1UCJA

Mutants of rnase sa
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVTFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The contribution of polar group burial to protein stability is strongly context-dependent
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
molecule keywords Guanyl-specific ribonuclease Sa
total genus 25
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2003-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1ucjA00
1BRGA 1RDSA 1T2IA 1YVSA 1HZ1A 1RNTA 1BRJA 1B2MA 1RCLA 1B2UA 1UCKA 1CH0A 4RNTA 2BU4A 1FUTA 3DH2A 1GOUA 3KCHA 1RGKA 1TRPA 1BSBA 1BU4A 2F4YA 1RHLA 8RNTA 1X1XA 1PY3A 1BSCA 1BNIA 1AQZA 1BIRA 1X1UA 1B2SA 1BSEA 1B20A 1Q9EA 2C4BA 2F5WA 4GSPA 3GSPA 3Q3FA 1BAOA 1RGCA 1RLSA 1UCIA 6RNTA 1X1WA 1GOYA 6GSPA 7RNTA 1B3SA 1LRAA 1BANA 1BUJA 1I0XA 1BRHA 4HOHA 2F5MA 4GHOA 1B21A 1RN4A 1RN1A 1RCKA 2RBIA 1YNVX 2KAAA 1I70A 3WR2A 1RNBA 1BNFA 1FZUA 2ZA4A 1JBTA 1BNJA 1RMSA 1BNEA 5HOHA 1BOXA 1BNSA 2KF3A 9RNTA 1BRKA 1JBRA 1GOVA 1X1YA 3D5IA 7GSPA 2HOHA 3HOHA 1RGFA 1JBSA 1UCJA 5BIRA 2SARA 1GMRA 1RGLA 1RGAA 1HYFA 1UCLA 2KF5A 1FW7A 4BU4A 1LOWA 2F56A 3AGOA 1BNGA 4BIRA 2BIRA 1FYSA 1I2FA 2KF4A 3WHOA 1I3IA 1R4YA 4HAAA 4J5GA 2AAEA 1DETA 1G02A 3AGNA 1DE3A 1B27A 1SARA 1A2PA 5GSPA 3D4AA 2AADA 3BIRA 1ZGXA 1C54A 1GMPA 1I8VA 2RNTA 1GSPA 2GSPA 3AHSA 2KF6A 1BSDA 1LOYA 1RGHA 1T2HA 3AHWA 3D5GA 3URPA 1I3FA 1LNIA 1BRNL 1RTUA 1GMQA 3DGYA 1I0VA 1BVIA 1B2ZA 1AY7A 1MGRA 1TRQA 1IYYA 1RSNA 1RGEA 1BGSA 5RNTA 3A5EA 3BU4A 1BRSA 1PYLA 3RNTA 1RGGA 5BU4A 1TTOA 3SYUA 1LOVA 4J5KA 1I2GA 1BRIA 1BNRA 1B2XA 1FUSA 1MGWA 1YGWA 1BSAA 1I2EA
chains in the Genus database with same CATH superfamily
1W00A 2XGNA 1YVSA 4X2OA 5AIGA 3AMOB 1YI23 1F8NA 1WMPA 1B2UA 5IEOA 1STFI 5AEUB 3EE1A 3EHCA 3OWYA 3DH2A 1YJN3 3A76A 1GOUA 3IMAB 3G4S3 1RHLA 1RN7A 2PZVA 1CYUA 1ZS7A 3SLUA 4DKIA 1PY3A 2F99A 1BSCA 1PFPA 5IENA 1BIRA 3EN8A 3D79A 3WOEB 1B2SA 2BMQB 1K41A 1KD14 3MSOA 2XH9A 3LTDA 2C10A 3DGNA 1IU7A 4KFEA 1VQO3 1IVVA 1RLSA 4K1UA 3CCR3 4LGQA 1X1WA 3NBJA 2K3DA 4K61A 3PXMA 1GY5A 1Y4KA 3WMDA 7RNTA 3BLZA 1BANA 2F86B 4LMIA 1W7CA 1JNQA 4GHOA 1B21A 1RN4A 1RN1A 1RCKA 2BMOB 2L4VA 2W9PA 5AYSC 2FGTA 3CC43 4N6V0 3Q2PA 2IUKA 1JBTA 1OPYA 1JRQA 2GBXB 2K54A 2BMRB 2Q07A 1E97A 4LZIA 4WYKA 4OUQA 3GZRA 1BNSA 4EC6A 9RNTA 2W56B 1A2KA 3F8HA 1D6ZA 2Z7AA 2A15A 1SPUA 1V74A 2IYJA 3D5IA 3PCSA 4RNYA 2W04A 1JN5A 3HOHA 2CW9A 1AR0A 3LTCA 2CX0A 3UB1A 4H61A 3T8NA 2E2VA 1LNHA 3EB8A 3B4OA 2MC8A 1RGLA 3OWSA 3GWRA 1K734 3UJMA 3CCL3 3GZXB 3NBBA 2WOHA 5HGRA 1L5GB 3T0UA 3X41A 1E3RA 4H3UA 1SJWA 1IQYA 2CWTA 1UGIA 2KXGA 4KT3B 1A67A 5D83A 1KWIA 3I563 3FGYA 4WP5A 1QAFA 1FUWA 1CEWI 5CXOA 2UUGC 1QMAA 1WMNA 4RNZA 2B24B 2AAEA 3QRDA 5KP3A 3SX1A 1N9EA 1OGZA 1T5YA 3U1WA 4XBTA 2AADA 2KCDA 3SOAA 2INXA 1W2ZA 1ZGXA 4WYKB 