1UCRA

Three-dimensional crystal structure of dissimilatory sulfite reductase d (dsrd)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
74
structure length
74
Chain Sequence
MEEAKQKVVDFLNSKSGSKSKFYFNDFTDLFPDMKQREVKKILTALVNDEVLEYWSSGSTTMYGLKGAGKQAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein dsvD
publication title Crystal Structure of Dissimilatory Sulfite Reductase D (DsrD) Protein-Possible Interaction with B- and Z-DNA by Its Winged-Helix Motif
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Unknown function
total genus 23
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08679 DsrD Dissimilatory sulfite reductase D (DsrD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ucrA00
4UV8A 2HTJA 3IKTA 3AAFA 4WK8F 4ZZLA 1BI3A 5E8GA 2OU2A 4BHPA 1KGSA 3F8MA 5D6FA 4RGRA 1XGOA 2F5EA 2XAGA 1F5TA 1R1VA 2QYOA 3BJOA 1MDMB 2L54A 1OYYA 1UCRA 3PFIA 4IHTA 2JSCA 3I59A 1B9NA 3GZ6A 1BM9A 1IUYA 1KU3A 3HRMA 3KP7A 3GLXA 3P7NA 4ENJA 4CHUA 1R00A 4JBAA 3U9GA 1XMAA 2W24A 3ECOA 4CXFA 4M71A 1R23A 1E17A 1O7LA 5DV5A 4EM2A 1SMYF 2HOEA 3ZP5A 2OZ6A 5ICFA 1DPUA 4G7HF 5JVTA 1IF1A 5IT9Z 2O0YA 1OPCA 4CO8A 1LDDA 1YS6A 4FT8A 2OBPA 2XVCA 3GXOA 1G6NA 4IRGA 4EJVA 3IRQA 2DQLA 3TDUC 3I59B 1IRFA 4L0YB 3QU3A 3KP3A 2K02A 2RGVA 3DFGA 4RAYA 4ESBA 5FGMA 3LAPA 1W4MA 4M74A 2H27A 4Q5SF 3EETA 2QQAA 3GO5A 3EUHA 2OQGA 2PJPA 3FXQA 2GXBA 1FWZA 5HDKA 1XDSA 3R61A 3EQLF 1QBJA 1ZG1A 1ZG3A 3R4KA 2WWYA 4LGWA 4LK0F 4P9UA 3G73A 2P5KA 3OV8A 1RNLA 2EV0A 1PDNC 2O03A 4KNYA 5LGNA 1BC8C 3HSRA 5D8KB 4XLNF 4GGGA 4ZYDA 1ODDA 3RI4A 3I64A 4LK1F 3EDPA 5K5QA 1BC7C 2O8XA 2VOOA 1ZLKA 2VE8A 3IRRA 3FHZA 1SD7A 2NNNA 2HWVA 4IF4A 1LQ1A 1ON1A 2P8TA 1GXQA 3R6SA 1IZ1A 4KMFA 2JT1A 1YG2A 1Q1HA 3JSPA 3GZ5A 4YG2F 3SXYA 5BPIA 3F3XA 1W7PA 1S7AA 2VBZA 5CYVA 1UHWA 5DDGA 4WXHA 4QWQA 3WODF 2VT2A 1D5VA 4ZYHA 1YW7A 3QPTA 2H6BA 2J5OA 5D5WB 1IN5A 5L3GA 2DPUA 1MJ9A 5CLSA 3F23A 1AOYA 2K7LA 4I02A 1WI9A 3V8KA 1G4DA 2ZFWA 4LLGF 1FYKA 5FLXZ 3TO6A 1R1UA 1YO5C 1I5ZA 1TQIA 1R58A 4AIKA 1W7PB 1Z9CA 1RUOA 4KUMA 3WU1B 1W5TA 1Z91A 3JTGA 1FSEA 3MEXA 2TDXA 4P55A 2UXXA 2F5DA 1KYZA 1XB4A 4WX9A 3MQ0A 1RZ4A 4M9ZA 1WWXA 2F5FA 4EMSA 3K1PA 5LHIA 1P2FA 1FP2A 5IT3A 3HSFA 5L3EA 2F2EA 5K5RA 1ZRDA 2JZYA 1HKQA 2XHKA 2EFQA 1USSA 2OQRA 2K86A 3MCZA 4KT5C 1XCBA 1ZYRF 5ICCA 4WCGA 1IRGA 1HBXG 3E6CC 3EYYA 3BDDA 2VN2A 4Y13A 4KICA 2ESNA 4TV7A 5L3FA 1OR7A 2WC2A 4GCVA 4XBFA 3W6JB 4OOIA 3QU6A 3MWMA 5K1YA 3WTUC 1B4AA 2Z5UA 4EM1A 5LEJA 5E18F 2IA1A 3GWZA 1P4WA 3I0TA 3Q9SA 5D5VB 1VTNC 1ZN2A 4A0ZA 1WKMA 1PP8F 2XRNA 2RDPA 3E97A 3FXRA 1UFMA 2A5YB 3V4GA 1FYLA 2E1NA 2C6YA 3JAMK 4XLPF 1MD0A 3E6MA 2IRFG 1QQIA 4U0WA 1SD6A 4U0VA 1LVAA 1WQ2A 5HDNA 1FZPB 2IPQX 1TQMA 4KFCA 3DEUA 3WU0A 3REOA 3VODA 1FSHA 1GXPA 5BQTA 4HAMA 4A6EA 2ISZA 1BJAA 3P9KA 4YFXF 4HOBA 2CO5A 5HVQC 3FWEA 2PMHA 3I53A 4BXUA 2EFOA 3GW2A 1OYWA 2MLGA 1IN7A 4RGUA 2EJRA 4L0ZB 4HF1A 4XSZF 3LAJA 2W84A 3KP6A 3KEOA 3RKXA 1BOAA 4HLXA 3L9FA 3OOPA 2W25A 1ZAOA 1WRJA 3KP5A 2GA2A 3C7JA 2QM3A 2M5WA 1U78A 3C3WA 4WF2A 4WXCA 4I7HA 3ABTA 2LDUA 4B09A 1GVJA 3J80K 2EFWA 1HXDA 3QAHA 2NAZA 3DXJF 2M45A 1TLHB 3ABUA 3T5XA 2E7WA 2LSOA 5LHHA 4HDVA 2G9WA 2DTRA 2IA0A 5D4SA 4IXAA 3T0YA 1YQAA 1P4AA 2KRFA 2ZCWA 1DUXC 2FBKA 3G3ZA 3VEPA 2MH2A 1FBUA 1G3YA 3QOPA 4GYGA 2ZBKA 5DYMA 5HS8A 5KVRA 3IL2A 1F9NA 3K2ZA 1MGTA 3B73A 3FZVA 5ICEA 5LRSA 1MKMA 2Q2EA 4A5NA 3TOAA 2FOKA 1J59A 5ICGA 1R1TA 3CUQA 4AIHA 1LEAA 4Q4ZF 2WV0A 3DPTA 3LA7A 4A12A 4U7DA 4L9VA 5LGTA 1SAXA 4PGGA 1BN5A 1I1SA 2QQ9A 3VFZA 4MQVA 3KP2A 5D5XB 2OAZA 3KCCA 1TW2A 3O6BB 2V9VA 1ULYA 1FBQA 1XSVA 2KIMA 4P96A 3M1EA 3HTSB 1TNSA 2CGPA 3NQOA 4CYDA 4KIBA 2YX4A 1TNTA 2STTA 4XSXF 4ZYEA 2KJCA 4M73A 3CUQB 1SD4A 3R0JA 3S2WA 2R3SA 2QLZA 3I54A 2IW5A 3LA3A 1YYVA 3NRVA 1FT9A 2HQNA 1O3SA 4HF2A 1EH6A 1ZG5A 3ZMDA 2PN6A 4YIFA 1H9GA 4UVAA 2HTSA 1B9MA 2QZ8A 4EGZA 2H6CA 1CF7A 5FD6A 1BBYA 2QVOA 1ZRCA 2O6GE 4EM0B 4IRIA 4G8XA 3K1NA 1RIOH 5AIPA 1XN7A 4EV0A 2V6CA 4RS8A 5DUIA 3ZN1A 3BP8A 4L9TA 3ZMVA 4R8HA 5E20A 3F6VA 3H3ZA 4AVPA 4NB5A 1G3TA 3GVAA 2XKPA 4LMYA 1U8RA 1HKTA 2DBBA 1T6SA 4BH9A 5HLHA 3L09A 2BYVE 1O3RA 4LLNA 2CSOA 3ERED 3BPXA 2DO7A 2AXLA 1O3TA 2HZTA 1ZARA 2HKOA 1LDKB 2FSWA 3V7CA 4ESJA 2L01A 2LNBA 2P5LC 1SFXA 1U2WA 2Y75A 4LD5A 2DT5A 3I71A 1V3FA 2ACJA 1ON2A 3MZHA 4BHBA 3F6OA 1ZHFA 6PAXA 1T0FA 2JPBA 5ILSA 1DPRA 1P6RA 4EJOA 1T2KA 3KP4A 5D8LB 2Z9OA 4H0EA 3GFJA 3K69A 4M72A 4HX4A 1IXRC 4EJTA 1I6XA 3F8BA 1DP7P 3SZTA 5D6EA 2CYYA 2V1XA 4ZYGA 5DEQA 4HYEA 3GF2A 1U5TA 2OD5A 4NQWA 3FF5A 1W5SA 2MBFA 2X4HA 1FX7A 1UB9A 4LB6B 3GEZA 5JR3A 2EV6A 1ZGAA 1YFHA 5LHGA 5HLIA 4OIOF 2DK5A 2CWEA 4IJAA 3J81K 1ZGJA 4L5JA 2CW0F 1R5GA 5DCMA 5KK1A 1P4XA 2XKOA 5L3CA 2PFBA 2MH9A 4PZJA 1QGPA 1SMTA 2BBYA 4ENKA 3SZPA 3RTRA 3M9AA 3MFKA 2XAQA 2A61A 5HLGA 1BIBA 4KYWA 1FNNA 2VE9A 1T38A 1U5TB 3RPQA 4D0PA 4HZFA 4ENMA 4HV6A 3W6KB 2EFNA 4YFKF 3JTHA 3WGGA 3JAMZ 2O61A 4HLYA 4LFUA 2K4JA 4WWCA 1KQ9A 5H6RA 5DCMB 4AD9A 2H09A 4HX7A 2D1HA 3PQKA 2EA4A 5JFRA 1SD5A 5DD8A 4LG0A 1WSUA 2ZMEA 2XASA 2XUBA 2L3DA 4KMUX 4MQ9F 2NYXA 4ENNA 3HHHA 1U6GA 3EYIA 2Y48A 2W57A 1B6AA 3T8TA 2MA3A 1Z6TA 2CG4A 4I0AA 1ZREA 2HYFA 3R60A 4Y15A 1LDJA 5ILUA 4HW0A 1XGSA 2P7VB 2D2WA 5A2QK 2H94A 3F72A 2EA2A 2V1DA 5DUKA 4KIFA 1HQCA 2KIFA 1KU7A 4CDGA 2J5PA 3COAC 2O3FA 1QPMA 4G9YA 1USTA 1QZZA 1XSXA 2XIGA 4LG0B 2ZMEB 1QNTA 3TO9A 1HW5A 2ZKZA 1RI7A 2R7FA 1SFEA 2FF4A 4EJUA 2L02A 3FM3A 2UWMA 1D3YA 2COMA 4I2OA 2A07F 1PP7U 4QLCU 5EEHA 5L3BA 3TGNA 1TTYA 2EWNA 1XD7A 2HS5A 2GZWA 4CICA 2P4WA 3J80Z 1REPC 3MZYA 1RUNA 3KLOA 3LWFA 1I27A 4O3MA 1EH7A 1Z1DA 4U0YA 1QZYA 4P9FA 2M1BA 3GUDA 5E1WA 1NHAA 3ZMSA 5JI6A 3GFIA 1AWCA 4HF0A 3T8RA 1IXSB 2NRAC 3ECHA 3HRSA 2MD5A 3LFKA 2HKXA 1J75A 3HRTA 1QO0D 2LKPA 4K2EA 2PEXA 5E8IA 2P7CB 4L9JA 2FE3A 4RB1A 2CFXA 3TOBA 2KIUA 4RB3C 1XGMA 1O57A 4EQQA 2GIVA 3ROUA 1KA8A 3H92A 4A0XA 4ZH4F 1SFUA 3VB2A 3RKYA 1IN4A 2VXZA 3WTXC 3HSEA 4OMZA 2NS0A 1MJBA 3HRUA 4Y17A 2PMUA 2W85A 1W7PD 3BJAA 5D5UB 4OIPF 1JHFA 1YW8A 2IJLA 2M30A 1K78A 4L9NA 2QWWA 3K9TA 2FU4A 2B0LA 1XGNA 4HV5A 4PDKA 2DFIA 2QBYA 5DCFA 4CZZA 2V79A 3L7WA 1H9TA 3WTZA 5DD4A 1YIOA 4DNCA 2HGCA 3KEQA 2UXNA 4JK1X 3F8FA 3WGHA 4AIJA 1F4KA 4G6DA 5D4RA 2YSRA 3KZZA 2BGCA 3WE3A 4L18B 4KIGA 5CVJA 3KFWX 1D8KA 4IRHA 4CGZA 1L0OC 2GXGA 2OA4A 1IN8A 4HQEA 4MTDA 5LRRA 3B02A 1KQ8A 2PG4A 2L4MA 3RIRA 1FLIA 3RDIA 2ZNYA 2EB7A 4EVIA 3DQVC 4UV9A 2BEOA 2FEZA 3C18A 3LA2A 1JHHA 4N9HA 4OINF 3BOQA 1U3EM 3QPHA 2GAUA 1C0WA 4HX8A 1FY7A 2KJBA 4M9SA 2RC4A 3F8CA 1HW2A 3I5UA 2YR2A 2R7DA 2ESHA 2FMLA 3WTWC 5FB2A 2VBWA 3HYIA 2HR3A 2AS5F 1J9IA 1KU9A 5FO5A 3NEUA 1XDUA 4IHSA 3GFLA 3KE2A 4A0YA 2IA2A 1YW9A 3WTVC 1LJ9A 1HW1A 2E1CA 1G3WA 3TO7A 1Z7UA 2NNYA 1EV7A 3RJPA 1R7JA 2K27A 4BQAA 3F21A 3V7SA 4O6JA 2X0LA 4U88A 2DPDA 3E5UA 1S3JA 1HSJA 5AONA 4FX4A 3ELKA 2Z33A 4Q47A 1GHCA 4RB2C 4R1HA 2A6EF 3F22A 3TDZC 3RKWA 4ESFA 3LQQA 