1UC9A

Crystal structure of a lysine biosynthesis enzyme, lysx, from thermus thermophilus hb8
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
280
structure length
256
Chain Sequence
b'MLAILYDRIRPDERMLFERAEALGLPYKKVYVPALPMVLGERPKELEGVTVALERCVSQSRGLAAARYLTALGIPVVNRPEVIEACGDKWATSVALAKAGLPQPKTALATDREEALRLMEAFGYPVVLKPVIGXXXXXXXXXXXXXXXXGFQHQLFYIQEYVEKPGRDIRVFVVGERAIAAIYRAENCPLTEEVARLSVKAAEAVGGGVVAVDLFESERGLLVNEVNHTMEFKNSVHTTGVDIPGEILKYAWSLAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lysine biosynthesis enzyme
molecule tags Biosynthetic protein
source organism Thermus thermophilus
publication title Crystal Structure of a Lysine Biosynthesis Enzyme, LysX, from Thermus thermophilus HB8
pubmed doi rcsb
total genus 73
structure length 256
sequence length 280
chains with identical sequence B
ec nomenclature ec 6.3.2.43: [Amino group carrier protein]--L-2-aminoadipate ligase.
pdb deposition date 2003-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08443 RimK RimK-like ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.80 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 1uc9A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1uc9A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1uc9A01
4O2AF 1IOWA 4XX0B 4XZ3B 2YL2A 4I50F 4O4HF 3R5HA 1KJ9A 1KEEA 3VA7A 4HR7A 2I80A 3AW8A 2DZDA 4ZQIA 3ETHA 1GSAA 1VBGA 4I55F 5LXTF 3TW6A 4MAMA 3HBLA 1E4EA 5D8DA 4IWYA 1JDEA 4EG0A 3VPCA 4YB8B 2ZDQA 4M98A 3UFXB 1B6SA 2XD4A 3N6RA 1EYZA 3QFFA 1I7NA 4O2BF 2W70A 5LP6F 2YZNA 5CAEB 4EABA 2YS7A 1JDBB 1DV2A 3WNZA 1B6RA 4MV4A 2ZDHA 2VR1A 2R7MA 3G8CA 1M6VA 4XYMB 3JRXA 3VMMA 4YAJB 1E4EB 1DIKA 2FPIB 2V58A 3MJFA 2R84A 3K5HA 3RV4A 5CB4F 3BSSA 1KJIA 3GIDA 3WO0A 1IOVA 2DIKA 2YS6A 2YZGA 3R5XA 5CA1F 2IP4A 2VHEA 4RZQA 4EA9A 3TIIA 1CE8A 1VKZA 1KJJA 4EGQA 1GSHA 3SE7A 2W6MA 2SCUB 2R6FA 3Q2OA 2W6PA 5BPFA 4M99A 2FPPB 1JKJB 3WO1A 3V4SA 1PK8A 2FB9A 3LP8A 2NU7B 3ORRA 4MV1A 2DWCA 2W6OA 4C5CA 3U9SA 3RV3A 3E5NA 3JRWA 2Z04A 3HO8A 3VOTA 4WD3A 1A9XA 4EAAA 5CA0F 5KKNB 2FPGB 4HNVA 3I12A 1KC7A 4J6EA 1CQIB 2NU9B 2HJWA 2PVPA 5J2TF 3RUPA 2NUAB 4WBNF 3MWEA 5BPHA 5LA6F 1ULZA 3MWDA 4L1KA 2YRXA 4ME6A 4ZOLF 1KJQA 2R87A 1UC8A 2DLNA 4ZHQF 3RFCA 3U9TA 2NPOA 4YAKB 2XCLA 4MV6A 4C5AA 1KBLA 5JVLA 1CQJB 2R85A 2CQYA 2C00A 3LWBA 3JZFA 5GONF 3ORQA 4O4LF 2ZDGA 5LOVF 4MV3A 1DV1A 1W96A 2CZGA 5I47A 2W6ZA 2R7LA 1I7LA 2QK4A 4O4IF 1EHIA 1GGOA 3TINA 3HB9A 3BFPA 4DLKA 1GSOA 2V5AA 1SCUB 1PX2A 2X0SA 4MA5A 4HNUA 5BMVF 3BG5A 5C8YF 1EUCB 4TV8F 1VBHA 1AUXA 2NU8B 2R86A 4C5BA 5LYJF 3G8DA 5K2MA 5H80A 5J2UF 4M9CA 4MV9A 4QSHA 4Y8VB 4I4TF 2V59A 2GPSA 4FU0A 4IWXA 2GLTA 1UC9A 2R7KA 1EZ1A 1C30A 2PN1A 3JZIA 5C1OA 2OLSA 1KJ8A 5JQWA 1BXRA 3K3PA 2YW2A 2W71A 2J9GA 4EA7A 5JH7F 1WR2A 2R82A 2YYAA 3GLKA 5IYZF 4E4TA 1BNCA 1T36A 2I8CA 5HBRB 4MV7A 1AUVA 2FP4B 4XYLB 5C1PA 3BSWA 2PBZA 2R7NA 1W93A 4TUYF 3V4ZA 1GLVA 2YZMA 4IZOA 4EGJA 4HNTA 4YJ2F 1EUDB 3VPDA 2GPWA 4MV8A 5HV6A 4EA8A 4M9UA 3AX6A 3R5FA 1C3OA 3OUUA 3R23A 4IHJF 2P0AA 2W6QA 3OUZA 5JVDF 2NU6B 4TV9F 4HQ6A 3BSYA 3ETJA 4GGMX 5KX5F 2VPQA 3N8DA 1CS0A 2QF7A 4MA0A 4YJ3F 2YRWA 1JLLB 4YBZB 5EZYF 3TIGA 3VPBA 3K5IA 4DIMA 2VQDA 2I87A 5DMXA 4ZI7F 3Q1KA 3TQTA 2W6NA
chains in the Genus database with same CATH superfamily
4A3BG 1D07A 1TEXA 3G0OA 4OQDA 1Y9JA 3P0HA 4BTVA 4YMGA 1J5XA 2WZBA 4RE5A 2IRWA 1OLOA 3BB1A 4ALKA 4EGCB 5JDCA 3EGIA 4LCEA 4AJ2A 4MR7B 2D5LA 3EWIA 4DUYB 1UJ4A 3W3AA 1FFAA 1JR4A 1RAGA 2UYQA 1Y0BA 2X5XA 3GDHA 3GJSA 3O93A 3L1IA 2CB0A 1NVKA 2AH5A 2NUPB 2C77A 2E4ZA 2FW9A 2K2QB 4K8RB 1Q50A 4O0LA 4JV5H 1EQ2A 3FG9A 3IOMA 4BIMA 5CFPA 2IDZA 2JLAA 1NMXA 5EWJB 5DJ5A 1Q19A 2D0PB 4C08A 4LOLA 3VDRA 3JYLA 4BFCA 3QVJA 2QXTA 1R6XA 3B3GA 2CXHA 5JD4A 4O7RA 1NW5A 3EULA 5AHXA 4BO6A 1WQ1R 2FLVA 3B6MA 5LZ9A 1PNRA 1HNWH 2WFMA 5IJXA 5SY6A 3Q7EA 4AYBE 2ZJ3A 2PM8A 3PPXA 4GMKA 2X42A 4CE5A 1EHYA 5K1ZA 1NVDA 2H65A 3JWGA 1IHOA 2SNIE 4I5FA 5A5FA 4TXNA 1IN1A 3HWX1 2DQZA 2SICE 1TVKB 3QFRA 1A5TA 1YFZA 3LT0A 5T5QA 5TEWA 3OPNA 1U7WA 3T5GA 3T54A 2GB4A 3ZHXA 2VDWA 1GUBA 2VK1A 3AHCA 4OYHA 3T3NA 1XP5A 1CF4A 2IK8A 1GA4A 4ISBA 3OM1A 3IRUA 1RQNA 1YIOA 2Q0QA 2GXAA 1UKBA 5INTA 3ADCA 3FB4A 1X8XA 2EQ5A 1OAKA 3OPQA 3R3UA 4AYTA 5KFSA 1WXDA 1OVGA 1YI0A 2JLBA 2QI9F 3LPAA 4CIDA 1LS6A 4M9RA 1JYFA 3NOXA 5ALZA 4MQBA 4ZV4A 1E1KA 3DVAA 1NRWA 2V03A 4W8OA 4NBRA 1L7VC 2XNKA 4F1WA 4KWIA 2VUMA 4AY5A 2DETA 3NC4A 1MRZA 1NJ5A 4IG4A 2JA7G 1DOZA 3IAAA 5A9TA 3TEJA 5AWFC 3L0BA 4HADA 3WFIA 1HMYA 2FZKA 3HJTA 3PL1A 1WABA 3TYXA 4Z51A 1ZVVA 4LK2A 4LF4B 5F98A 3GGOA 3HJAA 3OQBA 3CZAA 5K8TA 1GSOA 2AC7A 1NBHA 3I3OA 4MGKR 5DX1A 2BE7A 1K4MA 4I46A 4JYAB 1KYQA 3Q3IA 4DR4B 2C2DA 1GCUA 3VU9B 4RTKA 3DMTC 1UWCA 1Z6QA 1Z25A 1ZH6A 4GM0A 1V37A 1J09A 4P33A 3WWOA 3FNRA 2VTEA 5JQWA 3P4XA 4ZYLA 4Y2QA 2NN3C 4JC8A 2EERA 3GPDG 4HT3B 3OZBA 3V6MA 3GLKA 2YWCA 3MFQA 2I8CA 3G88A 4RFSB 5BSHA 2XCPA 3H9GA 4F6RB 2XMGA 3HXQA 4H2DA 1RIFA 3H97A 4G25A 5FTJA 2HRZA 3OHSX 1SK8A 1F38A 3I34X 2J46A 4FYHA 2GH1A 3UQ8A 3HKZE 4C6HA 1E9SA 3NHBA 1H6BA 1R8JA 2AWOA 2OZVA 2E6UX 3LK7A 4WFIA 4D9GA 1F6BA 2I4TA 3NI2A 2J3KA 2VJAA 4N7JA 5HK9A 4BMYA 3MINA 5A6SB 4PFKA 1KUTA 