1QVF2 2BO9B 1O7HB 2HMJB 1AVLA 2CFDA 1QALA 2KF6A 4WHAA 2IA7A 1T2HA 3AHWA 3U97A 3WDGB 3CC73 1DMMA 2O3OA 4JF8A 3SOYA 1QJGA 1GMQA 3WA2X 2LQVA 3G713 3CC23 1IQXA 2E2TA 3HZPA 3FF2A 1RSNA 4KFFA 5A0OB 1T3BA 1RGEA 4CDLA 3S27A 3EC9A 1J2BA 3X3YA 3WODG 3DUKA 1BRSA 1IDPA 3RNTA 1MNLA 1EEJA 4J8TA 1B2XA 2GEYA 2UX0A 1YGEA 1MGWA 3CCS3 3FG1A 3LZAA 4BL3A 1D6YA 3ER7A 3ALAA 1NJI4 4PEJA 1G96A 2B1XB 1B2MA 1UCKA 3V92A 1VQ43 1DVCA 4RNTA 3M8CA 2P05A 1LQGC 3F7XA 3FF0A 5KP1A 1GS3A 5AEWB 1YJW3 4AKYA 3LT8A 1RGKA 1BSBA 1BU4A 2F4YA 3KKGA 3S5CA 1LOXA 8RNTA 1ISKA 2I9WA 3B8LA 2D42A 4O02B 1AQZA 6STDA 1Q7Y4 3DGOA 1X1UA 1UW1A 3N8BA 1BSEA 1N8QA 1B20A 2R41A 1IT7A 1HU9A 3KZTA 4L8PA 5TGNA 1NB5I 1EQKA 5G2GA 2BT3A 1RRLA 4GSPA 3WA3A 3H3HA 5BXQA 2CWVA 5IG5A 3CCE3 2KRTA 5IEPA 5EEOA 3J7Yd 2W9QA 6GSPA 2JDIH 2YX9A 4FCZA 3X3ZA 1B3SA 4N6MA 3DZLA 3VSYA 3VF1A 3CCJ3 1I0XA 1FGOA 1BRHA 3DGLA 2OTL3 3CCU3 3FG3A 2YFIB 2QA43 1U8CB 4XDVA 1OGXA 2H0IA 1WNHA 3CCM3 5JBSA 3WR2A 3PYJA 4AEQA 4FCMA 4LSOA 4STDA 1RNBA 1BNFA 1VQ53 4G1MB 5AIHA 3RGAA 3EBTA 3K9MC 4R1KA 3X42A 1BNEA 1Q7HA 4NREA 5AI1A 2Z76A 2FXTA 1RRHA 5ELUA 3BNEA 4OVMA 4IT7A 3NBRA 4HKVB 2KF3A 1Q814 2QEX3 1JKGB 3NV0B 4FMCA 4HM4B 1JBRA 1EG9B 1ROVA 1Q824 4MMZB 4OK0A 3X40A 5IW9A 1N9JA 1HKXA 2PNCA 3HX8A 5KP4A 3CMA3 2HOHA 3S28A 1SQWA 1WQLB 4N6NB 5BIRA 5AYRB 1KSIA 3IPTA 5I97A 1NWWA 4HM0B 5ELJA 4CJNA 1UDII 4HBRA 4IPBA 1IV7A 2K0MA 1LOWA 3HI7A 1OUNA 2F56A 2OOVC 2XSOB 3T8UA 2W6JH 3AGOA 3NX0A 1RJOA 4FMBA 1GD3A 1I2FA 2KF4A 1GD4A 3LYGA 3CNMA 3G0KA 1TFOA 5LC7A 2CC3A 2V1LA 1FGRA 1US1A 3Q1CA 3UNLA 5M1AA 1LVNA 3UL5A 5GSPA 1JJ22 4HZBB 2WGOA 2HMNB 2CH9A 1CQSA 2HMMB 3JUNA 2GSPA 3LOYA 4U13A 1N8R4 1VQ63 1RGHA 5JPPA 1JV2B 2WO0A 1LNIA 1K8A4 1DVDA 2CFLA 1IVUA 2CG0A 5STDA 1JZOA 4IIAA 3SXXA 1IVXA 1BVIA 1B2ZA 5IG3A 4FMAA 5CLKA 1IYYA 1FGQA 3CNXA 1VQN3 1BGSA 3OWUA 3L0RA 3Q90A 2OQEC 2W2CA 3A5EA 1VQ83 3BU4A 4EBGA 1OHSA 1DYUA 4HVNA 3DMCA 1RGGA 3EN1B 5BU4A 1PU4A 2CX1A 1IQ8A 1LOVA 1I2GA 3NXJA 3I0YA 2M7OA 3LTBA 3JVCA 1FUSA 3DY5A 1I2EA 2ML6A 5M19A 3FZWA 1BRGA 3K5TA 1T2IA 2XF3A 4R9KA 1UI7A 1HZ1A 1OCVA 1BRJA 2SBLA 2W56A 2WGQA 1DMQA 3WOFB 1NDOB 4LEHA 1RCLA 2HMLB 2W0QA 2CKFB 4HM2B 1FGMA 2RSXA 3KCHA 4XM4A 1TRPA 5D82A 1Q864 1C54A 1S5AA 3F14A 1OF5A 2GBWB 1X1XA 2XFTA 2ZL8A 2UGIA 4GL6A 8CHOA 3OX9A 1BNIA 1YIT3 3EJVA 1W6YA 1MOLA 2F98A 1G0TA 2HMKB 4L7KA 1Q9EA 1M9GA 3GZBA 2C4BA 3GRDA 3CPW2 3MPHA 4AKZA 1C7HA 2OQEA 3KE7A 4I5QA 1MWSA 1YIJ3 3OXAA 4NHFA 2XEPA 1BAOA 3K7CA 3SVAA 3K63A 1YJ93 3MG1A 1GOYA 4BTXA 2CIUA 1W6GA 3PCRA 2WOFA 3NM2A 2GU3A 3DGMA 5AIFA 2QIYA 3F7SA 2BNGA 1QVG2 2F5MA 1ROAA 2YFLB 3RGRA 1VQ93 4I4KA 2ZDJA 3BNDA 3MYTA 2QGUA 3CCQ3 4MEIA 3CU3A 2KAAA 1JKGA 3NV0A 1O7WB 3F40A 3EQQB 4K90B 4CPKA 1M1K4 1FZUA 4XBXA 5IF6A 4RBNA 1ULIB 1BNJA 4HYZA 5EQLA 1IT8A 1W4NA 2H0GA 3MG3A 1VQ73 5HOHA 4BTWA 