4YIIA 2RV8A 5HDGA 1R36A 1DDNA 5CVVA 2GA1A 2EFPA 3DKWA 2DI3A 3RYPA 3CO7C 3HOTA 3PQJA 2RQPA 4JQFA 4FHTA 2FQ3A 1IAWA 5HOOA 3FM5A 1YLFA 2VC1A 2MC3A 1R5HA 1MJAA 1CF7B 3I4PA 3WGIA 1KQ0A 3V8JA 4MHGA 4UXNA 4HDUA 1S29A 1HSTA 2MLKA 2ZO4A 5E1XA 2LF7A 3BY6A 3CUQC 1K6OA 4I98B 2BV6A 3J81Z 3SFZA 1UHMA 4HQMA 5H6QA 3ZMZA 2WTEA 5AIQA 5FFZA 5ED4A 1Z6RA 3E5XA 3ULQB 1IXCA 5K5OA 4M6YA 1I1GA 4UHTA 3JSOA 1OMIA 3BPVA 5IT9K 2Y0MA 3HUGA 5E17F 4N0BA 2FBHA 1E2XA 3N4MA 2L4AA 3I58A 2A69F 3U2RA 3WG9A 3WTSC 3BJ6A 3FMRA 2ETHA 1BI2A 4KN4X 2VT3A 4S05A 2XAHA 3WE2A 3LSTA 5L3DA 2DK8A 3GFMA 4UVBA 2UZKA 3MAJA 4Q48A 5FFXA 3HTUA 3CDHA 3E6DA 4E70A 3IHUA 4WXDA 1MZBA 1CGPA 1OYIA 3FMQA 4P5OA 3RYRA 1ZH5A 4PCQA 1S8NA 2PBIA 1LB2A 2FNAA 3FXUA 4I01A 4UVCA 2FXAA 4KN7X 4EJWA 2A6HF 2M87A 3L2CA 1T39A 4G7ZF 2Q8KA 3V8LA 5E1ZB 2D45A 4LB5A 1EH8A 2VBYA 3JW4A 2ZNZA 3ZPLA 1FP1D 5TJJA 4S04A 3GYHX 5ERIA 5A2QZ 1XCVA 2P5VA 3N97A 1YTYA 2VC0A 4MTEA 2DW4A 2LF8A 2EK5A 5TRDA 4A6DA 3ZMTA 3LQRA 3TKYA 1Z05A 3KZYA 3ZQ7A 2KKOA 1L3LA 3Q5FA 1JE8A 1LEBA 1P92A 3DP7A 4F7ZA 3SHFA 3V7RA 2JPCA 1J2XA 3Q9VA 2BE5F 1BI0A 4IVNA 2G7UA 3K0LA 2XGXA 3E5QA 4KA4A 1FC3A 4HBLA 4RB0A 3CTAA 1FPQA 3CUOA 4YFNF 4GYIA 3IWFA 3BWGA 1BI1A 4ON0A 2RN7A 4G7OF 3VOEA 2HEOA 4UNOA 1TQPA 1J0RA 5BOXA 1S6LA 3P9CA 1H0MA 1YS7A 4N9IA 4A2UA 5FLXK 5CVRA 1FYMA 4O5VA 1JXSA 1O7FA 5JHUA 2IP2A 3ML6A 4I0BA 2VBXA 4RGXA 4PGHA 3CJNA 5LGUA 1ZRFA 4G6QA 4ZZDA 1KU2A 4M9XA 2DAOA 3M7GA 1U5TC 4XRFA 1ZLJA 5LLQA 5J8CA 3SQNA 4ETSA 5BPDA 5CVUA 4DQ2A 3DV8A 3D0SA 2OZUA 3T1BA 2JRTA 3D5LA 3IKVA 2A68F 4IPAA 4G94A 4RGSA 4OU0A 5BS6A 3O3KA 1Y0UA 2VODA 2FNPA 2D1VA 1XMKA 3F8NA 5HS7A 3WTYC 3QP5A 3FMSA 1XSDA 1IW7F 1FOKA 2K4BA 4LLLA 2PLYA 3L00A 5CJ9A 1PUEE 1TBXA 2PQ8A 3M8FA 4BHCA 5BMZA 3O2PE 5F64A 2VOPA 2CQKA 4M6XA 2RNJA 4OIQF 3R0AA 2FBIA 3K1MA 5LBQA 3HHGA 1IN6A 2XAJA 1OKRA 4BYYA 4GO1A 2YPRA 4ASNA 3WTTC 5J6XA 4RAZA 1K79A 2PI0A 5HS9A 2XAFA 2A3SA 2JTVA 2ELHA 1A04A 4MNUA 3DPLC 3P9IA 1O3QA 3KLNA 3FX3A 4NHJA 4OMYA 4Z2YA 2IT0A 1HKSA 1KYWA 4U7BA 4GXOA 4L5IA 3HIFA 2IVMA 2V1UA 4LJZF 2FRHA 4FX0A 3RPUA 5FD5A 2FA5A 3DF8A 3ISPA 3HOSA 3ZN0A 3TQNA 4KDPA 1T98A 3E6BA 3E3VA 3IWZA 5EEGA 4BAYA 5CVIA 4UUVA 3M8EA 2M8EA 4BNCA 2XV4S 4MGRA 1F1ZA 2DLLA 3KETA 2P6SA 3C1DA 3QRFF 3BROA 2Q0OA 2HFHA 2QQBA 2P6TA 3BZ6A 2QUFA 2FMYA 2YU3A 4MEYF 2ZJ2A 1JGSA 2HQRA 1S7OA 4OIRF 2RKHA 5LEKA 1V4RA 1TW3A 3ZMUA 2E7XA 2Z99A 2HDCA 2DU9A 1J5YA 2ADUA 1BIAA 1LNWA 2GQQA 1X3UA 4HA8A 3H3UA 3U1DA 4B8XA 1K78B 1G3SA 4I09A 5H20A 2ZXJA 2F5CA 3QP6A 5F1RA 2VONA 1MDMA 1R22A 2G7HA 4MEXF 2XROA 2QBYB 2ISYA 2QENA 2HYGD 3IC7A 4A5MA 1J7KA 3GX4X 4EGYA 1FBSA 2GWRA 2STWA 1STZA 2Z3YA 3CLOA 5ILVA 1ONVA 1D8JA 3J7AO 4R79A 2EV5A 2RVCA 5J8FA 5F6FA 3CO6C 2DQRA 4AWXB 1B59A 2YX7A 1K7AA 1B1BA
chains in the Genus database with same CATH superfamily
4UV8A 2HTJA 5IOZA 3IKTA 5IYDJ 3HKZN 3AAFA 3WHCA 4WK8F 4ZZLA 1BI3A 5E8GA 2OU2A 2Z16A 2VXDA 1V54H 4BHPA 1D0ZA 4IZZA 1KGSA 3F8MA 5D6FA 4RGRA 1XGOA 3ZOBA 5E3MA 2F5EA 2X6XA 2XAGA 2HXIA 3ABMH 3CCVI 1K4TA 1F5TA 1R1VA 3GMEA 2QYOA 3BJOA 5FKOA 1MDMB 2L54A 3PSIA 1OYYA 1UCRA 4F93B 3PFIA 2HQAA 4A3JJ 1XS9A 2JSCA 4IHTA 3I59A 4D5FA 1X4PA 1TWFJ 1B9NA 3GZ6A 1V55H 1BM9A 1GV5A 1IUYA 1KU3A 1RPWA 3AG2H 5E3LA 2XC7A 3HRMA 3KP7A 1Y1WJ 3GLXA 3P7NA 4ZJZA 4ENJA 2GXAA 1G59A 4CHUA 1R00A 5JVGF 4FETA 4JBAA 4XQFA 2VIXA 2W00A 3BQZA 1XMAA 2ELKA 3BG6A 3U9GA 3OYEA 2W24A 3G6EI 5CKTA 1UELB 3ECOA 4M71A 1R23A 4CXFA 4D9JA 1E17A 1O7LA 5DV5A 4EM2A 1SMYF 3O8HA 2JVGA 2HOEA 2WBMA 3HPGA 3ZP5A 1SVLA 1Q1VA 2VI6A 3CMMA 2OZ6A 5ICFA 1DPUA 1VQMI 4G7HF 3A1YA 5JVTA 4FE4A 4BDZA 1IF1A 3S1QJ 5IT9Z 2O0YA 3PNTA 1OPCA 1Y0NA 4CO8A 1LDDA 1YS6A 4FT8A 2OBPA 2XVCA 2EQRA 3MVPA 3GXOA 1G6NA 4IRGA 1TC3C 4RLQA 4EJVA 2OTLI 1HDDC 5IP6A 3IRQA 2DQLA 3TDUC 4C3IJ 2W7NA 3S1MJ 4UB6C 4F3QA 3JRIA 2M4GA 1H8AC 2EH3A 2X6WA 3I59B 1IRFA 3I4MJ 1JI8A 4L0YB 3QU3A 3KP3A 1VF9A 2OC6A 2K02A 3G1OA 2RGVA 2GM4A 1MIJA 3DFGA 4IEJA 3BR6A 4RAYA 4DGWB 4ESBA 2WB1N 4M3DA 5FGMA 3LAPA 2NVUB 3BR1A 1MNDA 1W4MA 4I76A 3TP3A 3CC4I 4M74A 2H27A 5BNGA 2M8GX 4Q5SF 4MFEA 1R4MB 3EETA 2K9MA 2DA5A 2QQAA 3CCYA 3GO5A 2KL4A 2DCEA 4KISA 4XRSA 3GZNB 1OCCH 3EUHA 2OQGA 2CQXA 3VYSB 2PJPA 3FXQA 2GXBA 3GTKJ 2DA6A 1FWZA 5HDKA 2QGUA 5IP9J 1XDSA 3R61A 4XL9A 3EQLF 3S93A 4G12A 1ETYA 1QBJA 1LE8A 3A01A 1ZG1A 1ZG3A 4DYCA 2LD5A 5DTDA 3PO2J 3R4KA 2WWYA 3ZQLA 1X1DA 4LGWA 4LK0F 4P9UA 1XG1A 3G73A 2P5KA 2EIKH 3HBLA 3OV8A 4ANJA 2PX9A 3OYJA 1RNLA 2EV0A 1UG2A 3DTIA 2XGDA 1PDNC 2O03A 4KNYA 5LGNA 5TISC 1MSEC 1BC8C 3HSRA 3OYAA 5D8KB 4XLNF 1SVMA 4GGGA 3KYLA 2XRLA 1I50J 3Q0VA 3CLQA 4ZYDA 1ODDA 3CJRB 3I64A 4LK1F 3EDPA 5K5QA 4LOCA 3RI4A 2O8XA 1JKPC 1BC7C 2VOOA 2QSGX 1ZLKA 5EF6A 2VE8A 2VL8A 3IRRA 3FHZA 1ZR2A 1SD7A 2KISA 3HG9A 2NNNA 2HWVA 3S3MA 2CS3A 1W0UA 4IF4A 2IS4A 3PFYA 4DBRA 1LQ1A 1ON1A 2P8TA 2R5YA 1HA8A 1GXQA 3R6SA 1IZ1A 4KMFA 2JT1A 3LSJA 1IC8A 3I56I 5GADJ 3IH4A 1YG2A 3VPRA 3L2VA 1Q1HA 1VQPI 3N05A 3JSPA 4F55A 4PJLA 1ACIA 2NVXJ 2XB0X 5EDNA 3GZ5A 4II3A 5EGOB 1XTAA 4YG2F 3TW6A 1LE8B 3SXYA 5BPIA 3F3XA 1W7PA 1S7AA 2VBZA 3SDGA 4BU2A 2HU9A 4IHVA 2NOJB 1EA3A 3DWLE 2NVTJ 5CYVA 1UHWA 5DDGA 2V1NA 4WXHA 4HNVA 2VPRA 4QWQA 5HNHA 3OS2A 5F0CA 4YELA 3WODF 4DZJA 2F4MB 4A3BJ 2VT2A 1D5VA 4ZYHA 4BACA 2L9NA 1YW7A 3QPTA 4DJAA 2H6BA 1M1EB 3M8JA 1Y8QB 2X1EA 3HM5A 2J5OA 5J1UA 3HDDA 5D5WB 1IN5A 1YJNI 2ME0A 5L3GA 4BL0B 1OISA 2DPUA 1MJ9A 5CLSA 1B8IB 2HPMA 2KRCA 3F23A 4FTHA 1AOYA 4A3GJ 2CRGA 2K7LA 4I02A 3ABLH 2NXNB 1WI9A 3V8KA 4GRIA 2R5YB 4XN0A 2QKLB 1G4DA 2ZFWA 4LLGF 4BXFA 4C3JJ 1FYKA 5FLXZ 2COBA 5F0FA 2CMPA 5GPAA 3TO6A 3HOUJ 1HC8A 1R1UA 2IS1A 1YO5C 1I5ZA 1TWHJ 1TQIA 4V19K 1R58A 3RKQA 4A3KJ 1NH3A 1ETQA 2DOFA 1MBHA 4AIKA 1W7PB 3PNYA 3G71I 1Z9CA 1RUOA 4KUMA 3L2RA 1PUFA 2R7WA 3WU1B 1W5TA 1Z91A 2E5NA 3JTGA 2LRDA 1FSEA 4QIWN 5HLTA 2AHQA 3MEXA 2TDXA 4P55A 1N77A 2FUG2 3LSHA 2JUCA 2KP6A 4F92B 2UXXA 2F5DA 2DDBA 2UUZA 1KYZA 1XB4A 3MQ0A 4WX9A 1RZ4A 4Y3OA 4M9ZA 1WWXA 2F5FA 4EMSA 1YRNA 3K1PA 5LHIA 1P2FA 1FP2A 1ZK8A 3HSFA 5IT3A 5L3EA 2F2EA 1MBJA 5K5RA 1ZRDA 2JZYA 5LFAA 1HKQA 2XHKA 3VDXA 3HC7A 2EFQA 4AYBA 4YRVA 5DM7F 2FX0A 3OYNA 3HB9A 1USSA 2OQRA 4A69C 2K86A 1TP4A 3MCZA 4KT5C 1XCBA 1HOMA 5J3LA 1ZYRF 5ICCA 4WCGA 3OIOA 1IRGA 1HBXG 4A3LJ 3E6CC 5J4YA 3EYYA 4LIUA 3BDDA 1RKWA 2VN2A 3QQAA 3DEEA 4Y13A 5GTIC 2VB6A 2K9NA 2ZB9A 4KICA 2ESNA 2JN6A 4TV7A 5L3FA 1OR7A 1X4OA 3S8PA 2Z1DA 5CQEA 4XN3A 1DGRM 2WC2A 4GCVA 4PFOA 3HOXJ 4XBFA 3W6JB 2TRTA 4CH7A 4OOIA 1MMNA 3QU6A 1APLC 3PL8A 2DMUA 3MWMA 5K1YA 3WTUC 2MFZA 1B4AA 3BT9A 2Z5UA 4EM1A 3JRFA 5LEJA 5E18F 3CC7I 3H1CA 2IA1A 1ZELA 2K9SA 3GWZA 2M3AA 1P4WA 2MYSA 3I0TA 3Q9SA 5D5VB 1VTNC 4XKBA 1ZN2A 3BR2A 2JMWA 4A0ZA 1WKMA 1PP8F 2XRNA 3K6GA 2RDPA 3AG1H 3FHNA 1MW7A 3UR3C 3E97A 3FXRA 2DYSH 1UFMA 4RAGA 3AL0B 2A5YB 3V4GA 3C2BA 1BR1A 1FYLA 2E1NA 2C6YA 4DOZA 3JAMK 2E1MB 4XLPF 1MD0A 3E6MA 3A4CA 4YIRX 2IRFG 1QQIA 4U0WA 1SD6A 4U0VA 