 2B83A 2ESRA 2XVZA 1PK8A 1KXJA 1P81A 1EK6A 1TRHA 3M9OB 2JK1A 3NHYA 1I5EA 5LXTF 1JSZA 3FDZA 3LFUA 2C1ZA 4GLJA 5AKIA 5EZYB 3K71B 4LDRA 5AW1A 4S1OA 2VDWA 2CJXA 3R8CA 3S1LA 2XYQA 4J0EA 1YQGA 1CS4C 1W0CA 3IBGA 5C34B 3EXEA 3HCWA 4K05A 1YZNA 1W30A 1EE9A 1DU4A 2BZGA 2OBBA 5GGXA 1LC0A 1ESMA 3D43A 3ADPA 3DD1A 1CB7A 4P7JA 4V39A 4CQLA 5LLTA 3CVVA 2B9EA 1J2UA 1NE7A 4KGXA 4QWAA 1NVMB 1D2HA 1IZ7A 1EFDN 2YHBA 1XDUA 3H1PA 3NBUA 4M46A 3PPVA 4OFBA 3BSYA 5I9IA 2MDTA 2Z8YM 2ATXA 3K1AB 3GT3A 5CLQA 3F6RA 3U44B 3G5AA 1QAOA 1XTIA 2AEMA 3WICA 1KC1A 4YHBA 4GPBA 1J2YA 4ZT6A 3RSHA 3ER8A 4RXMA 4ZJPA 3LXMA 2GYVA 4QBGB 2CMFA 1VL0A 4I99A 3R6LA 5HXAA 4WXEA 1JHQA 1I0IA 1EB9A 1YFKA 1UC5B 5FI0B 2EX4A 4JT2A 2IU0A 4AZTA 4C21A 4O1MA 2JI6A 3HJGA 1JIUA 2AOXA 1NVUQ 5AK4A 3VKFA 3AHEA 3OTHA 1M1NB 3JATA 4QPCA 1KOLA 3C1AA 4F6LA 1VTKA 1ORDA 2YZKA 4DQVA 3UN1A 3BTVA 3GFSA 2A67A 3GUZA 4NOKA 3ZJUA 3QIVA 2G63A 1D2MA 4TM5A 3B6JA 3R7FA 1MF7A 3WLSA 3RVSA 1CRZA 1PNTA 1DQNA 3AILA 4A3LG 3O4GA 2II6A 4B84A 2Q5EA 2VUMA 2ES4A 4FYHA 2DUUA 3MHPA 4BATA 2Q3BA 1NI4B 2PNFA 1MOQA 3BYZA 4RZ2A 3DOHA 3TZCA 5KNCA 1YACA 3KAKA 5AESA 1Z5GA 2Y1EA 4DMRA 2WSSA 4E14A 3OFSA 1WCMG 1UAGA 2O3RA 2R00A 1DRVA 3L8HA 3EZ7A 2HIXA 5DGIA 1UDBA 1WQ4A 1GTRA 3FUXA 3VZDA 2JNWA 1YOVA 3A1SA 4KYIB 5HCIA 1NVGA 4LGYA 3HV2A 2C07A 3VMFA 4IQGA 4HNQA 1WXWA 2GLXA 1DDIA 1DRWA 1OR8A 4QZVA 5HZGA 4NZYA 4N8EA 4XQEA 3SXPA 3WLTA 4B3CA 2E2HA 3PPWA 4V02A 2VNAA 5DEOA 1XG5A 3FCOA 1DO8A 2C4TA 1RVV1 4QJBA 2ISSD 2RGAA 4DCNA 4LFBH 4DV7H 2BN4A 4WKBA 5I5GA 1ZESA 3O1JC 4B3HA 4EVIA 1LF0A 1YBMA 4QXOA 3OEHD 2YV4A 5IASA 1NVVQ 1PS8A 4LCBA 1DDOA 3RFVA 2HWUA 4ZARA 5LQCA 4DGQA 2A1TS 1KHHA 3AHFA 2DABA 4JQCA 1W93A 1IIRA 1M9NA 3BK2A 3A1WA 4CWAA 3ADOA 3OUTA 1GPAA 1XXHE 4LJ6A 3KQKA 1GKKA 521PA 4P84A 4NJMB 5IKOA 4EHDA 1NMEA 1PVDA 2B8EA 3PTZA 5G0TA 1FLDA 1SRQA 1UBEA 2RI6A 4OA8A 1HLGA 2GN2A 1JRLA 1JBQA 1A69A 2H1WA 3M5WA 1P18A 3TIVA 2XITA 4MTLA 2D2VA 3VR4A 4WOJA 4CKZA 2CYAA 3GIQA 1A9PA 1Y48E 2NSLA 4FDUA 2YKGA 4U02A 3ZKWB 4HR7A 3KR1A 3GGSA 1Y37A 1TAHA 2BCJQ 3PQ4A 5EIAA 3Q9SA 5F5NA 1WDKA 3W2GA 1QOQB 1ZJ6A 4B8YA 2VFAA 2B25A 2EQBA 1YC5A 4ND7A 4GOLD 2IV3A 4KNYA 1I3LA 3DM5A 2B4KA 1EKXA 3C3KA 3HZHA 1PJ8A 2IYYA 3O9VA 5I7RA 3K9GA 2AOUB 2OBYA 2GZDA 2ZATA 3D6VA 1C3LA 1CW2B 3D0OA 4LXUA 4L51A 2ASVA 2Y1LA 3U13A 4YAGA 4X20B 1XTBA 4A5OA 4Q6WA 3G8BA 4NDNE 1SFOA 3V8NA 2WJYA 3WL5A 3ZUGA 3TXAA 5IVPA 4G4SP 4IKPA 4DV7B 2QT0A 4LJRA 4QWCA 3F6EX 2O8BA 5C1IA 1H23A 1AKUA 2BC9A 1D0VA 2AV6A 2X14A 3EVZA 1I2LA 1XUOA 3GZNA 4X95A 3FNBA 5DTEA 2BEVA 2V6GA 4IOJA 4DM4A 5IUKC 3IN5A 2HB6A 1UWCA 3AYZB 4IIHA 4TM7A 4TMWA 5EXSA 5F9FA 4IV0A 1KYQA 2FMFA 2I6SA 1ZI8A 2JGAA 2O7QA 3EIHA 4KP7A 4OYRA 2C61A 1RI5A 4WXPA 2DZDA 5ALTA 5MFZA 3U6KA 1NSYA 5E4TA 1WKVA 2CCKA 4HAOA 4KXNA 3CIFA 4AMUA 2V4RA 4ZCMA 5JR3A 1GSAA 2ZRFA 3L9WA 4MINA 3OPQA 4KPFC 1PK9A 5BW4A 5TE9A 5E3HA 4TZTA 3JYHA 5KFFA 3QOXA 1JNXX 5FX2A 3I45A 3RQIA 5HTOA 3KB1A 4EW6A 4JV5B 3A37A 3LA8A 1Y4AE 1XL0A 4HLUC 1M34E 3OQJA 2B99A 4M88A 4UDNA 3WP1B 4ER3A 5K8UA 4R9SA 3G2PA 1UNNC 4OHCA 1E3LA 5B2FA 3N8IA 1PZMA 1ORRA 4IYJA 5HGXA 2HSEA 1T10A 3Q8WA 4C76A 4ECYA 5BSEA 2P6MA 4FS2A 4ISCA 4HNUA 2J9RA 3QBVA 1CLEA 4A8JA 2XUHA 1U1IA 3A2NA 4G8BA 1PWXA 4HQOA 1T4GA 5BV7A 1Z6GA 3I1YA 3L4BA 4DV4H 5KSPA 1N78A 3IELA 5LPNA 1Y1QA 4KBYA 4WK0B 5ERYA 4D9FA 1HK7A 4FW8A 9MHTA 2J46A 4XYGA 1J0EA 2EJWA 2HPAA 4GRIA 1N36H 2AN3A 2X8JA 5KFHA 4Z4QA 4O4JF 2PL5A 2HH9A 4ETSA 4V0OA 3KYBA 3UBTA 1LK0A 1USVA 4PONA 