1UCJA

Mutants of rnase sa
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVTFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanyl-specific ribonuclease Sa
publication title The contribution of polar group burial to protein stability is strongly context-dependent
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
total genus 25
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2003-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1ucjA00
1MGWA 1RTUA 1B2SA 3HOHA 2BU4A 1BAOA 1BRIA 1R4YA 1UCIA 1I2FA 1I0XA 3BU4A 7GSPA 1ZGXA 2RBIA 5HOHA 1B2MA 3SYUA 1GMQA 1B2UA 1JBSA 1RSNA 3WHOA 1BNIA 1RNTA 1DE3A 1FYSA 2SARA 1GMPA 1T2HA 2BIRA 1Q9EA 1TTOA 1BANA 1BNJA 3RNTA 1RCKA 1X1UA 1FW7A 1LOVA 5RNTA 4HAAA 1GOYA 1PYLA 1BSDA 1YNVX 1GOVA 2F5MA 1FUSA 5BU4A 1BRNL 3D5GA 3BIRA 2F56A 1SARA 1I3IA 1RLSA 1UCLA 1BNSA 1BU4A 5GSPA 1YVSA 1B2XA 1HYFA 1BRKA 1RN1A 2AADA 1RCLA 1UCJA 1B20A 7RNTA 2RNTA 1GOUA 1BSEA 1BNGA 1AY7A 2ZA4A 2F5WA 3Q3FA 2F4YA 1A2PA 1BRGA 1RDSA 1B2ZA 1BNRA 1RHLA 1RGAA 1RGKA 1B27A 2KF4A 1RGCA 1I2GA 4GHOA 2AAEA 1BRJA 1BSAA 4RNTA 4BIRA 3D5IA 1I8VA 1JBRA 3AGNA 4J5KA 1LOYA 2KAAA 1X1XA 4HOHA 1BVIA 1X1YA 1JBTA 3A5EA 1RGHA 1GMRA 1I0VA 1RNBA 3KCHA 1BOXA 2KF6A 1BRHA 1B21A 1RGGA 2KF3A 2GSPA 9RNTA 1MGRA 1PY3A 1BUJA 1BIRA 2C4BA 1I2EA 3AHSA 1RGFA 1IYYA 1LOWA 3DH2A 3WR2A 1I3FA 1G02A 1BRSA 3AHWA 1DETA 3D4AA 1BSCA 3AGOA 4J5GA 3GSPA 3DGYA 2HOHA 6GSPA 1BSBA 1BNEA 4GSPA 1RGEA 1UCKA 4BU4A 1RGLA 5BIRA 1CH0A 1BNFA 1T2IA 1BGSA 1TRQA 1LNIA 1X1WA 2KF5A 1C54A 1FUTA 1B3SA 1HZ1A 1RMSA 1TRPA 8RNTA 3URPA 1AQZA 1RN4A 1I70A 1LRAA 1FZUA 6RNTA 1GSPA 1YGWA
chains in the Genus database with same CATH superfamily
1M904 1MGWA 1DMMA 3T8NA 1QAKA 3DGNA 4R9KA 1UUGB 2ZDJA 5JPUA 1VQ83 1N9EA 1W2B2 1VQ93 4HM1B 2XFSA 2OQEA 1IV9A 3WA3A 1UCIA 4HM2B 3M8CA 5IENA 3K9MC 3B4PA 2INXA 3D9RA 2RBIA 2XGNA 1OGZA 3TDGA 3F14A 4O3VA 5G1LA 3SXXA 1VQP3 1DE3A 2SARA 3AMOA 3EJVA 1GMPA 4MJDA 3SX1A 5BVBA 3JVCA 2SBLA 1LVNA 1FGMA 5IF6A 2P0MA 3EQQB 1RCKA 1GS3A 3NV0A 1FGOA 4HAAA 2CG1A 2CFKA 1GOYA 1BSDA 1YNVX 1GOVA 2Q07A 4O02B 1VQ43 1MNLA 2V1LA 3X40A 1OPYA 4EXRA 3BIRA 1VQK3 2F56A 1SARA 1N9JA 3SOYA 3T8UA 5KP1A 1IK3A 1JB4A 3PGBA 1BU4A 1HKXA 3G0KA 4CCVA 3KE7A 2Z77A 1OACA 1GYBA 3EN8A 1YVSA 3F7SA 3G713 3GRDA 1HYFA 1LQGC 1W6CA 1NO3A 3MSOA 2Y74A 3NQYA 1Q864 4L8OA 1GOUA 2ML5A 3CCJ3 4FMCA 1SQWA 5JBSA 4FCMA 2W56B 1B2ZA 1IVVA 3EN1B 4RNZA 1W02A 1NDOB 3EX9A 5IEPA 1RGCA 1I2GA 4GHOA 5AYSC 4RNTA 3STDA 3X3XA 5IW9A 2M7OA 3DGMA 1VQ63 2K3DA 3D5IA 3LTBA 4R80A 2XRXB 4N6NB 1STDA 4MEIA 2KAAA 3IMAB 3A5EA 1LOXA 4HM6B 1TJDA 2ZL8A 1STFI 1O7MB 1RGHA 1RKYA 1GMRA 5IERA 1I0VA 3S67A 1O7WB 4DKIA 4XDWA 3WODG 3SEDA 4I4KA 3BNBA 1RJOA 3WOEB 1GY7A 1LXEA 1JB5A 1RGGA 3F40A 3KIIA 3LMLA 3NBJA 5AIIA 2LQVA 1K41A 2CK3H 1WMPA 3FGYA 1O7PB 1TIJA 3CC73 