1LVAA 1WQ2A 2ZXIA 2L7ZA 5HDNA 4AVZA 2IPQX 4DYQA 1TQMA 1FZPB 4KFCA 3DEUA 3WU0A 3REOA 3AFHA 3VODA 1S7EA 2BOLA 4XKCA 1FSHA 3KZIC 3M3YJ 4I6ZA 1TWCJ 2V26A 4C2UA 1YIJI 2P0WA 1BJZA 5K7FA 5B1BH 1GXPA 5FRNA 1VNDA 2AO9A 1XX5A 1JTXA 2RNGA 3FKJA 5BQTA 3CCJI 5HODA 2IEKA 4HAMA 4A6EA 2ISZA 1K83J 1FMVA 3DKXA 2LY9A 1BJAA 5JLXA 4RMNA 2I8DA 3P9KA 2B7EA 5K7ZA 4YFXF 4HOBA 2OCEA 2CO5A 4JX4A 5B3SH 5HVQC 3FXJA 4D7NA 3FWEA 4PUSA 2PMHA 2M9HA 3I53A 2EFOA 3GW2A 4BXUA 4E7SA 1OYWA 1N25A 2MLGA 1IN7A 4RGUA 1H88C 2ZJQF 2EJRA 2XF7A 1R6RA 2R4GA 2ECBA 4L0ZB 4XLHA 4HNUA 4HF1A 3HL2A 1TWGJ 2ZXHA 3ZCOA 5E79C 3JRDA 1FJLA 4XSZF 2Y31A 3LAJA 3VYRB 2W84A 1FEXA 3KP6A 2JA6J 3KEOA 1JUPA 3VYUB 3RKXA 1BOAA 3V42A 4HLXA 1VQKI 1QPIA 3L9FA 3OOPA 3H36A 2BY0A 2W25A 1ZAOA 1WRJA 3M1CA 3KP5A 3ZQGA 2DODA 4FE7A 2GA2A 4N4OB 3C7JA 5J47A 2QM3A 5DM6F 4XR6A 4E7HA 2M5WA 1U78A 3C3WA 2B63J 3J7ZI 1JUSA 2BW3A 3DBHB 2R7UA 1D1BA 9ANTA 4WF2A 1YHQI 4X1EA 4WXCA 2W48A 4I7HA 3ABTA 2LDUA 1VZ0A 2V7FA 3ABKH 2R92J 4AM3A 3AL0C 4HG2A 2E36A 4B09A 5M5YJ 1GVJA 5GPCA 3J80K 3CD6I 2E1MC 2EFWA 1UHSA 2CV1A 1HXDA 1IJWC 3QAHA 2NAZA 3DXJF 2M45A 1TLHB 3ABUA 3T5XA 3BTCA 3FBNB 2E7WA 2LSOA 3FISA 3P5JA 5LHHA 4CA0A 3SEQA 4HDVA 2G9WA 2DTRA 1Y56A 2IA0A 4BBSJ 2K3PA 5D4SA 4IXAA 3T0YA 1YQAA 2Y69H 1P4AA 3BLYA 1WVRA 1MH3A 2JSPA 3OL4A 2KRFA 3SYTA 1FMWA 2ZCWA 1DUXC 2FBKA 3G3ZA 1V5EA 3VEPA 3RSNA 2MH2A 1FBUA 1G3YA 3QOPA 3JRGA 2LG4A 1W36C 2BW3B 4NNJA 1ZKGA 4GYGA 2ZBKA 5DYMA 5HS8A 5KVRA 2DMNA 3IL2A 1F9NA 2XPUA 1WH5A 1MGTA 2WADA 3H35A 2IXSA 3K2ZA 2IGNA 4B4CA 4BQQA 2X51A 3ZQIA 3B73A 2F48A 3FZVA 3MD2A 5ICEA 3DBLB 4BGDA 5LRSA 1MKMA 2LKXA 2QCOA 2Q2EA 4A5NA 4OWRB 3TOAA 2WAQA 2HNHA 3LSMA 1XC5A 4NC7A 1I3QJ 3PUFA 2FOKA 5IYBJ 3SEZA 1J59A 5ICGA 1R1TA 2L0KA 3CUQA 4AIHA 4J00A 1LEAA 4XOTA 4AUXA 4Q4ZF 2WV0A 3DPTA 3HOYJ 3LA7A 3F9KA 4A12A 1DP3A 2QSFX 4U7DA 4L9VA 5K7HA 5LGTA 1SAXA 4PGGA 1BN5A 1FIAA 1R4NB 1R5ID 2QQ9A 1JJ6C 1I1SA 1BA5A 1KZHA 3OYFA 3VFZA 4MQVA 3KP2A 5D5XB 2OAZA 3KCCA 2GOMA 4UY8I 2OV7A 1TW2A 2WA0A 2V6EA 3CCQI 3O6BB 2DA3A 1LFPA 2V9VA 1ULYA 4ZTFA 1U8BA 1FBQA 2DFEA 1XSVA 2KIMA 4P96A 2PJRA 4ZDLA 3M1EA 3M07A 3BR5A 4RA2A 3HTSB 4UB8C 1TNSA 3BTJA 3F0CA 2CGPA 3NQOA 4CYDA 4KIBA 1W5CC 2YX4A 1TNTA 3HZJA 2STTA 3S2HJ 4XSXF 4ZYEA 2KJCA 3H9QA 4M73A 3S14J 3CUQB 2RQQA 4B44A 2R7SA 1OCOH 1SD4A 1XMXA 3R0JA 3S2WA 2AQEA 2R3SA 4G6TB 2QLZA 3I54A 4M3BA 4IL6C 2IW5A 5KAFC 3LA3A 1YYVA 3NRVA 4B3XA 5EZHA 1FT9A 2HQNA 2VQLA 1O3SA 4HF2A 1EH6A 2HOTA 1ZG5A 3ZMDA 2E2IJ 2PN6A 4YIFA 1H9GA 4UVAA 2HTSA 3X2QH 1B9MA 2E19A 2QZ8A 4XRSG 1R49A 4EGZA 1W36D 1POGA 2H6CA 1CF7A 5HNFA 5FD6A 1BBYA 1SFKA 2ELJA 2QVOA 4UUTA 4MFDA 3EUAA 3S32A 3LL7A 1ZRCA 2O6GE 2PJRB 2ZC2A 3HXLA 4P1WA 2W82A 1X19A 4EM0B 4IRIA 1GDTA 4G8XA 1R71A 1Z3YA 3K1NA 1RIOH 2E1OA 3FIWA 5AIPA 4HRIA 4XNFA 1XN7A 3A03A 4EV0A 2V6CA 1XPXA 2VJ5A 3ZQHA 1T33A 3LSIA 3OYKA 2MSYA 4IHYA 3BR0A 4RS8A 5FKNA 3VYTB 5DUIA 2R7VA 3ZN1A 3BP8A 4L9TA 3ZMVA 3PUBA 3PIOF 4R8HA 5E20A 4IO9F 3F6VA 4IQ4A 3HKZA 3H3ZA 4AVPA 4NB5A 1G3TA 3GVAA 1NG7A 2XKPA 2V9KA 4LMYA 3LNQA 3QWLA 1U8RA 1HKTA 3DTKA 2DA4A 1PVEA 2DBBA 4F91B 1T6SA 2DXIA 4BH9A 5HLHA 3L09A 2BYVE 2LBFA 4C30A 2VKEA 1O3RA 1KONA 3IH2A 2R7QA 2HOSA 3BG7A 1ENHA 4BUPA 4LLNA 2CSOA 3OR1C 1DU6A 3ERED 3BPXA 5IY5H 2DO7A 2AXLA 4D1QA 1O3TA 2HZTA 1ZARA 1P7IA 2HKOA 1P7JA 1LDKB 3PJRA 3D5SC 2FSWA 3V7CA 2O5RA 3CF5F 5B1AH 3LFUA 4ESJA 2L01A 2LNBA 2P5LC 2IS2A 1SFXA 1SVOA 1U2WA 2Y75A 1PYVA 4BBRJ 4LD5A 2DT5A 3I71A 1V3FA 2BVMA 5B66C 2DMTA 2VQGA 1ON2A 2ACJA 1VQ4I 1VQ5I 3MZHA 4BHBA 3F6OA 3QYFA 1ZHFA 1FTTA 4YEJA 6PAXA 3ZQFA 4JYKA 1T0FA 2JPBA 5ILSA 1DPRA 1P6RA 4EJOA 1T2KA 3KP4A 5D8LB 2Z9OA 4H0EA 3GFJA 3S1RJ 3K69A 4M72A 2DMQA 1ZQ3P 3FBIB 4HX4A 3IAM2 3DLAA 1IXRC 3OYDA 1IDYA 2CH0A 2N8GA 2LBFB 2I10A 3OSFA 2IGKA 4EJTA 1I6XA 2R7OA 3F8BA 3OSGA 3RPUD 3OYIA 1DP7P 1QU3A 3LMMA 2CQNA 3SZTA 5D6EA 2CYYA 2V1XA 3RQIA 3K4JA 2QA4I 2VASA 2EIMH 2OUMA 4BS9A 4ZYGA 1VQOI 4XKWA 1K6YA 5DEQA 2EZIA 2BY1A 2WY7Q 2OF7A 5EEAA 3A01B 2GOXB 4H4KC 2OJED 2WB1A 2X6OA 3GF2A 1IO2A 4HYEA 1U5TA 2OD5A 4NQWA 3FF5A 1W5SA 1BR4A 2KMUA 2MBFA 2X4HA 3CCEI 1FX7A 3HEFA 3LSPA 1UB9A 2F5VA 2M0CA 4V2GA 1YJWI 4LB6B 2LY1A 3GEZA 5JR3A 3MN2A 2Y0SN 3HOWJ 2EV6A 1ZGAA 1YFHA 4EATA 1GLNA 4ZC3A 5LHGA 2LTPA 1T56A 5HLIA 4OIOF 2DK5A 1ETKA 2CWEA 2ZJPF 3PO3J 4XLAA 4IJAA 3J81K 2VKHA 1IV8A 5GAHJ 1ZR4A 1ZGJA 4L5JA 2CW0F 3OYGA 1R5GA 3HGYA 5DCMA 2XKOA 1P4XA 2X85A 5KK1A 5L3CA 2Y30A 3OY9A 2PFBA 4BXXJ 2LR8A 2X1DA 2MH9A 3ZXSA 4BE1A 1X58A 1E3HA 4PZJA 2KDZA 1QGPA 4BEHA 3PSFA 3U1KA 1SMTA 1QA6A 2BBYA 2JA7J 1A6QA 2ZSHB 1UMQA 3K70D 4ENKA 3SZPA 3RTRA 1BW5A 5FLVA 3M9AA 3MFKA 2XAQA 2HOAA 2E2HJ 1WJBA 3H9JA 2A61A 2VLAA 5HLGA 1BIBA 2XSDC 4KYWA 1FNNA 3G2BA 2VE9A 1T38A 1U5TB 2BZTA 3K2AA 2R7TA 3ESWB 4NQWB 3RPQA 3H5NA 4D0PA 2CV0A 4UUSA 4QPOA 4CCJA 1YX3A 2CQ7A 1GVDA 4HZFA 2EINH 3CMYA 4MIMA 3H9GA 2CQQA 2UV1A 4EEFG 4XIDA 3GLLA 4ENMA 3E1SA 4HV6A 2VJ4A 1OCRH 3W6KB 2XGCA 2EFNA 4A3DJ 4YFKF 4M3GA 3JTHA 3WGGA 3JAMZ 2O61A 4HLYA 3CF2A 1G8XA 2VPLA 2MC4A 2K4JA 4LFUA 4WWCA 4XONA 1KQ9A 1WJEA 2EZLA 5H6RA 5DCMB 4AD9A 4ZTJA 2H09A 4HX7A 2D1HA 3PQKA 2EA4A 5JFRA 3EUHC 1SD5A 1IG7A 2O8KA 2V9PA 5DD8A 4LG0A 1WSUA 2ZMEA 4BEHB 2FQ4A 3OIPA 2NOGA 2XASA 1VFCA 3VWBA 2XUBA 2L3DA 1Z77A 3BZCA 2KFDA 4KMUX 3SDBA 2NVQJ 2Y0SA 4CUGA 4MQ9F 2NYXA 4ENNA 3OOUA 3HHHA 1U6GA 3EYIA 2Y48A 3BC8A 2W57A 1B6AA 1GUUA 2EZHA 3T8TA 2MA3A 2Q1ZB 3JR9A 1F36A 4CCLA 1QZEA 1WJCA 2QF7A 3S2DJ 3FK7A 1Z6TA 2CG4A 1IRXA 4XM3A 2YU9J 4XRMA 1SFOJ 2R93J 4I0AA 1PUFB 3G4SI 1H89C 1ZREA 2HYFA 3MMYB 4UUSB 2KHMA 4KJZA 3TP0A 3QPLA 3R60A 4XLFA 2MD0A 3BR3A 4Y15A 4A3EJ 1LDJA 2BHZA 5ILUA 4HW0A 1XGSA 1RC9A 2P7VB 4XORA 1VQ9I 2D2WA 5A2QK 2H94A 3F72A 2EA2A 2V1DA 5DUKA 2VJIA 4KIFA 1HQCA 2KIFA 3BCBA 3LSKA 1KU7A 3UNGC 4CDGA 4J19A 1YRNB 2J5PA 3COAC 2O3FA 1QPMA 3JRCA 3L1PA 4BE0A 4G9YA 1USTA 1E3OC 3FXMA 1QZZA 2HVSA 2FOWA 1XSXA 1WJFA 2XIGA 3LSRA 4LG0B 4CCKA 2ZMEB 3QPSA 1Z67A 3G1MA 1RETA 1QNTA 3TO9A 1JKRC 2LH9A 1HW5A 2H8WA 3BTLA 1IGNA 2ZKZA 1RI7A 4HSTA 2NVYJ 2R7FA 1SFEA 2FF4A 2EPFA 1Y1VJ 1Z7LA 3U21A 5F1JA 4EJUA 2XSJC 1NG6A 2L02A 3FM3A 3VSKA 2UWMA 3S16J 3H5RA 1D3YA 2COMA 4I2OA 2A07F 5E3OA 1PP7U 3JREA 4QLCU 5EEHA 2M7AA 1E0EA 2K9LA 5J4VA 5L3BA 4NC8A 3TGNA 2OCCH 1TTYA 3Q3SA 1Z0XA 1K4SA 2EWNA 3B6AA 1U0JA 2ME6A 1JKOC 5FKKA 1XD7A 2HS5A 1YOVB 2GZWA 1YJ9I 4CICA 2P4WA 2B9SA 3J80Z 3I55I 1REPC 3DLLF 4JX6A 2L7KA 2DT7B 1U9NA 3A0BC 3MZYA 1RUNA 2CW7A 3KLOA 3LWFA 2JQ7A 1I27A 2YUSA 1RESA 5J40A 1WJ5A 4OAZA 1MBKA 4O3MA 1EH7A 1Z1DA 2WV1A 1SANA 4U0YA 1QZYA 4P9FA 3HOZJ 4LG3A 2MGQA 3RCOA 1IUFA 5IP7J 3J7AY 2M1BA 4IOCF 1OCPA 3GUDA 5E1WA 2BXZA 1NHAA 2Y9ZA 1MH4A 2XPVA 2ZSIB 3MKZA 3CMEI 3ZMSA 3CQZJ 1AHDP 5JI6A 3GFIA 1AWCA 1BOBA 4HF0A 4F52A 3T8RA 1LFUP 4JP0A 1IXSB 3OWTA 2NRAC 3K4MA 3ECHA 3HRSA 1JUMA 1BL0A 4ZDPA 4IHWA 2XB5A 2V4JC 4B47A 3E7LA 1I3AA 2MD5A 1TZLA 2CUJA 3LFKA 2GIZA 4LITA 1ETOA 2VUMJ 5M5WJ 