4CMKA 3SLGA 3O4JA 4HATA 2R2GA 4BDSA 4ECTA 1BMFA 2WZQA 4LVUA 4OKIA 1E79A 4P35A 5DX0A 3W8FA 3D6JA 2H5LA 3R3WA 3RROA 2FEKA 5KYWA 2VCHA 3E8MA 4Z1MA 4FSDA 1KT8A 1G6Q1 4AYWA 2V7TA 2E2IA 3DCNA 4EFNA 3WR5A 3LBAA 3QHAA 4GI5A 4A9AA 1HSOA 4AC9A 4CLRB 1DFGA 2ACVA 3ZBTA 2FWIA 2M1ZA 4HB4A 4QOGA 2A59A 2LUOA 3IVRA 3AWIA 2HDKA 2G77B 3DS8A 3P20A 3F9IA 3UJNA 1KJYA 4GNRA 2B5OA 4J03A 3M6MD 4FQ8A 1Q95A 4CL3A 3ZVKA 2OZLB 1B74A 5DK6A 2GBLC 4B79A 3DVAB 4J29A 3EUEA 1T3GA 1UMCB 5JO0A 4URWR 4ZVUA 1OHHD 1SOAA 5H5JA 4RHYA 3L7MA 4JEIA 3K9NA 2HFKA 2GBLA 2ZTSA 1KS2A 2C99A 2C3UA 3QVKA 4IQ4A 3USZA 4EF5A 1M2VA 2YS6A 4JT2A 1HF3A 2DFPA 1ZK2A 2LZ0A 1KJWA 1G3IA 4GEGA 3SM9A 3WV5A 2GILA 3PV0A 5IDVA 3P9QA 4AZSA 3IT0A 1NJ1A 4JQZA 1G5HA 1D2NA 3UAZA 1CJMA 1JSRA 4GX1A 5EJFA 1RJ9B 4DJEC 2C2HA 2JGDB 2ERXA 1U31A 2P2GA 2V45A 3QXCA 4J4TA 2W6OA 3WYNA 4HOYA 1L2TA 3E5NA 3DKIA 1J1IA 1OAAA 1Q91A 1KYVA 1QG0A 2J41A 4HB3A 3RVRA 3UY4A 1T5OA 1WW3A 3GJ3A 5E6UA 4L0QA 4Q7JB 2DPMA 4S1NA 4Q44A 1AZTA 2C4NA 3RLIA 1SKMA 5CDFE 4L08A 3CUWA 1E1LA 1PL0A 2EP5A 3LQKA 1J2JA 4Y7DA 1ZNZA 9MHTA 1TQ2A 4BNTA 2CQYA 1CHDA 3Q8KA 1ZM4A 2FWJA 2WT8A 1CETA 4S1OA 4MRAA 3LTNC 1Y3FE 5FLXW 5H70A 1EDZA 1XEXA 4K9QA 5KKAA 3HOUG 1H05A 2CL6X 2I4RA 3IQDB 4C4PA 2ZP1A 3MWDB 4HHEA 1UBHS 3CMMA 1M6VB 1OGJA 1RBYA 3GROA 5BWTA 2H54A 3SHTA 1ZKMA 1SH7A 4PO8A 4M8NE 3G2PA 5FQNA 5A05A 1PI3A 5DCLA 1XMVA 3V1KA 5IP5A 1KR2A 2PZJA 3FPJA 4I1YA 1UOOA 2GLTA 3DMTA 5F2EA 1HQDA 1U7HA 1ZJYA 1JJIA 2VA8A 3K5PA 2GEKA 3I2YX 2ZIGA 3FD8A 4O7NA 1BFKA 3OZEA 4F4ZA 3R3ZA 2HDHA 2JI4A 4IICA 4D9KA 1XIVA 4CIWA 1MZBA 1Z4KA 4RS4A 4UE2A 5EKSA 5L7YA 1U8FO 4CF4A 4MVWA 3AERB 1JTVA 3JD2A 3K9WA 1YOBA 2QMQA 3DOFA 1H9CA 3I05A 4R7TA 5TPZD 2AQKA 1G3QA 4XDGA 4C29A 1MMFB 3JX9A 3AL0C 3CPJB 1R0CA 1AKMA 2ZYDA 1EP9A 4ACBA 3CNQS 2VRCA 2NUAA 3N5KA 4V1CA 3OPVA 2NV6A 5JVDF 3L6CA 4KZPA 4KZKA 4LRUA 3FR7A 3TL3A 1WTAA 1UKEA 4JYAH 3CH5A 4QQFA 4E1VA 3MTJA 3MR2A 3T8YA 4EEXA 1WY5A 1YZUA 3L40A 2QIOA 2QTMA 3ZLUA 3HCNA 4O7ZA 3T5HA 4BBSG 3KQYA 4FFPA 4PHFA 3O4IA 1QRAA 4APMA 3WOHA 5KU1A 4PYNA 2N1MA 4RGYA 2WABA 4UJ3A 3ER8A 1WZ2A 4J0GA 1BXRB 3PK0A 1ZIPA 5AIBA 5EUQB 2WC1A 2Q1YA 5H7XA 2BFCA 4RHEA 3N44B 1RWKA 3LC7O 4MYDA 3WAKA 2J6BA 2PLRA 3IB6A 4TWZA 3ZEAA 4AD8A 3B3FA 1VZ2A 3D8UA 2BGIA 4A73A 2KX7A 2WOOA 3ZJUA 2IEBA 4A3IG 1E1YA 3STVA 4ZYWA 5LUBA 3QOFA 4G1EB 4PC2A 3QXSA 4BVAA 3MJSA 1Y3HA 1N3BA 3PZPA 3DGEC 3ONVA 2XMZA 4CKCB 1W2HA 2JJYA 3SOZA 5GJBA 1ULBA 1ZGHA 2H07A 4M9ZA 1QANA 3A6EA 3MLAA 2CKZB 4PZYA 5EY5B 3OPYI 4HAUA 2QTVB 1C9MA 1DJQA 1N7HA 1H3NA 1PGPA 1W5BA 1XZPA 2R11A 3JZAA 4LXXA 5TGTA 4WXPA 3VKVA 1ENZA 3EIEA 2PDAA 3BT7A 1UM9A 3E3OA 3Q8MA 5D1PA 4IDPA 3U9SA 5I9NA 1WB5A 1C4WA 3DL4A 2BC9A 4ZI2A 3T4PA 3O4GA 1SWWA 3AQIA 1E3WB 1Z7WA 4NZOA 3BVPA 3K9GA 1E5LA 2O1SA 5JCOA 4D7AA 4U4AA 1OLSA 2FI1A 4CKZA 4DV3B 3ZPXA 4P5EA 2HAEA 2JAQA 5DNYB 1QGAA 2NU7A 3BXHA 3NASA 1FIUA 4I2VA 3QMWA 1MAUA 4JEHA 5J5CA 2QRUA 3LCRA 3ROTA 3UG7A 1THMA 5J1TB 3E05A 3DDHA 3DVSX 3HCAA 1Z8DA 3U54A 1Z6XA 2CNDA 2R25B 3B2NA 4MV3A 4GYJA 3AHGA 2WAQA 4O2AB 4GEKA 2ZUFA 4CLOB 1JH8A 1Z13A 1ZIDA 1TOAA 3PFHA 1I7LA 1A5BB 4C0WA 3B82A 5ES4B 5FTLA 3FYTA 3JWJA 3N2LA 3VVBA 2NX2A 5ALMA 3W5HA 4OQLA 3GT3A 1EG2A 3PNPA 1ESNA 5AK3A 4C5BA 1NNUA 4ZZ2A 3HABA 4MV9A 3GFRA 3F1LA 4UTOA 3RWBA 3ZWPA 3R9XB 1PQUA 3BJZA 1A4IA 3FUUA 2NP7A 1E8NA 3JD0A 1ZJJA 2HGZA 2PN1A 3OZXA 5LQMA 2C5BA 1O75A 2A9KA 3OQ1A 2CXXA 3IJ5A 2CEAA 3MERA 4FW8A 4V24A 4B1FA 3HOXG 2V97A 1KQFA 4QVIA 1D2MA 1HG1A 1CDOA 1WR2A 4ED7A 1SELA 4R54A 5LP6A 2RDJA 2VBCA 1QLWA 4HYTA 3FZQA 4J0QA 2YN2A 4LTMA 3Q72A 4IKPA 5HPYB 3RU7A 3FHJA 3L8DA 4MV8A 2DHQA 4U7PB 3TW8B 3N43B 5LQSA 5E8RA 3B5IA 3V8NA 2PWPA 2C9OA 2IY9A 2UZIR 2QX8A 3JATA 3OBIA 4EECA 1RWNA 4GICA 1J5EB 3E35A 5JASA 3B2EA 3HDYA 4CUZA 2C2GA 2X2EA 2X6RA 1N7JA 3TL2A 4R7GA 3V55A 4QIWE 2EL9A 1F12A 1TZJA 2CDCA 3D4BA 4FMBB 3PHIA 4OAOA 5G53C 4EPYA 1XDNA 3M33A 4K86A 2EFHB 2VYVD 4M0FA 1WMAA 3JAWB 3MT7A 4E6EA 1CJTC 1E1CB 1TM7E 2QZJA 1W7AA 3EJ6A 3H1BA 3OT1B 4L6AA 2NZ8A 3OZWA 1ZO8A 3HH8A 2NO5A 1ZAUA 4KMRA 1R12A 1OV4A 4C1NA 4A2AA 5KHOC 3L04A 1A2BA 2XA9A 3GVCA 2PRYA 3W90A 5K7SA 2YYYA 3G13A 3HN6A 2I0FA 3DLCA 2MSLA 4MCHA 2JVJA 3P9KA 1NQ5A 1OFGA 2JL1A 1KEVA 3DFMA 1KY5A 3T1QA 1JJAA 3H1FA 2WJYA 4M0EA 3ECAA 3H17A 5B6PA 5B1YA 1CR4A 1S3SA 3ER6A 5EJ2A 3FCSB 2IU0A 2IPXA 1WXWA 1XMXA 3CA8A 3KCQA 3WA6A 4LHZA 1JAYA 1Y5MA 1Z68A 5KFYA 2Z9BA 4OMFG 3KQKA 2OOSA 1MOZA 5DH9A 3FGPA 3SX0A 3WTCA 3VV2A 2DAPA 2QWXA 1KJIA 2I4MA 2IS1A 1II8A 1SKBA 1WX1A 4HYQA 1IN5A 4RZQA 1DDIA 2EJBA 4H27A 3AY0A 2SECE 1UF9A 3ISJA 4JELA 5C1DA 3RBDA 3AVQA 2A5GA 5L3QA 2CLHB 4LJYA 3WJ7A 1Y8ZA 1VHJA 2C5HA 5KOJA 2NZXA 3HUEA 3KPUA 4JOSA 5I4CA 4DQLA 5J9FA 3A26A 5L40A 1EVYA 5EYPB 2JFXA 3U3MA 3GIWA 3U1BA 1LBEA 2RJOA 3PGMA 3TQIA 4Z2AA 3C5VA 3C7KA 3RWMB 1FUUA 1U0FA 1V48A 4EY6A 4IOLA 1TZMA 4JMPA 2YOFA 1RBQA 2AXNA 3CLTC 3UFXA 3DKPA 1G9TA 3DLBA 1QG6A 3G89A 5KT6A 2G82A 2ZB4A 5DBIA 2VXCA 2V1XA 1VMAA 2HTEA 3G0IA 1NQTA 5FWXB 4BRUA 3KQLA 3PLRA 2VF7A 1DQYA 1ESCA 3C87A 2DR3A 5T41A 2RGUA 1PL7A 2BGKA 1EZ4A 2OV2A 1PGNA 1PJ2A 1TO2E 2QPLA 2B25A 2Z83A 2V0GA 1LWOA 1JU4A 4IYJA 2HRBA 4CV0A 4DIEA 1ORVA 1WY7A 2DUNA 1I13A 2FFJA 3I9LA 3OOSA 