3QVXA 2MSWA 3HZOA 3FBTA 5DRTA 2VEOA 2CJFA 5EIBD 2CL6X 1TEXA 4H1VA 1OGIA 3BN3A 5TT0A 4RB2C 1E18A 3K9QO 4EUKA 2RGUA 5BWBA 2ZT7A 3N44B 5K7SA 4F2GA 5D3MA 3G88A 1OX5A 3T3MB 2IHNA 4XJTA 1PNVA 1E9FA 1E61A 1TZCA 3A6GA 3G5LA 4LYJA 4PNEA 4PANA 4Q1FA 3AEKB 1KY4A 4IYRA 4YCNA 1X80A 3HGTA 4AX8A 1BQEA 1ZGBA 2Q6OA 4E4RA 4GI1A 1NZDA 1N2IA 2X2OA 4OI0A 2NSYA 4A0QA 3GZ4A 4TVSA 5KKAA 3DKVA 5EE1A 3HKBB 3RUFA 1FJXA 4O4LB 3KNZA 4J9NA 3KOUA 3HB7A 2BFWA 2NTVA 2XWPA 4EHIA 1E2QA 4EHLA 4MCJA 2NP6A 1TMOA 2JA6A 5TC4A 3UBMA 5K01A 4D26A 3B6ZA 3AONB 3NWBA 5DLDA 3O7WA 4HGPA 4PZEA 1HNWB 3BHMA 3L4BC 2FMUA 1UBRS 2EW8A 3RIEA 4EW3A 1I14A 2PMBA 1NN5A 4H6PA 3ROGA 1YUMA 5TVGA 3EPPA 4KWTA 2COJA 2CW8A 1NPTO 4OPMA 3ZHZA 5LP1A 5HCUA 2ZUFA 1P4AA 2OZPA 2YBEA 4OY3A 3NOXA 3Q85A 5AXAA 5SY4A 1I2DA 4G5OA 4LK3A 1M1ZA 1P1KA 3PUXA 4XB6B 1OC2A 5KYYA 1FRQA 4JU9A 3KQOA 4UM9D 1CF2O 2PIDA 3E84A 4L8VA 5G40A 1PGPA 2BTEA 4YAEA 3PKIA 3PHIA 1EUQA 2A78A 2GCIA 2JBAA 2ZAGA 1IQ0A 3DHVA 3GPBA 5B7QA 4UTXA 1TK2A 5D5HA 1YAHA 4WINA 2F3UA 4P1ZA 4U7DA 4E15A 4WJKB 3C43A 1DTWA 2GFIA 2QE7D 4GL4A 4C29A 4RTLA 1GUZA 2ZBRA 3BF7A 3UEOA 4ABTA 4XVCA 1EM6A 1O4VA 1QJ4A 1LPAB 1MX9A 3QU4A 4JLVA 1RQRA 3RS0A 1AMNA 5L8VA 4RPGA 1I1QB 4K81B 4PSKA 1A04A 2IVZA 1YE5A 1I7DA 1EFKA 1JDSA 1K5HA 1NF2A 2YDXA 3HEAA 5MHTA 4HH0A 3QI2A 1CUFA 2FPLA 2R96A 4DDHA 1EP9A 3P9IA 1TA9A 3WC4A 5HOQA 1KXZA 1OX6A 2EHDA 3KJHA 4YJHA 1D2CA 3FPAA 3VR3A 3ZR4B 1SUWA 1WPGA 5CX1A 4DNPA 4LN1A 5L3VA 3M5PA 1E2BA 2FWRA 2VJYA 4R31A 4JBWA 5DX0A 8OHMA 3EZ9A 3NT5A 2KLBA 4FDMA 4NONA 3K2BA 3LL7A 3S99A 3BABA 4KV9A 1M3SA 4FIZA 4ZYTA 1I5RA 1IZ9A 3ZOKA 4FEGA 3S2YA 1YS4A 4IFBA 5B58T 1LDBA 2XYPA 3BMOA 2NNLD 5FTMA 3RS3A 3TPZA 3NWEA 2VG8A 1CQPA 5TMBA 1G63A 4ALJA 3BSWA 1TKBA 4DV3B 1V25A 2VWQA 3H4DA 2VHTA 3CCFA 4GGOA 2J9ZB 5KOYA 4JJFA 4NYJQ 4NMMA 4QJ5A 2YJ5A 4UUAA 4A8HA 2DFPA 2I4TA 2ZUSA 2ZR8A 1RC1A 2I9KA 4JEMA 5I4BA 4B09A 3BE8A 2E48A 1C1HA 1OLSB 2OO5A 2O4UX 1LX7A 1F2UA 2PA3A 1JBKA 4RUCA 2R7ZA 2C5HA 3EZNA 4O7YA 3T4XA 1ODKA 2PT6A 3G8YA 3NANA 4PG4A 1QTRA 1LBHA 4TLDA 3DV0B 1WDLA 4HGNA 2H85A 1Y81A 2ZI7A 5FLMG 2ZK7A 1DAFA 5IYBG 2QV7A 4XVRA 1Y3AA 3V4FA 4MQ5A 3PLRA 4ARSA 5CCDA 3INNA 4BC0A 3GA0A 4GZ6A 4F3RA 3STTA 1XJCA 2ZOSA 5C8DA 1BD4A 2E7ZA 3ND5A 4WADA 3REQA 1F12A 1NIJA 4HQ6A 3L8CA 4BKRA 4DSUA 2RHDA 1SKAA 4NENB 5G4LA 4CT4B 4KC0A 1L5FA 5ABPA 5DYGA 4GKJB 2JAOA 3AEUB 3RRJA 2JIOA 4B3JA 5BVGB 5FO0A 4ZOAA 4Q43A 3K0CC 4BFLA 5JMTA 3LGSA 3NEJA 1YIAA 3C3XA 4UM8B 3W7BA 1M76A 3O3CA 5IAAA 5BW5A 3TNLA 1US8B 3WAJA 1B14A 2RIRA 2BIFA 2FZLA 2P3QA 3JSLA 4AAYA 4ESVA 2ZJBA 5LCXA 5CG2A 5TPWB 1EX1A 1EI9A 2BI8A 4P54A 2PQ6A 4XQCA 4MW6A 2YXDA 4M8NE 3HJFA 1JU3A 2J09A 3TRKA 4HVTA 4FHFA 1EVKA 2PYIA 4F8YA 4IDCA 2UYCA 1LK7A 1W4AA 3WADA 3IAUA 3FFAA 5B6PA 1QVRA 4DC1A 3ZDEA 2ZJ7A 1QZUA 1TK3A 5KSWB 1WOMA 4WESA 1VL5A 3G85A 4IGAA 1QVWA 2QUZA 4GPTA 4JLJA 4DQKA 2M6LA 1YA6A 1TVKB 1PFGA 1VP3A 1DPFA 2CFRA 2WKQA 3LHSA 1XZ8A 3TKYA 4B0PA 4AKSA 1O94A 1X77A 3NAZA 4YVFA 4BOYA 4DSAA 5JD6A 3D5TA 1SKMA 1MT3A 1ZZEA 3DKIA 3KB8A 1Y5RA 4LSMA 4RZUA 5BMOA 5JJ5A 4BWFB 2XV1A 4ILKA 4LJ4A 3ROZA 1RP7A 4FZRA 3RH0A 5E7QA 2I3ZA 3GY0A 4MQBA 4N0PA 4BMVA 2WQ7A 3WLMA 1FXSA 4DOMA 1ULTA 1UOOA 1SZDA 4FW9A 1AK1A 1QKIA 3HKBA 1CSEE 3ZQ4A 5JS7A 1N6HA 2FZEA 3IP5A 2O2JA 1EWVA 4BGDA 3M6LA 3BCRA 3QKRB 3N2GA 4B71A 3UKOA 3KSAC 1E8DA 3FR8A 1L4BA 1ISSA 3H2IA 1G21B 1R9JA 4CV3A 4Z4CA 5EUBA 4E7OA 1WR2A 2XMGA 3JQDA 4P7GA 1P0FA 3RYHB 3F98A 1PU2A 5HKBA 3RGGA 4P4LA 2ZDHA 2CNOA 