2HKXA 3VSLA 2AQFA 1J75A 2MG4A 4C2TA 3HRTA 3K10A 4E7LA 1QO0D 2LKPA 4IKFA 4K2EA 1HDPA 2PEXA 4PK4A 3GBGA 5FJ8J 1W0TA 5E8IA 1U9OA 2P7CB 4L9JA 1EKEA 2FE3A 4RB1A 2CFXA 3TOBA 2KIUA 2X9DA 2XF6A 4RB3C 1J09A 4M3EA 1LKXA 1XGMA 1O57A 4EQQA 2EZKA 2GIVA 1TL8A 3ROUA 1MMAA 1KA8A 4HEA2 3H92A 4A0XA 2QSHX 4ZH4F 1MBGA 2TCTA 3CESA 1SFUA 4PFPA 3VB2A 4PSWA 1X1PA 4PSXA 3RKYA 1IN4A 3W6VA 3CZ6A 2VXZA 1D1CA 3WTXC 3HSEA 4OMZA 2NS0A 1MJBA 1HCRA 3HRUA 4Y17A 2PMUA 2W85A 1W7PD 3BJAA 4BKXA 1PJRA 1EJ9A 3KYCB 3PNVA 5D5UB 4OIPF 1JHFA 2WY8Q 1YW8A 2IJLA 3DKYA 2M30A 2G0EA 3HJEA 3FXOA 1K78A 1MMDA 2H1KA 4L9NA 1MBFA 2QWWA 1I6HJ 4FCYA 3K9TA 4S0HB 3GTQJ 2XGEA 2FU4A 2B0LA 1XGNA 4M6VA 2L7MP 2PMZN 4HV5A 1T8IA 4PDKA 3S15J 2DFIA 2QBYA 5DCFA 4B43A 1UJ8A 4CZZA 4IX7A 2V79A 3L7WA 1T08B 1H9TA 3WTZA 2IS6A 5DD4A 1YIOA 4DNCA 2HGCA 1D0XA 1A5JA 3KEQA 2UXNA 3GCMA 4JK1X 1JKQC 4CCMA 1VI0A 3W2WA 3F8FA 3NARA 3WGHA 2JJ7A 1OJLA 2R7RA 2E35A 2GLOA 4AIJA 1F4KA 4G6DA 3B6CA 5D4RA 2CW8A 2YSRA 3KZZA 3RZDJ 2BGCA 3WE3A 4L18B 4KIGA 5CVJA 3KFWX 4FISA 1D8KA 5E3NA 3I4NJ 3IP4B 4B48A 2DA7A 4A3IJ 2KZGA 4IRHA 4RAFA 1O4XA 1D1AA 1NK2P 4CGZA 4DBQA 2OPTA 2IGMA 1L0OC 2GXGA 2OA4A 1QHHD 4BQNA 1IN8A 4HQEA 2L7FP 4II2A 4MTDA 2X6YA 1SC7A 2R7XA 3EPZA 3ONQA 5LRRA 3B02A 2IAIA 2XDVA 1KQ8A 2D5VA 4E7JA 3WG7H 2PG4A 3DBRB 1EF4A 2L4MA 3RIRA 1FLIA 2O7OA 3RDIA 1MBEA 2ZNYA 2EB7A 3SZGA 4EVIA 1FIPA 3DQVC 3MKWB 2JVHA 2K5CA 2F4OB 2DOAA 4UV9A 1OCTC 2E60A 2CV2A 2BEOA 2FEZA 3C18A 1TWAJ 3LA2A 3IUOA 1JHHA 4N9HA 4LIVA 4OINF 3BOQA 1U3EM 3QPHA 3GTGJ 2GAUA 1C0WA 5IPAA 4HX8A 2HYJA 3FXLA 1FY7A 2KJBA 3GTMJ 1A36A 3QYEA 3H0DA 3SJMA 4M9SA 2RC4A 2Q2EB 2KT0A 3F8CA 1HW2A 2R5ZA 1FOXA 3K4LA 3I5UA 2YR2A 3WU2C 2MW8A 1ERDA 2R7DA 4XICA 3AKZA 2ESHA 2FMLA 3WTWC 5FB2A 2VBWA 3HYIA 2HR3A 2M34A 4JX5A 3CP2A 3GTOJ 2AS5F 1AA7A 1J9IA 1X1CA 2GBYA 1KU9A 5FO5A 3NEUA 5LD2C 3HGGA 1XDUA 4IHSA 3CCUI 3GFLA 3KE2A 2BXYA 2IGOA 4FQGA 4A0YA 2JA5J 2IA2A 1YW9A 3WTVC 3MKYB 1LJ9A 1HW1A 4C9YA 2E1CA 1G3WA 2KLOA 5M3FJ 3TO7A 3A0HC 1Z7UA 2NNYA 3FXKA 1EV7A 2CJJA 3RJPA 1P9QC 1R7JA 2K27A 2WAEA 1S5LC 3RZOJ 2KQRA 2QEXI 4BQAA 2MABA 3F21A 1Z3XA 2LFBA 2VJJA 3V7SA 4O6JA 2X0LA 4U88A 3C2HA 2DPDA 1HLVA 2E5ZA 3E5UA 3S1NJ 2YS9A 2H8RA 1S3JA 1HSJA 2EILH 2R5ZB 4BJ6C 5EJCA 1BR2A 2DT6A 5AONA 1S72I 4FX4A 4Z6YA 1RKTA 3ELKA 2Z33A 3ZRGA 4Q47A 4BJTA 1GHCA 3K4KA 4RB2C 4R1HA 2VQHA 1K61A 2A6EF 3F22A 3TDZC 3RKWA 4ESFA 3LQQA 4YIIA 2FJ1A 3K4NA 2JK3A 2RV8A 5HDGA 1R36A 1DDNA 5CVVA 2GA1A 2EFPA 5M5XJ 3DKWA 2DI3A 4D7MA 3Q0UA 4A3FJ 3RYPA 3CO7C 4A93J 4X6AJ 3HOTA 4BY1J 3PQJA 2RQPA 4JQFA 5B5EC 3L2QA 4FHTA 4RLFA 2FQ3A 1IAWA 5HOOA 1TT5B 5H2FC 1DGWY 1V5GA 2KPMA 3ASOH 3FM5A 3ERMA 1YLFA 2VC1A 2MC3A 3C2GA 4CSWA 2DN0A 3K70C 1R9TJ 4B3AA 1R5HA 1MJAA 1CF7B 3TBIA 3I4PA 3WGIA 1KQ0A 3V8JA 2A05A 4MHGA 4AC0A 4UXNA 3KPHA 4HDUA 1S29A 1HSTA 2MLKA 2ZO4A 2LKSA 5E1XA 1LVKA 1D0YA 2VKVA 3BG9A 2LF7A 2ZFUA 3DU5A 3BY6A 1I39A 4W97A 1ORKA 2ECCA 3CUQC 1K6OA 4I98B 2BV6A 3J81Z 4W1UA 3SFZA 1UHMA 4HQMA 1UG0A 2DA1A 5H6QA 5EZGA 3ZMZA 3RQ4A 2WTEA 5AIQA 5EGOA 3GTLJ 5FFZA 2DYRH 5ED4A 1NK3P 4HNTA 1Z6RA 4XMYA 3E5XA 1VQNI 3ULQB 3IV5A 1IXCA 5K5OA 1FOYA 4QTRA 2QQ8A 4Y33A 2JRMA 4M6YA 1I1GA 4UHTA 1HF0A 4E4HA 3JSOA 1OMIA 4NBQA 3BPVA 3TL4X 4BE2A 5IT9K 2Y0MA 3HUGA 3GTPJ 5E17F 4N0BA 2FBHA 3AG3H 1E2XA 3N4MA 2L4AA 3I58A 2A69F 2KRHA 4E7IA 3U2RA 5GAEJ 3WG9A 2M0MA 3WTSC 3BJ6A 3FMRA 2ETHA 4CCNA 1B8IA 1BI2A 4A3CJ 1QVUA 4KN4X 2VT3A 3KIOA 4S05A 2XAHA 3WE2A 1OFCX 3LSTA 5L3DA 2JUGA 4DW6A 3J7YJ 2AXTC 2DK8A 3GFMA 3FKIJ 4UVBA 2UZKA 1LPQA 2XF5A 3MAJA 3A02A 2I5UA 1CQTA 2DDAA 4Q48A 2LY2A 5FFXA 3I9V2 3HTUA 3CDHA 3E6DA 4L5EA 1LUJB 3IHUA 4E70A 4WXDA 1MZBA 1CGPA 1OYIA 3FMQA 2NS8A 4P5OA 1IV6A 3RYRA 2DTZA 4ITVA 4E6KG 2Y2ZA 4PJ0C 4AIDA 3OR2C 1ZH5A 4Y7NJ 4AYBN 4PCQA 1S8NA 2PBIA 5F27A 5CQGA 1LB2A 2FNAA 3FXUA 4I01A 2LOOA 2LP0A 2JWTA 1YI2I 3LOCA 4UVCA 2HDDA 2FXAA 4C3HJ 1AKHA 1X1AA 4KN7X 5M3MJ 4EJWA 2A6HF 2M87A 5GTHC 3L2CA 4J01A 5GAGJ 3OYLA 1T39A 3HUGB 4G7ZF 2Q8KA 3V8LA 3OYMA 4CZCA 5E1ZB 1E3PA 4GDFA 5EG0A 4IQJA 2D45A 4LB5A 4RM3A 2XPWA 1EH8A 2VBYA 3JW4A 2ZNZA 2CUZA 3ZPLA 1FP1D 1FTZA 1A31A 2IBDA 4NC6A 1MMSA 5TJJA 2ID3A 4S04A 5TGTA 5JLWA 4DIQA 3GYHX 1JT6A 3ASNH 5J1RA 5ERIA 3K4CA 3KEYA 4MO7A 2L5QA 5A2QZ 1XCVA 2P5VA 3N97A 1YTYA 2VC0A 3E0JB 4MTEA 3S3NA 2DW4A 1QRYA 5KAIC 2HPIA 3IAS2 2LF8A 1NTCA 2EK5A 1F43A 5TRDA 2L2OA 4A6DA 3TMOA 3ZMTA 3LQRA 3TKYA 2K9QA 1B72A 1ETWA 1Z05A 4CYCA 3KZYA 5J1YA 5FLMJ 2KDOA 1T95A 3NAUA 5CPRB 3ZQ7A 1ZTRA 2KKOA 1L3LA 1X1BA 4HSRA 4ZDOA 2K85A 3Q5FA 1JE8A 1AKHB 1LEBA 1P92A 3DP7A 4QSHA 4F7ZA 3HOVJ 3SHFA 3M4OJ 3V7RA 1SEUA 4XLEA 3KYDB 2JPCA 1J2XA 3Q9VA 3HPHA 3DCFA 5EG0B 4XLCA 1UAAA 4PJNA 3A2KA 2BE5F 1BI0A 4IVNA 3D1NI 3K7AJ 4Y52J 1Y39A 2Y9YA 1N75A 2G7UA 3K0LA 2XGXA 2RREA 3E5QA 1LFBA 4KA4A 1MSFC 1FC3A 5C3EJ 4HBLA 4RB0A 3CTAA 3UKGA 1FPQA 1RRJA 3CCLI 4ZYAA 4BQOA 3CUOA 3CC2I 1X3ZB 4GYIA 4YFNF 2O9LA 4JOMA 3IWFA 3BWGA 1BI1A 4ON0A 2RN7A 4G7OF 1A6IA 1DU0A 3VOEA 2KZVA 2VKDA 5KCMA 2HEOA 2VQCA 1VQ7I 5FKMA 3OYHA 1Y8RB 4UNOA 1TQPA 4MLOA 4NUBA 3FDYA 1J0RA 4BJ5C 5BOXA 1S6LA 1B72B 4CYCB 1VQLI 2M2EA 3P9CA 1T0FC 1H0MA 1YS7A 4N9IA 4A2UA 5FLXK 5CVRA 4N4NB 4PJMA 3FK6A 5JHFA 4O5VA 1FYMA 3DEWA 1VQ8I 3OL3A 1Y6IA 3K4BA 1JXSA 1O7FA 3QODA 1X2NA 1DQUA 4OAYA 5JHUA 2IP2A 3OYCA 3ML6A 3O8GA 4I0BA 2VBXA 3I3LA 2EBIA 4RGXA 4PGHA 3CDIA 2ZJRF 1AU7A 1WCMJ 3CJNA 3OS0A 2DFFA 5LGUA 1IDZA 1ZRFA 3PM1A 4G6QA 2HXOA 3CMAI 4DZPA 4ZZDA 1KU2A 3OMYA 2K3FA 4M9XA 1YE9A 2DAOA 3D5RC 3M7GA 2X1CA 1U5TC 4XRFA 1ZLJA 5LLQA 5J8CA 3SQNA 1YITI 4ETSA 2DFHA 5F08A 5BPDA 5CVUA 3W3CA 4DQ2A 1OQYA 3BQYA 3DV8A 3OYBA 3D0SA 1Z21A 2OZUA 2Z2SB 3T1BA 2JRTA 3D5LA 3IKVA 3JRAA 2LYCA 3JCUC 2A68F 4HPQA 1MNEA 5IOYA 3DTEA 2BY3A 4IPAA 4G94A 4RGSA 4OU0A 5BS6A 2L9VA 3O3KA 1WFXA 1A35A 1Y0UA 2RAEA 2VODA 1WJAA 2FNPA 2D1VA 1XMKA 2F6CA 3F8NA 5HS7A 2A6TA 3WTYC 2HDWA 3FMSA 3QP5A 1XSDA 1IW7F 1FOKA 2K4BA 1RR8C 4LLLA 3MKLA 1JTYA 4E7KA 3CP8A 1JJ8C 2LVSA 4I99C 2X48A 5KNLA 2PLYA 2ZXWH 3JRBA 3L00A 5CJ9A 3L2WA 2CFOA 1PUEE 1TBXA 2PQ8A 3M8FA 2WAFA 4BHCA 5BMZA 4RM2A 3O2PE 5F64A 2VOPA 2CQKA 3CDLA 4M6XA 2RNJA 2E34A 4OIQF 1ITYA 3R0AA 3H5AA 2FBIA 2LLKA 2E2JJ 3K1MA 5LBQA 3HHGA 2K40A 1IN6A 1ETVA 4V2FA 2XAJA 1OKRA 4GO1A 4BYYA 2L9SA 2YPRA 5EYRA 4ASNA 3WTTC 3W2AA 5J6XA 1X2MA 4KITB 4GFBA 2R7ZJ 1SAUA 4RAZA 1ZGWA 1K79A 1BW6A 5F0HA 2PI0A 3S17J 5C4XJ 3MZ8A 1WHUA 5HS9A 2XAFA 1TT0A 2A3SA 2JTVA 2ELHA 1A04A 4CCOA 3BG5A 4MNUA 3DPLC 3P9IA 1O3QA 3KLNA 3FX3A 2XAUA 4X0GA 5KHDA 4NHJA 1VQ6I 4OMYA 4Z2YA 5FROA 2IT0A 1HKSA 3QYBA 3TW7A 1KYWA 4U7BA 1X3WB 2WAQN 1WZ2A 2DMPA 2ICWG 2ZMEC 2F4IA 3ZGKA 4GXOA 4L5IA 2EIJH 4XKVA 1GV2A 3W2VA 3HIFA 2DJNA 2IVMA 2V1UA 2HI3A 4PJJA 4LJZF 3OS1A 2M7BA 5F04A 2FRHA 3LSGA 1S9HA 4RBOA 3ZR8X 4FX0A 1WGXA 3CCSI 3RPUA 5FD5A 2CUEA 3GTJJ 2FA5A 1OR7C 3DF8A 3ISPA 3HOSA 1MMGA 3TQNA 3ZN0A 3CCMI 4KDPA 1T98A 3E6BA 3E3VA 4B1RA 3CJTB 4IHXA 4BY7J 3IWZA 2E71A 