2C4BA 4OK0A 3AHSA 1IYYA 4FCZA 2QIYA 1LOWA 1UUWB 3WR2A 3UB1A 1TFOA 4FMAA 1IU7A 3AGOA 3NBRA 2K0MA 4R1KA 1YJ93 6GSPA 1BSBA 3EBTA 2P0XA 1U5OA 1UCKA 3ZFZA 3UL5A 4RBNA 2OWPA 3FKAA 1BGSA 1TRQA 1X1WA 3ECFA 3CCE3 1V74A 1A67A 1R4CA 1Q40B 1HZ1A 1JZOA 3FZWA 1RMSA 4KFEA 2MC8A 3ZG0A 3E99A 3CPOA 5CXOA 2W9PA 8RNTA 1AR0A 3EB8A 4KFDA 2E2UA 3CCV3 5TGNA 2CW9A 3EBYA 3LT8A 3PZWA 4R4KA 4CJNA 6RNTA 3DGLA 1RTUA 2STDA 4AKYA 2BU4A 3S5CA 1DVDA 4HVNA 2XR8B 5FGOA 5M19A 1BRIA 2D42A 3V92A 2IMJA 4G1MB 5STDA 3CD63 1PU4A 2UGIA 1ZGXA 1B2MA 3SYUA 4J9AA 1YJW3 1KWIA 1S5AA 2IYJA 3B7CA 1RRHA 2E2VA 4XBYA 1JN5A 4XBTA 1K734 3CCL3 3H51A 3NM2A 2CFGA 1TP6A 2PNCA 2OTJ3 1CYUA 2H0IA 1T2HA 2BIRA 2YFLB 1US1A 1UGIA 1N5HA 2F98A 1X1UA 1UGHI 3PYJA 1M1XB 3B4OA 4NREA 2RGQA 3JUOA 1PYLA 2L1SA 1WTHA 3KN4A 5EQLA 1BRNL 3D5GA 5D81A 2W03A 3DMCA 1RLSA 1Y4KA 2ZHXB 3CPW2 3O8YA 3G6E3 3UNLA 4EV2A 2CC3A 1QVG2 1B2XA 1W5ZA 1Z1SA 5IG4A 1BRKA 1RN1A 2ML6A 5LC6A 1G0TA 3FF0A 1OHSA 4K90B 2B1XB 5DREA 1O7NB 5DRVA 1KQS2 2W0QA 2L4VA 1JV2B 3HZPA 1A2PA 1BRGA 1RDSA 2XFTA 2YFIB 1EEJA 4H3UA 3HIGA 1SIIA 3KSPA 2CX0A 1EG9B 1Q42A 1Q40A 1RGKA 3NBBA 4MMZB 3S29A 3I563 3CCM3 2KF4A 2CHCA 1N8QA 2H0GA 4WHAA 2E2TA 1V57A 5I97A 1VQO3 2AAEA 3UL6A 3G8ZA 5EVHA 1UDII 2O9UX 2KRTA 3I0YA 4STDA 1F8NA 1C7HA 2OTL3 1LOYA 1VQQA 1DMNA 1BVIA 1AVLA 4BTWA 4LEHA 3DZLA 4N6UA 1FGRA 1M9GA 3BB9A 3PCRA 1NJI4 3MWZA 3JUNA 4K1UA 1JNQA 4BTXA 1RNBA 2WGQA 4KT3B 4EBGA 1KD14 1EQKA 4NPBA 1UW1A 1ISKA 2W9QA 1BRHA 5M18A 5ELJA 3GAXA 4WFOA 3JUQA 4XBXA 2BMOB 2WOHA 1PY3A 1YIT3 1BIRA 2Z7AA 3SVAA 2F86B 5ELUA 2CWUA 3VGNA 4CDLA 1KC84 3D4AA 1DETA 1BSCA 4J5GA 2FXTA 1ZO2A 1A2VA 1KSIA 3S28A 4KFFA 1EUIC 4MMXB 3V99A 1OCVA 3LYGA 4N6TA 3NQZA 1OGXA 4GSPA 4BU4A 1RGLA 1UI7A 2QGUA 4IIAA 5KP4A 1VQ53 1BNFA 1E3VA 1T2IA 3CC23 1C54A 4XM4A 3NHXA 2BNGA 2D1WA 4BL2A 3DUKA 5AIFA 3KFQC 4FMDA 2JDIH 2BHMA 2BT3A 3QK9A 4ILFA 2RCDA 4KVHA 4U13A 3RDEA 3MPHA 1LRAA 3CMA3 1SIHA 1YGWA 2F99A 2B24B 3EC9A 3OX9A 1JRQA 2IUJA 3HOHA 3N54B 1B2SA 4WYKB 2Y73A 1N8R4 2H0HA 1MWRA 2XSHB 1BAOA 4RNYA 1VZZA 1NU3A 4O8SA 1AVKA 2R41A 2KCDA 1ROVA 1I0XA 1QJGA 1CEWI 3BU4A 3CNMA 4IPBA 7GSPA 1YJN3 4FR9A 1FUWA 4N6V0 5HGRA 1NNVA 1YGEA 2CWTA 1RSNA 4EYCA 1Q7Y4 3WHOA 1IVWA 3U1WA 1WNHA 3B8LA 5CF1A 1UUVB 1FYSA 1YVBI 2BMQB 1WQLB 2J8XB 3X42A 5M1AA 1Q9EA 3RGAA 2WGOA 4HJLB 3F9SA 2CKFB 4L7KA 1FW7A 2OOVC 1LOVA 1IQYA 5RNTA 2IUKA 3IPTA 1LQMB 2HMKB 4FMBA 5A0OB 2F5MA 3GZBA 4NHFA 4PEJA 1WMNA 3F8XA 3FG3A 1N5PA 1I3IA 2W56A 3F8HA 1GY5A 3K0ZA 3KSED 3WMDA 4GL6A 4ZM8A 2GU3A 2GU1A 1QVF2 4MMYB 3HX8A 5GSPA 3SOAA 2CFWA 4H61A 3CXC2 1ULJB 4J8TA 1NWWA 4K1VA 2AADA 1RCLA 1UCJA 2HMMB 3DXOA 1B20A 1V58A 7RNTA 4GB5A 5JPPA 2HMNB 1BNGA 1AY7A 8CHOA 3FG4A 2QA43 3Q3FA 1Q814 2F4YA 3OW22 1IV7A 1M1K4 4HM5B 2C11A 1ZX2A 2OCTA 3FCSB 1YHQ3 3WOFB 1W4NA 3Q90A 1YI23 1BRJA 1BSAA 