5HDQA 1A9ZA 3GOQA 4RX1A 3A6FA 1WRBA 2VYVD 3DDOA 1LLQA 3CX7A 2LBPA 4U8HA 4HGQA 1T8WA 2GOYA 3QOWA 4KMRA 1J90A 4M4SA 4ANFA 4DS3A 1CJBA 4XDZA 3EWAA 1I2AA 4II7A 3ZW8A 8ATCA 4FGJA 2COEA 3HWX1 1QH9A 3GFPA 4G4GA 3K15A 4C6TB 1S2DA 5G41A 2PUEA 3I9LA 3SC2A 3TE7A 5GJCA 3W5JA 2V7GA 2BP7A 4KMSA 3SXUB 3BAFA 2WKSA 1WUYA 3DOCA 4EQ6A 2AD1A 3L8MA 3H1TA 4QUGA 3H2YA 5HUHA 2BFPA 3F74A 3OQIA 1P2VA 5EJ4A 4DV2B 2IEIA 1TL7C 1RM3A 4GNKA 4WWHA 1Q7BA 4YR0A 2ZSUA 5I3ZA 3COJA 4PZLA 4YJKA 3MFIA 3CR8A 4J1TC 3W2FA 3A6HA 1O95D 4ENTA 2AG6A 1ECLA 3L8GA 4M0KA 5EUQB 2GR9A 3RABA 5BORA 2P0AA 3EQ6A 1QHIA 4O7LA 3REGA 4CMHA 2JB9A 1W76A 2WUVA 2YZ2A 3G1TA 1AVTA 3UXEA 3IUYA 3RVMA 2FPKA 3IJRA 5T3UA 4QWBA 1CJTC 4CI0B 4Y0NA 2BW0A 4C9BA 5JVDF 4AZ0A 2ZAIA 3MPOA 4R2JA 4KLNA 2XD9A 1ENZA 2AHOA 2I7VA 1K2WA 1PWZA 1CK4A 1ZL0A 2PZLA 1KFJB 3EDCA 3ID6C 5KTSA 3L5KA 4BKQA 1T3TA 2Y9MB 2VPXA 4BZZA 1TWCA 1NBEA 1S4QA 4C7OA 4OXXA 4MA4A 1PS0A 4Y6RA 3M4IA 4U9HS 4D8VA 1NHGA 3OC6A 4UM7A 3FTQA 4JWTA 1T5OA 5EWJB 4AZ3B 5HFNA 1JHOA 4QGSA 3T9DA 4GPIB 1N0UA 1Z47A 3JAMW 5FLYA 5CCBA 1K8QA 4MV8A 2VH1A 4D3ZA 1FNDA 3FB1A 1CUJA 2X3YA 4O4HB 3THYB 2PZAA 4BEJA 2I3AA 1XZMA 1E0KA 3H4VA 2WPNA 1EFVA 1U0FA 4RY0A 1CS0A 4IGFA 1GZ3A 1GA1A 5FQNA 3HKDB 1QBKC 3UMCA 3I9JA 4EY8A 4ZDJA 1W49A 2SKEA 3LUJA 2QAGB 3KQLA 4OQLA 4C14A 3TY5A 5KFIA 1KFEB 3DNPA 1L7QA 1AF4A 2CUKA 2FWMX 3GIMA 2HA2A 2C57A 2OV2A 4GMFA 3CLRC 3GUVA 5FLKA 2AJLI 3ZE1B 4G0YA 1SCJA 4XH9B 1L4MA 2GUGA 1GYPA 3KVNA 3IVCA 3GARA 4IHKA 4J0IA 4EQ5A 3DOFA 1B74A 3O8CA 1YFJA 1NLZA 3IOCA 2WV7A 3KOOA 3LHIA 4BVFA 2EFHB 3N8DA 3R5KA 1O6CA 5SZIA 2ZM6B 4JJ4A 4JYPA 1Z6YA 3NLLA 3ZLBA 1X7WA 1CEYA 2WT9A 1CG6A 4LI0A 4ALIA 3AUXA 4RCZA 3S7TA 1OT3A 4JUFA 4A8PA 4CV0A 2QMHA 1TCAA 1FQJA 4D9CA 4JJ8A 1J00A 3LX4A 4Q21A 4QNNA 1DV2A 3RPEA 4MVXA 4M0JA 5DOVA 3W2IA 4BV9A 1QYIA 4MDEA 1ENOA 2W2MA 4WT7A 4FZVA 4O7TA 1YRHA 1FLNA 1W5BA 2VPYA 4RK5A 3ZE0B 4G1UC 4H15A 1FRFS 2G08A 3ELUA 4Q3LA 2OCBA 3W3AD 5ECGC 4LSGA 4EFNA 1P8JA 3TINA 2C5LA 2EAUA 5E3JA 4RK6A 1NW5A 5EE5B 4GLLA 2P3OA 5K0CA 2BJVA 1GUAA 3OLWA 3PD7A 4FYWA 3IG0A 4ZK6A 1OI7A 1SQ0A 3EIFA 4Q9JA 5JWHA 3BMXA 4EG3A 1A7JA 2PVSA 4NCHA 3UPUA 1TA4A 1KL7A 3H2HA 2LIVA 3HY4A 5J9FA 4AJKA 4ZKDA 2O0HA 3BK7A 3MCTA 4KLRA 4C6TA 1DVRA 1X2BA 1GGHA 3I4MG 3LLSA 4DR4B 2KBFA 3J80A 1AXGA 3E7FA 4CEJA 4X1KB 3BRQA 2ATIA 2JA7G 1P0MA 2CDRA 5KQSA 1KP9A 3YASA 3RT1A 3KOMA 1WB5A 4D0NA 1GXSB 4V0MA 3WKDA 3WQBA 1F8XA 1MH9A 1NULA 3BQ9A 3EA4A 4KGVA 4L6AA 3IPXA 1DQRA 1O5IA 2QRKA 1HPLA 2YVKA 5CJ2A 1PEKE 4PQYA 3G8DA 4G1FA 5ANRB 3D1VA 5JCJA 1NV9A 2IYUA 1H0KA 1Z9BA 3PTAA 5IJXA 1DDGA 1W1WA 3BZWA 3LYLA 4IUBS 1N2GA 4LAFA 3JYNA 5LMZA 1TW2A 3KLMX 3WGTA 3O0TA 4FC7A 2O3JA 2EZTA 4YB8B 4P5DA 3T41A 3TLMA 2OYSA 3FVRA 5C5DA 2Z6VA 4HYTA 3GVIA 4XYEA 1C1DB 3CKYA 1IL0A 2OG2A 5AK3A 3SAJA 4LMBA 1UQTA 4BNJA 2FMAA 4DIKA 2HNBA 5CLFA 2CYCA 4IIFA 3C1OA 1K6MA 1IBMB 1ZUWA 3QU7A 3DNFA 1Y63A 1QZ3A 2OBXA 2VHXA 2HDNB 5EHIA 1Y4SA 2W6PA 1VJDA 3V1YA 2B8JA 1F6DA 3V97A 3C3AA 3C3JA 3BK1A 3SCZA 1OLUB 5MDHA 5AKLA 4OHZA 4D46A 3HH8A 4W5WA 1RW4A 3OPMA 4IKOA 4EEZA 2ZZNA 2VKTA 2XTMA 3AUYA 2FZWA 1G3QA 5DASA 1KH2A 3OZEA 3LLUA 2HJWA 4AJEA 4FEYA 3Q41A 1RWXA 5CB8A 1X8JA 4IWYA 1HYHA 4YT8A 3TMAA 2RONA 4X85A 4BO2A 3PWTA 5HZKA 5LWHA 4R9UC 3HCCA 2CKMA 3NZEA 5JS6A 5J4KA 3G6WA 4LYDA 3DBVO 5IKXA 2EFJA 4R05A 4W9RA 2J3MA 4ENVA 3DULA 3B1YA 3HCNA 3IULA 3OHPA 4IEEA 4Y9TA 3L8DA 1T1RA 3ESAA 4LF8H 2XOXA 4NCIA 4U63A 2J07A 3UJBA 4BGUA 4F2WA 2HCTA 4YAKB 1CR6A 1JJAA 3T7CA 