1W1WE 5EEGA 3AG4H 2R0QC 4KT6A 4BAYA 3TEDA 5CVIA 2LC2A 3M8EA 4ABZA 2M8EA 4UUVA 4A3MJ 1D5YA 2XV4S 4BNCA 2W1OA 2DA2A 3BCAA 1F1ZA 2DLLA 4MGRA 1WH7A 1OLTA 3QOEA 4XOPA 3KETA 2LREA 2DJIA 2P6SA 5DS9A 3C1DA 3JRHA 3IH3A 2P81A 3QRFF 3BROA 1YX5A 5IYCJ 3L2UA 2Q0OA 1RR7A 2HFHA 2QQBA 3CJQB 2LMDA 4D5CA 2P6TA 3BZ6A 3Q0WA 2QUFA 1V5FA 3CCRI 2HQ5A 2FMYA 1ETXA 1QVTA 1QHGA 4BDYA 2YU3A 2ID6A 4FASD 3G1LA 2BVLA 4MEYF 2OTJI 2ZJ2A 4XK4A 3BTIA 1G2HA 3NWTA 2BHYA 2BY2A 2L9RA 1JGSA 3H0GJ 5C4JJ 2H1LA 3BZKA 3DU6A 3EUKL 2HQRA 1S7OA 4U87A 4OIRF 2RKHA 5LEKA 1MNMC 1UZCA 1V4RA 1TW3A 1JGGA 1FOWA 3ZMUA 2HVRA 4C2MJ 2E7XA 2Z99A 2HDCA 2DU9A 4E7ZA 1J5YA 2ADUA 3S3OA 1BIAA 5FKLA 3PIPF 1LNWA 1OCZH 2GQQA 2LK2A 1X3UA 3NWSA 4HA8A 3H3UA 1IRZA 4M3FA 1GT0C 5FRMA 3U1DA 4B8XA 1K78B 1G3SA 3BG3A 4I09A 5H20A 2ZXJA 2F5CA 3QP6A 4RDUA 5F1RA 2W4SA 1MDMA 2VONA 2HZDA 2M4KA 4IOAF 2DOEA 2KIQA 1R22A 2HVQA 5GP9A 2G7HA 4MEXF 3ZQCA 3DPUA 2NS7A 1JT0A 1WPKA 3H3VK 2XROA 4AU7A 2QBYB 2ISYA 2QENA 2HYGD 2FD5A 4QPQA 2JA2A 3IC7A 4A5MA 1J7KA 3GX4X 4DYRA 4EGYA 1FBSA 2CUFA 2GWRA 2STWA 2QKMB 1STZA 1WI3A 2Z3YA 3CLOA 1N78A 5ILVA 1ONVA 1D8JA 3KX2A 5C44J 3J7AO 4NDLA 4R79A 2CU7A 2JA8J 2EV5A 2RVCA 1WJDA 3OIQA 5F6FA 5J8FA 3CO6C 2DQRA 2A5WA 4AWXB 4Y4RA 3SFIA 1B59A 1B1BA 2YX7A 3WHBA 1K7AA 2PMZA 3ZQQA
chains in the Genus database with same CATH topology
4UV8A 2HTJA 3IKTA 3AAFA 4WK8F 4ZZLA 1BI3A 5E8GA 2OU2A 4BHPA 1KGSA 3F8MA 5D6FA 4RGRA 1XGOA 2F5EA 2XAGA 1F5TA 1R1VA 2QYOA 3BJOA 1MDMB 2L54A 1OYYA 1UCRA 3PFIA 4IHTA 2JSCA 3I59A 1B9NA 3GZ6A 1BM9A 1IUYA 1KU3A 3HRMA 3KP7A 3GLXA 3P7NA 4ENJA 4CHUA 1R00A 4JBAA 3U9GA 1XMAA 2W24A 3ECOA 4CXFA 4M71A 1R23A 1E17A 1O7LA 5DV5A 4EM2A 1SMYF 2HOEA 3ZP5A 2OZ6A 5ICFA 1DPUA 4G7HF 5JVTA 1IF1A 5IT9Z 2O0YA 1OPCA 4CO8A 1LDDA 1YS6A 4FT8A 2OBPA 2XVCA 3GXOA 1G6NA 4IRGA 4EJVA 3IRQA 2DQLA 3TDUC 3I59B 1IRFA 4L0YB 3QU3A 3KP3A 2K02A 2RGVA 3DFGA 4RAYA 4ESBA 5FGMA 3LAPA 1W4MA 4M74A 2H27A 4Q5SF 3EETA 2QQAA 3GO5A 3EUHA 2OQGA 2PJPA 3FXQA 2GXBA 1FWZA 5HDKA 1XDSA 3R61A 3EQLF 1QBJA 1ZG1A 1ZG3A 3R4KA 2WWYA 4LGWA 4LK0F 4P9UA 3G73A 2P5KA 3OV8A 1RNLA 2EV0A 1PDNC 2O03A 4KNYA 5LGNA 1BC8C 3HSRA 5D8KB 4XLNF 4GGGA 4ZYDA 1ODDA 3RI4A 3I64A 4LK1F 3EDPA 5K5QA 1BC7C 2O8XA 2VOOA 1ZLKA 2VE8A 3IRRA 3FHZA 1SD7A 2NNNA 2HWVA 4IF4A 1LQ1A 1ON1A 2P8TA 1GXQA 3R6SA 1IZ1A 4KMFA 2JT1A 1YG2A 1Q1HA 3JSPA 3GZ5A 4YG2F 3SXYA 5BPIA 3F3XA 1W7PA 1S7AA 2VBZA 5CYVA 1UHWA 5DDGA 4WXHA 4QWQA 3WODF 2VT2A 1D5VA 4ZYHA 1YW7A 3QPTA 2H6BA 2J5OA 5D5WB 1IN5A 5L3GA 2DPUA 1MJ9A 5CLSA 3F23A 1AOYA 2K7LA 4I02A 1WI9A 3V8KA 1G4DA 2ZFWA 4LLGF 1FYKA 5FLXZ 3TO6A 1R1UA 1YO5C 1I5ZA 1TQIA 1R58A 4AIKA 1W7PB 1Z9CA 1RUOA 4KUMA 3WU1B 1W5TA 1Z91A 3JTGA 1FSEA 3MEXA 2TDXA 4P55A 2UXXA 2F5DA 1KYZA 1XB4A 4WX9A 3MQ0A 1RZ4A 4M9ZA 1WWXA 2F5FA 4EMSA 3K1PA 5LHIA 1P2FA 1FP2A 5IT3A 3HSFA 5L3EA 2F2EA 5K5RA 1ZRDA 2JZYA 1HKQA 2XHKA 2EFQA 1USSA 2OQRA 2K86A 3MCZA 4KT5C 1XCBA 1ZYRF 5ICCA 4WCGA 1IRGA 1HBXG 3E6CC 3EYYA 3BDDA 2VN2A 4Y13A 4KICA 2ESNA 4TV7A 5L3FA 1OR7A 2WC2A 4GCVA 4XBFA 3W6JB 4OOIA 3QU6A 3MWMA 5K1YA 3WTUC 1B4AA 2Z5UA 4EM1A 5LEJA 5E18F 2IA1A 3GWZA 1P4WA 3I0TA 3Q9SA 5D5VB 1VTNC 1ZN2A 4A0ZA 1WKMA 1PP8F 2XRNA 2RDPA 3E97A 3FXRA 1UFMA 2A5YB 3V4GA 1FYLA 2E1NA 2C6YA 3JAMK 4XLPF 1MD0A 3E6MA 2IRFG 1QQIA 4U0WA 1SD6A 4U0VA 1LVAA 1WQ2A 5HDNA 1FZPB 2IPQX 1TQMA 4KFCA 3DEUA 3WU0A 3REOA 3VODA 1FSHA 1GXPA 5BQTA 4HAMA 4A6EA 2ISZA 1BJAA 3P9KA 4YFXF 4HOBA 2CO5A 5HVQC 3FWEA 2PMHA 3I53A 4BXUA 2EFOA 3GW2A 1OYWA 2MLGA 1IN7A 4RGUA 2EJRA 4L0ZB 4HF1A 4XSZF 3LAJA 2W84A 3KP6A 3KEOA 3RKXA 1BOAA 4HLXA 3L9FA 3OOPA 2W25A 1ZAOA 1WRJA 3KP5A 2GA2A 3C7JA 2QM3A 2M5WA 1U78A 3C3WA 4WF2A 4WXCA 4I7HA 3ABTA 2LDUA 4B09A 1GVJA 3J80K 2EFWA 1HXDA 3QAHA 2NAZA 3DXJF 2M45A 1TLHB 3ABUA 3T5XA 2E7WA 2LSOA 5LHHA 4HDVA 2G9WA 2DTRA 2IA0A 5D4SA 4IXAA 3T0YA 1YQAA 1P4AA 2KRFA 2ZCWA 1DUXC 2FBKA 3G3ZA 3VEPA 2MH2A 1FBUA 1G3YA 3QOPA 4GYGA 2ZBKA 5DYMA 5HS8A 5KVRA 3IL2A 1F9NA 3K2ZA 1MGTA 3B73A 3FZVA 5ICEA 5LRSA 1MKMA 2Q2EA 4A5NA 3TOAA 2FOKA 1J59A 5ICGA 1R1TA 3CUQA 4AIHA 1LEAA 4Q4ZF 2WV0A 3DPTA 3LA7A 4A12A 4U7DA 4L9VA 5LGTA 1SAXA 4PGGA 1BN5A 1I1SA 2QQ9A 3VFZA 4MQVA 3KP2A 5D5XB 2OAZA 3KCCA 1TW2A 3O6BB 2V9VA 1ULYA 1FBQA 1XSVA 2KIMA 4P96A 3M1EA 3HTSB 1TNSA 2CGPA 3NQOA 4CYDA 4KIBA 2YX4A 1TNTA 2STTA 4XSXF 4ZYEA 2KJCA 4M73A 3CUQB 1SD4A 3R0JA 3S2WA 2R3SA 2QLZA 3I54A 2IW5A 3LA3A 1YYVA 3NRVA 1FT9A 2HQNA 1O3SA 4HF2A 1EH6A 1ZG5A 3ZMDA 2PN6A 4YIFA 1H9GA 4UVAA 2HTSA 1B9MA 2QZ8A 4EGZA 2H6CA 1CF7A 5FD6A 1BBYA 2QVOA 1ZRCA 2O6GE 4EM0B 4IRIA 4G8XA 3K1NA 1RIOH 5AIPA 1XN7A 4EV0A 2V6CA 4RS8A 5DUIA 3ZN1A 3BP8A 4L9TA 3ZMVA 4R8HA 5E20A 3F6VA 3H3ZA 4AVPA 4NB5A 1G3TA 3GVAA 2XKPA 4LMYA 1U8RA 1HKTA 2DBBA 1T6SA 4BH9A 5HLHA 3L09A 2BYVE 1O3RA 4LLNA 2CSOA 3ERED 3BPXA 2DO7A 2AXLA 1O3TA 2HZTA 1ZARA 2HKOA 1LDKB 2FSWA 3V7CA 4ESJA 2L01A 2LNBA 2P5LC 1SFXA 1U2WA 2Y75A 4LD5A 2DT5A 3I71A 1V3FA 2ACJA 1ON2A 3MZHA 4BHBA 3F6OA 1ZHFA 6PAXA 1T0FA 2JPBA 5ILSA 1DPRA 1P6RA 4EJOA 1T2KA 3KP4A 5D8LB 2Z9OA 4H0EA 3GFJA 3K69A 4M72A 4HX4A 1IXRC 4EJTA 1I6XA 3F8BA 1DP7P 3SZTA 5D6EA 2CYYA 2V1XA 4ZYGA 5DEQA 4HYEA 3GF2A 1U5TA 2OD5A 4NQWA 3FF5A 1W5SA 2MBFA 2X4HA 1FX7A 1UB9A 4LB6B 3GEZA 5JR3A 2EV6A 1ZGAA 1YFHA 5LHGA 5HLIA 4OIOF 2DK5A 2CWEA 4IJAA 3J81K 1ZGJA 4L5JA 2CW0F 1R5GA 5DCMA 5KK1A 1P4XA 2XKOA 5L3CA 2PFBA 2MH9A 4PZJA 1QGPA 1SMTA 2BBYA 4ENKA 3SZPA 3RTRA 3M9AA 3MFKA 2XAQA 2A61A 5HLGA 1BIBA 4KYWA 1FNNA 2VE9A 1T38A 1U5TB 3RPQA 4D0PA 4HZFA 4ENMA 4HV6A 3W6KB 2EFNA 4YFKF 3JTHA 3WGGA 3JAMZ 2O61A 4HLYA 4LFUA 2K4JA 4WWCA 1KQ9A 5H6RA 5DCMB 4AD9A 2H09A 4HX7A 2D1HA 3PQKA 2EA4A 5JFRA 1SD5A 5DD8A 4LG0A 1WSUA 2ZMEA 2XASA 2XUBA 2L3DA 4KMUX 4MQ9F 2NYXA 4ENNA 3HHHA 1U6GA 3EYIA 2Y48A 2W57A 1B6AA 3T8TA 2MA3A 1Z6TA 2CG4A 4I0AA 1ZREA 2HYFA 3R60A 4Y15A 1LDJA 5ILUA 4HW0A 1XGSA 2P7VB 2D2WA 5A2QK 2H94A 3F72A 2EA2A 2V1DA 5DUKA 4KIFA 1HQCA 2KIFA 1KU7A 4CDGA 2J5PA 3COAC 2O3FA 1QPMA 4G9YA 1USTA 1QZZA 1XSXA 2XIGA 4LG0B 2ZMEB 1QNTA 3TO9A 1HW5A 2ZKZA 1RI7A 2R7FA 1SFEA 2FF4A 4EJUA 2L02A 3FM3A 2UWMA 1D3YA 2COMA 4I2OA 2A07F 1PP7U 4QLCU 5EEHA 5L3BA 3TGNA 1TTYA 2EWNA 1XD7A 2HS5A 2GZWA 4CICA 2P4WA 3J80Z 1REPC 3MZYA 1RUNA 3KLOA 3LWFA 1I27A 4O3MA 1EH7A 1Z1DA 4U0YA 1QZYA 4P9FA 2M1BA 3GUDA 5E1WA 1NHAA 3ZMSA 5JI6A 3GFIA 1AWCA 4HF0A 3T8RA 1IXSB 2NRAC 3ECHA 3HRSA 2MD5A 3LFKA 2HKXA 1J75A 3HRTA 1QO0D 2LKPA 4K2EA 2PEXA 5E8IA 2P7CB 4L9JA 2FE3A 4RB1A 2CFXA 3TOBA 2KIUA 4RB3C 1XGMA 1O57A 4EQQA 2GIVA 3ROUA 1KA8A 3H92A 4A0XA 4ZH4F 1SFUA 3VB2A 3RKYA 1IN4A 2VXZA 3WTXC 3HSEA 4OMZA 2NS0A 1MJBA 3HRUA 4Y17A 2PMUA 2W85A 1W7PD 3BJAA 5D5UB 4OIPF 1JHFA 1YW8A 2IJLA 2M30A 1K78A 4L9NA 2QWWA 3K9TA 2FU4A 2B0LA 1XGNA 4HV5A 4PDKA 2DFIA 2QBYA 5DCFA 4CZZA 2V79A 3L7WA 1H9TA 3WTZA 5DD4A 1YIOA 4DNCA 2HGCA 3KEQA 2UXNA 4JK1X 3F8FA 3WGHA 4AIJA 1F4KA 4G6DA 5D4RA 2YSRA 3KZZA 2BGCA 3WE3A 4L18B 4KIGA 5CVJA 3KFWX 1D8KA 4IRHA 4CGZA 1L0OC 