3OW22 3B4PA 3CCV3 1BOXA 4L8OA 3AMOA 1JB2A 5IG0A 3IJEB 2CFKA 5D81A 2OOVA 3TDGA 3D9RA 3FSDA 1U5OA 1FA3A 1W6CA 7GSPA 1AVKA 4R4KA 1RGFA 1IVWA 4XBYA 1NB3I 1Z1SA 3LH4A 1UCJA 3KSPA 1M904 3EF8A 2L1SA 4ORLA 1VZZA 3NM7A 2P0XA 1RKYA 3PGBA 1RGAA 3FKAA 1HYFA 2H0HA 4HM7B 1STDA 1UCLA 2KF5A 1FW7A 2STDA 4BU4A 3HIIA 3I553 2Y73A 1MWRA 4BIRA 2BIRA 4O8SA 1FYSA 1EA2A 4K1VA 3WHOA 4WFOA 1I3IA 2MF7A 3MWZA 1ZX2A 1NU3A 4J9AA 3JUOA 3MHEA 1TU5A 1G02A 3HK4A 3AGNA 3GAXA 4BL2A 1D6UA 1SARA 1A2PA 1W2B2 3D4AA 3ZG5A 1IV9A 1OHPA 1O7NB 1TFKA 3BNCA 2IMJA 3BIRA 2E2UA 1BUQA 3NQZA 1IK3A 4NPBA 2HMOB 1UUWB 2RNTA 1GSPA 1VQK3 1VQQA 4XDWA 4HJLB 3H51A 1I3FA 3N54B 3PS8A 1BRNL 4KVHA 3CD63 1RTUA 2RGQA 2YFJB 4HZ9B 3ROBA 1W01A 1WMOA 3G6E3 3DGYA 5JPUA 1N5HA 3UL6A 1AY7A 1LQMB 3MKIA 5AIIA 3S29A 2XSHB 1FGTA 1ASKA 5RNTA 4X2HA 3ECFA 1TP6A 1NO3A 3CPOA 4FCJA 2ML5A 2XFSA 4N6UA 1JB5A 1YVBI 4R9LA 5G1KA 1UUGB 1PYLA 1EKMA 1MWUA 3SYUA 2OCTA 4RZMA 1K9M4 1AV4A 2LYXA 1BNRA 4O2HA 1YGWA 2BHMA 1JN5B 1BSAA 2R4IA 4HM8B 2GEXA 1UI8A 1UGHI 1RDSA 1RNTA 1GYBA 2CHCA 4JRFA 3VGNA 3STDA 2Z77A 1CH0A 3N9HA 2BU4A 3RDEA 1FUTA 3LT9A 2XGLA 1JB4A 4KZ1A 1M1XB 3KFQC 2RFRA 5IG4A 3NHXA 1TIJA 2D1WA 3NQYA 5G1LA 2Y74A 1A90A 1KC84 3OV4A 1VQP3 5DRVA 1NNVA 1OH0A 1MWTA 5DREA 4CCVA 3D3LA 4BTYA 2C11A 3V98A 1KQS2 1W02A 3JUPA 3KN4A 4Q53A 4EW5A 2F5WA 7STDA 2P38A 3GSPA 2GXFA 2CK3H 3KSED 3V99A 3Q3FA 3O8YA 1RGCA 1UCIA 2O9UX 6RNTA 5FGOA 3NUVA 4FR9A 4EV2A 1TUHA 1OF5B 3FCSB 1LRAA 1CYVA 4WWUC 1BUJA 3FG4A 4HOHA 4LYLB 4N3VA 1W5ZA 1V58A 3JUQA 2RBIA 1YNVX 1I70A 2IUJA 1O7MB 1SIIA 2ZA4A 3LMLA 4GB5A 1V57A 1RMSA 1N5PA 1ZO2A 4O3VA 3BNBA 3K0ZA 3EBYA 5M18A 4KFDA 2OTJ3 4XB5A 1R4CA 3F9SA 2P09A 1BRKA 4HM3B 3SEDA 1GOVA 4HM1B 1TJDA 1X1YA 4EXRA 5BVBA 1GY6A 4QWTA 1DMNA 1ULJB 2JQ5A 3B7CA 3ZFZA 3FH1A 1JBSA 2W03A 2SARA 3DXOA 1GMRA 2XRXB 4HM5B 1EUIC 2OWPA 3MG2A 2CG1A 2ZHXB 3E99A 3GZYB 4MMYB 3FLJA 3BB9A 3KIIA 5IERA 1Q40A 5FW5A 1BNGA 4MJDA 1UUVB 3PZWA 4FMDA 3HIGA 1S723 4N6OB 1R4YA 4HAAA 4J5GA 1VQM3 2CFWA 1GY7A 1DETA 5CF1A 1B27A 4HM6B 1QAKA 4N6TA 1DE3A 1YHQ3 3CME3 3LTAA 1JZDA 4N6LA 1SIHA 2CFGA 3F8XA 4TX4A 1GMPA 3X3XA 1I8VA 3AHSA 3EX9A 4MMXB 3JUMA 1BSDA 1LOYA 3QK9A 5CK6A 3ZG0A 3D5GA 2CWUA 2P0MA 3URPA 3LXUX 1OACA 1VQL3 1WTHA 1OHOA 1K28A 2Z6BA 1I0VA 2FNQA 2RCDA 3G16A 1MGRA 1Q42A 1TRQA 3DM8A 5EVHA 5CF2A 3S67A 3G8ZA 4ILFA 1A2VA 1LXEA 4R80A 5LC6A 4EV5A 1TTOA 1E3VA 4ZM8A 4J5KA 1O7GB 1BRIA 2XR8B 3CXC2 1Q40B 4EYCA 2GU1A 2IY2A 1O7PB 2J8XB
chains in the Genus database with same CATH topology