4H0NA 1HDXA 1NYLA 4CKEA 1NBIA 1XHFA 1ZXLA 2CNKA 4LTDA 2JD2A 2HMTA 5EVJA 1WXEA 2C29D 3VPCA 1PX2A 4Q4CA 4IRCA 3B6MA 4FNOA 4KXQA 3HJCA 1OFUA 3SGLA 1SULA 3QPVA 1MD9A 2I76A 3LWBA 2GN9A 2IEBA 5CITA 3HU3A 3P32A 4M9QA 1TLTA 3CLRD 3X2FA 5GZ3A 3DZBA 3OCXA 4BKPA 1ZN7A 4RMHA 1IXSB 3EVCA 4RUKA 4XM1A 5JH7B 1F3LA 2AX4A 3I30X 3ZV7A 3GT4A 4JBHA 4Y2QA 4GM4A 1BFUA 4ND2A 2J87A 3VHXB 2LIPA 4BO6A 2BZ0A 4M1QA 5FWYA 1BE8A 1F0NA 3ZG6A 2OY0A 1P75A 3AR5A 3E5MA 4L3OA 3DAOA 2XPCA 5C31A 5E1DA 3RC8A 1R66A 2VQ3A 1T0UA 1W1UA 2CLMB 3VVCA 1S8FA 3RWBA 2HRRA 2WP8J 4D99A 4NMHA 5H80A 4FMBB 5JJKA 1KSFX 2C54A 1SUCA 1L3BA 1UCFA 3HUFA 4QE3A 3WFIA 2YJTD 4DA0A 4FYMA 4X1OA 1BWQA 2H1LA 2Z4RA 1SWVA 4MEJA 4UU0A 1BAPA 1RJQA 1UPXA 3ZE2B 4GZMA 2E55A 4RSHA 5GZ6A 2CNLA 5CFMA 3FPKA 3H65A 1E1KA 3QIAA 4M1ZA 1Q0LA 2GCEA 2OQ2A 3NOQA 1YDMA 2GKOA 2GQ0A 4RVUA 3J81A 1JFFB 4A0RA 4FE2A 1E7QA 4RF4A 1SPXA 2C7GA 4HI0E 1N2ZA 2EVWX 2GMWA 4L15A 4HN2A 1IYZA 2HV9A 2X3FA 3FCYA 3CF2A 3FYCA 3E7PA 3K0FA 3T3IA 1E5LA 1U9JA 4HDMB 4R1NA 3AW9A 3EXHA 2C95A 4AG3A 1ZOLA 2A5LA 4DLKA 2MSLA 2D62A 4C0QC 4KQXA 4EO7A 3IA7A 3TOCA 2V6BA 2IGBA 2X19A 3HXQA 1KYWA 4L8WB 3CO5A 3RKUA 1GGMA 4HL6A 1Y7PA 3D3WB 3SBEA 3NDBB 1ISGA 2C5FA 2W6MA 3LK7A 2BFNA 1WV0A 3IA2A 3GNQA 4B4DA 2JD0A 3KEOA 4EVRA 2P9YA 4HB3A 1M66A 3D8RA 4JYMA 1PZFA 1YDFA 5EWMB 1S68A 3ZGLA 2R48A 3C24A 3LMLA 1N2CE 3HR7A 1N0WA 2R8YA 5IW8A 1U3UA 1Z7YA 2GEUA 4NYEA 1KZ1A 3SNOA 2ZANA 3CZPA 3OOYA 4R5HA 2HCBA 3OX1A 4Y8VA 4Z9YA 1XROA 1GP2A 4J8PA 4IIYA 5COQA 3QG5A 3ECAA 1HYBA 3B1FA 4XLTA 3GRKA 3GAFA 1PR3A 1NRIA 2NX2A 3WRWA 2HA3A 1GO3E 2WP0A 1W87A 3OOHA 1JIVA 2WMOB 3UCXA 1CJUC 4UCTA 4WUVA 2IYEA 4ZI7B 4GMXA 4E5SA 5K03A 4ZVOA 2NXCA 4EI7A 1W44A 2QN6A 1P0PA 3HACA 3LL4A 4XGNA 2CGEA 1SCQA 3CR7A 3ZV4A 3JRXA 1JG3A 1QF9A 4M1YA 1Q44A 1RMQA 1P6QA 4BB0A 1VSBA 1NPDA 1VJRA 4JLOA 3NEYA 2AHRA 2A1UA 2PIAA 3SG0A 3W6ZA 3GEIA 2CEAA 5AJVB 4XUEA 3AF3A 3LZ6A 2PUWA 1ZUNA 4G26A 3AEYA 3LT0A 4QOSA 5JRDS 1K4KA 3OJXA 5KYXA 2BGNA 3GU3A 5AJUA 5K0NA 1UOEA 2NQTA 3Q7EA 1U1EA 1YDWA 5I9LA 4TQRA 2C3YA 3PR1A 3ZXYA 3S81A 3GDOA 1C14A 4BQPA 3U1TA 5ADWA 4MTCA 3QXGA 2GKGA 3LQYA 3NRJA 4L5YA 4NNJA 3GTOA 1TAQA 1E5QA 1PZNA 2V6FA 4Y7CA 3AR6A 4MJ3A 1GTVA 4Q8EA 4H3SA 1JG7A 1FMLA 4MWCA 4EB3A 1Z25A 3NYQA 1RPZA 2AU0A 1YS1X 2NG1A 2YICA 1AN0A 2I3GA 4YRQA 4GKAA 1QV6A 1Z4QA 1YB6A 4B2PA 3A1EA 3N8NA 1Z6ZA 3GV7B 4U6SA 5K8VA 2O57A 2FFJA 2IQIA 3EDYA 1DE0A 3MRVA 3SKVA 4NCXA 2R00C 2Z8ZA 3G2QA 1FW8A 3GRVA 3QEMA 2BH2A 3EH1A 2VCHA 3TD2A 2B0JA 3HCBA 2XQVA 4A2AA 1C3JA 1C50A 4KWHA 4UXIA 5F23A 2YIDA 4YJ3F 4XJVA 5F2NA 1EZ4A 3STHA 4FKMA 4W5JA 1HRKA 1AB6A 2HHCA 3KFLA 3UG6A 5DCUA 3ZHBA 2OHJA 2VRNA 4BO9A 1ZNZA 3INYA 1XBTA 3I9V1 3R5SA 2C2MA 1TT5A 3ZDRA 2VDOB 3B1ZA 4KUGA 3DR3A 1N6LA 2HRQA 1DOAA 1OA0A 2HHJA 4IQ8A 3UUWA 3KKOA 3EPKA 3X1WA 1KP3A 2JVKA 3M4NA 4U00A 2UXBH 3SYNA 2VHJA 3MAAC 3BXOA 3UYLA 3R9XB 3LCRA 3N42B 4OYLA 5IUJC 5B1DA 1KS9A 2UV8A 3FVTA 2YIMA 3QG1A 1P9NA 3O84A 4R9RA 1ACJA 1LBIA 3GPDG 5EIEA 1W5EA 5KYUA 5IWCA 4MKXA 5F33A 4GDMA 1XLTC 4HDAA 3ADCA 2D5LA 2PT5A 5F1PA 5LMCA 1NOJA 4P4SB 5L4NA 2JA6G 4DAAA 1ESDA 5TQ0A 5CP8A 4YLEA 1VECA 2C5EA 5JZOA 1P8AA 2ZYRA 1C9YA 3Q2OA 1WOYA 3LBYA 1DEOA 4PGGA 3ET5A 1U90A 1C7ZA 2JHGA 3RFTA 4R6WA 2Q5IA 4XPIA 3K72B 3A9TA 5EWMA 1K9VF 4FS3A 3RC7A 5K3FA 3ZK9A 4C01A 1IK4A 2VT6A 3D31A 2PS1A 4Z2AA 4B32A 2C4WA 4NXNH 4C07A 3QYAA 5FD5A 3LDUA 5JYCA 5IHXA 3D3WA 5HA5A 3VJMA 1PWYE 4GW3A 1RTKA 2I62A 4OJYA 4XW2A 4EFMA 1HDRA 1ZXXA 4MTEA 3TW8A 