1IDPA 4K61A 1IT7A 4KZ1A 4X2HA 3MKIA 1I8VA 2W04A 2MF7A 4OVMA 1JBRA 3CC43 3NX0A 3AGNA 4J5KA 3GZYB 4WYKA 1X1XA 4HOHA 1NB5I 4FCJA 1BUQA 1UI8A 1RRLA 1X1YA 4LMIA 1PFPA 2P09A 2GXFA 3MG3A 3NM7A 5CF2A 7STDA 1OHOA 2XF3A 3N8BA 5G2GA 3G4S3 3K7CA 3FLJA 5AYRB 5AEUB 3DY5A 2YFJB 1J2BA 4WWUC 2KF3A 3DGOA 3PCSA 1D6YA 2BMRB 3ROBA 1U8CB 4HM7B 1VQN3 3KKGA 2GSPA 2JQ5A 3FG1A 1MGRA 1IT8A 4I5QA 1QMAA 2QEX3 1BUJA 1IVXA 3K5TA 4LYLB 1I2EA 1QALA 2W2CA 1L5GB 3OWSA 5EEOA 1EA2A 4WP5A 1WMOA 1JKGB 1I3FA 1BRSA 1MWSA 1A90A 1NB3I 5D83A 3GZRA 1TU5A 4OUQA 3DGYA 3LZAA 1DMQA 2HOHA 1W00A 5IG5A 6STDA 1DYUA 1Q824 1E3RA 2GEYA 1W6GA 3JUPA 5BIRA 3D3LA 1CH0A 1CYVA 1W01A 2KF5A 1MWTA 3HI7A 2CIUA 4HBRA 3PS8A 2I9WA 3MYTA 2GBXB 3LTAA 3NXJA 1B3SA 1Q7HA 4HM3B 3ZG5A 5CLKA 2P38A 1TRPA 4HKVB 2CWVA 2GBWB 2R4IA 3EE1A 3LXUX 4HZBB 3URPA 3VF1A 1FGTA 1RN4A 1FGQA 1I70A 1OHPA 2A15A 1DVCA 4LSOA 4N6MA 5IG3A 2KXGA 2UUGC 5LC7A 2CH9A 3H3HA 5FW5A 4HYZA 1MOLA 4L8PA 4LZIA 1SJWA 2W6JH 2HMOB 3EF8A 1R4YA 2K54A 1O7GB 1I2FA 2UX0A 5HOHA 3U97A 4R9LA 4EV5A 2OQEC 1GMQA 5KP3A 1B2UA 4CPKA 3CCQ3 3CU3A 3LTCA 5IEOA 4QWTA 1JBSA 1BNIA 1RNTA 3A76A 3N9HA 1QAFA 5AIGA 2OOVA 4EC6A 1OF5B 2LYXA 2PZVA 3MHEA 1TTOA 1K8A4 1BANA 1BNJA 3BLZA 3OXAA 1TUHA 3RNTA 4HZ9B 3OV4A 3CME3 2CFLA 1JB2A 1GD4A 2YX9A 3CNXA 3WA2X 1VQ73 1FA3A 3FF2A 4AEQA 1A2KA 1FUSA 3HK4A 3K63A 1VQL3 1IQ8A 5BU4A 5AI1A 2XSOB 2CX1A 3T0UA 3CCR3 1S723 1HU9A 2GEXA 4JRFA 1SPUA 3J7Yd 1UCLA 2CFDA 1BNSA 1IQXA 1JN5B 1ROAA 5CK6A 4N6OB 2XH9A 1JKGA 1ULIB 1G96A 1VQM3 2Z6BA 3MG1A 5IG0A 1OH0A 1JJ22 2C10A 1LNHA 3MG2A 3G16A 2Z76A 2XEPA 2RNTA 3IJEB 3ALAA 1MWUA 1BSEA 1GY6A 3BNEA 2ZA4A 2F5WA 1W2ZA 2HMJB 2RFRA 4HM0B 3CCS3 3NUVA 2P05A 1TFKA 1W7CA 1BNRA 1RHLA 3F7XA 3Q2PA 1T5YA 3Q1CA 1EKMA 1RGAA 4EW5A 4RZMA 3X41A 1B27A 3OWYA 3LTDA 4BIRA 2BO9B 4O2HA 4HM8B 1IVUA 3X3ZA 3HIIA 4X2OA 1JBTA 3AMOB 1W6YA 4LGQA 5G1KA 1OUNA 3D79A 1RN7A 2IA7A 2IY2A 3RGRA 4N6LA 3LOYA 3LT9A 3KCHA 1BOXA 1E97A 4AKZA 3X3YA 2KF6A 3NV0B 2HMLB 4HM4B 3SLUA 3KZTA 4XB5A 2FNQA 1O7HB 5AEWB 4IT7A 1B21A 3OWUA 3WDGB 9RNTA 1AV4A 2RSXA 2XGLA 3QRDA 4ORLA 4Q53A 5D82A 3S27A 1OF5A 1RGFA 3DH2A 3V98A 3AHWA 1G02A 3GZXB 1JZDA 2WOFA 3BNDA 4BTYA 1YIJ3 4JF8A 3GSPA 3PXMA 2WO0A 4BL3A 3FSDA 1D6UA 1BNEA 2O3OA 1GD3A 3UJMA 3JUMA 1RGEA 3EHCA 3LH4A 1T3BA 3FH1A 2CG0A 1LNIA 4XDVA 1FUTA 5BXQA 3L0RA 3GWRA 3DM8A 2FGTA 1D6ZA 4TX4A 3I553 1ZS7A 3VSYA 1K9M4 1AQZA 3CCU3 5AIHA 1ASKA 1K28A 3ER7A 1FZUA 1CQSA 1GSPA 3BNCA 4N3VA
chains in the Genus database with same CATH topology