2GXGA 2OA4A 1IN8A 4HQEA 4MTDA 5LRRA 3B02A 1KQ8A 2PG4A 2L4MA 3RIRA 1FLIA 3RDIA 2ZNYA 2EB7A 4EVIA 3DQVC 4UV9A 2BEOA 2FEZA 3C18A 3LA2A 1JHHA 4N9HA 4OINF 3BOQA 1U3EM 3QPHA 2GAUA 1C0WA 4HX8A 1FY7A 2KJBA 4M9SA 2RC4A 3F8CA 1HW2A 3I5UA 2YR2A 2R7DA 2ESHA 2FMLA 3WTWC 5FB2A 2VBWA 3HYIA 2HR3A 2AS5F 1J9IA 1KU9A 5FO5A 3NEUA 1XDUA 4IHSA 3GFLA 3KE2A 4A0YA 2IA2A 1YW9A 3WTVC 1LJ9A 1HW1A 2E1CA 1G3WA 3TO7A 1Z7UA 2NNYA 1EV7A 3RJPA 1R7JA 2K27A 4BQAA 3F21A 3V7SA 4O6JA 2X0LA 4U88A 2DPDA 3E5UA 1S3JA 1HSJA 5AONA 4FX4A 3ELKA 2Z33A 4Q47A 1GHCA 4RB2C 4R1HA 2A6EF 3F22A 3TDZC 3RKWA 4ESFA 3LQQA 4YIIA 2RV8A 5HDGA 1R36A 1DDNA 5CVVA 2GA1A 2EFPA 3DKWA 2DI3A 3RYPA 3CO7C 3HOTA 3PQJA 2RQPA 4JQFA 4FHTA 2FQ3A 1IAWA 5HOOA 3FM5A 1YLFA 2VC1A 2MC3A 1R5HA 1MJAA 1CF7B 3I4PA 3WGIA 1KQ0A 3V8JA 4MHGA 4UXNA 4HDUA 1S29A 1HSTA 2MLKA 2ZO4A 5E1XA 2LF7A 3BY6A 3CUQC 1K6OA 4I98B 2BV6A 3J81Z 3SFZA 1UHMA 4HQMA 5H6QA 3ZMZA 2WTEA 5AIQA 5FFZA 5ED4A 1Z6RA 3E5XA 3ULQB 1IXCA 5K5OA 4M6YA 1I1GA 4UHTA 3JSOA 1OMIA 3BPVA 5IT9K 2Y0MA 3HUGA 5E17F 4N0BA 2FBHA 1E2XA 3N4MA 2L4AA 3I58A 2A69F 3U2RA 3WG9A 3WTSC 3BJ6A 3FMRA 2ETHA 1BI2A 4KN4X 2VT3A 4S05A 2XAHA 3WE2A 3LSTA 5L3DA 2DK8A 3GFMA 4UVBA 2UZKA 3MAJA 4Q48A 5FFXA 3HTUA 3CDHA 3E6DA 4E70A 3IHUA 4WXDA 1MZBA 1CGPA 1OYIA 3FMQA 4P5OA 3RYRA 1ZH5A 4PCQA 1S8NA 2PBIA 1LB2A 2FNAA 3FXUA 4I01A 4UVCA 2FXAA 4KN7X 4EJWA 2A6HF 2M87A 3L2CA 1T39A 4G7ZF 2Q8KA 3V8LA 5E1ZB 2D45A 4LB5A 1EH8A 2VBYA 3JW4A 2ZNZA 3ZPLA 1FP1D 5TJJA 4S04A 3GYHX 5ERIA 5A2QZ 1XCVA 2P5VA 3N97A 1YTYA 2VC0A 4MTEA 2DW4A 2LF8A 2EK5A 5TRDA 4A6DA 3ZMTA 3LQRA 3TKYA 1Z05A 3KZYA 3ZQ7A 2KKOA 1L3LA 3Q5FA 1JE8A 1LEBA 1P92A 3DP7A 4F7ZA 3SHFA 3V7RA 2JPCA 1J2XA 3Q9VA 2BE5F 1BI0A 4IVNA 2G7UA 3K0LA 2XGXA 3E5QA 4KA4A 1FC3A 4HBLA 4RB0A 3CTAA 1FPQA 3CUOA 4YFNF 4GYIA 3IWFA 3BWGA 1BI1A 4ON0A 2RN7A 4G7OF 3VOEA 2HEOA 4UNOA 1TQPA 1J0RA 5BOXA 1S6LA 3P9CA 1H0MA 1YS7A 4N9IA 4A2UA 5FLXK 5CVRA 1FYMA 4O5VA 1JXSA 1O7FA 5JHUA 2IP2A 3ML6A 4I0BA 2VBXA 4RGXA 4PGHA 3CJNA 5LGUA 1ZRFA 4G6QA 4ZZDA 1KU2A 4M9XA 2DAOA 3M7GA 1U5TC 4XRFA 1ZLJA 5LLQA 5J8CA 3SQNA 4ETSA 5BPDA 5CVUA 4DQ2A 3DV8A 3D0SA 2OZUA 3T1BA 2JRTA 3D5LA 3IKVA 2A68F 4IPAA 4G94A 4RGSA 4OU0A 5BS6A 3O3KA 1Y0UA 2VODA 2FNPA 2D1VA 1XMKA 3F8NA 5HS7A 3WTYC 3QP5A 3FMSA 1XSDA 1IW7F 1FOKA 2K4BA 4LLLA 2PLYA 3L00A 5CJ9A 1PUEE 1TBXA 2PQ8A 3M8FA 4BHCA 5BMZA 3O2PE 5F64A 2VOPA 2CQKA 4M6XA 2RNJA 4OIQF 3R0AA 2FBIA 3K1MA 5LBQA 3HHGA 1IN6A 2XAJA 1OKRA 4BYYA 4GO1A 2YPRA 4ASNA 3WTTC 5J6XA 4RAZA 1K79A 2PI0A 5HS9A 2XAFA 2A3SA 2JTVA 2ELHA 1A04A 4MNUA 3DPLC 3P9IA 1O3QA 3KLNA 3FX3A 4NHJA 4OMYA 4Z2YA 2IT0A 1HKSA 1KYWA 4U7BA 4GXOA 4L5IA 3HIFA 2IVMA 2V1UA 4LJZF 2FRHA 4FX0A 3RPUA 5FD5A 2FA5A 3DF8A 3ISPA 3HOSA 3ZN0A 3TQNA 4KDPA 1T98A 3E6BA 3E3VA 3IWZA 5EEGA 4BAYA 5CVIA 4UUVA 3M8EA 2M8EA 4BNCA 2XV4S 4MGRA 1F1ZA 2DLLA 3KETA 2P6SA 3C1DA 3QRFF 3BROA 2Q0OA 2HFHA 2QQBA 2P6TA 3BZ6A 2QUFA 2FMYA 2YU3A 4MEYF 2ZJ2A 1JGSA 2HQRA 1S7OA 4OIRF 2RKHA 5LEKA 1V4RA 1TW3A 3ZMUA 2E7XA 2Z99A 2HDCA 2DU9A 1J5YA 2ADUA 1BIAA 1LNWA 2GQQA 1X3UA 4HA8A 3H3UA 3U1DA 4B8XA 1K78B 1G3SA 4I09A 5H20A 2ZXJA 2F5CA 3QP6A 5F1RA 2VONA 1MDMA 1R22A 2G7HA 4MEXF 2XROA 2QBYB 2ISYA 2QENA 2HYGD 3IC7A 4A5MA 1J7KA 3GX4X 4EGYA 1FBSA 2GWRA 2STWA 1STZA 2Z3YA 3CLOA 5ILVA 1ONVA 1D8JA 3J7AO 4R79A 2EV5A 2RVCA 5J8FA 5F6FA 3CO6C 2DQRA 4AWXB 1B59A 2YX7A 1K7AA 1B1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UV8 A;  2HTJ A;  3IKT A;  3AAF A;  4WK8 F;  4ZZL A;  1BI3 A;  5E8G A;  2OU2 A;  4BHP A;  1KGS A;  3F8M A;  5D6F A;  4RGR A;  1XGO A;  2F5E A;  2XAG A;  1F5T A;  1R1V A;  2QYO A;  3BJO A;  1MDM B;  2L54 A;  1OYY A;  1UCR A;  3PFI A;  4IHT A;  2JSC A;  3I59 A;  1B9N A;  3GZ6 A;  1BM9 A;  1IUY A;  1KU3 A;  3HRM A;  3KP7 A;  3GLX A;  3P7N A;  4ENJ A;  4CHU A;  1R00 A;  4JBA A;  3U9G A;  1XMA A;  2W24 A;  3ECO A;  4CXF A;  4M71 A;  1R23 A;  1E17 A;  1O7L A;  5DV5 A;  4EM2 A;  1SMY F;  2HOE A;  3ZP5 A;  2OZ6 A;  5ICF A;  1DPU A;  4G7H F;  5JVT A;  1IF1 A;  5IT9 Z;  2O0Y A;  1OPC A;  4CO8 A;  1LDD A;  1YS6 A;  4FT8 A;  2OBP A;  2XVC A;  3GXO A;  1G6N A;  4IRG A;  4EJV A;  3IRQ A;  2DQL A;  3TDU C;  3I59 B;  1IRF A;  4L0Y B;  3QU3 A;  3KP3 A;  2K02 A;  2RGV A;  3DFG A;  4RAY A;  4ESB A;  5FGM A;  3LAP A;  1W4M A;  4M74 A;  2H27 A;  4Q5S F;  3EET A;  2QQA A;  3GO5 A;  3EUH A;  2OQG A;  2PJP A;  3FXQ A;  2GXB A;  1FWZ A;  5HDK A;  1XDS A;  3R61 A;  3EQL F;  1QBJ A;  1ZG1 A;  1ZG3 A;  3R4K A;  2WWY A;  4LGW A;  4LK0 F;  4P9U A;  3G73 A;  2P5K A;  3OV8 A;  1RNL A;  2EV0 A;  1PDN C;  2O03 A;  4KNY A;  5LGN A;  1BC8 C;  3HSR A;  5D8K B;  4XLN F;  4GGG A;  4ZYD A;  1ODD A;  3RI4 A;  3I64 A;  4LK1 F;  3EDP A;  5K5Q A;  1BC7 C;  2O8X A;  2VOO A;  1ZLK A;  2VE8 A;  3IRR A;  3FHZ A;  1SD7 A;  2NNN A;  2HWV A;  4IF4 A;  1LQ1 A;  1ON1 A;  2P8T A;  1GXQ A;  3R6S A;  1IZ1 A;  4KMF A;  2JT1 A;  1YG2 A;  1Q1H A;  3JSP A;  3GZ5 A;  4YG2 F;  3SXY A;  5BPI A;  3F3X A;  1W7P A;  1S7A A;  2VBZ A;  5CYV A;  1UHW A;  5DDG A;  4WXH A;  4QWQ A;  3WOD F;  2VT2 A;  1D5V A;  4ZYH A;  1YW7 A;  3QPT A;  2H6B A;  2J5O A;  5D5W B;  1IN5 A;  5L3G A;  2DPU A;  1MJ9 A;  5CLS A;  3F23 A;  1AOY A;  2K7L A;  4I02 A;  1WI9 A;  3V8K A;  1G4D A;  2ZFW A;  4LLG F;  1FYK A;  5FLX Z;  3TO6 A;  1R1U A;  1YO5 C;  1I5Z A;  1TQI A;  1R58 A;  4AIK A;  1W7P B;  1Z9C A;  1RUO A;  4KUM A;  3WU1 B;  1W5T A;  1Z91 A;  3JTG A;  1FSE A;  3MEX A;  2TDX A;  4P55 A;  2UXX A;  2F5D A;  1KYZ A;  1XB4 A;  4WX9 A;  3MQ0 A;  1RZ4 A;  4M9Z A;  1WWX A;  2F5F A;  4EMS A;  3K1P A;  5LHI A;  1P2F A;  1FP2 A;  5IT3 A;  3HSF A;  5L3E A;  2F2E A;  5K5R A;  1ZRD A;  2JZY A;  1HKQ A;  2XHK A;  2EFQ A;  1USS A;  2OQR A;  2K86 A;  3MCZ A;  4KT5 C;  1XCB A;  1ZYR F;  5ICC A;  4WCG A;  1IRG A;  1HBX G;  3E6C C;  3EYY A;  3BDD A;  2VN2 A;  4Y13 A;  4KIC A;  2ESN A;  4TV7 A;  5L3F A;  1OR7 A;  2WC2 A;  4GCV A;  4XBF A;  3W6J B;  4OOI A;  3QU6 A;  3MWM A;  5K1Y A;  3WTU C;  1B4A A;  2Z5U A;  4EM1 A;  5LEJ A;  5E18 F;  2IA1 A;  3GWZ A;  1P4W A;  3I0T A;  3Q9S A;  5D5V B;  1VTN C;  1ZN2 A;  4A0Z A;  1WKM A;  1PP8 F;  2XRN A;  2RDP A;  3E97 A;  3FXR A;  1UFM A;  2A5Y B;  3V4G A;  1FYL A;  2E1N A;  2C6Y A;  3JAM K;  4XLP F;  1MD0 A;  3E6M A;  2IRF G;  1QQI A;  4U0W A;  1SD6 A;  4U0V A;  1LVA A;  1WQ2 A;  5HDN A;  1FZP B;  2IPQ X;  1TQM A;  4KFC A;  3DEU A;  3WU0 A;  3REO A;  3VOD A;  1FSH A;  1GXP A;  5BQT A;  4HAM A;  4A6E A;  2ISZ A;  1BJA A;  3P9K A;  4YFX F;  4HOB A;  2CO5 A;  5HVQ C;  3FWE A;  2PMH A;  3I53 A;  4BXU A;  2EFO A;  3GW2 A;  1OYW A;  2MLG A;  1IN7 A;  4RGU A;  2EJR A;  4L0Z B;  4HF1 A;  4XSZ F;  3LAJ A;  2W84 A;  3KP6 A;  3KEO A;  3RKX A;  1BOA A;  4HLX A;  3L9F A;  3OOP A;  2W25 A;  1ZAO A;  1WRJ A;  3KP5 A;  2GA2 A;  3C7J A;  2QM3 A;  2M5W A;  1U78 A;  3C3W A;  4WF2 A;  4WXC A;  