4DDWA 1JR4A 2PJZA 1C81A 1X19A 2ZRNA 2YZMA 4NEHB 3FTDA 1G18A 3WOVA 3DP7A 2YS6A 2W2PA 2J3EA 3IB6A 4KW7A 5AKEA 3RLFA 4X97A 3RRYA 1H9AA 1NW7A 3NTVA 4ZVRA 3SGIA 2J0QA 2A30A 1BH6A 1W4CA 1WP4A 4D1YA 2PX6A 1XCOA 2F43A 1NJ6A 3ZGOA 2PVCA 2Y1CA 5DCLA 4D8XA 4F3CA 1WA5A 2ZRAA 3PC6A 2ORWA 4X20A 1YOVB 2IVFA 3P0EA 4WFJA 3QLEA 4KO2S 5CH3A 1NW4A 3ZI7A 821PA 4BY1G 3LM8A 1G41A 3WLFA 3KO8A 4K8OA 4OP2A 4XWKA 2AXQA 3Q2KA 3HRKA 5K0FA 5MF6A 1Q6YA 2EP5A 4J2OA 1IBLH 1DIKA 4PHTA 5CW1A 2HU7A 1YK1A 3EGXB 5L4LA 1H8EA 5H9WA 1AD2A 2PYZA 5IAJA 3NS7A 1A8UA 2XT0A 1SURA 1JDBC 1JWBB 1QCDA 1WVMA 3IOBA 2NZYA 4X3CA 2RK4A 1QYCA 3UFXB 2OHVA 5GJWC 2QYZA 4HPJB 1XHEA 1Z4IA 2YNMC 2H7XA 1S3SA 4DARA 4M0UA 4CETA 4FFDA 2C83A 4NAVA 3H2ZA 3JCZA 4R83A 3USES 4KMOA 3DTVA 3LO5A 4HLUA 5EESA 1KQFA 4M36A 2EGGA 2XZLA 4HUQA 4TTQA 1QE3A 4Q5IA 3IS3A 3MINB 3VPHA 1VGQA 4MYDA 4EAQA 1CJCA 3I1FA 3BFXA 4ZICA 3DVQX 3HBLA 3CWQA 2MOKA 4QULA 5DM2A 3FGOA 3NX4A 2PUJA 4DC0A 1YVPA 3L6UA 1RFGE 2OO3A 1ZC4A 2QTHA 3GG2A 3K7EA 2HCRA 1U2QA 2G1KA 3DZ8A 4A8JB 4CFYA 2QWXA 1GKIA 4AIRA 1R0RE 4KDRA 2I7XA 4COOA 5DT9A 1GYRA 1VZ2A 1TT5B 1D09A 3CRMA 5J63A 3OQOA 3D02A 3GJXC 2OLSA 1Y5MA 5HILA 3P9SA 2Q3FA 3I83A 1UK9A 4OXYA 4V0NA 2ONZA 2XWJI 3GDGA 1QH8A 5IH3A 2J33A 2NP7A 1TUBA 3KSUA 3A9WA 3WB2A 2GBIA 3L06A 3NHPA 2J31A 2HWWA 3N2YA 2UAGA 1FDWA 1U3CA 4F2PA 4HX5A 1FVIA 3GFTA 3I1JA 4X64H 1M1YB 4BAGA 1Q0RA 1W5SA 4CDRA 1COZA 3SS9X 4II2A 3WL4A 1OIWA 2LGJA 3R75A 4BB9A 2FRDC 4ROTA 5AVZA 1M5RA 4UVEA 4G0UA 3K6SA 1Z0IA 4LOIA 2QMZA 4MIOA 3UMFA 4AYBA 2ZIWB 1BXRB 2Q5FA 3E0QA 5TARA 2W6ID 4EYSA 3C15C 5A5GA 2X8JB 3NBMA 5FYDA 4L22A 3CEPB 4GR9A 3MTDA 3EXG2 3UH1A 5AW5A 5B30A 3ZWWA 2VP3A 2WSLA 3KOZA 4Y2UA 1KYTA 1W48A 4FYPA 1GPYA 4MRPA 2XUGA 5E9AA 3RK0A 1AM4D 1NUTA 1SC4A 4H7DA 4AL4A 4D79A 4D5GA 4EG7A 2RG7A 1BU8A 2WJWA 5DGAA 3EXFA 3LQFA 4JKOA 5LWQA 1U0OC 1LWOA 1DBWA 2CB9A 3N2KB 3U31A 4MV9A 4FXPA 4GOKA 3PXGA 4H6XA 5IHPA 1QH0A 2FXVA 2OD7A 2YXBA 2IYOA 1E9BA 1FX1A 1NX6A 1EXMA 4OGFA 5F7JA 3W7VA 2HT6A 4FU0A 2PTHA 3I76A 4NU6A 3QX7A 5DGDA 5JD3A 3ZDYB 1XNGA 2DKFA 4L9WA 4YV0A 3O83A 4JLUA 1U5BB 3O3OB 4JJIA 5GZ1A 4LXTA 2IQ5A 1NFFA 3D6JA 1E2NA 1ZP6A 4HQRA 5D00A 2IWHA 3I42A 3D1JA 2G5TA 1VAJA 3Q2IA 4NIMA 4RL4A 5IFKA 3UM9A 1B2RA 4FWBA 2XUQA 1Q57A 1GNVA 1HDZA 3HYTA 3N28A 3RVLA 2R8JA 4IH9A 2XYGA 3AGQA 4QJ4A 2ALZA 3KVOA 4G37A 2QUHA 2UU9H 3C8UA 2XVMA 2RARA 3K0KA 2IX9A 1N2OA 2JHAA 2OC9A 2A1IA 1WHSB 4EPYA 4TYNA 2FQYA 1VE9A 3GLUA 5EN4A 1G5TA 3LUDA 2YJ4A 4P3XA 1JXLA 2ZU6A 4BN5A 3W0LB 2FN9A 5GY7A 2P6NA 4JBIA 4JC0A 4KFTA 3I2GA 2CN1A 2E4VA 2A3RA 2JK0A 4YLGA 4LF8B 3B8HA 4NU8X 3V4OA 2B8WA 3LULA 2XYHA 3RBEA 4MV6A 2NGRA 2GAAA 1MOZA 3C7KA 4GI7A 3LFTA 4XAQA 3V4SA 2OXTA 5AR1A 2BD0A 3PICA 5FTJA 4ZT7A 3CWZA 1A77A 4DR2B 4KR3A 3V6JA 2E4ZA 1YTUA 4CMCA 1NG1A 1AK9A 3A04A 1NSFA 4X45A 2JLCA 3PFIA 1Y9ZA 2V4UA 4LDAA 2X9LA 3GPCA 4G3IA 4Q7EA 4BLQA 3T1QA 1I2KA 2JLXA 4V24A 4H3HB 4UNNA 4MMYB 4OHMA 4MUGA 4YMVA 2IYZA 3WGNA 1OI2A 3K2IA 3ZIAA 2E4UA 4N1AA 1E3DA 1L3CA 4ZJZA 4HYKA 1R6AA 2D00A 4HWPA 2WHXA 4Q00A 1CEXA 1XRNA 1BVYF 4TXMA 2PD3A 2FG7C 2QU8A 3AFGA 2UUAH 1YE8A 2BUAA 2IPOA 3PGVA 1GSHA 3CF6R 5ENDA 2B2NA 2JIDA 3LCMA 4I1PA 2BCEA 3DD5A 2P35A 4L07A 1FVHA 1ST2A 1ZG3A 4HDSB 4J43A 3UAOA 5P8WA 1A4RA 1OIVA 1BHJA 4BMOB 3MM4A 1J5XA 2ID4A 4U2GA 1GGJA 4CMEC 2JATA 2QLTA 2LCFA 2WHYA 1K66A 1GG2A 2Q5LA 3OOJA 1OILA 1TFUA 1F2UB 4RJLA 1JQ5A 2N46A 4KG7A 1RYNA 1JEYA 4PXYA 4PGHA 5J47A 5TQ2A 5FJIA 3W6PA 1PDWA 5AW3A 1JFRA 3QZ8A 