1MGWA 1RTUA 1B2SA 3HOHA 2BU4A 1BAOA 1BRIA 1R4YA 1UCIA 1I2FA 1I0XA 3BU4A 7GSPA 1ZGXA 2RBIA 5HOHA 1B2MA 3SYUA 1GMQA 1B2UA 1JBSA 1RSNA 3WHOA 1BNIA 1RNTA 1DE3A 1FYSA 2SARA 1GMPA 1T2HA 2BIRA 1Q9EA 1TTOA 1BANA 1BNJA 3RNTA 1RCKA 1X1UA 1FW7A 1LOVA 5RNTA 4HAAA 1GOYA 1PYLA 1BSDA 1YNVX 1GOVA 2F5MA 1FUSA 5BU4A 1BRNL 3D5GA 3BIRA 2F56A 1SARA 1I3IA 1RLSA 1UCLA 1BNSA 1BU4A 5GSPA 1YVSA 1B2XA 1HYFA 1BRKA 1RN1A 2AADA 1RCLA 1UCJA 1B20A 7RNTA 2RNTA 1GOUA 1BSEA 1BNGA 1AY7A 2ZA4A 2F5WA 3Q3FA 2F4YA 1A2PA 1BRGA 1RDSA 1B2ZA 1BNRA 1RHLA 1RGAA 1RGKA 1B27A 2KF4A 1RGCA 1I2GA 4GHOA 2AAEA 1BRJA 1BSAA 4RNTA 4BIRA 3D5IA 1I8VA 1JBRA 3AGNA 4J5KA 1LOYA 2KAAA 1X1XA 4HOHA 1BVIA 1X1YA 1JBTA 3A5EA 1RGHA 1GMRA 1I0VA 1RNBA 3KCHA 1BOXA 2KF6A 1BRHA 1B21A 1RGGA 2KF3A 2GSPA 9RNTA 1MGRA 1PY3A 1BUJA 1BIRA 2C4BA 1I2EA 3AHSA 1RGFA 1IYYA 1LOWA 3DH2A 3WR2A 1I3FA 1G02A 1BRSA 3AHWA 1DETA 3D4AA 1BSCA 3AGOA 4J5GA 3GSPA 3DGYA 2HOHA 6GSPA 1BSBA 1BNEA 4GSPA 1RGEA 1UCKA 4BU4A 1RGLA 5BIRA 1CH0A 1BNFA 1T2IA 1BGSA 1TRQA 1LNIA 1X1WA 2KF5A 1C54A 1FUTA 1B3SA 1HZ1A 1RMSA 1TRPA 8RNTA 3URPA 1AQZA 1RN4A 1I70A 1LRAA 1FZUA 6RNTA 1GSPA 1YGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MGW A;  1RTU A;  1B2S A;  3HOH A;  2BU4 A;  1BAO A;  1BRI A;  1R4Y A;  1UCI A;  1I2F A;  1I0X A;  3BU4 A;  7GSP A;  1ZGX A;  2RBI A;  5HOH A;  1B2M A;  3SYU A;  1GMQ A;  1B2U A;  1JBS A;  1RSN A;  3WHO A;  1BNI A;  1RNT A;  1DE3 A;  1FYS A;  2SAR A;  1GMP A;  1T2H A;  2BIR A;  1Q9E A;  1TTO A;  1BAN A;  1BNJ A;  3RNT A;  1RCK A;  1X1U A;  1FW7 A;  1LOV A;  5RNT A;  4HAA A;  1GOY A;  1PYL A;  1BSD A;  1YNV X;  1GOV A;  2F5M A;  1FUS A;  5BU4 A;  1BRN L;  3D5G A;  3BIR A;  2F56 A;  1SAR A;  1I3I A;  1RLS A;  1UCL A;  1BNS A;  1BU4 A;  5GSP A;  1YVS A;  1B2X A;  1HYF A;  1BRK A;  1RN1 A;  2AAD A;  1RCL A;  1UCJ A;  1B20 A;  7RNT A;  2RNT A;  1GOU A;  1BSE A;  1BNG A;  1AY7 A;  2ZA4 A;  2F5W A;  3Q3F A;  2F4Y A;  1A2P A;  1BRG A;  1RDS A;  1B2Z A;  1BNR A;  1RHL A;  1RGA A;  1RGK A;  1B27 A;  2KF4 A;  1RGC A;  1I2G A;  4GHO A;  2AAE A;  1BRJ A;  1BSA A;  4RNT A;  4BIR A;  3D5I A;  1I8V A;  1JBR A;  3AGN A;  4J5K A;  1LOY A;  2KAA A;  1X1X A;  4HOH A;  1BVI A;  1X1Y A;  1JBT A;  3A5E A;  1RGH A;  1GMR A;  1I0V A;  1RNB A;  3KCH A;  1BOX A;  2KF6 A;  1BRH A;  1B21 A;  1RGG A;  2KF3 A;  2GSP A;  9RNT A;  1MGR A;  1PY3 A;  1BUJ A;  1BIR A;  2C4B A;  1I2E A;  3AHS A;  1RGF A;  1IYY A;  1LOW A;  3DH2 A;  3WR2 A;  1I3F A;  1G02 A;  1BRS A;  3AHW A;  1DET A;  3D4A A;  1BSC A;  3AGO A;  4J5G A;  3GSP A;  3DGY A;  2HOH A;  6GSP A;  1BSB A;  1BNE A;  4GSP A;  1RGE A;  1UCK A;  4BU4 A;  1RGL A;  5BIR A;  1CH0 A;  1BNF A;  1T2I A;  1BGS A;  1TRQ A;  1LNI A;  1X1W A;  2KF5 A;  1C54 A;  1FUT A;  1B3S A;  1HZ1 A;  1RMS A;  1TRP A;  8RNT A;  3URP A;  1AQZ A;  1RN4 A;  1I70 A;  1LRA A;  1FZU A;  6RNT A;  1GSP A;  1YGW A; 
#chains in the Genus database with same CATH topology