1BRGA 1RDSA 1T2IA 1YVSA 1HZ1A 1RNTA 1BRJA 1B2MA 1RCLA 1B2UA 1UCKA 1CH0A 4RNTA 2BU4A 1FUTA 3DH2A 1GOUA 3KCHA 1RGKA 1TRPA 1BSBA 1BU4A 2F4YA 1RHLA 8RNTA 1X1XA 1PY3A 1BSCA 1BNIA 1AQZA 1BIRA 1X1UA 1B2SA 1BSEA 1B20A 1Q9EA 2C4BA 2F5WA 4GSPA 3GSPA 3Q3FA 1BAOA 1RGCA 1RLSA 1UCIA 6RNTA 1X1WA 1GOYA 6GSPA 7RNTA 1B3SA 1LRAA 1BANA 1BUJA 1I0XA 1BRHA 4HOHA 2F5MA 4GHOA 1B21A 1RN4A 1RN1A 1RCKA 2RBIA 1YNVX 2KAAA 1I70A 3WR2A 1RNBA 1BNFA 1FZUA 2ZA4A 1JBTA 1BNJA 1RMSA 1BNEA 5HOHA 1BOXA 1BNSA 2KF3A 9RNTA 1BRKA 1JBRA 1GOVA 1X1YA 3D5IA 7GSPA 2HOHA 3HOHA 1RGFA 1JBSA 1UCJA 5BIRA 2SARA 1GMRA 1RGLA 1RGAA 1HYFA 1UCLA 2KF5A 1FW7A 4BU4A 1LOWA 2F56A 3AGOA 1BNGA 4BIRA 2BIRA 1FYSA 1I2FA 2KF4A 3WHOA 1I3IA 1R4YA 4HAAA 4J5GA 2AAEA 1DETA 1G02A 3AGNA 1DE3A 1B27A 1SARA 1A2PA 5GSPA 3D4AA 2AADA 3BIRA 1ZGXA 1C54A 1GMPA 1I8VA 2RNTA 1GSPA 2GSPA 3AHSA 2KF6A 1BSDA 1LOYA 1RGHA 1T2HA 3AHWA 3D5GA 3URPA 1I3FA 1LNIA 1BRNL 1RTUA 1GMQA 3DGYA 1I0VA 1BVIA 1B2ZA 1AY7A 1MGRA 1TRQA 1IYYA 1RSNA 1RGEA 1BGSA 5RNTA 3A5EA 3BU4A 1BRSA 1PYLA 3RNTA 1RGGA 5BU4A 1TTOA 3SYUA 1LOVA 4J5KA 1I2GA 1BRIA 1BNRA 1B2XA 1FUSA 1MGWA 1YGWA 1BSAA 1I2EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BRG A;  1RDS A;  1T2I A;  1YVS A;  1HZ1 A;  1RNT A;  1BRJ A;  1B2M A;  1RCL A;  1B2U A;  1UCK A;  1CH0 A;  4RNT A;  2BU4 A;  1FUT A;  3DH2 A;  1GOU A;  3KCH A;  1RGK A;  1TRP A;  1BSB A;  1BU4 A;  2F4Y A;  1RHL A;  8RNT A;  1X1X A;  1PY3 A;  1BSC A;  1BNI A;  1AQZ A;  1BIR A;  1X1U A;  1B2S A;  1BSE A;  1B20 A;  1Q9E A;  2C4B A;  2F5W A;  4GSP A;  3GSP A;  3Q3F A;  1BAO A;  1RGC A;  1RLS A;  1UCI A;  6RNT A;  1X1W A;  1GOY A;  6GSP A;  7RNT A;  1B3S A;  1LRA A;  1BAN A;  1BUJ A;  1I0X A;  1BRH A;  4HOH A;  2F5M A;  4GHO A;  1B21 A;  1RN4 A;  1RN1 A;  1RCK A;  2RBI A;  1YNV X;  2KAA A;  1I70 A;  3WR2 A;  1RNB A;  1BNF A;  1FZU A;  2ZA4 A;  1JBT A;  1BNJ A;  1RMS A;  1BNE A;  5HOH A;  1BOX A;  1BNS A;  2KF3 A;  9RNT A;  1BRK A;  1JBR A;  1GOV A;  1X1Y A;  3D5I A;  7GSP A;  2HOH A;  3HOH A;  1RGF A;  1JBS A;  1UCJ A;  5BIR A;  2SAR A;  1GMR A;  1RGL A;  1RGA A;  1HYF A;  1UCL A;  2KF5 A;  1FW7 A;  4BU4 A;  1LOW A;  2F56 A;  3AGO A;  1BNG A;  4BIR A;  2BIR A;  1FYS A;  1I2F A;  2KF4 A;  3WHO A;  1I3I A;  1R4Y A;  4HAA A;  4J5G A;  2AAE A;  1DET A;  1G02 A;  3AGN A;  1DE3 A;  1B27 A;  1SAR A;  1A2P A;  5GSP A;  3D4A A;  2AAD A;  3BIR A;  1ZGX A;  1C54 A;  1GMP A;  1I8V A;  2RNT A;  1GSP A;  2GSP A;  3AHS A;  2KF6 A;  1BSD A;  1LOY A;  1RGH A;  1T2H A;  3AHW A;  3D5G A;  3URP A;  1I3F A;  1LNI A;  1BRN L;  1RTU A;  1GMQ A;  3DGY A;  1I0V A;  1BVI A;  1B2Z A;  1AY7 A;  1MGR A;  1TRQ A;  1IYY A;  1RSN A;  1RGE A;  1BGS A;  5RNT A;  3A5E A;  3BU4 A;  1BRS A;  1PYL A;  3RNT A;  1RGG A;  5BU4 A;  1TTO A;  3SYU A;  1LOV A;  4J5K A;  1I2G A;  1BRI A;  1BNR A;  1B2X A;  1FUS A;  1MGW A;  1YGW A;  1BSA A;  1I2E A; 
#chains in the Genus database with same CATH topology