3KSZO 1KSGA 2CXTA 2WABA 3THSA 4DW8A 2MYTA 4N7JA 5C2JB 3HRHA 4YAJA 1M2HA 5CDGA 4EARA 4A3FG 4F11A 4YAKA 4JI3H 2DPIA 3GELA 5DTMA 2Y0SE 3RTEA 4CR8A 1EGMB 1KIFA 4TRMA 4OK6A 2O2CA 2BMFA 3OFNA 4LWQA 4TT3D 1PI3A 1VIMA 3IDZA 1HLFA 4Z4FA 3GF4A 4IGIA 4D3FA 5IJ0A 3NBYB 5AQ1A 4EMUA 3AU9A 3H4TA 1QKJA 4PLFA 4QEDA 1X3SA 4RM3A 1DLJA 4L0CA 1PHRA 2A57A 4XI9A 3IERA 1R0WA 4O59O 4ZOLA 1EK2A 2V3VA 3M4XA 5LBTA 1XMVA 4ZK2A 3VHXA 4EW1A 1LQUA 1SG6A 1VE6A 4I3GA 1QF7A 4NJMA 5TGTA 4WBXC 1B3RA 3N1UA 3EVAA 3MTEA 1SOMA 3HDQA 3IO5A 2GEKA 1SOAA 3QX8A 4IXDA 4TLEA 5KFMA 1YR7A 2W7TA 4BNDA 2OWDA 5KVSA 2RK3A 3GA5A 4I4NA 4LC9A 4YNBA 3FA2A 3CX6A 1HNZB 2XJ4A 2UU9B 2ORYA 4CQMD 1S3IA 2YFYA 1E3QA 4B75A 1G4UR 5KNCH 1QP0A 1DHRA 3W9BA 2P62A 2WF8A 4E6PA 2FK2A 2A9KA 2D5IA 1CZUA 1DADA 4PC2A 1OXSC 4AUEA 4JA2A 5KJ6A 1M7BA 1C0LA 3S3TA 5BNWA 2R8EA 3D6HA 4YGXB 3ZDDA 2XOEA 4ZIRA 4GDFA 3SC3A 5LMUB 2CLDX 4YCMA 5AW0A 3JQAA 1M75A 1JPNA 1U0LA 2FUNB 3DMGA 3TYXA 4CMIB 4DKXA 2WG0A 4BBRG 3OVMA 1OZAA 1XHLA 4Q9LA 4AF7A 3JRNA 4N9WA 3D1LA 3AWIA 3QVUA 3WMGA 1ESNA 4G2NA 4OOEA 5K8IA 3MN1A 1SVSA 1RXIA 3EFHA 4R2MA 4YXFA 1T3NA 3QHAA 1WY5A 4RPLA 2Z02A 3AG5A 3LPMA 4PCUA 3IAS1 4TTSA 1AHPA 2FP3A 2AQKA 5K3BA 1T5DX 1FRVA 1AGRA 2QP3A 4H6WA 2H1OA 3EBOA 1JT9A 1K5PA 3DF7A 1Z5VA 4JVMA 4ZC1A 1GN8A 3FX2A 4WOKA 4A6PA 3GH3A 4DR3H 2V59A 1FSFA 2Q41A 2A94A 1S4MA 2VC2B 3F7NA 5C53B 4HX9A 2BF7A 3A11A 3W8DA 1V2HE 2HJ9A 2NT3A 3IXQA 4KVZA 1W6RA 1M7JA 4BN4A 2ZIFA 2R93A 1C8LA 3WLOA 1NKSA 2O2DA 3I4CA 4IDAA 3H6HA 4HWGA 5HFAA 1VHJA 4HXFB 1NMXA 5GVSA 1MX5A 3OMXA 4TYMA 4UTRA 3QE3A 3OAAD 5B3JC 4X84A 2X0RA 3GOHA 3KM0A 3L7DA 4FOOA 1MENA 4JUIA 3HDHA 4XDHA 3SLRA 2CXNA 4AZSA 4DCPA 5KC9A 3AHHA 2WJ6A 1NUHA 1GZ4A 2V7QD 3GW8A 3KOYA 5ICFA 4DN6A 3CSDA 3PVCA 2FWPA 4BTLA 1GD1O 1Y82A 4L57A 4EENA 5KX5A 3UKDA 1AT1A 5EQFA 2VSNA 2ACKA 2CLEB 4HLNA 1YF3A 1X7DA 4CKCB 4NJEB 1HDIA 1ZIYA 4X00A 3I2KA 2B5WA 2JZNA 1ZN8A 3VDXA 4PPFA 2JCBA 3OLVA 1EXNA 2C82A 3UB2A 1PZEA 4XPZA 1OBCA 3BWYA 1WIWA 3PX2A 4GYYA 4MYRA 3WIUA 4E2XA 4KXLA 1YJ5A 1JGTA 2ODPA 2Z9DA 2AMFA 2WJPA 3KJEA 1L5KA 4AZ0B 4D7AA 3OCYA 4G97A 4Z4HA 4BMNA 2MINA 2XYVA 5IP9G 4FM9A 4N0QA 1C9JA 4U2DA 3TUJC 2J3KA 3FNFA 5LP6B 2FQ1A 4DA9A 1UBHS 1TWAA 3EYWA 2Z3VA 3JTEA 2G7MC 1ZD5A 1IC6A 2PPVA 3W8FA 4CKWA 4NNOA 4RACA 2RFLA 3AP2A 4DMMA 3SC2B 1E7YA 1NQXA 4L7QA 3ULKA 4Z51A 4ZYLA 2BP7B 3SXUA 3EA0A 4P92A 1WRVA 3HCPA 1FEZA 1J33A 3L1UA 4L75A 1M2OB 4M9XA 4OHPA 2NW6A 2LW7A 1JEEA 5D7NA 5D6NA 3GUUA 5DWQA 3AKZA 2IUTA 5HIIA 3AXTA 1MO4A 2HSDA 4ZO6A 2CNVA 3ICEA 5DP2A 1Y3HA 1WXDA 3I73A 4QSHA 1W75A 2B30A 2H08A 4GP7A 4LHYA 3QFHA 1L5MA 2ZWVA 3L3BA 2PRJA 1PE0A 1LRKA 2ZE7A 1AUPA 3C97A 3PE4A 3TZBA 3UGKA 1YR9A 2N75A 1Z45A 2PMDA 2BISA 3ONDA 3PXAA 4FQ5A 4NCNA 4RPCA 3GJZA 4Y2YA 4KSBA 1JG2A 3QA3E 1QBGA 5AI8A 4ZAYA 2D1YA 4IJQA 3PW0A 3FNIA 1E1RD 1HDOA 2EKZA 2AIRA 3H8JA 1F51E 5D86A 3VZBA 4NMWA 4EFKA 2J7PA 1XU9A 3RT7A 3G9XA 1A5SB 1OCEA 3LF2A 2H54A 1TJYA 3GEEA 2ZJAA 3PFCA 4IQFA 1EJBA 5LM3A 3G17A 2C7PA 3ICPA 2Q7XA 5D3KA 4DLLA 2H2IA 2YS7A 3CXRA 3R5XA 1YB4A 2EL7A 3MQ2A 4G5QA 4PLPA 3WKEA 1G3UA 4Q15A 4XGIA 4D9BA 5AJHA 1KQNA 1YNOA 3NIDB 2G9NA 5JJLA 4MQEA 2OFFA 1TYAE 3QZ7A 1RMTA 4Y2SA 5CXXA 1RHUA 2BFEB 3OF3A 4WBNB 1IY9A 1VJ1A 5ELXA 1JHRA 1X86B 3A1TA 2QR5A 3F5FA 3HB9A 4YAUA 4K1XA 2QUKA 4TYYA 1CJKC 3AEXA 3CCBA 1X1QA 1G8MA 2I7DA 4CIWA 2XCTB 2Z2XA 5F64A 3QKTA 2O03A 1SFRA 2B1QA 3EDOA 2PUVA 3D8HA 3FMOB 4JD5A 5ALSA 4A0HA 4DXAA 2DX7A 3WA7A 3CR3C 1WAMA 2I6FA 5T4EA 2FP4A 