 1M90 4;  1MGW A;  1DMM A;  3T8N A;  1QAK A;  3DGN A;  4R9K A;  1UUG B;  2ZDJ A;  5JPU A;  1VQ8 3;  1N9E A;  1W2B 2;  1VQ9 3;  4HM1 B;  2XFS A;  2OQE A;  1IV9 A;  3WA3 A;  1UCI A;  4HM2 B;  3M8C A;  5IEN A;  3K9M C;  3B4P A;  2INX A;  3D9R A;  2RBI A;  2XGN A;  1OGZ A;  3TDG A;  3F14 A;  4O3V A;  5G1L A;  3SXX A;  1VQP 3;  1DE3 A;  2SAR A;  3AMO A;  3EJV A;  1GMP A;  4MJD A;  3SX1 A;  5BVB A;  3JVC A;  2SBL A;  1LVN A;  1FGM A;  5IF6 A;  2P0M A;  3EQQ B;  1RCK A;  1GS3 A;  3NV0 A;  1FGO A;  4HAA A;  2CG1 A;  2CFK A;  1GOY A;  1BSD A;  1YNV X;  1GOV A;  2Q07 A;  4O02 B;  1VQ4 3;  1MNL A;  2V1L A;  3X40 A;  1OPY A;  4EXR A;  3BIR A;  1VQK 3;  2F56 A;  1SAR A;  1N9J A;  3SOY A;  3T8U A;  5KP1 A;  1IK3 A;  1JB4 A;  3PGB A;  1BU4 A;  1HKX A;  3G0K A;  4CCV A;  3KE7 A;  2Z77 A;  1OAC A;  1GYB A;  3EN8 A;  1YVS A;  3F7S A;  3G71 3;  3GRD A;  1HYF A;  1LQG C;  1W6C A;  1NO3 A;  3MSO A;  2Y74 A;  3NQY A;  1Q86 4;  4L8O A;  1GOU A;  2ML5 A;  3CCJ 3;  4FMC A;  1SQW A;  5JBS A;  4FCM A;  2W56 B;  1B2Z A;  1IVV A;  3EN1 B;  4RNZ A;  1W02 A;  1NDO B;  3EX9 A;  5IEP A;  1RGC A;  1I2G A;  4GHO A;  5AYS C;  4RNT A;  3STD A;  3X3X A;  5IW9 A;  2M7O A;  3DGM A;  1VQ6 3;  2K3D A;  3D5I A;  3LTB A;  4R80 A;  2XRX B;  4N6N B;  1STD A;  4MEI A;  2KAA A;  3IMA B;  3A5E A;  1LOX A;  4HM6 B;  1TJD A;  2ZL8 A;  1STF I;  1O7M B;  1RGH A;  1RKY A;  1GMR A;  5IER A;  1I0V A;  3S67 A;  1O7W B;  4DKI A;  4XDW A;  3WOD G;  3SED A;  4I4K A;  3BNB A;  1RJO A;  3WOE B;  1GY7 A;  1LXE A;  1JB5 A;  1RGG A;  3F40 A;  3KII A;  3LML A;  3NBJ A;  5AII A;  2LQV A;  1K41 A;  2CK3 H;  1WMP A;  3FGY A;  1O7P B;  1TIJ A;  3CC7 3;  2C4B A;  4OK0 A;  3AHS A;  1IYY A;  4FCZ A;  2QIY A;  1LOW A;  1UUW B;  3WR2 A;  3UB1 A;  1TFO A;  4FMA A;  1IU7 A;  3AGO A;  3NBR A;  2K0M A;  4R1K A;  1YJ9 3;  6GSP A;  1BSB A;  3EBT A;  2P0X A;  1U5O A;  1UCK A;  3ZFZ A;  3UL5 A;  4RBN A;  2OWP A;  3FKA A;  1BGS A;  1TRQ A;  1X1W A;  3ECF A;  3CCE 3;  1V74 A;  1A67 A;  1R4C A;  1Q40 B;  1HZ1 A;  1JZO A;  3FZW A;  1RMS A;  4KFE A;  2MC8 A;  3ZG0 A;  3E99 A;  3CPO A;  5CXO A;  2W9P A;  8RNT A;  1AR0 A;  3EB8 A;  4KFD A;  2E2U A;  3CCV 3;  5TGN A;  2CW9 A;  3EBY A;  3LT8 A;  3PZW A;  4R4K A;  4CJN A;  6RNT A;  3DGL A;  1RTU A;  2STD A;  4AKY A;  2BU4 A;  3S5C A;  1DVD A;  4HVN A;  2XR8 B;  5FGO A;  5M19 A;  1BRI A;  2D42 A;  3V92 A;  2IMJ A;  4G1M B;  5STD A;  3CD6 3;  1PU4 A;  2UGI A;  1ZGX A;  1B2M A;  3SYU A;  4J9A A;  1YJW 3;  1KWI A;  1S5A A;  2IYJ A;  3B7C A;  1RRH A;  2E2V A;  4XBY A;  1JN5 A;  4XBT A;  1K73 4;  3CCL 3;  3H51 A;  3NM2 A;  2CFG A;  1TP6 A;  2PNC A;  2OTJ 3;  1CYU A;  2H0I A;  1T2H A;  2BIR A;  2YFL B;  1US1 A;  1UGI A;  1N5H A;  2F98 A;  1X1U A;  1UGH I;  3PYJ A;  1M1X B;  3B4O A;  4NRE A;  2RGQ A;  3JUO A;  1PYL A;  2L1S A;  1WTH A;  3KN4 A;  5EQL A;  1BRN L;  3D5G A;  5D81 A;  2W03 A;  3DMC A;  1RLS A;  1Y4K A;  2ZHX B;  