1HG0A 3CURA 4IEEA 4LZWA 2IUTA 4MPJA 4QBKA 1E32A 4RELA 5FO0A 4ZYYA 5ISMA 3FSRA 2CNUA 1YB6A 4GOKA 5KDLA 5BSFA 1TKRA 5AW4A 1HE1C 4V0LA 4RPIA 4YYZA 3FZGA 1XQ9A 3LW8A 4HRVA 2PKWA 3E7DA 2Z1MA 2FRDC 1IZ7A 1L5QA 1Q6YA 2ZROA 3L5KA 1R0SA 2J9GA 1P31A 3IXQA 2QSZA 4HNSA 3T3GA 3OTOB 3P2JA 1Y4ZA 2X8WA 1GU0A 4NV3A 1D2HA 3OOWA 1N5KA 4IDBA 1UPXA 4RVNA 4TZKA 5DN6A 1G7CA 4IZOA 3N8IA 2BCEA 2JAHA 3GDGA 4KVAA 5IPFA 1Y4DE 4F7DA 5REQA 1BH6A 4I4IA 5F2KA 2AZ4A 4I55B 4GMGA 5KTOA 3RREA 1MJNA 5DM0A 4XFKA 4NAHA 5EN4A 2EKLA 5IUNC 2H5IA 4EHHA 2WIBA 2BDTA 3NO4A 4A6XA 4L22A 1IY9A 1T4CA 3OKPA 4PQEA 5JSZB 1FDVA 5EI5A 3SYLA 1DWQA 1DXQA 3QE0A 1DXOA 3WIUA 5KVSA 2R47A 2HU2A 1N4AA 3FHTA 3FCEA 2GJKA 3ZVMA 3ZV7A 3CN7A 1TC1A 4UUMA 1P74A 1KWKA 4JLVA 3JAMW 1JMVA 2IQIA 3FKSA 4HRXA 1IUKA 1T34A 4Q3LA 5TMBA 1HQYE 1Y7TA 3EGOA 1MA3A 4UU0A 1XZQA 3DW3X 2QE7D 4G0MA 4EEKA 2NV0A 1BW9A 3O9ZA 4WXEA 2HK9A 1CEYA 3H6GA 1WVMA 4QOSA 1MF7A 4BHTA 4RU1A 2XGMA 3RYFA 1BRTA 1PF7E 5T4FA 1AH2A 1JEQA 4NJMA 2CUNA 2C20A 3F7NA 4AG3A 4BCDA 4JYBA 2VUIB 1CZNA 1I3OA 2VDMB 2VS1A 3RNLA 2AXQA 2R8XA 4N0PA 5HZHA 2HQOA 4KFTA 3E3AA 1Z7GA 2FZGA 2ZRIA 3G1WA 3KV3O 1FDRA 4G24A 5A1JA 2FPUA 3AM1A 1DO2A 1HDYA 2O1WA 3GLUA 2V6MA 2IF2A 3P5SA 3NANA 4DC0A 3DE4X 1JH9A 3VJRA 4FKZA 4P92A 3KLBA 1W94A 1BHJA 5FD8A 4D46A 3OHPA 1O3YA 4LF9H 1HKHA 1OREA 1H65A 2UAGA 5AJUA 3B3AA 1SMKA 3UGTA 1SXHA 4W5JA 3W7BA 1J6UA 4QLOA 1VKRA 2OM6A 1XEWY 4YAJA 3UW1A 3IEUA 4O7TA 1T0HB 5KVQA 1UWVA 3TTVA 1TEHA 2VBFA 2W11A 3A10A 4UDNA 4WESB 4WWHA 4G0VA 1KYXA 3KZOA 3QQ5A 5EIBC 5LN1A 2Z43A 4D98A 3DP7A 4LYFA 1C2YA 2Q9AA 5E3JA 1LFAA 3JSNA 1U0TA 1ULZA 1YDMA 3D0KA 1QK4A 2VNKA 2HLPA 3DBHB 3E70C 4U9UA 4B87A 2ECQA 1QUEA 4ND3A 3NEAA 4Z9YA 1ZGAA 2NU8A 2OFWA 5HF5A 3TTWA 4BMXA 3HM9A 4KR2A 5BWWA 2OGWA 1BJTA 1JA1A 3VO9A 4BO5A 1GTZA 4H9GA 3IMCA 4RJ2A 4A2CA 4J9MA 4NFSA 4WBNA 2ZSEA 1UDRA 2QUZA 5DXJA 4CT5A 1XJWA 2RFLA 1IJFA 1BJRE 1TECE 2FFAA 1P16A 5JISA 1LNZA 2GBIA 1YH3A 4DV6H 5LMCA 1FY2A 2MSEB 3EZYA 4BUJA 1G2QA 1ADFA 3LUGA 1E1DA 1E61A 4D45A 1RJQA 4U7WA 4BZXA 1VZ3A 1Z6AA 5KCZA 1FRFS 1H23A 2VJYA 1KY4A 3HUTA 4EELA 5KEIA 5LWQA 1TGYA 3DULA 1IVSA 4L6IA 4OQFA 5KTTA 2IZ5A 4LFAB 1J00A 2Q6KA 1X7YB 3TZCA 3PNYA 3PLAE 3EVTA 4L8GA 1KO8A 2V9WA 2O05A 2XLBA 4KVGA 2AN4A 2EGGA 4EJMA 2JLUA 5HOEA 4FNOA 1XZ8A 1YQQA 4LXYA 1LSOA 4TWBA 4FMPA 3GG9A 1SQ5A 3H5WA 4Q7MB 1FJ2A 4G8BA 1B00A 1TYDE 2I78A 4Q39A 2P0AA 4TVIA 1KGDA 3OUZA 2CK3D 2XVZA 4MEJA 4MJXA 4QBGB 5IARA 1OBVA 4R68A 3VHXA 1H9AA 4EY7A 2O19A 1RWVA 1ODFA 1C29B 4FGKA 3CONA 3B1YA 5CAEA 1G5RA 1B1CA 1FS6A 3ZD6A 3OVMA 1LJ8A 2JGFA 2I6TA 1KI1A 1X14A 2WFLA 3CUTA 1NBMD 4HL6A 1UBRS 2GF9A 4R1MA 3RVBA 4RB2C 1FLAA 1QE3A 1SVOA 3DD5A 5GZ3A 4EBFA 5GGXA 5TEVA 1E8MA 4I50F 1L5VA 2GA8A 3DVLA 1TWAA 3CZCA 3C43A 3PDJA 1XOIA 4JENA 5KTYA 3HKCB 4EY4A 2AT1A 4TQ9A 1GLGA 5C32A 4R1TA 2EZ8A 4L75A 5IM4A 2Q5EA 4TT3A 3WK8A 1HE4A 2B4RO 4LJ6A 4DGSA 3KJIA 1VYTA 4LMRA 3VAAA 4OHMA 3WWYA 3NHZA 5EMNA 5IBRA 5FJ8G 4MWDA 3WHIA 5SYNA 1E2IA 1OC4A 4QTYA 5CA0B 1ZOLA 3HCDA 2PUWA 3LOUA 4HXGA 2Z6UA 1A9QA 3TZKA 5HM8A 3N2ZB 3EXIA 1UZNA 1YR2A 3RB6A 2W7PA 3CLRC 3G2LA 3Q3GE 4I4NA 4NHOA 4WNCA 2BW0A 2OAP1 3B8HA 3CVOA 4ZTBA 4EZEA 4ZQFA 2R751 3D64A 2Q45A 3DQQA 2MDTA 1L8AA 1PL6A 2DB3A 4ZAGA 1SVUA 3GIDA 3WO0A 5CM0A 2RGNC 2WSIA 1KZ4A 4MMYB 3NBFA 3PVXA 1B26A 4OB6A 5EQDA 3WBKA 2OHXA 3DMPA 2E7ZA 4RVUA 1RXWA 3K9QO 1EDBA 1SUCA 3GPIA 4JI6B 3HKBA 4AJ1A 4BFYA 5HIKA 3TM5A 3RGZA 1E4FT 1A8PA 1GPNA 2AI2A 1A04A 4B76A 3AM4A 1O96B 3IQHX 2QUKA 3LG2A 1DLJA 5IKXA 3C14C 4V2UA 1O95A 2HA2A 3PB3A 4OHKA 3THRA 5JDCC 5A6SA 3PL5A 5M3BA 1BMTA 1YDHA 4IBOA 1ZEJA 3CSSA 3U44A 3HO8A 2WFZA 1EFCA 2HPZA 4B3FX 5FFMA 2Y9PB 2CXTA 1P4AA 3AHEA 3ZE9A 5KINB 1JTFA 2X1VA 3O2SB 4FXOA 4RK7A 1S9FA 4YR7A 5LKRA 2CV0A 2QW8A 1OJ7A 1XZNA 2L2QA 2OBFA 2QL6A 1DFIA 3FKSD 1OI3A 1T5IA 1PLLA 1X1BA 3RBEA 2ZIUB 4X3OA 4XKJA 5COBA 4EK9A 4OCZA 4O4JF 4V0SA 1MW8X 4I4CA 3MGAA 4R1SA 3WK4A 1ZUNA 3BERA 4X8MA 1J22A 2O03A 1N32H 3DGFC 4PG7A 4RJJA 5AI4A 1P9LA 2GJ4A 1QQ5A 4P7KA 2J5QA 2Y3IA 3C4JA 1QOPB 3KXKA 3LRTA 3Q7TA 3CG0A 1SRQA 1U0JA 3WRYA 4A82A 3WQQA 1EFVB 2ALJA 3OMLA 1BWPA 4GZMA 1H6DA 1M76A 4QGBA 1PQPA 1PFKA 1BX3A 4NV1A 4G56A 3IE2A 3COVA 4H7EA 4HJRA 3VPFA 4RHUA 2H1CA 2VZEA 3FJOA 4BS9A 1M1UA 2DWQA 1GGMA 1UJ6A 4UZFA 4WCFC 1O54A 3FM9A 1OBCA 4FYKA 3M6XA 5ITSA 2XECA 4DV4B 2BFNA 2EDCA 1JEEA 2BT4A 4QPJC 2PGOA 2ZJ2A 2F6RA 1O6GA 2VAMA 4LWOA 1EUCA 5HBRB 2ZIEA 4LJ4A 3S1AB 2BEWA 2FN4A 3PUWA 4XVQA 2BPOA 3SJAA 3VPAA 3VZQA 4PZLA 4LF4H 2ZIZA 1RVV1 3GFTA 4YJ2F 1HZZA 3H0CA 3QI7A 2HDNB 4OUKX 1Q7EA 1QZTA 4GPEA 4UEQA 1MCZA 3OEHA 1W0KA 4WN9A 4PXAA 3VR4A 4AAYA 6LDHA 5LZ5A 4TQSA 3ZY3A 1XYVA 2CL7X 2NQTA 1YXMA 1DCKA 3CRW1 4PGAA 2ZPTX 5KNBH 4ALMA 4UCFA 3WKEA 2WM2A 3TIGA 2YZKA 4AFNA 1Y8AA 1QGOA 4HBZA 4Y18A 3FGNA 1SXPA 2BBOA 4ITUA 3W78A 3H4MA 3I0MA 1QRDA 4OLHA 4D8VA 5HNKA 3BDVA 1WXIA 4IDNA 4MZXA 3GH1A 1E59A 1FVXA 2OGUA 3QLTA 4ON9A 2HT6A 5IYDG 3FA2A 4CKEA 3HFSA 5JUWA 1EVJA 1JWLA 2AOXA 4O5AA 2O0JA 2O2ZA 2L42A 3TPZA 2FSHA 2HF8A 3LLVA 3UMCA 3V1UA 3KUUA 1PQWA 3KJQA 4MW2A 9LDTA 2WSSD 1WKCA 3GG2A 5IJ9B 3AT1A 1XTQA 1U9IA 3C7AA 3QX8A 1JL3A 5T8KC 3RFUA 1O08A 5IYZA 1R4NB 2FKLA 1ML3A 2ZB7A 4KNYA 