2B92A 1D03A 3OJEA 1RM4A 2FFAA 2I1QA 2HQ1A 2NZVG 2TMKA 2J3IA 4Q05A 4W6ZA 4DEXA 3VAAA 1G17A 3W5DA 2ANCA 4Y1RA 2UUPA 3O91A 4U5QA 4GKJH 3LYHA 5MGNA 1K4MA 2VK2A 3TAHA 2PWYA 4BY7G 3W4KA 4DLZA 4D6XA 1NJ2A 2NO0A 1QYWA 4WHXA 1SJ9A 4CUJA 4ZYWA 1Q0HA 4S1PA 5AHWA 3KCQA 2EL9A 3W5AA 3QX3A 3W34A 1JALA 4TYWA 2XGPA 2ARKA 3GJ3A 1GPMA 1NURA 1DX9A 1DQZA 3GLTA 5B53A 3H8VA 3SPXA 1MPXA 3EWSA 4RAOA 1VCIA 1YH3A 1J24A 3IV7A 1M8FA 5K09A 4TTJA 1ZNQO 3RC9A 3R7DA 1T8YA 1E5TA 1T9KA 1RJRA 2Y66A 2ZR0A 1J97A 3DE1X 3NGLA 4ETNA 3WRXC 1QQTA 3M9XA 4XASA 4YJFA 3J7AC 3ESRA 4BMXA 1EUZA 4GYWA 1YFLA 5LMUH 4TV9F 4ARBA 3MCZA 4G1VA 5CEJA 4DJEC 3T5PA 3WJ2A 3ENZA 4KQGA 1BE0A 5KX5B 1JG6A 4F2DA 2G9RA 4LHVA 1EE1A 2HSGA 2JJ1A 4ZCSA 2XF2A 1IRIA 1C1YA 1T6BY 3E9MA 5I8ZA 3ZWBA 3EOBI 4DRXA 2D06A 4R3NA 4X66B 1BTOA 4K9SA 3ROPA 9ATCA 4YJ2A 1WLYA 2C8KA 3FFTA 3JQRA 3LRPA 4R8SA 4YFYA 3V55A 3N2ZB 1TQDA 5K6TA 4EYGA 4EW2A 1JVSA 2P9JA 5BO5A 2ZE8A 4NC9A 1NRWA 2AN1A 3P2YA 3GR6A 4RWEA 3EHEA 3FMIA 2CMHA 2ZBUA 4OD0A 4R71A 2D3TA 4Y18A 2PSSA 3IESA 1F38A 1LPOA 5HF6A 3WYAA 4RDHA 4ER0A 4A3EG 3TCKA 1PEDA 2VUSA 4HLCA 1XPRA 4Q9IA 3H6KA 3HP1A 4JYBA 4RSRA 4UFOA 4WJZA 5CRIA 5FAKA 5KREA 3PF9A 1Z6PA 4DRYA 3NM5A 3GJ0A 3OTWA 2W2KA 3A3YA 3FAZA 3GBVA 4EPRA 5LIRA 1OLUA 4IDHA 1X1EA 5K3DA 4TKVB 2X0NA 2X6TA 3PGMA 5FTKA 1RK6A 3UWPA 5KNDD 1L1QA 3DXXA 2NADA 4Q3DA 2KB0A 3RGXA 2DLDA 4WDRA 2OMEA 5ER9A 5JDIC 5DQIA 3N3BC 4IJ6A 2X58A 1RD4A 4KU4A 1WXGA 1SBNE 1IB6A 1Q3KA 3EOZA 3WMWA 1EWTA 3OZCA 3QWIA 5K8LA 3PNSA 3WMFA 4C78A 1C1DA 3JWJA 4OMCA 4BFCA 4C0LA 2HHHB 3CBGA 1D2AA 1K89A 1KI3A 3H1AA 1VFNA 3DMNA 1KJYA 4G0XA 2L17A 4DMLA 1J39A 1WB6A 2G25A 3A1CA 3QBJA 1C7RA 3SM3A 4BYMA 4F45A 1EG2A 3H40A 4DLAA 4D97A 1WB4A 2XQGA 1KPGA 1VCHA 4XJSA 5J5CA 4CIVA 3FVVA 4FEAA 4OI2A 3AI7A 2Y05A 1Q11A 2ZYIA 4AQYH 4QOEA 4EELA 3EULA 2XCLA 4LJ5A 3KQQA 1Y6JA 1UAYA 4ZZ1A 1EDEA 1JIXA 5KT5A 4HADA 4L8LA 2IHKA 4KFRA 1QFJA 1OKKD 1YQXA 1EK1A 4QPZA 1CRQA 4CLOB 1IZZA 5IYZF 1MIOA 3IMGA 2WJVA 2QSUA 2CE2X 1C29B 5JAUA 3L6OO 2GRAA 2J4FA 1KKUA 1YB7A 4IEIA 3EZXA 4MS3A 4NG4A 4FLFA 3VR3D 4DBZA 4XYMA 3SSOA 1A7AA 5CXQA 1TQ4A 1G2QA 5FD8A 1Z63A 4MI1A 4B7UA 4BEVA 1NXVA 3VKUA 4H0FA 3CY6A 2OORA 5LQDA 1DC3A 1P5FA 4M1WA 2QQ5A 3E9CA 4ARUA 1DJMA 1QCCA 2O20A 2X7XA 3FWPA 3EMVA 3PUWA 4O4LF 1B26A 1B0PA 1ODCA 2WV9A 2SHKA 3DE5X 3ANYB 3INGA 2RCYA 3NDIA 5G4KA 1KO1A 4ZJYA 4UZEA 1VIVA 3T0GA 5GIOE 1G7SA 4ZZIA 1K5GA 5KU7A 3QVWA 2P9BA 2QTZA 5C7YA 7ADHA 2JD1A 4M7WA 1JZQA 2UYHA 4FFVA 1A9SA 2BL4A 3W5SA 4O7NA 2FX2A 3WFJA 3VU8A 4C6HA 2F1JA 2PGOA 1NMSA 4DZZA 2DFTA 3IUBA 4AUNA 1MC5A 1VG1A 5DCYA 3TTYA 4A1FA 3KQMA 1A27A 3MMPA 4PFJA 4ZA2A 1XZFA 5F3WB 3ZLVA 4N3BA 5BYJA 1SKUA 3AV0B 1CFZA 1L8AA 5FWXA 1E7WA 1WZEA 1KMQA 1XDDA 2GNOA 3DB2A 3EMKA 3TLAA 1CULC 4GPEA 5EJ7A 3A1VA 4ZU1X 2J6IA 3ZCXA 1B04A 1M8GA 2WIKA 1IPFA 5EG5A 2R9VA 5LJLA 2OZLB 1G8GA 1S8NA 3NUAA 2DYKA 1Q92A 2P2SA 3KSDO 1FLAA 1BCSB 3ZY2A 1WVIA 3D3KA 2ETVA 3RYHA 1TEVA 4RULA 1WMSA 3HU1A 4IY1A 3TOSA 2ENWA 2QRHA 5T6BA 5EJAA 1NDHA 2L2QA 1NYQA 2ZRCA 2DFKB 2PXHA 4KPYA 1CUSA 1QRUA 1YXMA 2FWJA 3AVQA 3FWZA 4BNGA 3EWIA 2O50A 4QSMA 5BXQC 3BRSA 4MV3A 1SUEA 3U17A 1DARA 1DXYA 3O8LA 2Z5LA 4LYYA 1K0UA 1QK5A 2MT9A 3MJTA 3TQHA 2CFOA 3UUGA 3GLGA 1JQJC 5KYVA 2VS1A 3BEOA 3C5HA 1ZGJA 1M10A 2P27A 2VQSA 1KE1A 3TEMA 4MWSA 1SELA 3P9XA 4NJOA 4PVCA 3HNRA 3I4LA 3M6XA 1GTSA 3LPNA 1DEKA 2YJGA 3DVRX 3H17A 4RQUA 5EHZA 1W73A 1M72A 2R8BA 3MJHA 3ZTTA 1B33N 3DKKA 4RIIA 4AG5A 1ZRNA 4HAVA 3EIEA 3KZVA 