3CPW 2;  3O8Y A;  3G6E 3;  3UNL A;  4EV2 A;  2CC3 A;  1QVG 2;  1B2X A;  1W5Z A;  1Z1S A;  5IG4 A;  1BRK A;  1RN1 A;  2ML6 A;  5LC6 A;  1G0T A;  3FF0 A;  1OHS A;  4K90 B;  2B1X B;  5DRE A;  1O7N B;  5DRV A;  1KQS 2;  2W0Q A;  2L4V A;  1JV2 B;  3HZP A;  1A2P A;  1BRG A;  1RDS A;  2XFT A;  2YFI B;  1EEJ A;  4H3U A;  3HIG A;  1SII A;  3KSP A;  2CX0 A;  1EG9 B;  1Q42 A;  1Q40 A;  1RGK A;  3NBB A;  4MMZ B;  3S29 A;  3I56 3;  3CCM 3;  2KF4 A;  2CHC A;  1N8Q A;  2H0G A;  4WHA A;  2E2T A;  1V57 A;  5I97 A;  1VQO 3;  2AAE A;  3UL6 A;  3G8Z A;  5EVH A;  1UDI I;  2O9U X;  2KRT A;  3I0Y A;  4STD A;  1F8N A;  1C7H A;  2OTL 3;  1LOY A;  1VQQ A;  1DMN A;  1BVI A;  1AVL A;  4BTW A;  4LEH A;  3DZL A;  4N6U A;  1FGR A;  1M9G A;  3BB9 A;  3PCR A;  1NJI 4;  3MWZ A;  3JUN A;  4K1U A;  1JNQ A;  4BTX A;  1RNB A;  2WGQ A;  4KT3 B;  4EBG A;  1KD1 4;  1EQK A;  4NPB A;  1UW1 A;  1ISK A;  2W9Q A;  1BRH A;  5M18 A;  5ELJ A;  3GAX A;  4WFO A;  3JUQ A;  4XBX A;  2BMO B;  2WOH A;  1PY3 A;  1YIT 3;  1BIR A;  2Z7A A;  3SVA A;  2F86 B;  5ELU A;  2CWU A;  3VGN A;  4CDL A;  1KC8 4;  3D4A A;  1DET A;  1BSC A;  4J5G A;  2FXT A;  1ZO2 A;  1A2V A;  1KSI A;  3S28 A;  4KFF A;  1EUI C;  4MMX B;  3V99 A;  1OCV A;  3LYG A;  4N6T A;  3NQZ A;  1OGX A;  4GSP A;  4BU4 A;  1RGL A;  1UI7 A;  2QGU A;  4IIA A;  5KP4 A;  1VQ5 3;  1BNF A;  1E3V A;  1T2I A;  3CC2 3;  1C54 A;  4XM4 A;  3NHX A;  2BNG A;  2D1W A;  4BL2 A;  3DUK A;  5AIF A;  3KFQ C;  4FMD A;  2JDI H;  2BHM A;  2BT3 A;  3QK9 A;  4ILF A;  2RCD A;  4KVH A;  4U13 A;  3RDE A;  3MPH A;  1LRA A;  3CMA 3;  1SIH A;  1YGW A;  2F99 A;  2B24 B;  3EC9 A;  3OX9 A;  1JRQ A;  2IUJ A;  3HOH A;  3N54 B;  1B2S A;  4WYK B;  2Y73 A;  1N8R 4;  2H0H A;  1MWR A;  2XSH B;  1BAO A;  4RNY A;  1VZZ A;  1NU3 A;  4O8S A;  1AVK A;  2R41 A;  2KCD A;  1ROV A;  1I0X A;  1QJG A;  1CEW I;  3BU4 A;  3CNM A;  4IPB A;  7GSP A;  1YJN 3;  4FR9 A;  1FUW A;  4N6V 0;  5HGR A;  1NNV A;  1YGE A;  2CWT A;  1RSN A;  4EYC A;  1Q7Y 4;  3WHO A;  1IVW A;  3U1W A;  1WNH A;  3B8L A;  5CF1 A;  1UUV B;  1FYS A;  1YVB I;  2BMQ B;  1WQL B;  2J8X B;  3X42 A;  5M1A A;  1Q9E A;  3RGA A;  2WGO A;  4HJL B;  3F9S A;  2CKF B;  4L7K A;  1FW7 A;  2OOV C;  1LOV A;  1IQY A;  5RNT A;  2IUK A;  3IPT A;  1LQM B;  2HMK B;  4FMB A;  5A0O B;  2F5M A;  3GZB A;  4NHF A;  4PEJ A;  1WMN A;  3F8X A;  3FG3 A;  1N5P A;  1I3I A;  2W56 A;  3F8H A;  1GY5 A;  3K0Z A;  3KSE D;  3WMD A;  4GL6 A;  4ZM8 A;  2GU3 A;  2GU1 A;  1QVF 2;  4MMY B;  3HX8 A;  5GSP A;  3SOA A;  2CFW A;  4H61 A;  3CXC 2;  1ULJ B;  4J8T A;  1NWW A;  4K1V A;  2AAD A;  1RCL A;  1UCJ A;  2HMM B;  3DXO A;  1B20 A;  1V58 A;  7RNT A;  4GB5 A;  5JPP A;  2HMN B;  1BNG A;  1AY7 A;  8CHO A;  3FG4 A;  2QA4 3;  3Q3F A;  1Q81 4;  2F4Y A;  3OW2 2;  