4KOEC 2YIJA 2YUTA 3F5MA 3OZTA 1V9PA 1E5TA 4DR1B 1FRQA 3M3PA 4OB7A 4PLGA 1JVNA 1C5KA 2GVNA 3DOHA 4YAOA 5T6MA 3T7IA 1T2DA 4HEQA 5FL3A 3BMOB 4LHWA 4F6CA 4FEGA 1NXQA 5BVHB 3NBYB 3JQFC 4A3JG 2VTKA 3F6YA 3H3XA 5DGDA 4AU1A 4CQNA 4FUTA 4YGYA 2H1FA 4KCGA 3N1UA 4ID3A 4R5MA 3GUZA 1G17A 4UHHA 4B09A 2G71A 3M81A 1YS4A 4HNRA 3VR5A 4RVCA 1G6KA 1N5JA 4XR9A 4AW9A 3MTGA 1BG6A 2J3IA 2B1QA 2UUBH 1YC2A 2IZ6A 4FR5A 4LPSA 4YK7A 1UMDB 3CO0S 4MWEA 3CX6A 5AJZA 1N1DA 3TKLA 2ZIXA 1MUUA 1A1SA 1FRZA 3HP1A 1TUEA 1J2YA 3R09A 3C3CA 4FZJA 1FYEA 1AG9A 4WBNF 1WOYA 1DIAA 1Z0JA 4U2DA 1CUZA 4IJUA 2XOEA 4LH7A 4ME6A 4EFBA 3FCYA 3KX2A 2PS1A 3R5TA 2DPLA 3KJEA 4P82A 5D3ZA 2XUIA 5ALXA 4YY3H 1ONNA 2WHRA 1XGKA 4JOCA 2I2DA 4C4AA 1CEEA 3U61B 4ZYZA 4O1MA 4OXIA 1ZCFA 4W8HA 2QL9A 3GEPA 2C5SA 2Q4EA 1W4RA 4EI7A 2QRJA 2IEZA 3PQCA 1Z17A 2VNSA 1KI4A 4E51A 1Q1NA 3AEQA 2VYVA 2WTEA 3U7QB 1F2TB 1TC2A 2CHQA 1NN3A 2D1FA 2GTHA 4H0FA 2HL6A 1I6WA 1FFXA 1GGFA 3TSZA 2WTNA 3MELA 4KXWA 4PAMA 3CHYA 5ALWA 1HNNA 4B8ZA 3IUPA 2H7VA 3KT0A 4FGZA 4F2PA 1RM3A 3SNHA 4Y8VB 2J4CA 3DZ8A 1WZNA 5E7QA 1E7YA 3OKCA 3ZJTA 1RJWA 1VL0A 4K9LA 2OGTA 3PX3A 3MUNA 3ICEA 4LRYA 3LUDA 4RWZA 2E18A 5JNUA 3D3EA 3HB7A 2GDJA 3MS2A 2GI4A 2YOGA 3A9CA 2ZZNA 2ZRCA 3CYFA 1Y1SA 1CUEA 2C54A 2YUIA 2JIPA 1BQEA 4M7PA 1XTVA 3HY3A 2IMWP 1Z7BA 4TTSA 2W00A 1GKUB 3TX2A 2PTHA 1IN8A 2IW1A 3ZH2A 3K9BA 5BWNA 1WPRA 4YWJA 3RKSA 3CNNA 4UXJA 4BQRA 5A6VA 2OV3A 1ECJA 1HYQA 1OU4A 4J6FA 2A4KA 1JDJA 4P31A 3HU5A 3HXLA 4A6DA 4BQPA 3JZDA 1C9NA 2IBSA 1BE6A 3NBAA 4WT7A 2QTGA 3LC0A 4B71A 1PG5A 4DDMA 5B4VA 2XBUA 1LEHA 5EJMA 2B0JA 1CERA 4ZZ1A 1QQ6A 3QEBZ 1TM3E 2KM1A 4K0KH 2RK4A 3I9KA 2Y4RA 1RT9A 5CBKA 4V1CB 1F48A 1WD7A 4OP1A 5TPZA 2I6QA 2HO4A 4HPWA 4NBSA 4EUEA 3AZOA 4QFDA 3IHWA 1VBKA 3ZQUA 4B6SA 4MW4A 2YY7A 4Y2PA 5JPIA 4JKOA 5EGNA 2AOTB 2Q07A 3IT1A 4DR6B 3IAHA 1UXHA 4PN7A 1MC1A 2RCNA 3SR0A 2BEUB 5DSZA 5LA6B 2NTJA 4P3OA 3ZCQA 3B38A 4M98A 4CQJA 4DL4A 5JJIA 2I3AA 2OHHA 4Y9DA 3TRKA 4Z7NB 2BISA 3ABIA 1UDCA 4Y3UA 2E48A 1TVKA 1G2OA 1C8KA 2HNBA 2WUVA 3CIFA 1A7JA 3NAGA 2BQ3A 1L7PA 3JU3A 1D1PA 5PGMA 3TZBA 1RPAA 5T4HA 5JYCA 5KFWA 3GXOA 1M1NA 4LOIA 1RHMA 4U02A 2A6PA 4X94A 3OE7A 4RXMA 4YXFA 4NYJQ 4ICIA 2R2AA 2EV9A 3AUJB 2JLXA 3DTVA 2A9RA 4KFSA 3UV6A 3E22A 3NM5A 2IUSA 2KSWA 4RLHA 3V34A 4FGSA 1Z0UA 1KY2A 2F3UA 2EW8A 2XUPA 3O3CA 4AMZA 3VU9A 1H4TA 1YJQA 1NM5C 3QH4A 4P3NA 1G18A 2GZ1A 3G2NA 4UMFA 2G1UA 4JBLA 1OV6A 1DPGA 2QD4A 5HRCA 1R6UA 3UJBA 4O3NA 1SOUA 1UEXC 1US8A 2JAPA 4CM4B 4D9HA 1Y14B 1XDSA 1ABEA 1EP3B 3PT9A 4NBKA 5K3CA 2JB9A 3SZGA 4DSAA 2G9VA 4YCMA 4JI1H 5DIZA 1FP7A 4B4DA 1DGSA 4DPLA 1Z5NA 4QECA 1PVVA 1RBMA 1V43A 2P3QA 1U7XA 3DHVA 3QKUA 4H7KA 1GAQA 4L4XA 4YAKB 1E2MA 1SQGA 1UIRA 2A0WA 2OM2A 2X41A 3OQIA 4OO3A 3HPRA 2XUOA 4MA4A 5DWVA 1KHTA 1YL7A 3T4EA 3LY8A 3LFUA 3LECA 3AFMA 2C5EA 1YJ5A 3I2KA 5F1PA 5GAJA 2P6MA 3AVVA 1P1KA 1ZGJA 3FSGA 5EWLB 4WPGA 2RGBA 5IT0A 1XDUA 1GSIA 1QJCA 1VP3A 4HN9A 2ZTLA 3SSOA 3D3QA 1PR6A 3MINB 3MJ4A 2G5TA 4N5DA 3C6YA 3UMBA 3OPYB 4Z4HA 1TKAA 1QMGA 3CVYA 5GJWC 5K2MA 3AVTA 1W1IA 5CDGA 4NL4H 4BQQA 5I5VA 1L5NA 1IBLH 2GEUA 1K8ZB 5KCMA 1E98A 3QITA 2PZGA 5BQ3A 2ZJZA 1BJKA 3Q3CA 2HMAA 3A4MA 4N8EA 2HT1A 3TSWA 1QU3A 2B1IA 4BVLA 4WCDA 2QM0A 3H5LA 1BNCA 5IWAH 1MFZA 5KFEA 3DH0A 3NAZA 1OXMA 3L8FA 3OJWA 1QOQB 1I01A 3R8CA 5IJ0A 1I7QB 4M9UA 4B4UA 1EAYA 1QS0A 3P0EA 4HGYA 5G0WA 1C3OA 3QY9A 5CA1A 5F9NA 5FI0B 4FHGA 3DEJA 3NTOA 3QFCA 1Z62A 5JU6A 3UXEA 3IAS1 3QTLA 1JQDA 3R3YA 5FWXA 1A72A 2ZIFA 4ER6A 4YV0A 1NOKA 2PZ8A 1NUTA 4DSTA 4MINA 1V11B 1GY8A 1WDKA 4KO8A 4QQNA 3VV3A 4YCDA 2QE6A 2X0EA 1AE1A 1ADJA 1E5XA 3SC4A 4B4VA 5HRAA 3UOWA 2WIGA 1TCAA 5BWMA 3AV0B 3MWGA 4BNUA 4ZV7A 3PW5A 4DAEA 4TRNA 1T0UA 2PT6A 1H2HA 2RHHA 3GU3A 4X20B 4ZWNA 3K6SB 3TLZA 4AJPA 1OX4B 2XLCA 3UAYA 1Q0TA 2JZNA 4X1YB 4Z2YA 5LU8A 1LLDA 1R9JA 2PX2A 1A7AA 1ZITA 3ERCA 2UVVA 3T9FA 2GAAA 2VHTA 2VP4A 2XV1A 1S4MA 2UZ0A 2X2OA 4ZVQA 3K8YA 3R76A 3U80A 1NIJA 1SOWA 4LBWA 3G7SA 5CM2Z 4F4WA 2QVZX 4KN9S 4TM8A 4R01A 3FNFA 5H82A 1GFSA 1K27A 4C2AA 4Z49A 1NMYA 1Q21A 3JQBA 4QWAA 2X2FA 1FZQA 4PCAA 4TRRA 5C1IA 2XSZD 1KKLA 3AR3A 2FEOA 3I1YA 4S2EA 2JFOA 3EW7A 5KWEA 4TV8A 1KZ7B 3PKZA 4YR9A 2IYRA 3PQ3A 1DAPA 2V54A 3HKEB 5EIXA 10MHA 2R4TA 3B20A 4AXBA 1OXVA 2QSYA 2XE8A 3VOSA 2E55A 4C7XA 4M1ZA 4IHKA 4MUEA 2CZCA 3SJUA 2W2KA 3WS7A 3E9QA 1ZRSA 5A9RA 4OX9Y 3HA3A 1HDRA 4IUYA 3TK1A 1E6UA 4LHVA 1F7VA 1ONSA 1Y82A 3KEOA 2VDNB 1S2IA 2PXCA 3A6LA 1GL9B 5HGXA 4LZOA 4RDIA 3STUA 2QAJA 4KQ6A 1OT5A 1J42A 5HKLA 3F7TA 3H3FA 3H5RA 5FL7A 5MN5A 2A5FA 3IQXA 1NFRA 2JI9A 1ZJWA 4UDXX 4LOHA 1DP4A 1FMCA 3BH7A 3P27A 4D0RA 4Q4JA 4Z3DA 1G38A 1ZS9A 4LNUA 1L9XA 4XDYA 2JH9A 4A0HA 4CMCA 5KFOA 4FBUA 1GYFA 1UR5A 2IBTA 1L5FA 3P45A 1DKUA 3MHTA 2YY6A 1FP4A 1R0XA 4M0LA 4OSEA 4HNGA 5DP2A 2WM8A 5MDHA 5HP4A 2CJWA 2EBFX 4C2TA 2BKEA 2VUUA 1U8TA 2N0SA 4LFBB 4BFWA 1GU7A 1N6PA 1S01A 1XZMA 2J32A 2ZVQX 3KDAA 4DL6A 1P61B 1Q3TA 3UEOA 2Q7OE 4X44A 4AJ4A 3H86A 3HOVG 5LYJF 1YMVA 3WYBA 4EUHA 2IDKA 5CK5A 4B82A 3NC0B 2QRLA 3K09A 1MQ9A 3K1ZA 3N3BC 4FJ2A 5TT0A 4EITA 2LRHA 4X8LA 4IRDA 3DAGA 1I9CA 5HCUA 4J1QA 1QR6A 4E2ZA 2AVNA 2I5PO 5DBFA 1V25A 3F98A 4W99A 5I9MA 3RARA 1EKFA 5CXQA 2RK3A 