 1W00 A;  2XGN A;  1YVS A;  4X2O A;  5AIG A;  3AMO B;  1YI2 3;  1F8N A;  1WMP A;  1B2U A;  5IEO A;  1STF I;  5AEU B;  3EE1 A;  3EHC A;  3OWY A;  3DH2 A;  1YJN 3;  3A76 A;  1GOU A;  3IMA B;  3G4S 3;  1RHL A;  1RN7 A;  2PZV A;  1CYU A;  1ZS7 A;  3SLU A;  4DKI A;  1PY3 A;  2F99 A;  1BSC A;  1PFP A;  5IEN A;  1BIR A;  3EN8 A;  3D79 A;  3WOE B;  1B2S A;  2BMQ B;  1K41 A;  1KD1 4;  3MSO A;  2XH9 A;  3LTD A;  2C10 A;  3DGN A;  1IU7 A;  4KFE A;  1VQO 3;  1IVV A;  1RLS A;  4K1U A;  3CCR 3;  4LGQ A;  1X1W A;  3NBJ A;  2K3D A;  4K61 A;  3PXM A;  1GY5 A;  1Y4K A;  3WMD A;  7RNT A;  3BLZ A;  1BAN A;  2F86 B;  4LMI A;  1W7C A;  1JNQ A;  4GHO A;  1B21 A;  1RN4 A;  1RN1 A;  1RCK A;  2BMO B;  2L4V A;  2W9P A;  5AYS C;  2FGT A;  3CC4 3;  4N6V 0;  3Q2P A;  2IUK A;  1JBT A;  1OPY A;  1JRQ A;  2GBX B;  2K54 A;  2BMR B;  2Q07 A;  1E97 A;  4LZI A;  4WYK A;  4OUQ A;  3GZR A;  1BNS A;  4EC6 A;  9RNT A;  2W56 B;  1A2K A;  3F8H A;  1D6Z A;  2Z7A A;  2A15 A;  1SPU A;  1V74 A;  2IYJ A;  3D5I A;  3PCS A;  4RNY A;  2W04 A;  1JN5 A;  3HOH A;  2CW9 A;  1AR0 A;  3LTC A;  2CX0 A;  3UB1 A;  4H61 A;  3T8N A;  2E2V A;  1LNH A;  3EB8 A;  3B4O A;  2MC8 A;  1RGL A;  3OWS A;  3GWR A;  1K73 4;  3UJM A;  3CCL 3;  3GZX B;  3NBB A;  2WOH A;  5HGR A;  1L5G B;  3T0U A;  3X41 A;  1E3R A;  4H3U A;  1SJW A;  1IQY A;  2CWT A;  1UGI A;  2KXG A;  4KT3 B;  1A67 A;  5D83 A;  1KWI A;  3I56 3;  3FGY A;  4WP5 A;  1QAF A;  1FUW A;  1CEW I;  5CXO A;  2UUG C;  1QMA A;  1WMN A;  4RNZ A;  2B24 B;  2AAE A;  3QRD A;  5KP3 A;  3SX1 A;  1N9E A;  1OGZ A;  1T5Y A;  3U1W A;  4XBT A;  2AAD A;  2KCD A;  3SOA A;  2INX A;  1W2Z A;  1ZGX A;  4WYK B;  1QVF 2;  2BO9 B;  1O7H B;  2HMJ B;  1AVL A;  2CFD A;  1QAL A;  2KF6 A;  4WHA A;  2IA7 A;  1T2H A;  3AHW A;  3U97 A;  3WDG B;  3CC7 3;  1DMM A;  2O3O A;  4JF8 A;  3SOY A;  1QJG A;  1GMQ A;  3WA2 X;  2LQV A;  3G71 3;  3CC2 3;  1IQX A;  2E2T A;  3HZP A;  3FF2 A;  1RSN A;  4KFF A;  5A0O B;  1T3B A;  1RGE A;  4CDL A;  3S27 A;  3EC9 A;  1J2B A;  3X3Y A;  3WOD G;  3DUK A;  1BRS A;  1IDP A;  3RNT A;  1MNL A;  1EEJ A;  4J8T A;  1B2X A;  2GEY A;  2UX0 A;  1YGE A;  1MGW A;  3CCS 3;  3FG1 A;  3LZA A;  4BL3 A;  1D6Y A;  3ER7 A;  3ALA A;  1NJI 4;  4PEJ A;  1G96 A;  2B1X B;  1B2M A;  1UCK A;  3V92 A;  1VQ4 3;  1DVC A;  4RNT A;  3M8C A;  2P05 A;  1LQG C;  3F7X A;  3FF0 A;  5KP1 A;  1GS3 A;  5AEW B;  1YJW 3;  4AKY A;  3LT8 A;  1RGK A;  1BSB A;  1BU4 A;  2F4Y A;  3KKG A;  3S5C A;  1LOX A;  8RNT A;  1ISK A;  2I9W A;  3B8L A;  2D42 A;  4O02 B;  1AQZ A;  6STD A;  1Q7Y 4;  3DGO A;  1X1U A;  1UW1 A;  3N8B A;  1BSE A;  1N8Q A;  1B20 A;  2R41 A;  1IT7 A;  1HU9 A;  3KZT A;  4L8P A;  5TGN A;  1NB5 I;  1EQK A;  5G2G A;  2BT3 A;  1RRL A;  4GSP A;  3WA3 A;  3H3H A;  5BXQ A;  2CWV A;  5IG5 A;  3CCE 3;  2KRT A;  5IEP A;  5EEO A;  3J7Y d;  2W9Q A;  6GSP A;  2JDI H;  2YX9 A;  4FCZ A;  3X3Z A;  1B3S A;  4N6M A;  3DZL A;  3VSY A;  3VF1 