1IV7 A;  1M1K 4;  4HM5 B;  2C11 A;  1ZX2 A;  2OCT A;  3FCS B;  1YHQ 3;  3WOF B;  1W4N A;  3Q90 A;  1YI2 3;  1BRJ A;  1BSA A;  1IDP A;  4K61 A;  1IT7 A;  4KZ1 A;  4X2H A;  3MKI A;  1I8V A;  2W04 A;  2MF7 A;  4OVM A;  1JBR A;  3CC4 3;  3NX0 A;  3AGN A;  4J5K A;  3GZY B;  4WYK A;  1X1X A;  4HOH A;  1NB5 I;  4FCJ A;  1BUQ A;  1UI8 A;  1RRL A;  1X1Y A;  4LMI A;  1PFP A;  2P09 A;  2GXF A;  3MG3 A;  3NM7 A;  5CF2 A;  7STD A;  1OHO A;  2XF3 A;  3N8B A;  5G2G A;  3G4S 3;  3K7C A;  3FLJ A;  5AYR B;  5AEU B;  3DY5 A;  2YFJ B;  1J2B A;  4WWU C;  2KF3 A;  3DGO A;  3PCS A;  1D6Y A;  2BMR B;  3ROB A;  1U8C B;  4HM7 B;  1VQN 3;  3KKG A;  2GSP A;  2JQ5 A;  3FG1 A;  1MGR A;  1IT8 A;  4I5Q A;  1QMA A;  2QEX 3;  1BUJ A;  1IVX A;  3K5T A;  4LYL B;  1I2E A;  1QAL A;  2W2C A;  1L5G B;  3OWS A;  5EEO A;  1EA2 A;  4WP5 A;  1WMO A;  1JKG B;  1I3F A;  1BRS A;  1MWS A;  1A90 A;  1NB3 I;  5D83 A;  3GZR A;  1TU5 A;  4OUQ A;  3DGY A;  3LZA A;  1DMQ A;  2HOH A;  1W00 A;  5IG5 A;  6STD A;  1DYU A;  1Q82 4;  1E3R A;  2GEY A;  1W6G A;  3JUP A;  5BIR A;  3D3L A;  1CH0 A;  1CYV A;  1W01 A;  2KF5 A;  1MWT A;  3HI7 A;  2CIU A;  4HBR A;  3PS8 A;  2I9W A;  3MYT A;  2GBX B;  3LTA A;  3NXJ A;  1B3S A;  1Q7H A;  4HM3 B;  3ZG5 A;  5CLK A;  2P38 A;  1TRP A;  4HKV B;  2CWV A;  2GBW B;  2R4I A;  3EE1 A;  3LXU X;  4HZB B;  3URP A;  3VF1 A;  1FGT A;  1RN4 A;  1FGQ A;  1I70 A;  1OHP A;  2A15 A;  1DVC A;  4LSO A;  4N6M A;  5IG3 A;  2KXG A;  2UUG C;  5LC7 A;  2CH9 A;  3H3H A;  5FW5 A;  4HYZ A;  1MOL A;  4L8P A;  4LZI A;  1SJW A;  2W6J H;  2HMO B;  3EF8 A;  1R4Y A;  2K54 A;  1O7G B;  1I2F A;  2UX0 A;  5HOH A;  3U97 A;  4R9L A;  4EV5 A;  2OQE C;  1GMQ A;  5KP3 A;  1B2U A;  4CPK A;  3CCQ 3;  3CU3 A;  3LTC A;  5IEO A;  4QWT A;  1JBS A;  1BNI A;  1RNT A;  3A76 A;  3N9H A;  1QAF A;  5AIG A;  2OOV A;  4EC6 A;  1OF5 B;  2LYX A;  2PZV A;  3MHE A;  1TTO A;  1K8A 4;  1BAN A;  1BNJ A;  3BLZ A;  3OXA A;  1TUH A;  3RNT A;  4HZ9 B;  3OV4 A;  3CME 3;  2CFL A;  1JB2 A;  1GD4 A;  2YX9 A;  3CNX A;  3WA2 X;  1VQ7 3;  1FA3 A;  3FF2 A;  4AEQ A;  1A2K A;  1FUS A;  3HK4 A;  3K63 A;  1VQL 3;  1IQ8 A;  5BU4 A;  5AI1 A;  2XSO B;  2CX1 A;  3T0U A;  3CCR 3;  1S72 3;  1HU9 A;  2GEX A;  4JRF A;  1SPU A;  3J7Y d;  1UCL A;  2CFD A;  1BNS A;  1IQX A;  1JN5 B;  1ROA A;  5CK6 A;  4N6O B;  2XH9 A;  1JKG A;  1ULI B;  1G96 A;  1VQM 3;  2Z6B A;  3MG1 A;  5IG0 A;  1OH0 A;  1JJ2 2;  2C10 A;  1LNH A;  3MG2 A;  3G16 A;  2Z76 A;  2XEP A;  2RNT A;  3IJE B;  3ALA A;  1MWU A;  1BSE A;  1GY6 A;  3BNE A;  2ZA4 A;  2F5W A;  1W2Z A;  2HMJ B;  2RFR A;  4HM0 B;  3CCS 3;  3NUV A;  2P05 A;  1TFK A;  1W7C A;  1BNR A;  1RHL A;  3F7X A;  3Q2P A;  1T5Y A;  3Q1C A;  1EKM A;  1RGA A;  4EW5 A;  4RZM A;  3X41 A;  1B27 A;  3OWY A;  3LTD A;  4BIR