5E7MA 2XYPA 2IUFA 2HPHA 1O94D 3AP2A 4QU9A 3WLSA 9ATCA 4OLJA 2FUG6 3ZVNA 4MGZR 1ZEMA 5KG1A 2XYVA 3RJ9A 1SQ0A 3ZW7A 2BELA 5GTDA 1MOQA 3FHCB 3RFTA 3R5FA 3LPMA 4MVJF 5HA5A 1QQBA 3LCCA 2G1JA 1NONA 1EUZA 2FMIA 2WBLC 1IBSA 4JXKA 4TS4A 4U7JA 5BQPA 3BQ9A 3TQFA 4MOWA 3ZHUA 2FDRA 3LCMA 3R74A 2HA4A 5L6LB 3N8DA 2VTVA 2EVWX 3W3AH 1EH5A 1G7RA 3JQEA 3WKCA 4X7RA 2CUKA 1WV0A 1MEEA 3T52A 3A11A 4Y9RA 3OX2A 2KLBA 5FT9A 1J8DA 1VHQA 2TMDA 3U7JA 1ADYA 1CR6A 2ZRGA 1DBIA 3H2IA 3TQRA 2WG2A 3KR1A 4TTAA 1B1AA 1GTVA 2WSYB 4JBIA 4MGIR 1M6HA 1UBSB 2DZDA 2GN1A 1I1HA 3VTZA 5B7NA 1BYIA 3JYNA 1FJHA 1XTUA 2QX4A 1KC1A 3BD7A 4PZ7A 4JQSA 3WWIA 2WV9A 5DOVA 4ESOA 4YRIA 5E7IA 3ORFA 4EG3A 5B7GA 1K75A 2IYWA 3OA2A 5AVZA 3Q8SB 4YAIA 1JQEA 2WVHA 3W9UA 3GTKA 4D6YA 2IYPA 1EYZA 5CJJA 1NW8A 3UJHA 5L3SB 3Q3EA 4NOMA 4K9PA 4BKOA 4JV1A 3L0YA 1MC8A 1I94H 4D43A 1E1QD 1PU2A 2DKFA 2ACEA 3P96A 3MJEA 2ZSDA 4QT0A 1G8MA 1H5UA 3EVEA 3PTAA 1NF9A 5E6UB 1YQGA 2QR2A 4X84A 5KVAA 2HF2A 2JCBA 2V5UA 2O50A 2RBGA 3NHKA 2C9ZA 1QAQA 1XZBA 3NRJA 4BWSC 2H2GA 2VVTA 3KOWA 3PFKA 3AZPA 3UMRA 5KFGA 4TQGA 3AF2A 3GJZA 2XIQA 4QJIA 1ZD2P 5IVPA 4LE2A 2VOBA 2HFJA 4LNAA 1UBMS 2DECA 2K7ZA 2A4MA 3NP7A 1MO4A 3GCWA 3HQ4O 2CLEB 5C9ZA 1UBTS 2P6UA 1HDGO 2C1XA 2XB8A 4O4LA 3GAZA 5AO9A 4PGFA 3PDIB 2O52A 4ZN6A 3S5JA 3MWEA 1NJGA 1INLA 1N0UA 2GS9A 2XDWA 4PWYA 4D3ZA 5KYUB 1X94A 1VL1A 1BN7A 1TPYA 1LXCA 1VSQA 3TGPA 3HCCA 3FNGA 3OLQA 4AWBA 3F3MA 4EG5A 1XWWA 4F9TA 1U6KA 4XGKA 2C22A 2Q3EA 1P39A 3NHUA 1MVLA 3LT2A 4DA0A 1GNPA 1KTIA 5KVCA 4DA9A 2JEJA 2ASEA 3PC8A 1XKXA 1BD4A 2EBHX 4DLKA 3FWPA 4CM8A 4DF3A 5BW6B 3Q4GA 4CTNA 4QELA 1J07A 2FGJA 2OL4A 3RC3A 3ZIUA 5EWEA 2QGFA 3H5AA 3OT1A 2DR0A 4M9CA 5EHGA 1RRKA 5K3DA 3JQAA 3ZK7A 1W5TA 4YFYA 5HS6A 3U6KA 4EMSA 2AMFA 4GOXA 4KVFA 4WZBA 1OZAA 3TLEA 1HDZA 4F2GA 3ZV5A 5B6JA 5BT8A 2HV8A 1P62B 3PCXA 4HLCA 1VHLA 3WNQA 1W5EA 3TAHA 1Z75A 2W71A 1JWAB 8ATCA 1LPBB 1VI5A 3KVVA 2J3HA 4L0CA 5HFNA 1WCXA 2O7QA 4YLYA 1J2UA 4LI3X 1VYVA 4M8KA 1SO8A 4Q37A 5B53A 4BC0A 5JNVA 2VTDA 3FVWA 3NP9A 5F76A 5T8KA 3KOYA 4P53A 4OM8A 3AF6A 2F7SA 5EKDA 5A03A 4NKRA 2WIAA 2GARA 2ZIVB 1GTG1 4L02A 2YWJA 3DYIA 3GLHE 3JYHA 5LZ7A 5LXTB 5EMMA 5K0ZA 4QUAA 5LDDC 4NYMQ 1VPDA 1XPOA 1QPZA 2Y68A 1O8CA 2FYTA 3EWAA 3CBQA 4UD2A 2VSNA 3N6XA 1DG1G 1O5IA 1UJMA 1QWOA 2YRWA 1OB5A 1GRVA 3ILXA 2X7XA 3PGXA 1Y89A 5L1IA 2HEIA 2I1VB 4CFZA 5EOYA 2JGNA 1MPXA 1W1UA 1JFFA 2AKYA 3D7NA 4HN4B 1YVUA 2J09A 2Z3WA 5HBRA 3GLIA 2Q3JA 4F4FA 1M2WA 2AF3C 2OZKA 4EYIB 4PZUA 1KBQA 3N9IA 1OKKD 2VNJA 5EJ6A 5LQAA 1JR2A 4QFCA 4XB6B 4I9NA 5TE9A 1WB9A 4KN6A 4MTLA 1XV5A 2VN8A 4HI0E 5LXTF 2A1UB 4JODA 2BFWA 4QWMA 4YWHA 3ZS9A 4C3UA 4IDCA 3VPCA 4B3RH 2QLLA 3T9BA 5AKJA 3NHRA 5TIIA 2GYUA 2OG2A 1CSEE 2PFSA 5B3KA 4Z7JA 5I4IA 5AW8A 3JV7A 3WA7A 2HQRA 4OUDA 3AFNA 2WFAA 5IDYA 3KNZA 5F23A 4BB0A 3WLTA 4DZTA 3BWMA 2ZB2A 5CFOA 5LMNH 4XFDA 3AYZB 4WCFA 3ST7A 2A84A 2GUWA 4ZALA 1RWQA 2Z3VA 5COAA 4RHFA 2DIKA 1L2ZA 2AFHE 1FU7A 4LX0A 4HQNA 1UEIA 5T6BA 3VX4A 3D54D 4QGFA 1L1QA 4PHCA 2C7QA 5KHAA 1CUCA 1NPDA 3SFZA 4GM1A 3E7WA 1DXHA 4JVOA 1CUJA 3VYWA 3TBKA 2OD2A 4J9SA 5HUQA 1L4KA 2LXNA 2ZOSA 3EZLA 1EM8B 1A71A 1ZRNA 3FRIA 1FUYB 3VJKA 4B0PA 3V4OA 1T6YA 4PY2A 2A86A 5KYTA 3S81A 3JQAB 1H5NA 2HIGA 3DOOA 3QG5A 4A3DG 2FG5A 4FD3A 5EIBD 4BE9A 3O94A 4HDNB 4F91B 2HBYA 1RLIA 5M2QA 2BR0A 2QORA 1QIJA 2J3LA 3E8SA 2WYHA 3SZ3A 1OYYA 1RQPA 3J7AK 1P4SA 1YU6A 3ASVA 3BIWA 2PMZA 3CVZA 3PR5B 1EA7A 1EVZA 3JVVA 1ODCA 4BZZA 2CNVA 4FINA 1IXYA 2Q3MA 2VHWA 2X15A 2FX3A 2WMNB 1A96A 3EF1A 4AS3A 1R0RE 1I7SB 1YTUA 2JAOA 3RFCA 1BFDA 3A4IA 1W88A 4OHXA 1B8VA 3D2BA 4JI0H 4MWZA 3S3TA 2B99A 5AKLA 3ECSA 3VDQA 3O8OB 5JJKA 4W5NA 2GQRA 1W96A 3MAGA 2Y0BA 4TOIA 2QL5A 1VL2A 5EPEA 3RLFA 1HSZA 1QBGA 3HGMA 4EQ6B 5AKEA 2VRNA 3M6AA 3S1LA 2IOYA 1M34A 5AM5A 1JX4A 3HGTA 4BKRA 3E0XA 5JG7A 3CN9A 4R84A 3T1OA 3WGVA 2QD3A 1PX2A 2FXVA 3NFRA 3SI8A 2J1LA 3A3NA 3HWWA 4RV4A 3EMKA 3VYVA 2VDLB 5KFCA 2P4HX 4GQIA 4ZGBA 2H2WA 4L07A 3ZTWA 5KS8A 3ITEA 1CD5A 4NNJA 5EWLA 3WADA 5CR5A 1L7XA 4FONA 4D2IA 3T0FA 1Y7HA 3C6MA 3KO8A 1T9GS 5H68A 3P8ZA 2NZVG 3OLZA 2RHMA 3DA8A 3X43A 1KU6A 3WV4A 4BRZA 5A3QA 3KKNA 1RM5A 3PXCX 1U0HC 3FMIA 3V48A 2O5EA 821PA 2QYOA 4LXTA 5AHOA 3UJ7A 3TF5A 1XVUA 3EXFA 4DUGA 1N5DA 4ES6A 4V3BA 2R65A 3CNHA 3K94A 3LDFA 1WVGA 4DV0H 3IBGA 4IJVA 3RTDA 4BO7A 2V1UA 3CJRA 1YS1X 2OORC 1V7CA 5DTEA 3TXYA 2BP7B 1NUHA 3D8TA 3MBKA 2QZPA 2YW9A 3BQMB 4ND5A 4P5DA 4XJXA 5AKIA 1PVDA 1L9KA 4UEJA 1JLHA 1HORA 3UW3A 1II9A 4BCCA 4E12A 2P4QA 5I45A 2A94A 5IABA 5JW6A 2EXXA 3W5JA 3A05A 4XD7D 1SC1A 1IXKA 2RMKA 2YL2A 5ALYA 3TE7A 2PS9A 3F5QA 4HQKA 3UWDA 1G2PA 4CCYA 5IDQA 3FUCA 4NARA 4QICA 2D2EA 1AKTA 2O5VA 5CT6A 3KLOA 4MAMA 5KG7A 2PKCA 3H4DA 4KRYA 1MJ5A 1T3ZA 5AM4A 5ENZA 1U2PA 1NPYA 1WR8A 3GR6A 1R9NA 1F9AA 2I62A 2PD6A 2FLNA 3R0QA 4PYRA 3WGLA 1ZETA 1DC3A 3EX7C 3CVUA 3O1IC 1UXKA 3MT0A 4EDHA 2HIHA 3SGIA 1C2TA 1ONPA 3C5HA 5IVHA 3RRMA 1K5HA 4EB3A 1BGVA 2IXFA 5LD2C 1QFJA 1RFLA 2IF0A 3AC0A 3MG9A 4R9RA 3I39X 3JARA 5ETJA 2ZBQA 4URXR 3UJAA 1SXJC 1VCNA 1BDJA 1K06A 1L5RA 1RQGA 3E8XA 3NKVA 2P41A 3UPTA 2A9FA 3S29A 3ZGLA 4W6QA 1XCMA 5KG0A 1ZW6A 2DCMA 2IYFA 2Y9MB 4JCCA 4KYTA 4OJQA 3EXHA 4IRUB 1O0BA 