A;  3CCJ 3;  1I0X A;  1FGO A;  1BRH A;  3DGL A;  2OTL 3;  3CCU 3;  3FG3 A;  2YFI B;  2QA4 3;  1U8C B;  4XDV A;  1OGX A;  2H0I A;  1WNH A;  3CCM 3;  5JBS A;  3WR2 A;  3PYJ A;  4AEQ A;  4FCM A;  4LSO A;  4STD A;  1RNB A;  1BNF A;  1VQ5 3;  4G1M B;  5AIH A;  3RGA A;  3EBT A;  3K9M C;  4R1K A;  3X42 A;  1BNE A;  1Q7H A;  4NRE A;  5AI1 A;  2Z76 A;  2FXT A;  1RRH A;  5ELU A;  3BNE A;  4OVM A;  4IT7 A;  3NBR A;  4HKV B;  2KF3 A;  1Q81 4;  2QEX 3;  1JKG B;  3NV0 B;  4FMC A;  4HM4 B;  1JBR A;  1EG9 B;  1ROV A;  1Q82 4;  4MMZ B;  4OK0 A;  3X40 A;  5IW9 A;  1N9J A;  1HKX A;  2PNC A;  3HX8 A;  5KP4 A;  3CMA 3;  2HOH A;  3S28 A;  1SQW A;  1WQL B;  4N6N B;  5BIR A;  5AYR B;  1KSI A;  3IPT A;  5I97 A;  1NWW A;  4HM0 B;  5ELJ A;  4CJN A;  1UDI I;  4HBR A;  4IPB A;  1IV7 A;  2K0M A;  1LOW A;  3HI7 A;  1OUN A;  2F56 A;  2OOV C;  2XSO B;  3T8U A;  2W6J H;  3AGO A;  3NX0 A;  1RJO A;  4FMB A;  1GD3 A;  1I2F A;  2KF4 A;  1GD4 A;  3LYG A;  3CNM A;  3G0K A;  1TFO A;  5LC7 A;  2CC3 A;  2V1L A;  1FGR A;  1US1 A;  3Q1C A;  3UNL A;  5M1A A;  1LVN A;  3UL5 A;  5GSP A;  1JJ2 2;  4HZB B;  2WGO A;  2HMN B;  2CH9 A;  1CQS A;  2HMM B;  3JUN A;  2GSP A;  3LOY A;  4U13 A;  1N8R 4;  1VQ6 3;  1RGH A;  5JPP A;  1JV2 B;  2WO0 A;  1LNI A;  1K8A 4;  1DVD A;  2CFL A;  1IVU A;  2CG0 A;  5STD A;  1JZO A;  4IIA A;  3SXX A;  1IVX A;  1BVI A;  1B2Z A;  5IG3 A;  4FMA A;  5CLK A;  1IYY A;  1FGQ A;  3CNX A;  1VQN 3;  1BGS A;  3OWU A;  3L0R A;  3Q90 A;  2OQE C;  2W2C A;  3A5E A;  1VQ8 3;  3BU4 A;  4EBG A;  1OHS A;  1DYU A;  4HVN A;  3DMC A;  1RGG A;  3EN1 B;  5BU4 A;  1PU4 A;  2CX1 A;  1IQ8 A;  1LOV A;  1I2G A;  3NXJ A;  3I0Y A;  2M7O A;  3LTB A;  3JVC A;  1FUS A;  3DY5 A;  1I2E A;  2ML6 A;  5M19 A;  3FZW A;  1BRG A;  3K5T A;  1T2I A;  2XF3 A;  4R9K A;  1UI7 A;  1HZ1 A;  1OCV A;  1BRJ A;  2SBL A;  2W56 A;  2WGQ A;  1DMQ A;  3WOF B;  1NDO B;  4LEH A;  1RCL A;  2HML B;  2W0Q A;  2CKF B;  4HM2 B;  1FGM A;  2RSX A;  3KCH A;  4XM4 A;  1TRP A;  5D82 A;  1Q86 4;  1C54 A;  1S5A A;  3F14 A;  1OF5 A;  2GBW B;  1X1X A;  2XFT A;  2ZL8 A;  2UGI A;  4GL6 A;  8CHO A;  3OX9 A;  1BNI A;  1YIT 3;  3EJV A;  1W6Y A;  1MOL A;  2F98 A;  1G0T A;  2HMK B;  4L7K A;  1Q9E A;  1M9G A;  3GZB A;  2C4B A;  3GRD A;  3CPW 2;  3MPH A;  4AKZ A;  1C7H A;  2OQE A;  3KE7 A;  4I5Q A;  1MWS A;  1YIJ 3;  3OXA A;  4NHF A;  2XEP A;  1BAO A;  3K7C A;  3SVA A;  3K63 A;  1YJ9 3;  3MG1 A;  1GOY A;  4BTX A;  2CIU A;  1W6G A;  3PCR A;  2WOF A;  3NM2 A;  2GU3 A;  3DGM A;  5AIF A;  2QIY A;  3F7S A;  2BNG A;  1QVG 2;  2F5M A;  1ROA A;  2YFL B;  3RGR A;  1VQ9 3;  4I4K A;  2ZDJ A;  3BND A;  3MYT A;  2QGU A;  3CCQ 3;  4MEI A;  3CU3 A;  2KAA A;  1JKG A;  3NV0 A;  1O7W B;  3F40 A;  3EQQ B;  4K90 B;  4CPK A;  1M1K 4;  1FZU A;  4XBX A;  