4I7H A;  3ABT A;  2LDU A;  4B09 A;  1GVJ A;  3J80 K;  2EFW A;  1HXD A;  3QAH A;  2NAZ A;  3DXJ F;  2M45 A;  1TLH B;  3ABU A;  3T5X A;  2E7W A;  2LSO A;  5LHH A;  4HDV A;  2G9W A;  2DTR A;  2IA0 A;  5D4S A;  4IXA A;  3T0Y A;  1YQA A;  1P4A A;  2KRF A;  2ZCW A;  1DUX C;  2FBK A;  3G3Z A;  3VEP A;  2MH2 A;  1FBU A;  1G3Y A;  3QOP A;  4GYG A;  2ZBK A;  5DYM A;  5HS8 A;  5KVR A;  3IL2 A;  1F9N A;  3K2Z A;  1MGT A;  3B73 A;  3FZV A;  5ICE A;  5LRS A;  1MKM A;  2Q2E A;  4A5N A;  3TOA A;  2FOK A;  1J59 A;  5ICG A;  1R1T A;  3CUQ A;  4AIH A;  1LEA A;  4Q4Z F;  2WV0 A;  3DPT A;  3LA7 A;  4A12 A;  4U7D A;  4L9V A;  5LGT A;  1SAX A;  4PGG A;  1BN5 A;  1I1S A;  2QQ9 A;  3VFZ A;  4MQV A;  3KP2 A;  5D5X B;  2OAZ A;  3KCC A;  1TW2 A;  3O6B B;  2V9V A;  1ULY A;  1FBQ A;  1XSV A;  2KIM A;  4P96 A;  3M1E A;  3HTS B;  1TNS A;  2CGP A;  3NQO A;  4CYD A;  4KIB A;  2YX4 A;  1TNT A;  2STT A;  4XSX F;  4ZYE A;  2KJC A;  4M73 A;  3CUQ B;  1SD4 A;  3R0J A;  3S2W A;  2R3S A;  2QLZ A;  3I54 A;  2IW5 A;  3LA3 A;  1YYV A;  3NRV A;  1FT9 A;  2HQN A;  1O3S A;  4HF2 A;  1EH6 A;  1ZG5 A;  3ZMD A;  2PN6 A;  4YIF A;  1H9G A;  4UVA A;  2HTS A;  1B9M A;  2QZ8 A;  4EGZ A;  2H6C A;  1CF7 A;  5FD6 A;  1BBY A;  2QVO A;  1ZRC A;  2O6G E;  4EM0 B;  4IRI A;  4G8X A;  3K1N A;  1RIO H;  5AIP A;  1XN7 A;  4EV0 A;  2V6C A;  4RS8 A;  5DUI A;  3ZN1 A;  3BP8 A;  4L9T A;  3ZMV A;  4R8H A;  5E20 A;  3F6V A;  3H3Z A;  4AVP A;  4NB5 A;  1G3T A;  3GVA A;  2XKP A;  4LMY A;  1U8R A;  1HKT A;  2DBB A;  1T6S A;  4BH9 A;  5HLH A;  3L09 A;  2BYV E;  1O3R A;  4LLN A;  2CSO A;  3ERE D;  3BPX A;  2DO7 A;  2AXL A;  1O3T A;  2HZT A;  1ZAR A;  2HKO A;  1LDK B;  2FSW A;  3V7C A;  4ESJ A;  2L01 A;  2LNB A;  2P5L C;  1SFX A;  1U2W A;  2Y75 A;  4LD5 A;  2DT5 A;  3I71 A;  1V3F A;  2ACJ A;  1ON2 A;  3MZH A;  4BHB A;  3F6O A;  1ZHF A;  6PAX A;  1T0F A;  2JPB A;  5ILS A;  1DPR A;  1P6R A;  4EJO A;  1T2K A;  3KP4 A;  5D8L B;  2Z9O A;  4H0E A;  3GFJ A;  3K69 A;  4M72 A;  4HX4 A;  1IXR C;  4EJT A;  1I6X A;  3F8B A;  1DP7 P;  3SZT A;  5D6E A;  2CYY A;  2V1X A;  4ZYG A;  5DEQ A;  4HYE A;  3GF2 A;  1U5T A;  2OD5 A;  4NQW A;  3FF5 A;  1W5S A;  2MBF A;  2X4H A;  1FX7 A;  1UB9 A;  4LB6 B;  3GEZ A;  5JR3 A;  2EV6 A;  1ZGA A;  1YFH A;  5LHG A;  5HLI A;  4OIO F;  2DK5 A;  2CWE A;  4IJA A;  3J81 K;  1ZGJ A;  4L5J A;  2CW0 F;  1R5G A;  5DCM A;  5KK1 A;  1P4X A;  2XKO A;  5L3C A;  2PFB A;  2MH9 A;  4PZJ A;  1QGP A;  1SMT A;  2BBY A;  4ENK A;  3SZP A;  3RTR A;  3M9A A;  3MFK A;  2XAQ A;  2A61 A;  5HLG A;  1BIB A;  4KYW A;  1FNN A;  2VE9 A;  1T38 A;  1U5T B;  3RPQ A;  4D0P A;  4HZF A;  4ENM A;  4HV6 A;  3W6K B;  2EFN A;  4YFK F;  3JTH A;  3WGG A;  3JAM Z;  2O61 A;  4HLY A;  4LFU A;  2K4J A;  4WWC A;  1KQ9 A;  5H6R A;  5DCM B;  4AD9 A;  2H09 A;  4HX7 A;  2D1H A;  3PQK A;  2EA4 A;  5JFR A;  1SD5 A;  5DD8 A;  4LG0 A;  1WSU A;  2ZME A;  2XAS A;  2XUB A;  2L3D A;  4KMU X;  4MQ9 F;  2NYX A;  4ENN A;  3HHH A;  1U6G A;  3EYI A;  2Y48 A;  2W57 A;  1B6A A;  3T8T A;  2MA3 A;  1Z6T A;  2CG4 A;  4I0A A;  1ZRE A;  2HYF A;  3R60 A;  4Y15 A;  1LDJ A;  5ILU A;  4HW0 A;  1XGS A;  2P7V B;  2D2W A;  5A2Q K;  2H94 A;  3F72 A;  2EA2 A;  2V1D A;  5DUK A;  4KIF A;  1HQC A;  2KIF A;  1KU7 A;  4CDG A;  2J5P A;  3COA C;  2O3F A;  1QPM A;  4G9Y A;  1UST A;  1QZZ A;  1XSX A;  2XIG A;  4LG0 B;  2ZME B;  1QNT A;  3TO9 A;  1HW5 A;  2ZKZ A;  1RI7 A;  2R7F A;  1SFE A;  2FF4 A;  4EJU A;  2L02 A;  3FM3 A;  2UWM A;  1D3Y A;  2COM A;  4I2O A;  2A07 F;  1PP7 U;  4QLC U;  5EEH A;  5L3B A;  3TGN A;  1TTY A;  2EWN A;  1XD7 A;  2HS5 A;  2GZW A;  4CIC A;  2P4W A;  3J80 Z;  1REP C;  3MZY A;  1RUN A;  3KLO A;  3LWF A;  1I27 A;  4O3M A;  1EH7 A;  1Z1D A;  4U0Y A;  1QZY A;  4P9F A;  2M1B A;  3GUD A;  5E1W A;  1NHA A;  3ZMS A;  5JI6 A;  3GFI A;  1AWC A;  4HF0 A;  3T8R A;  1IXS B;  2NRA C;  3ECH A;  3HRS A;  2MD5 A;  3LFK A;  2HKX A;  1J75 A;  3HRT A;  1QO0 D;  2LKP A;  4K2E A;  2PEX A;  5E8I A;  2P7C B;  4L9J A;  2FE3 A;  4RB1 A;  2CFX A;  3TOB A;  2KIU A;  4RB3 C;  1XGM A;  1O57 A;  4EQQ A;  2GIV A;  3ROU A;  1KA8 A;  3H92 A;  4A0X A;  4ZH4 F;  1SFU A;  3VB2 A;  3RKY A;  1IN4 A;  2VXZ A;  3WTX C;  3HSE A;  4OMZ A;  2NS0 A;  1MJB A;  3HRU A;  4Y17 A;  2PMU A;  2W85 A;  1W7P D;  3BJA A;  5D5U B;  4OIP F;  1JHF A;  1YW8 A;  2IJL A;  2M30 A;  1K78 A;  4L9N A;  2QWW A;  3K9T A;  2FU4 A;  2B0L A;  1XGN A;  4HV5 A;  4PDK A;  2DFI A;  2QBY A;  5DCF A;  4CZZ A;  2V79 A;  3L7W A;  1H9T A;  3WTZ A;  5DD4 A;  1YIO A;  4DNC A;  2HGC A;  3KEQ A;  2UXN A;  4JK1 X;  3F8F A;  3WGH A;  4AIJ A;  1F4K A;  4G6D A;  5D4R A;  2YSR A;  3KZZ A;  2BGC A;  3WE3 A;  4L18 B;  4KIG A;  5CVJ A;  3KFW X;  1D8K A;  4IRH A;  4CGZ A;  1L0O C;  2GXG A;  2OA4 A;  1IN8 A;  4HQE A;  4MTD A;  5LRR A;  3B02 A;  1KQ8 A;  2PG4 A;  2L4M A;  3RIR A;  1FLI A;  3RDI A;  2ZNY A;  2EB7 A;  4EVI A;  3DQV C;  4UV9 A;  2BEO A;  2FEZ A;  3C18 A;  3LA2 A;  1JHH A;  4N9H A;  4OIN F;  3BOQ A;  1U3E M;  3QPH A;  2GAU A;  1C0W A;  4HX8 A;  1FY7 A;  2KJB A;  4M9S A;  2RC4 A;  3F8C A;  1HW2 A;  3I5U A;  2YR2 A;  2R7D A;  2ESH A;  2FML A;  3WTW C;  5FB2 A;  2VBW A;  3HYI A;  2HR3 A;  2AS5 F;  1J9I A;  1KU9 A;  5FO5 A;  3NEU A;  1XDU A;  4IHS A;  3GFL A;  3KE2 A;  4A0Y A;  2IA2 A;  1YW9 A;  3WTV C;  1LJ9 A;  1HW1 A;  2E1C A;  1G3W A;  3TO7 A;  1Z7U A;  2NNY A;  1EV7 A;  3RJP A;  1R7J A;  2K27 A;  4BQA A;  3F21 A;  3V7S A;  4O6J A;  2X0L A;  4U88 A;  2DPD A;  3E5U A;  1S3J A;  1HSJ A;  5AON A;  4FX4 A;  3ELK A;  2Z33 A;  4Q47 A;  1GHC A;  4RB2 C;  4R1H A;  2A6E F;  3F22 A;  3TDZ C;  3RKW A;  4ESF A;  3LQQ A;  4YII A;  2RV8 A;  5HDG A;  1R36 A;  1DDN A;  5CVV A;  2GA1 A;  2EFP A;  3DKW A;  2DI3 A;  3RYP A;  3CO7 C;  3HOT A;  3PQJ A;  2RQP A;  4JQF A;  4FHT A;  2FQ3 A;  1IAW A;  5HOO A;  3FM5 A;  1YLF A;  2VC1 A;  2MC3 A;  1R5H A;  1MJA A;  1CF7 B;  3I4P A;  3WGI A;  1KQ0 A;  3V8J A;  4MHG A;  4UXN A;  4HDU A;  1S29 A;  1HST A;  2MLK A;  2ZO4 A;  5E1X A;  2LF7 A;  3BY6 A;  3CUQ C;  1K6O A;  4I98 B;  2BV6 A;  3J81 Z;  3SFZ A;  1UHM A;  4HQM A;  5H6Q A;  3ZMZ A;  2WTE A;  5AIQ A;  5FFZ A;  5ED4 A;  1Z6R A;  3E5X A;  3ULQ B;  1IXC A;  5K5O A;  4M6Y A;  1I1G A;  4UHT A;  3JSO A;  1OMI A;  3BPV A;  5IT9 K;  2Y0M A;  3HUG A;  5E17 F;  4N0B A;  2FBH A;  1E2X A;  3N4M A;  2L4A A;  3I58 A;  2A69 F;  3U2R A;  3WG9 A;  3WTS C;  3BJ6 A;  3FMR A;  2ETH A;  1BI2 A;  4KN4 X;  2VT3 A;  4S05 A;  2XAH A;  3WE2 A;  3LST A;  5L3D A;  2DK8 A;  3GFM A;  4UVB A;  2UZK A;  3MAJ A;  4Q48 A;  5FFX A;  3HTU A;  3CDH A;  3E6D A;  4E70 A;  3IHU A;  4WXD A;  1MZB A;  1CGP A;  1OYI A;  3FMQ A;  4P5O A;  3RYR A;  1ZH5 A;  4PCQ A;  1S8N A;  2PBI A;  1LB2 A;  2FNA A;  3FXU A;  4I01 A;  4UVC A;  2FXA A;  4KN7 