1G291 1N2GA 1J0DA 2C4TA 3GZJA 2DLCX 4LJKA 1KRXA 3CBGA 2OFPA 3NBUA 3ZQJA 4DMKA 2R1VB 4IZIA 5LA6A 2FLPA 1IEVA 3M6FA 1Z0DA 1TJPB 3ZXYA 1M1ZA 1RC8A 3GEBA 3LS2A 4QRIA 4V39A 3GIKA 2CXPA 1QDUA 3QHPA 5FPSA 5B4TA 3G7NA 1QHGA 3OIFA 3RSFA 5BVGB 3OBBA 2X9LA 1Q3KA 1HLPA 2H0RA 2ZU0C 1QCCA 2PL9A 3TTYA 2GHRA 2R9VA 2WF5A 1QH0A 1R4ZA 1EG7A 2IPLA 2ZREA 5TSDA 3IA7A 3TR5A 3UK6A 4AXXA 1TCBA 1SA0A 2ZJOA 4ECYA 1SZPA 2DPHA 2O2XA 3DONA 5EC8A 1I1KA 1RRCA 4N0EA 2MIIA 5CBPB 1AB5A 1ZSYA 2PKYX 2EKBA 5HTOA 3H20A 2VAPA 4Z53A 4LF8H 2Y1KA 1L4HA 1S1MA 1A69A 1XAGA 1I4WA 3NTUA 4NFYA 1NASA 2JHAA 1UDXA 3GQBB 2HW8A 3PX7A 2WMYA 5G0SA 2OP0A 1D2CA 4YRCA 4MW9A 3ZWKA 2DJIA 1R6BX 2BDUA 2JFUA 2X8LA 3G0GA 1JI3A 3JCZA 3K2IA 3UUEA 5C5EA 5FJJA 5EJ4A 2P8SA 3V4VB 2YQ4A 1QYWA 4RSGA 1SXIA 1UADA 4MKXA 4D57A 2GPSA 2D1QA 1WZIA 2DBZA 2Z5LA 1WETA 1M3SA 2O2YA 5I4BA 3RAJA 5C1OA 2M32A 3FWHA 4XEHA 1TJ5A 1QH1B 1U1EA 1XSEA 2VPWA 4FGJA 4IUCS 3V8EA 1CIJA 4AF8A 1SXQA 4CFYA 1BE1A 3EEFA 4KH0A 1VHWA 1J0CA 1NP7A 3DHNA 4KWEA 1DUVG 3BWVA 4OU4A 2Q4DA 3GP3A 3S2EA 3EPJA 5U4QA 3D8HA 3FPHA 4MS4A 1T0PA 5AHRA 3PIIA 3WLJA 4D4HA 1S2GA 2PMDA 2RAVA 2WU3A 4UTPA 6AT1A 4MR7A 3QVSA 2LVBA 2REQA 5BNWA 4LDAA 5JBQA 4Y0NA 3ETEA 1VCIA 1TQ8A 5KNBD 3OPYA 3EA4A 4RF5A 3VPGA 1G1AA 3AR5A 4CQMD 4QWEA 1ENYA 3FDSA 1SNYA 3FYHA 4BGIA 4YMTA 4P2GA 4PG6A 3D5TA 3EIHA 1LGYA 1RSZA 1G60A 2H4YA 4AKGA 3FPLA 3FUWA 1MABB 3GRYA 3V6HA 2JI6A 3W6OA 4EHIA 2HHHB 3ANLA 3GELA 4DCGA 3KKEA 4CIVA 2P9FA 1GV0A 1I4DD 1WUKS 5DMHA 1A76A 4ZC1A 2BDEA 3W3ZB 2JKZA 2ORVA 3L8CA 3RKUA 4AJLA 4CODB 3ABQB 2ZJ0A 3R0ZA 1Y33E 3GFGA 3VGJA 3ZNPA 4C4TA 4EMBA 1XPRA 2PZKA 2W0MA 1TMGE 1N5IA 2AUTA 2NUTA 1KDTA 2UXBB 4AN1A 3RFFA 1NYQA 2QN7A 2YCHA 2IV3A 2NADA 3M83A 1U9ZA 3LZDA 3KVYA 3MCWA 4NJEA 4WLFA 1LI4A 2X5RA 1E2UA 5JYDA 3LXRA 3ND7A 2BM1A 3F74A 1ES9A 2JD1A 1K3TA 3IIJA 1FU8A 2ZS9A 3ANXA 4RTQA 2QN8A 3U7EB 4YRSA 1FFXB 1OZHA 5D51S 1J1ZA 4JJ8A 4WKBA 5JFOA 4HWKA 2ONJA 1FYXA 1E9CA 2C04A 3D6TB 3IQFA 3VR6H 5EJEA 5JTUA 3UMYA 3I9V1 5SY9A 4AP6A 1GDHA 1X9HA 3WISA 1OLUA 1XRMA 3H2KA 4YRLA 1QZZA 1IB6A 4D9MA 4JR1A 3I04A 3S6JA 3S44A 3SEAA 3U4HA 1CR2A 1FX1A 1K9VF 1NF2A 1PDWA 1V16A 1DINA 3VTFA 2PE5A 2JIDA 2ZS8A 1I10A 1TLFA 1P60A 4P2BA 2QRQA 3NV7A 5DYTA 2ZJTA 1M2JA 2C29D 2FWPA 4GRIA 4RV5A 5FR1A 4UFZA 4WJKB 5HIIA 4BFTA 2X4IA 5HG0A 5IASA 2HJWA 2D00A 2Y0EA 3D7KA 4D3YA 4E5SA 4EHJA 5LA6F 4QLAA 1NC3A 4ZOLF 5T14A 1ZN2A 2A30A 3I6IA 1Y1WG 1T1SA 2CBXA 2PX0A 4KAJA 2H06A 4V38A 1CKOA 2E4YA 4BNYA 1LA2A 3IQWA 4OIFA 3E2PA 1WH2A 4WLVA 3C4QA 5IT9A 4NG5A 3OF5A 4UOEA 5GONF 3D81A 1J56A 1PV4A 2HY7A 4R9SA 3DJYA 2GBFA 3W8DA 4C22A 1IEQA 1ZMOA 3K92A 4NV0A 3AFIA 4DBVO 2IPMA 4PO3X 4C3ZA 3CT4A 2CD7A 2UVDA 4XAQA 1J49A 1EFRA 1S2MA 3FH0A 3TKAA 3ILYA 3GJTA 5LLTA 1B0UA 1QZXA 2QXYA 4YP7A 3S1AA 4ECVA 4FM9A 4B3BA 2HREA 3PFIA 4TLLB 1RK6A 3MMNA 4LWPA 4Q15A 4WXYB 4DT1A 3EG9B 4D4KA 1JQJC 4M6WB 4EENA 4ZO9A 2X4LA 5TR9A 2C2XA 4JUZA 4MUMA 4EF6A 5C8ZA 5C5DA 1EDDA 2DE0X 2DR2A 1H4VB 1R0BA 1Z8HA 3LQ1A 1KYZA 3LUCA 4EY8A 4DNQA 2QMUA 2QYZA 1EVIA 3L7YA 3PKIA 2ORWA 1U9IC 4LK3A 2PWAA 2FA9A 2I34A 2JAXA 3ADPA 3B60A 3L8YA 4E2XA 1S6YA 3H2ZA 3O83A 2DT8A 5KJ1A 1XDBA 1CXZA 4LRQA 5KU7A 3EEIA 2G4VA 1B8PA 4MV5A 5FBHA 2J7PD 5L3ZA 1K6XA 2HLDD 4W5RA 2Z2KA 2ZANA 3KYCA 3VZCA 1STOA 2M6RA 5TGZA 3RSGA 1W2GA 1HR0B 1PR4A 4MQMA 4U9IS 2BUCA 2CW5A 3IILA 1TUGA 3CZ5A 4HGNA 5CLLA 1PS0A 4LQCA 1E2LA 2XWBF 3G17A 4EBBA 4F2DA 4RKYA 2W9BA 3KS9A 3BGWA 2G72A 3IQGX 1SIBE 4CDRA 2QR3A 2FEWB 5DG7A 4RZ3A 3F73A 4XEUA 3EZ7A 1MXHA 3UJ8A 3TNJA 3IOBA 2XWQA 3MSXA 3L5OA 4DC9A 1AK9A 3CVXA 4KR7A 1HDCA 3PP8A 4M7OA 5CH5A 1LRKA 1ZSVA 2CVFA 4NCJA 1R0ZA 3EEQA 3MR3A 3HA7A 3WK5A 1Z4OA 1QO0D 4YN3A 4Y9SA 4E2YA 5DF1A 1SIWA 3NM4A 1GZVA 3CVVA 2ANCA 4REOA 2CFSA 2DFDA 4R8SA 3CJQA 4HQ0A 5A3VA 3EY4A 3P9NA 5KYUA 4ZTUB 4EFEA 4M1MA 3KEFA 2PWYA 4TLDA 4MUKA 2BOVA 5FPRA 1V3VA 1UAGA 3FNQA 1C7FA 2XX3A 2XYHA 2EKQA 1YR6A 4U63A 5COQA 4EJ0A 4EW2A 4EWLA 1JHAA 5CXXA 2PZBA 5CGZA 4RTNA 2W7TA 1DTEA 1T4BA 3UMMA 1VXOA 4BXOA 4ZAVA 3AERA 3AOEC 1QGUA 2I33A 3FDXA 1BVYF 2GZAA 3E18A 1CQJA 2EJCA 3GZ4A 1NW6A 3JQ8B 1TQ6A 3NV9A 3PHJA 4DRZA 1RM4A 2AD5A 4ZOAA 1DKQA 1N5LA 3WWDA 1XZJA 3IO5A 2Y2VA 1YA8A 1EFDN 4U6SA 3AUFA 5TY0A 3AW9A 1EE2A 1PNOA 3IN5A 1QH8B 5BYJA 2GOYA 1SHKA 2R8HA 3UK0A 4E5YA 4B6EA 3DFZA 5JCOC 3AUKA 5KX5A 4B4WA 1VBFA 1RADA 5GV8A 1OUMA 2PGAA 4DILA 5BMVB 1FKAH 4ER0A 1A9SA 5ENDA 5KAMA 3RF6A 3ZKAA 1CUFA 1ZI6A 4ZU6X 3UJ9A 1SK9A 4FR2A 1Y1WA 3LX4A 3BM5A 1DAAA 3IS3A 4AQYH 1FZTA 2FR8C 2ZJYA 2XNHA 5DFAA 4XFJA 2H1VA 2NXNA 3SSMA 3IL2A 3NZEA 4UUGA 3CLUD 4C2UA 3G8DA 1JDBC 2XJ4A 3ENZA 3H3VH 4D99A 2BSAA 1U0SY 2FR1A 5FWAA 3QE9Y 4EPVA 5IC4A 3QXXA 1U3VA 1Q7RA 2PSDA 2WYIA 4QVKA 5L3QB 5J2UA 1YFKA 2LIVA 3C97A 3IDZA 4MDEA 1YRYE 1L4GA 1WJGA 1DOHA 2YHAA 1YBVA 5C8YB 1P2GA 3ACBA 1RKBA 5C1PA 1ZL0A 3SXUA 2IS6A 3RBAA 1ZNQO 3AEZA 3JVEA 5DO9A 3EA5A 3L18A 3IOCA 1DC5A 1CKNB 2V7UA 4QLBA 1UBEA 3HC7A 3TAUA 4JLJA 5AICA 3FOEC 3TXXA 1LTKA 2QUJA 3QUCA 4POAA 1NVBA 4CKYA 1E3SA 3CX3A 2C9CA 2HA3A 4A0GA 1DAMA 4RMHA 1JBEA 2K6GA 5BNFA 1SC4A 1E9EA 3LU1A 4TUYA 3KHUA 3VR6D 5DLDA 2WYWA 1P7WA 4KLZA 4NR0A 1Z63A 5IYBG 5LB2A 2JAWA 3T3MB 2IVFA 1RXEA 2Q3LA 5EUCA 3RAFC 