5IF6 A;  4RBN A;  1ULI B;  1BNJ A;  4HYZ A;  5EQL A;  1IT8 A;  1W4N A;  2H0G A;  3MG3 A;  1VQ7 3;  5HOH A;  4BTW A;  3OW2 2;  3B4P A;  3CCV 3;  1BOX A;  4L8O A;  3AMO A;  1JB2 A;  5IG0 A;  3IJE B;  2CFK A;  5D81 A;  2OOV A;  3TDG A;  3D9R A;  3FSD A;  1U5O A;  1FA3 A;  1W6C A;  7GSP A;  1AVK A;  4R4K A;  1RGF A;  1IVW A;  4XBY A;  1NB3 I;  1Z1S A;  3LH4 A;  1UCJ A;  3KSP A;  1M90 4;  3EF8 A;  2L1S A;  4ORL A;  1VZZ A;  3NM7 A;  2P0X A;  1RKY A;  3PGB A;  1RGA A;  3FKA A;  1HYF A;  2H0H A;  4HM7 B;  1STD A;  1UCL A;  2KF5 A;  1FW7 A;  2STD A;  4BU4 A;  3HII A;  3I55 3;  2Y73 A;  1MWR A;  4BIR A;  2BIR A;  4O8S A;  1FYS A;  1EA2 A;  4K1V A;  3WHO A;  4WFO A;  1I3I A;  2MF7 A;  3MWZ A;  1ZX2 A;  1NU3 A;  4J9A A;  3JUO A;  3MHE A;  1TU5 A;  1G02 A;  3HK4 A;  3AGN A;  3GAX A;  4BL2 A;  1D6U A;  1SAR A;  1A2P A;  1W2B 2;  3D4A A;  3ZG5 A;  1IV9 A;  1OHP A;  1O7N B;  1TFK A;  3BNC A;  2IMJ A;  3BIR A;  2E2U A;  1BUQ A;  3NQZ A;  1IK3 A;  4NPB A;  2HMO B;  1UUW B;  2RNT A;  1GSP A;  1VQK 3;  1VQQ A;  4XDW A;  4HJL B;  3H51 A;  1I3F A;  3N54 B;  3PS8 A;  1BRN L;  4KVH A;  3CD6 3;  1RTU A;  2RGQ A;  2YFJ B;  4HZ9 B;  3ROB A;  1W01 A;  1WMO A;  3G6E 3;  3DGY A;  5JPU A;  1N5H A;  3UL6 A;  1AY7 A;  1LQM B;  3MKI A;  5AII A;  3S29 A;  2XSH B;  1FGT A;  1ASK A;  5RNT A;  4X2H A;  3ECF A;  1TP6 A;  1NO3 A;  3CPO A;  4FCJ A;  2ML5 A;  2XFS A;  4N6U A;  1JB5 A;  1YVB I;  4R9L A;  5G1K A;  1UUG B;  1PYL A;  1EKM A;  1MWU A;  3SYU A;  2OCT A;  4RZM A;  1K9M 4;  1AV4 A;  2LYX A;  1BNR A;  4O2H A;  1YGW A;  2BHM A;  1JN5 B;  1BSA A;  2R4I A;  4HM8 B;  2GEX A;  1UI8 A;  1UGH I;  1RDS A;  1RNT A;  1GYB A;  2CHC A;  4JRF A;  3VGN A;  3STD A;  2Z77 A;  1CH0 A;  3N9H A;  2BU4 A;  3RDE A;  1FUT A;  3LT9 A;  2XGL A;  1JB4 A;  4KZ1 A;  1M1X B;  3KFQ C;  2RFR A;  5IG4 A;  3NHX A;  1TIJ A;  2D1W A;  3NQY A;  5G1L A;  2Y74 A;  1A90 A;  1KC8 4;  3OV4 A;  1VQP 3;  5DRV A;  1NNV A;  1OH0 A;  1MWT A;  5DRE A;  4CCV A;  3D3L A;  4BTY A;  2C11 A;  3V98 A;  1KQS 2;  1W02 A;  3JUP A;  3KN4 A;  4Q53 A;  4EW5 A;  2F5W A;  7STD A;  2P38 A;  3GSP A;  2GXF A;  2CK3 H;  3KSE D;  3V99 A;  3Q3F A;  3O8Y A;  1RGC A;  1UCI A;  2O9U X;  6RNT A;  5FGO A;  3NUV A;  4FR9 A;  4EV2 A;  1TUH A;  1OF5 B;  3FCS B;  1LRA A;  1CYV A;  4WWU C;  1BUJ A;  3FG4 A;  4HOH A;  4LYL B;  4N3V A;  1W5Z A;  1V58 A;  3JUQ A;  2RBI A;  1YNV X;  1I70 A;  2IUJ A;  1O7M B;  1SII A;  2ZA4 A;  3LML A;  4GB5 A;  1V57 A;  1RMS A;  1N5P A;  1ZO2 A;  4O3V A;  3BNB A;  3K0Z A;  3EBY A;  5M18 A;  4KFD A;  2OTJ 3;  4XB5 A;  1R4C A;  3F9S A;  2P09 A;  1BRK A;  4HM3 B;  3SED A;  1GOV A;  4HM1 B;  1TJD A;  1X1Y A;  4EXR A;  5BVB A;  1GY6 A;  4QWT A;  1DMN A;  1ULJ B;  2JQ5 A;  3B7C A;  3ZFZ A;  3FH1 A;  1JBS A;  2W03 