1Z08A 1A2OA 3NBKA 1BEZA 1H5UA 3FWYA 3BUSA 3MGKA 3QX9A 3S2ZA 3VR5D 3AOEA 1IJFA 1RRMA 4Z7JA 4OX9Y 1M1UA 3JYLA 4KSYA 4OXQA 3VV3A 2FKAA 1Y1WG 5KJCA 4Q19A 1T25A 3UWDA 1Y9JA 3BAAA 3WA6A 3ORFA 3M34A 4JI1H 1Q6ZA 3BA8A 5ICMA 3IT1A 2JF0A 3DCJA 4YALA 4LFAB 2GI4A 5B4UA 1LW6E 1PG0A 2QY6A 4ZRMA 1P4JA 2ZYAA 2H2HA 1N33H 3OM9A 2GBLC 1ET0A 5JHGB 2JIZA 2YV5A 1MHPA 2ZM6H 1KI9A 3PNVA 4PLYA 1EIWA 3WLJA 4EEXA 4QFCA 1VB5A 4G07A 1MIOB 3QWAA 4W6QA 3WVNA 3RU3A 2AGPA 4LF6B 1CDEA 2OHHA 3FHJA 4HDNA 4QLBA 5FOWA 1C7EA 1ZGHA 2A0WA 2PUBA 3ZDCA 3FRHA 4IZIA 4AKGA 4U3JA 1XLTA 3E58A 2BM9A 5SY6A 5JIBA 2GM3A 4Y2VA 1JEYB 4A1OA 1RKXA 3B2NA 2WUDA 3I5AA 4EQZA 5DM0A 3LY8A 4YPOA 3H1EA 2DEUA 3H5WA 2O8FB 1SBIA 2Y6VA 2H2GA 2D1QA 3DW3X 3L41A 3CLHA 5EJMA 4DLTA 1Q5PA 1SQGA 4AROA 3A7EA 1WXFA 5LXTB 2QAGC 1L7MA 4F3YA 3KT6A 4B4VA 4B8ZA 3AIOA 1YR3A 5JAZA 1WKCA 4A3JG 2O6LA 2YN0A 3LLVA 3OM0A 1UBTS 3OTQA 3JR3A 3K8QA 3OT5A 4HG2A 4V2UA 3K3PA 4QTYA 3R0VA 1QPGA 4F1KA 4C0AC 1SHTX 5DBFA 3EEQA 3E8XA 4JQOA 4LK2A 4NTZA 1YKFA 1Z0DA 3CRZA 2HOQA 1EAYA 1XXHB 4I9NA 3PUKA 2CUZA 2VRWA 4ZOLB 1H2XA 1AKQA 2G17A 2D59A 4GFDA 2I8AA 3SN6A 5HS4A 4JV2A 5JNLA 2JGDB 2REQA 1UF9A 3A4TA 5IYDG 1VJGA 3HN6A 1UMDA 2DQYA 3JWPA 4MRAA 1TQ2A 3FBGA 1DXHA 1TAUA 3SJUA 3HPQA 5EJIA 3X44A 2R7NA 1QKKA 1OBDA 1K1SA 2C2DA 1VMAA 2ZAMA 1P4HA 2C4MA 3JYQA 3RB3A 1FXUA 4LHWA 3OICA 1NJ1A 3KJFA 3LBHA 1YU6A 4IUCS 4DLNA 3NU1A 3AUTA 3TVTA 2PX5A 4HQLA 3UMJA 5DW0A 1CHNA 1OD6A 1XRJA 7REQA 2NXJA 2XQFA 4OYHA 2QR3A 4UVGA 3KQUA 4NAUA 1YJXA 3OECA 2IWRA 1JPUA 1FMTA 2V4QA 2CDCA 3HBJA 3H6GA 3LSTA 4MVJP 3RJTA 4IDGA 1H85A 3T5DA 2NPIA 4PX2A 2YX1A 2RDIA 3IR7A 1B41A 4AY3A 1YRLA 1CJSA 2VZ0A 3NKVA 3OIDA 1KP2A 5FL7A 3IVMA 2Z30A 5JW6A 3E7WA 3N58A 4INAA 5DSTA 3WIOA 5A5FA 1N6NA 3PQ7A 4X24A 3EFEA 4QHTA 4ZYZA 5CYGA 1DLIA 5IVDA 1STOA 1G9TA 3OQBA 4KQ9A 4OAPA 1ISMA 2HJSA 3AGPA 1USGA 1WPRA 2IOQA 1GCGA 1C8BA 3A6PC 1N0HA 1J21A 5HK8A 2QF7A 5A3QA 3PDHA 3B12A 3QPAA 3C48A 3OOEA 4N5NA 5FAXA 3WWPA 3AVYA 2PKXA 4PQEA 4D82A 2PR2A 4YPFA 2AFHA 3RRZA 2JHFA 1FTYA 4JOSA 5ILQA 3LQSA 2I9PA 3LY5A 1SCAA 5FUQA 4UAVA 1NC3A 4J3FA 4UQLA 2QG6A 1TU4A 3HCAA 5B1YA 1OZHA 4AJ4A 4IRDA 1O94C 1FU4A 2C3OA 3TQOA 1HEIA 1IWBB 4AO6A 3I2IA 3D2BA 5DBGA 3X43A 4UPDA 4DILA 1XFDA 1ZGAA 4NPHA 3RWOA 4P7FA 5KFVA 3LDAA 4KO8A 4B2IA 4AMBA 1A9XB 2ZRIA 3ESCA 3WO1A 2QT9A 3EQ9A 4G5XA 5ALHA 3DEYX 1YUNA 3D4OA 3IOEA 5HYVA 5HBRB 1ZINA 2VF4X 5C0OE 3UV3A 4B4KA 2Y0SA 4XD7D 1G5HA 1HURA 4PSAA 4BZWA 1PZXA 2X8AA 3WMXA 3CH5A 4ME6A 5JVLA 4WXYB 5AKHA 1J06A 3GRRA 1QUEA 3BBPA 4NJEA 3BACA 2ZBDA 1UWLA 4LTNA 4EX6A 2O7NA 2J8ZA 1K6JA 2I2XB 2Q1SA 2Q6TA 3HSKA 4MKZA 5FA8A 4FOSA 2VBIA 3TZQA 4EUFA 1XPOA 5BRJA 4O7ZA 1QMGA 2F59A 3OEYA 3SX4A 2CHEA 3TSYA 2WE7A 3BE5A 1U3GA 4YRSA 4QVKA 4KWEA 5DLGA 5AM2A 1NP6A 1Q14A 5BWMA 3GHHA 2JA1A 4Q4AB 1XEXA 1YL6A 1USWA 4DM7A 1FRZA 2EKQA 4W4TA 4W5HA 4IVQA 2A5YB 1RQLA 3MR6A 3BXGA 2GCOB 3MJ4A 4N7RA 5ALWA 3K1JA 5ECDA 3A10A 3KQSA 3RTXA 2NU6A 3EMDA 1NUQA 5B3AA 4L4XA 2B1RA 3OLYA 2PKEA 3RJ5A 4N49A 4QXRA 5LNK6 3N86A 3NHLA 3A4LA 3IKMB 1NNI1 4ZO7A 3LOQA 2O7RA 1KRHA 2X9QA 2RSLA 2R751 1H3NA 1QHYA 2HEGA 1RXUA 2XVAA 3RARA 4NFSA 4E5KA 3DFMA 4OL0A 4ZPXA 2DOKA 5K3CA 1CBUA 5I7HA 4DIMA 2DR2A 5JARA 3C0KA 4X62B 3ND7A 3A1FA 2IA5A 3N0RA 3SJBA 4EO4A 1OV4A 4C20A 3A70A 1I4EB 2ZYTX 4L85A 4PYJA 1G9XA 2IY9A 4XGRA 4HYYA 2XCIA 5I9SA 1UMDB 4LQDA 5D1NA 3RHFA 3ZIDA 4BRZA 4AVYA 2QMYA 1LDNA 1X92A 2ZTMA 4DQDA 2K2QB 4N12A 4XWTA 5K0LA 4ETWA 4F7WA 3D5QA 2BHNA 2V4ZA 3EPI