1KXJA 5NLLA 2ZFUA 2KHZA 3DJFA 1X80A 3HYTA 3IP7A 3NORA 2AGOA 3IRVA 1CE8B 2QVLA 2ZIAA 1QGUB 4MKFA 4FHFA 3RRBA 2VQ3A 2VOEA 1JG1A 1S7CA 1KI6B 4XW2A 1D0SA 4XYLA 4XRGA 3LL4A 3THXB 3EDQA 4G8JA 4L95C 1C9DB 4M87A 3LT4A 1VPLA 4ONEA 2AB0A 1YNSA 3CSDA 3R9WA 2YZLA 4E5PA 4EABA 2XBMA 1SUAA 1A9PA 1P73A 3WDSA 3X1KA 3OFND 4QJFA 1JFLA 3FPGA 5A4JA 4PSAA 1LZKA 1M1YE 3EOAI 1KVSA 4ZPJA 5F7JA 4CHTA 4MVJG 3TY8A 3VSBA 3Q15C 4KXVA 2B6NA 2O7VA 1XAJA 2PLAA 3INGA 5IAGA 3B48A 5JO9A 4Q7QA 2MCFA 3NNSA 4EUKA 5BYKA 2ONYA 1NLMA 2DHEA 3DDCA 4UE3S 5BNIA 4Y1EA 1C9JA 1G41A 1GRRA 1I8TA 3C0FB 1WCWA 2AQIA 2X8JB 3D59A 4IOJA 5FBLB 5B5SA 2VYNA 1ILWA 1PK8A 3C3KA 4QDOA 5AUOB 4TX1A 2P6NA 3HY6A 5FHRA 3CXRA 3JALA 2JGMA 1OH5A 3DZJA 3WIVA 4FI3C 2FWBA 4ZZ0A 1XEWX 3KE8A 3RCBA 3GFSA 3ZQ6A 1WMSA 3LL7A 1BDIA 1NXOA 4OFZA 1YK0A 4CTJA 3GA5A 3L4JA 2B4TO 2WUDA 3GDOA 3NVAA 4K6HA 2FOXA 2C96A 3TSCA 4X66B 1SB9A 2VQFH 4MKHA 4C4OA 1XX6A 3Q0IA 3HPQA 1X7XA 4PZAA 4TTIA 4BVFA 2VPZA 1KBLA 1V8DA 3A0UA 3HDHA 2FFBA 4LYGA 3SD7A 4DAOA 5FUYA 1BYUA 4ED1A 3GLFE 1X3LA 3K0AA 1JUDA 4GPAA 3BCUA 3FYDA 5GGYA 4E6NA 2GM4A 2V8BA 2N42A 1KQ3A 1FYVA 1NSFA 3JTEA 3SF0A 1XPJA 4DIKA 1EGVB 4Q6WA 4J4BA 5DEOA 4C76A 4MVJE 4ND4A 4WE3A 5I5YA 5IYCG 3O2JA 4C4SA 1TVEA 1KMHA 4RFVA 5IP9G 3HL0A 4ESVA 1JXOA 1FW6A 1KOGA 3FTEA 3LPDA 3EWSA 3N6VA 1FW8A 4RK4A 2B83A 3EGXB 3HP7A 4KPUB 1K7FB 2ZLBA 1U1GA 3F9RA 1IOZA 3NJ8A 4NATA 2PQ0A 5KFUA 1Z22A 4CEHA 5JBIA 1Q17A 1Q1QA 2PQMA 2WU8A 1SCNE 1CQZA 2D13A 2O06A 3K70B 2H18A 5EKUA 1YBAA 2AD1A 3MOGA 5TJ9A 4X1YA 1A5AB 3GGPA 1CCWA 1MB2A 1FCJA 2WKWA 3B12A 3AJAA 3K0CC 4Z9XA 5TC4A 1K7EB 4EYGA 4LF6B 1H69A 2GKOA 3H0GG 4MTEA 1TYBE 4X61A 3AIOA 4P3XA 4FFSA 5FX2A 2ASDA 2XNDD 1NNLA 2Y8EA 3I1IA 4IV0A 1BRMA 2SCUA 3OZAA 4RS3A 1OWPA 7REQB 2EYQA 2JVIA 2QN1A 4NF2A 1XD8A 2ZZMA 4JI7H 4IX9A 5CFNA 4IMRA 5KWSA 3SZOA 1TT5B 1JE1A 3T99A 1N2CA 1HFEL 2BTOA 1IATA 2V6JA 2XWSA 3N8NA 3MSCA 4BEJA 1FFSA 3DOEA 3KYDB 4U7HA 3L2PA 5DPMA 3F1KA 5DMXA 1OXKB 1Q7TA 3D4IA 1TZCA 3K2QA 3RS8A 1YULA 4UTXA 1WXHA 1PHRA 5A06A 1WXFA 3Q7IA 1SD1A 5JZOA 1EX7A 1VGQA 1WDMA 4IAOA 1EFPA 3MMPA 3D8BA 2PS3A 4NYIQ 3P0IA 1ZK0A 4W5QA 3D3WB 1Y3CE 4X41A 4IWYA 2XUZA 4M22A 1LW6E 4MEBA 5AOAA 4RTMA 2B1GA 2BGTA 4EYOA 5IFKA 2WSMA 2DFNA 1B2LA 1QTIA 3QEKA 4HD8A 2OR3A 4PX5A 4QODA 5KTKA 1WF3A 3IBCA 4TV8B 3KT8A 3R3XA 4NONA 3TLXA 3ZDRA 1NR5A 5M5BA 3ZD7A 4AIIA 3SC6A 1M54A 2GR9A 3FFAA 4WN9B 1T2CA 3UAVA 2IHYA 5K6AC 2FRDA 5B1EA 2ISSD 1N34H 1L5ZA 6YASA 4LF8B 1C9EA 3A6ZA 4IOKA 2C83A 1FDSA 4WKOA 5CURA 1DAKA 3A32A 2H1IA 3ENWA 5B55A 3KVNA 5JFTA 4G1FA 1O94C 4DMFA 1U2GA 2J07A 3NU1A 4JLKA 1MJHA 4J94A 4YCLA 4ZKDA 2VPYA 2QNRA 2YRFA 1G21A 4LCJA 4LSXA 3PPYA 1Q77A 4JKYA 4CC6A 2FUCA 3HZHA 4CT4B 3LZ6A 4KN5A 1GZ4A 5JSUA 2W9AA 1IUNA 4HY3A 2F8SA 5CU7A 5JQGF 2W4QA 5I60A 3I6ZA 4O29A 5HFJA 2HHFB 1JBKA 1QNFA 2BBTA 4FYMA 1EGQA 5CLJA 2EG5A 4E15A 4IJWA 1TADA 2PUTA 2C2BA 1F9EA 1R4AA 3RI3A 5LXTA 3AP1A 3JS5A 4QTUB 5IT5A 4V0ME 2R93G 2YWHA 4IHJA 1HT1E 5A0VA 3B3QA 1XXLA 3P2MA 4D5EA 4EKIA 3QHQA 4KYVA 2UVUA 3LWBA 5D7NA 5J47A 1WZUA 3W05A 1NURA 3CR3C 2BH9A 2O8EA 2AZMA 2YHBA 1UAYA 2BVNA 4I66A 4P80A 3RT7A 4A7PA 4TYYA 2AQ8A 4BAGA 1OFUX 2B8NA 1Z3CA 3J81W 3C7CB 4M9SA 1W8DA 4HDMA 1XUOA 5ED0A 4ZEWA 3K1JA 5HKOA 2RF4A 1HEYA 3PRHA 3Q9NA 4NENA 3I62A 1X1RA 4JH0A 4YVFA 2VWHA 1KVTA 2HJGA 2JDIA 4MGEA 1Z15A 2FQ1A 2XMCA 5E4TA 3TCKA 2R86A 1ZUIA 3I9OA 3D6FA 3HSKA 1AMUA 2OWDA 1U8EA 5EOVA 3IMEA 3C85A 2CE7A 3IKMB 3KXPA 1YBFA 4C01A 2PZAA 2UZ3A 3C3PA 3IERA 5HF6A 1PJ4A 4RZXA 5E2IA 3WMXA 1MOPA 2CVZA 3WKBA 1ND5A 4OUDB 2C95A 2QJTA 1T8RA 3L0OA 4NPCA 2Y71A 3A6DA 3EVZA 4ADSG 2VTBA 3BYZA 4TMTA 4JXZA 3GTGA 5HDBB 4L74A 2WLSA 3EZNA 3T5LA 4PX2A 1P4RA 2H4WA 2BKUA 3BFKA 3BZUA 2DSNA 2WNIA 4R2IA 1E1CA 3G85A 1C0KA 4YRPA 421PA 2QG6A 3RO7A 1CNMA 1LDBA 3PBKA 3E9EA 3QPUA 1Z6GA 4AZ0B 3AVUA 1MG5A 4MUYA 2DTDA 1DO0A 3CRNA 4Q5IA 4QNRA 2RG7A 4GQAA 1CR1A 5CK4A 4NJMB 1P1FA 3X3HA 3GT7A 5JANA 2MSWA 2Q5CA 3OCJA 3QEJA 2G40A 3GCDA 4F12A 2DLDA 2AMYA 3DEAA 4W63A 3GUHA 3LZCA 3PRKE 3FTDA 3ZI7A 1T9BA 1ZJ4A 3HCFA 4UHCA 5K3FA 1UDBA 3S2UA 5FBZA 3NHMA 1MC4A 3TQQA 4X64B 1Z2PX 1ZWLA 2R8PA 5DLFA 1DKRA 3VU3A 3SHWA 2FDCA 4MIKA 4YUYA 5KFZA 4KBGA 2XNDA 3AW8A 3P26A 4JQYA 4F9GA 3W5BA 4GR4A 3NATA 2QOEA 2NG1A 5EZYA 4BNZA 2HLHA 5D8DA 2JGAA 2CMKA 5DNDA 3BACA 4ZVOA 3VR5D 5CFLA 1GGVA 4R3WA 4CKWA 1VLHA 1BC5A 2CFTA 2MOKA 1B15A 2Z5VA 5LDGA 6ADHA 1V5FA 4W4TA 1RHUA 3X44A 1T24A 4HYYA 4LV5B 4Y6QA 4GI2A 4YJDA 5LP6C 5IZCA 4HK4A 4YC7A 1CZUA 4GFDA 5KOJB 3OQMA 3QVGA 3VMMA 4MARA 2JGRA 1PK9A 1DU4A 3ONDA 1UPTA 3T5KA 3C3WA 2QUBA 3K6JA 4FCTA 3B6IA 3RFXA 3OC0A 1OH6A 2HSDA 4BX2A 5BUCA 3FLMA 3B1FA 4UCSA 4YP9A 3BJYA 4EB0A 5KQLA 2PUGA 2C7PA 3VVLA 3WRWA 1GZHB 1IBMB 3HWSA 3LO5A 2ZCJA 2Y6UA 2XT6A 3CQ9A 2FB9A 3G0DA 5BO5A 3WFJA 1HYBA 4AKSA 4TYNA 3EWNA 3FF1A 1L5HB 4LF6H 1GWNA 4G5XA 4HDRB 4RA9B 5GQSA 1F2DA 4LSAA 3WGMA 2WSLA 3DE3X 2UYHA 4UBMA 4GC9A 3SM3A 2JCYA 2ZXUA 2P67A 4L5JA 2FQYA 1IIRA 2FE1A 1IDN1 5DI3B 2FCRA 4PGMA 1ACMA 1CIVA 2YXPX 3CLVA 5KAPA 3T3PB 2YU9A 4IZ6A 4N0MA 3ZWYA 2ZGVA 2CC2A 4GZ6A 3BBPA 2WM3A 3ENVA 3J7TA 3EGXA 1FVHA 4YRQA 1SXJB 2CDRA 2Q99A 1RHRA 4LJSA 1VDMA 3OO0A 2DYKA 1NJ6A 1T9AA 2AV6A 3TEFA 