A;  2SAR A;  3DXO A;  1GMR A;  2XRX B;  4HM5 B;  1EUI C;  2OWP A;  3MG2 A;  2CG1 A;  2ZHX B;  3E99 A;  3GZY B;  4MMY B;  3FLJ A;  3BB9 A;  3KII A;  5IER A;  1Q40 A;  5FW5 A;  1BNG A;  4MJD A;  1UUV B;  3PZW A;  4FMD A;  3HIG A;  1S72 3;  4N6O B;  1R4Y A;  4HAA A;  4J5G A;  1VQM 3;  2CFW A;  1GY7 A;  1DET A;  5CF1 A;  1B27 A;  4HM6 B;  1QAK A;  4N6T A;  1DE3 A;  1YHQ 3;  3CME 3;  3LTA A;  1JZD A;  4N6L A;  1SIH A;  2CFG A;  3F8X A;  4TX4 A;  1GMP A;  3X3X A;  1I8V A;  3AHS A;  3EX9 A;  4MMX B;  3JUM A;  1BSD A;  1LOY A;  3QK9 A;  5CK6 A;  3ZG0 A;  3D5G A;  2CWU A;  2P0M A;  3URP A;  3LXU X;  1OAC A;  1VQL 3;  1WTH A;  1OHO A;  1K28 A;  2Z6B A;  1I0V A;  2FNQ A;  2RCD A;  3G16 A;  1MGR A;  1Q42 A;  1TRQ A;  3DM8 A;  5EVH A;  5CF2 A;  3S67 A;  3G8Z A;  4ILF A;  1A2V A;  1LXE A;  4R80 A;  5LC6 A;  4EV5 A;  1TTO A;  1E3V A;  4ZM8 A;  4J5K A;  1O7G B;  1BRI A;  2XR8 B;  3CXC 2;  1Q40 B;  4EYC A;  2GU1 A;  2IY2 A;  1O7P B;  2J8X B; 
#chains in the Genus database with same CATH homology
 1BRG A;  1RDS A;  1T2I A;  1YVS A;  1HZ1 A;  1RNT A;  1BRJ A;  1B2M A;  1RCL A;  1B2U A;  1UCK A;  1CH0 A;  4RNT A;  2BU4 A;  1FUT A;  3DH2 A;  1GOU A;  3KCH A;  1RGK A;  1TRP A;  1BSB A;  1BU4 A;  2F4Y A;  1RHL A;  8RNT A;  1X1X A;  1PY3 A;  1BSC A;  1BNI A;  1AQZ A;  1BIR A;  1X1U A;  1B2S A;  1BSE A;  1B20 A;  1Q9E A;  2C4B A;  2F5W A;  4GSP A;  3GSP A;  3Q3F A;  1BAO A;  1RGC A;  1RLS A;  1UCI A;  6RNT A;  1X1W A;  1GOY A;  6GSP A;  7RNT A;  1B3S A;  1LRA A;  1BAN A;  1BUJ A;  1I0X A;  1BRH A;  4HOH A;  2F5M A;  4GHO A;  1B21 A;  1RN4 A;  1RN1 A;  1RCK A;  2RBI A;  1YNV X;  2KAA A;  1I70 A;  3WR2 A;  1RNB A;  1BNF A;  1FZU A;  2ZA4 A;  1JBT A;  1BNJ A;  1RMS A;  1BNE A;  5HOH A;  1BOX A;  1BNS A;  2KF3 A;  9RNT A;  1BRK A;  1JBR A;  1GOV A;  1X1Y A;  3D5I A;  7GSP A;  2HOH A;  3HOH A;  1RGF A;  1JBS A;  1UCJ A;  5BIR A;  2SAR A;  1GMR A;  1RGL A;  1RGA A;  1HYF A;  1UCL A;  2KF5 A;  1FW7 A;  4BU4 A;  1LOW A;  2F56 A;  3AGO A;  1BNG A;  4BIR A;  2BIR A;  1FYS A;  1I2F A;  2KF4 A;  3WHO A;  1I3I A;  1R4Y A;  4HAA A;  4J5G A;  2AAE A;  1DET A;  1G02 A;  3AGN A;  1DE3 A;  1B27 A;  1SAR A;  1A2P A;  5GSP A;  3D4A A;  2AAD A;  3BIR A;  1ZGX A;  1C54 A;  1GMP A;  1I8V A;  2RNT A;  1GSP A;  2GSP A;  3AHS A;  2KF6 A;  1BSD A;  1LOY A;  1RGH A;  1T2H A;  3AHW A;  3D5G A;  3URP A;  1I3F A;  1LNI A;  1BRN L;  1RTU A;  1GMQ A;  3DGY A;  1I0V A;  1BVI A;  1B2Z A;  1AY7 A;  1MGR A;  1TRQ A;  1IYY A;  1RSN A;  1RGE A;  1BGS A;  5RNT A;  3A5E A;  3BU4 A;  1BRS A;  1PYL A;  3RNT A;  1RGG A;  5BU4 A;  1TTO A;  3SYU A;  1LOV A;  4J5K A;  1I2G A;  1BRI A;  1BNR A;  1B2X A;  1FUS A;  1MGW A;  1YGW A;  1BSA A;  1I2E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...