A;  2BO9 B;  4O2H A;  4HM8 B;  1IVU A;  3X3Z A;  3HII A;  4X2O A;  1JBT A;  3AMO B;  1W6Y A;  4LGQ A;  5G1K A;  1OUN A;  3D79 A;  1RN7 A;  2IA7 A;  2IY2 A;  3RGR A;  4N6L A;  3LOY A;  3LT9 A;  3KCH A;  1BOX A;  1E97 A;  4AKZ A;  3X3Y A;  2KF6 A;  3NV0 B;  2HML B;  4HM4 B;  3SLU A;  3KZT A;  4XB5 A;  2FNQ A;  1O7H B;  5AEW B;  4IT7 A;  1B21 A;  3OWU A;  3WDG B;  9RNT A;  1AV4 A;  2RSX A;  2XGL A;  3QRD A;  4ORL A;  4Q53 A;  5D82 A;  3S27 A;  1OF5 A;  1RGF A;  3DH2 A;  3V98 A;  3AHW A;  1G02 A;  3GZX B;  1JZD A;  2WOF A;  3BND A;  4BTY A;  1YIJ 3;  4JF8 A;  3GSP A;  3PXM A;  2WO0 A;  4BL3 A;  3FSD A;  1D6U A;  1BNE A;  2O3O A;  1GD3 A;  3UJM A;  3JUM A;  1RGE A;  3EHC A;  3LH4 A;  1T3B A;  3FH1 A;  2CG0 A;  1LNI A;  4XDV A;  1FUT A;  5BXQ A;  3L0R A;  3GWR A;  3DM8 A;  2FGT A;  1D6Z A;  4TX4 A;  3I55 3;  1ZS7 A;  3VSY A;  1K9M 4;  1AQZ A;  3CCU 3;  5AIH A;  1ASK A;  1K28 A;  3ER7 A;  1FZU A;  1CQS A;  1GSP A;  3BNC A;  4N3V A; 
#chains in the Genus database with same CATH homology
 1MGW A;  1RTU A;  1B2S A;  3HOH A;  2BU4 A;  1BAO A;  1BRI A;  1R4Y A;  1UCI A;  1I2F A;  1I0X A;  3BU4 A;  7GSP A;  1ZGX A;  2RBI A;  5HOH A;  1B2M A;  3SYU A;  1GMQ A;  1B2U A;  1JBS A;  1RSN A;  3WHO A;  1BNI A;  1RNT A;  1DE3 A;  1FYS A;  2SAR A;  1GMP A;  1T2H A;  2BIR A;  1Q9E A;  1TTO A;  1BAN A;  1BNJ A;  3RNT A;  1RCK A;  1X1U A;  1FW7 A;  1LOV A;  5RNT A;  4HAA A;  1GOY A;  1PYL A;  1BSD A;  1YNV X;  1GOV A;  2F5M A;  1FUS A;  5BU4 A;  1BRN L;  3D5G A;  3BIR A;  2F56 A;  1SAR A;  1I3I A;  1RLS A;  1UCL A;  1BNS A;  1BU4 A;  5GSP A;  1YVS A;  1B2X A;  1HYF A;  1BRK A;  1RN1 A;  2AAD A;  1RCL A;  1UCJ A;  1B20 A;  7RNT A;  2RNT A;  1GOU A;  1BSE A;  1BNG A;  1AY7 A;  2ZA4 A;  2F5W A;  3Q3F A;  2F4Y A;  1A2P A;  1BRG A;  1RDS A;  1B2Z A;  1BNR A;  1RHL A;  1RGA A;  1RGK A;  1B27 A;  2KF4 A;  1RGC A;  1I2G A;  4GHO A;  2AAE A;  1BRJ A;  1BSA A;  4RNT A;  4BIR A;  3D5I A;  1I8V A;  1JBR A;  3AGN A;  4J5K A;  1LOY A;  2KAA A;  1X1X A;  4HOH A;  1BVI A;  1X1Y A;  1JBT A;  3A5E A;  1RGH A;  1GMR A;  1I0V A;  1RNB A;  3KCH A;  1BOX A;  2KF6 A;  1BRH A;  1B21 A;  1RGG A;  2KF3 A;  2GSP A;  9RNT A;  1MGR A;  1PY3 A;  1BUJ A;  1BIR A;  2C4B A;  1I2E A;  3AHS A;  1RGF A;  1IYY A;  1LOW A;  3DH2 A;  3WR2 A;  1I3F A;  1G02 A;  1BRS A;  3AHW A;  1DET A;  3D4A A;  1BSC A;  3AGO A;  4J5G A;  3GSP A;  3DGY A;  2HOH A;  6GSP A;  1BSB A;  1BNE A;  4GSP A;  1RGE A;  1UCK A;  4BU4 A;  1RGL A;  5BIR A;  1CH0 A;  1BNF A;  1T2I A;  1BGS A;  1TRQ A;  1LNI A;  1X1W A;  2KF5 A;  1C54 A;  1FUT A;  1B3S A;  1HZ1 A;  1RMS A;  1TRP A;  8RNT A;  3URP A;  1AQZ A;  1RN4 A;  1I70 A;  1LRA A;  1FZU A;  6RNT A;  1GSP A;  1YGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...