2QNBA 2ZYWX 1SKYB 5EXTA 1LS1A 1QH9A 4DEXA 3VR4D 3PRJA 5DWDA 2C4UA 4R2KA 3KQUA 1E4YA 2PBRA 2PL1A 2VYND 1QRRA 2R93A 3QUQA 4MQLA 3AINA 1AU9A 5CM8B 5FPPA 4QX6A 4NH0A 3DHEA 3OQPA 4ZCMA 3G8YA 1ZQ9A 2PX6A 2CJYA 2A1TR 2LWIA 3E61A 3K35A 4Y1RB 5IW8A 3RE1A 3RFVA 4BY1G 5LM3A 3BMOA 4Z9FA 2BM8A 4IMJB 5CIQA 2XHEA 5DIFA 3N28A 5H3LA 3WL6A 4CVNA 1W34A 2WMOB 3PR2B 4CF3A 6REQB 2V7QD 2VQFB 1TAHA 3N0VA 3U60B 4ZC8A 1PTJA 4EO4A 4RHTA 1XDGA 4QUEA 4GG1A 5SZJA 3S24A 2AE1A 3D4PA 3L46A 4QGAA 2CNKA 3FMOB 1FQJA 1W35A 3FNBA 3VXKA 4C2BA 4D6XA 5JEDA 4UBLA 5EXSA 3GMTA 1H8ED 4RL4A 4GBMA 4QJ5A 3TN7A 4QDUA 1GGJA 3THWB 1RPJA 1PT5A 2JASA 1VE9A 3G1TA 4CFSA 2Q3BA 2PPVA 4P86A 3KKQA 3LY5A 5A7GA 2QVCA 1TA8A 3LX8A 3LQ4A 4FDAA 4RFLA 1PD0A 3DFUA 1U04A 2YJTD 3MCUA 4F93B 3RRYA 4TV9F 2ZRKA 4BY9E 4OHBA 1RD4A 1KFJB 4LYHA 4BNIA 5EJ8A 3DMGA 2VJCA 1D2EA 4V3CA 3PPVA 2C78A 1F8FA 2Y1XA 2C1EA 5ILOA 1J1UA 1IZ9A 1GAWA 4IJQA 1AKNA 2CLKB 4RY8A 4P8RA 3WP0A 5GADl 2Z1NA 3OF2A 3RAEC 2W6NA 3ZHCA 2WPNA 1A3CA 4ECWA 1DIOB 2A3NA 1UJNA 2VWPA 2HX1A 5ESRA 3UK2A 2HADA 4DL7A 5AK0A 3T7RA 5C8XA 4CV2A 3P4YA 3MLBA 4CCSA 1ESDA 2WHXA 2VBIA 2Q62A 4FBLA 1PV1A 4FYYA 4LGCA 1YAHA 1G21B 4N03A 2VFAA 3A1UA 3CGWA 3T4UA 2O8CA 2FP4A 3TDMA 1R5BA 1ZJ6A 1RLJA 1ZUNB 2WICA 3CNBA 5EIOA 4DR3B 2HXGA 1KH1A 1IHPA 4K05A 1XC7A 1P2BA 2NNLD 3U44B 2O07A 1V8OA 3WNZA 1EM6A 1GCIA 2PA3A 3C6ZA 3N7UA 4MUFA 3TLKA 5LU9A 4GUDA 4JLMA 3NUGA 2BQUA 2WZDA 4DKJA 2CV1A 2BUAA 4N7RA 4BVHA 2O6HA 2FMKA 5DGBA 4E2FA 1WZCA 2BEVB 3A28A 3HHEA 5DNUA 4RF2A 3SE7A 1KNQA 1CRLA 2OGZA 4IEFB 4RMNA 5D00A 5DM4A 4EYEA 2EHJA 2I67A 1MDBA 5FYQA 4JQCA 2OG1A 5IJZA 3DSRA 2H2FA 1Q1ZA 4BVKA 2HIMA 3OH8A 4G4IA 1N9GB 1SCKA 1SVKA 1ZC3A 2JLCA 5FLKA 2YIVX 4MVJM 3TDKA 2PO7A 2OE2A 4G8CA 3PJRA 2V55B 2A0KA 4XVUA 3PS9A 1SEIA 1EBBA 1ATIA 4IDDA 4M0MA 4DNPA 3IEKA 2W8LA 3MMXA 5HSGA 2WU1A 3QVWA 4LFAH 2VF4X 4DRYA 3DTFA 1T94A 1MH9A 4HZGA 3BA9A 1UC8A 1ECCA 5KFFA 4M1QA 4F6RA 4HLUC 1F1BA 2KW5A 2XE4A 1U9CA 1M6NA 4Q16A 4TL9A 4W9NC 5CH3A 5ALHA 5J2TB 3OHMA 2UU9B 3H0EA 2HGWA 1YA4A 2JA5A 5I9BA 1SG0A 2VEDA 2Q50A 3AUXA 3LLUA 1O58A 4ZT6A 4UUBA 2QK4A 3KSUA 5EP2A 3PYMA 1KBOA 1V4VA 3L02A 3L4SO 3QPVA 3QJ5A 4TLBA 1XB2A 3WLRA 5ANRB 3MJVA 3ECCA 2HA5A 1XQVA 5AJVB 2C2OA 1ZVKA 3CUVA 5AUPB 4B3GA 4R2WA 2N75A 2ONKA 4MP8A 5AK5A 1Y9DA 4HGOA 2QEQA 1HMPA 1IOLA 1J39A 3GK3A 4RM2A 3AI3A 4NBVA 2CZQA 3ONWA 2FLLA 3DZCA 3I83A 4O1IA 3RASA 3UJCA 2P11A 3A7DA 4OI1A 4PPQA 4OX9B 1YHZA 1KARA 4JLPA 4G9GA 4KIFA 5LZ8A 2FP4B 1BO6A 3MWYW 3W6ZA 4HAOA 1K92A 3MTDA 4OREX 4F4JA 2INGX 2V4MA 1BKDR 3UNXA 1GNRA 3DUFB 5K0JA 3F4KA 2EOAA 2O0HA 1P5RA 3N2EA 2BN4A 4FHCA 4KPUA 4P34A 4WKPA 1CR0A 1SKAA 4N8DA 4Q18A 4ZICA 3DEYX 2VATA 4EKDA 3CWCA 1EE1A 4INJA 1UBFA 2C98A 4ZVMA 2YXEA 4D44A 4OXXA 4FFNA 5J23A 3E2MA 3KKLA 1XNGA 1ZOPA 4P93A 2CL5A 3G5UA 4FI3F 4RMJA 1E3EA 3UT6A 2IIVA 4J49A 4X93A 4AX8A 1Y3IA 1Y6GA 3AR7A 3F5DA 3N76A 4O82A 4GPZA 5CX4A 4ECAA 4F5EA 4INOA 1NW7A 3M9WA 3NDPA 1HGXA 3MW8A 4I5GA 3PQFA 2ZETA 5SZHB 4OQXA 3WMEA 3KWJA 1KEEA 1JIHA 1FLVA 2C0QA 2JHCA 1K9SA 2VJKA 3EGWA 4M0UA 3QTBA 1T1RA 2QZZA 3H9UA 4G0WA 2P9JA 3GFVA 4X3CA 4NEQA 4NSNA 5JBNA 3N0TA 4ACAA 1Y9AA 1O6BA 1SPXA 1FBTA 2YWDA 2RAFA 3IDQA 3VZSA 4DZZA 2QG4A 2VAXA 2J5XA 3FLEA 4AJOA 3CLUC 4YACA 1VIYA 3EEOA 1WHSB 1MIOB 1P3DA 1RHJA 4MV4A 4LYYA 3U4DA 4G85A 4BNLA 2IZZA 2I3GA 2XUHA 3ZQ4A 1E2EA 3KZ1E 5AW1A 4D97A 3T5MA 1L8LA 4LHYA 5DXFA 3CXUA 5IUKC 4AICA 1E4VA 4M76B 1L7OA 1NLZA 1R8YA 4OHWA 3MBIA 5H3HA 5IXYA 1KR5A 3ENKA 1ATZA 1QO7A 4HNQA 1IVYA 2ZSJA 3CKMA 3ESCA 4YTEA 3BIJA 1MFPA 4Z1OA 1A1VA 1UOPA 1F20A 2NU6A 2IWHA 3IIEA 5GJVC 4ARCA 2G1PA 4ZARA 1N56A 2JEYA 2KSQA 2GAOA 2OB2A 3U3KA 5EKXA 2FE3A 3QQPA 2H0QA 3SJ7A 4FYPA 2WYOA 3AK4A 3QTTA 1KSGA 4B81A 3H0KA 3EDOA 4I9FA 2MCTA 4MYTA 5B58T 3VOAA 1PQ4A 2I6XA 4H16A 2N47A 2AG6A 2F90A 3LPCA 4Y1RA 3D31A 3OAAA 2BJVA 1XMOH 4IH4A 1CKEA 1ST3A 2GF0A 2QDXA 2OT3B 3HVUA 4KQJA 4MR8B 3TE6A 3PE3A 2QA5A 2A0FA 1TVCA 2WYVA 3ZY5A 2ZQZA 4AL4A 2EZ9A 5JCPA 4WMLA 2BFPA 1GILA 3JPWA 3ANTA 3IP8A 4DMMA 1OZFA 1ZGZA 2FXIA 1XNQB 4OJMX 4C30A 1T1GA 2PGXA 1D5CA 1E9AA 3H2SA 6Q21A 5DGCA 4K9OA 5C34B 1VYUA 3BGVA 3ZHSA 1OH8A 3BRQA 2NZYA 1II8B 1YWGO 2Z56A 2IA6A 3DFFA 4GMHA 5BN5B 1PR1A 3LBNA 4JX9A 1A9RA 5K3SA 1AV6A 4DLBA 4O4IF 1DRVA 1Y5NA 2CHUA 1RXUA 3NBQA 4XI9A 4JC4A 2UUCH 1W4LA 3CO5A 2JA5G 2ZPUA 3QENA 4J16A 3F9CA 4JSRA 1EINA 2QN3A 2G0AA 1YRBA 2J9XB 2ZXEA 3SK0A 5FPTA 3V7UA 4FPXA 3GLSA 4DBLC 1LTQA 3OIWA 2ZW9A 4UULA 5FOXA 5SV2A 1H2EA 5BSRA 4QWDA 2FG6C 3I6QA 4PPGA 5T67A 3HXTA 1JDZA 1Z0AA 4QEKA 2NMVA 3IUNA 1NR7A 1PSWA 2H0AA 3PDIA 3VO8A 2BEJA 4F97A 1K1QA 1RR6A 2Z2ZA 2EJTA 3OIUA 4D8WA 3DAAA 2IU4A 3LDHA 4D0NA 3SNKA 4FFBA 3BCRA 1ZQ1A 1F5SA 3IKLA 3L92A 1L4EA 4ATNA 1YHNA 1KAHA 3CZRA 2FHSA 2FRVA 1Y1LA 1V4BA 4GSLA 4KC0A 4GIBA 5FAKA 3KHRA 1XTRA 2CLSA 4IWNA 5LCXA 1NI5A 1Q1AA 2JIBA 1VLLA 4L15A 4MS3B 1BHQ1 2LDXA 1T2UA 2PGNA 3RQSA 3DTVB 3AYHB 4ABTA 4OHOA 3TNFA 3L43A 3FYUB 4K88A 4LE1A 1IZYA 3SQDA 1YFLA 1L7NA 2Q1SA 4TRMA 4Z5XA 3DV0A 5LMUH 2IXDA 4KI7A 4ARUA 3KKZA 4DIMA 1E9BA 4WK0B 2VJBA 5KZMB 4JJAA 1E1MA 5JMPA 1HLDA 3PPIA 5D1HA 4ZANA 3B85A 4NWIA 3D2CA 3P94A 2HMTA 1QYCA 4F06A 1US8B 5IWAB 1BXGB 3IV7A 5E25A 4RJIA