X;  4EJW A;  2A6H F;  2M87 A;  3L2C A;  1T39 A;  4G7Z F;  2Q8K A;  3V8L A;  5E1Z B;  2D45 A;  4LB5 A;  1EH8 A;  2VBY A;  3JW4 A;  2ZNZ A;  3ZPL A;  1FP1 D;  5TJJ A;  4S04 A;  3GYH X;  5ERI A;  5A2Q Z;  1XCV A;  2P5V A;  3N97 A;  1YTY A;  2VC0 A;  4MTE A;  2DW4 A;  2LF8 A;  2EK5 A;  5TRD A;  4A6D A;  3ZMT A;  3LQR A;  3TKY A;  1Z05 A;  3KZY A;  3ZQ7 A;  2KKO A;  1L3L A;  3Q5F A;  1JE8 A;  1LEB A;  1P92 A;  3DP7 A;  4F7Z A;  3SHF A;  3V7R A;  2JPC A;  1J2X A;  3Q9V A;  2BE5 F;  1BI0 A;  4IVN A;  2G7U A;  3K0L A;  2XGX A;  3E5Q A;  4KA4 A;  1FC3 A;  4HBL A;  4RB0 A;  3CTA A;  1FPQ A;  3CUO A;  4YFN F;  4GYI A;  3IWF A;  3BWG A;  1BI1 A;  4ON0 A;  2RN7 A;  4G7O F;  3VOE A;  2HEO A;  4UNO A;  1TQP A;  1J0R A;  5BOX A;  1S6L A;  3P9C A;  1H0M A;  1YS7 A;  4N9I A;  4A2U A;  5FLX K;  5CVR A;  1FYM A;  4O5V A;  1JXS A;  1O7F A;  5JHU A;  2IP2 A;  3ML6 A;  4I0B A;  2VBX A;  4RGX A;  4PGH A;  3CJN A;  5LGU A;  1ZRF A;  4G6Q A;  4ZZD A;  1KU2 A;  4M9X A;  2DAO A;  3M7G A;  1U5T C;  4XRF A;  1ZLJ A;  5LLQ A;  5J8C A;  3SQN A;  4ETS A;  5BPD A;  5CVU A;  4DQ2 A;  3DV8 A;  3D0S A;  2OZU A;  3T1B A;  2JRT A;  3D5L A;  3IKV A;  2A68 F;  4IPA A;  4G94 A;  4RGS A;  4OU0 A;  5BS6 A;  3O3K A;  1Y0U A;  2VOD A;  2FNP A;  2D1V A;  1XMK A;  3F8N A;  5HS7 A;  3WTY C;  3QP5 A;  3FMS A;  1XSD A;  1IW7 F;  1FOK A;  2K4B A;  4LLL A;  2PLY A;  3L00 A;  5CJ9 A;  1PUE E;  1TBX A;  2PQ8 A;  3M8F A;  4BHC A;  5BMZ A;  3O2P E;  5F64 A;  2VOP A;  2CQK A;  4M6X A;  2RNJ A;  4OIQ F;  3R0A A;  2FBI A;  3K1M A;  5LBQ A;  3HHG A;  1IN6 A;  2XAJ A;  1OKR A;  4BYY A;  4GO1 A;  2YPR A;  4ASN A;  3WTT C;  5J6X A;  4RAZ A;  1K79 A;  2PI0 A;  5HS9 A;  2XAF A;  2A3S A;  2JTV A;  2ELH A;  1A04 A;  4MNU A;  3DPL C;  3P9I A;  1O3Q A;  3KLN A;  3FX3 A;  4NHJ A;  4OMY A;  4Z2Y A;  2IT0 A;  1HKS A;  1KYW A;  4U7B A;  4GXO A;  4L5I A;  3HIF A;  2IVM A;  2V1U A;  4LJZ F;  2FRH A;  4FX0 A;  3RPU A;  5FD5 A;  2FA5 A;  3DF8 A;  3ISP A;  3HOS A;  3ZN0 A;  3TQN A;  4KDP A;  1T98 A;  3E6B A;  3E3V A;  3IWZ A;  5EEG A;  4BAY A;  5CVI A;  4UUV A;  3M8E A;  2M8E A;  4BNC A;  2XV4 S;  4MGR A;  1F1Z A;  2DLL A;  3KET A;  2P6S A;  3C1D A;  3QRF F;  3BRO A;  2Q0O A;  2HFH A;  2QQB A;  2P6T A;  3BZ6 A;  2QUF A;  2FMY A;  2YU3 A;  4MEY F;  2ZJ2 A;  1JGS A;  2HQR A;  1S7O A;  4OIR F;  2RKH A;  5LEK A;  1V4R A;  1TW3 A;  3ZMU A;  2E7X A;  2Z99 A;  2HDC A;  2DU9 A;  1J5Y A;  2ADU A;  1BIA A;  1LNW A;  2GQQ A;  1X3U A;  4HA8 A;  3H3U A;  3U1D A;  4B8X A;  1K78 B;  1G3S A;  4I09 A;  5H20 A;  2ZXJ A;  2F5C A;  3QP6 A;  5F1R A;  2VON A;  1MDM A;  1R22 A;  2G7H A;  4MEX F;  2XRO A;  2QBY B;  2ISY A;  2QEN A;  2HYG D;  3IC7 A;  4A5M A;  1J7K A;  3GX4 X;  4EGY A;  1FBS A;  2GWR A;  2STW A;  1STZ A;  2Z3Y A;  3CLO A;  5ILV A;  1ONV A;  1D8J A;  3J7A O;  4R79 A;  2EV5 A;  2RVC A;  5J8F A;  5F6F A;  3CO6 C;  2DQR A;  4AWX B;  1B59 A;  2YX7 A;  1K7A A;  1B1B A; 
#chains in the Genus database with same CATH topology
 4UV8 A;  2HTJ A;  5IOZ A;  3IKT A;  5IYD J;  3HKZ N;  3AAF A;  3WHC A;  4WK8 F;  4ZZL A;  1BI3 A;  5E8G A;  2OU2 A;  2Z16 A;  2VXD A;  1V54 H;  4BHP A;  1D0Z A;  4IZZ A;  1KGS A;  3F8M A;  5D6F A;  4RGR A;  1XGO A;  3ZOB A;  5E3M A;  2F5E A;  2X6X A;  2XAG A;  2HXI A;  3ABM H;  3CCV I;  1K4T A;  1F5T A;  1R1V A;  3GME A;  2QYO A;  3BJO A;  5FKO A;  1MDM B;  2L54 A;  3PSI A;  1OYY A;  1UCR A;  4F93 B;  3PFI A;  2HQA A;  4A3J J;  1XS9 A;  2JSC A;  4IHT A;  3I59 A;  4D5F A;  1X4P A;  1TWF J;  1B9N A;  3GZ6 A;  1V55 H;  1BM9 A;  1GV5 A;  1IUY A;  1KU3 A;  1RPW A;  3AG2 H;  5E3L A;  2XC7 A;  3HRM A;  3KP7 A;  1Y1W J;  3GLX A;  3P7N A;  4ZJZ A;  4ENJ A;  2GXA A;  1G59 A;  4CHU A;  1R00 A;  5JVG F;  4FET A;  4JBA A;  4XQF A;  2VIX A;  2W00 A;  3BQZ A;  1XMA A;  2ELK A;  3BG6 A;  3U9G A;  3OYE A;  2W24 A;  3G6E I;  5CKT A;  1UEL B;  3ECO A;  4M71 A;  1R23 A;  4CXF A;  4D9J A;  1E17 A;  1O7L A;  5DV5 A;  4EM2 A;  1SMY F;  3O8H A;  2JVG A;  2HOE A;  2WBM A;  3HPG A;  3ZP5 A;  1SVL A;  1Q1V A;  2VI6 A;  3CMM A;  2OZ6 A;  5ICF A;  1DPU A;  1VQM I;  4G7H F;  3A1Y A;  5JVT A;  4FE4 A;  4BDZ A;  1IF1 A;  3S1Q J;  5IT9 Z;  2O0Y A;  3PNT A;  1OPC A;  1Y0N A;  4CO8 A;  1LDD A;  1YS6 A;  4FT8 A;  2OBP A;  2XVC A;  2EQR A;  3MVP A;  3GXO A;  1G6N A;  4IRG A;  1TC3 C;  4RLQ A;  4EJV A;  2OTL I;  1HDD C;  5IP6 A;  3IRQ A;  2DQL A;  3TDU C;  4C3I J;  2W7N A;  3S1M J;  4UB6 C;  4F3Q A;  3JRI A;  2M4G A;  1H8A C;  2EH3 A;  2X6W A;  3I59 B;  1IRF A;  3I4M J;  1JI8 A;  4L0Y B;  3QU3 A;  3KP3 A;  1VF9 A;  2OC6 A;  2K02 A;  3G1O A;  2RGV A;  2GM4 A;  1MIJ A;  3DFG A;  4IEJ A;  3BR6 A;  4RAY A;  4DGW B;  4ESB A;  2WB1 N;  4M3D A;  5FGM A;  3LAP A;  2NVU B;  3BR1 A;  1MND A;  1W4M A;  4I76 A;  3TP3 A;  3CC4 I;  4M74 A;  2H27 A;  5BNG A;  2M8G X;  4Q5S F;  4MFE A;  1R4M B;  3EET A;  2K9M A;  2DA5 A;  2QQA A;  3CCY A;  3GO5 A;  2KL4 A;  2DCE A;  4KIS A;  4XRS A;  3GZN B;  1OCC H;  3EUH A;  2OQG A;  2CQX A;  3VYS B;  2PJP A;  3FXQ A;  2GXB A;  3GTK J;  2DA6 A;  1FWZ A;  5HDK A;  2QGU A;  5IP9 J;  1XDS A;  3R61 A;  4XL9 A;  3EQL F;  3S93 A;  4G12 A;  1ETY A;  1QBJ A;  1LE8 A;  3A01 A;  1ZG1 A;  1ZG3 A;  4DYC A;  2LD5 A;  5DTD A;  3PO2 J;  3R4K A;  2WWY A;  3ZQL A;  1X1D A;  4LGW A;  4LK0 F;  4P9U A;  1XG1 A;  3G73 A;  2P5K A;  2EIK H;  3HBL A;  3OV8 A;  4ANJ A;  2PX9 A;  3OYJ A;  1RNL A;  2EV0 A;  1UG2 A;  3DTI A;  2XGD A;  1PDN C;  2O03 A;  4KNY A;  5LGN A;  5TIS C;  1MSE C;  1BC8 C;  3HSR A;  3OYA A;  5D8K B;  4XLN F;  1SVM A;  4GGG A;  3KYL A;  2XRL A;  1I50 J;  3Q0V A;  3CLQ A;  4ZYD A;  1ODD A;  3CJR B;  3I64 A;  4LK1 F;  3EDP A;  5K5Q A;  4LOC A;  3RI4 A;  2O8X A;  1JKP C;  1BC7 C;  2VOO A;  2QSG X;  1ZLK A;  5EF6 A;  2VE8 A;  2VL8 A;  3IRR A;  3FHZ A;  1ZR2 A;  1SD7 A;  2KIS A;  3HG9 A;  2NNN A;  2HWV A;  3S3M A;  2CS3 A;  1W0U A;  4IF4 A;  2IS4 A;  3PFY A;  4DBR A;  1LQ1 A;  1ON1 A;  2P8T A;  2R5Y A;  1HA8 A;  1GXQ A;  3R6S A;  1IZ1 A;  4KMF A;  2JT1 A;  3LSJ A;  1IC8 A;  3I56 I;  5GAD J;  3IH4 A;  1YG2 A;  3VPR A;  3L2V A;  1Q1H A;  1VQP I;  3N05 A;  3JSP A;  4F55 A;  4PJL A;  1ACI A;  2NVX J;  2XB0 X;  5EDN A;  3GZ5 A;  4II3 A;  5EGO B;  1XTA A;  4YG2 F;  3TW6 A;  1LE8 B;  3SXY A;  5BPI A;  3F3X A;  1W7P A;  1S7A A;  2VBZ A;  3SDG A;  4BU2 A;  2HU9 A;  4IHV A;  2NOJ B;  1EA3 A;  3DWL E;  2NVT J;  5CYV A;  1UHW A;  5DDG A;  2V1N A;  4WXH A;  4HNV A;  2VPR A;  4QWQ A;  5HNH A;  3OS2 A;  5F0C A;  4YEL A;  3WOD F;  4DZJ A;  2F4M B;  4A3B J;  2VT2 A;  1D5V A;  4ZYH A;  4BAC A;  2L9N A;  1YW7 A;  3QPT A;  4DJA A;  2H6B A;  1M1E B;  3M8J A;  1Y8Q B;  2X1E A;  3HM5 A;  2J5O A;  5J1U A;  3HDD A;  5D5W B;  1IN5 A;  1YJN I;  2ME0 A;  5L3G A;  4BL0 B;  1OIS A;  2DPU A;  1MJ9 A;  5CLS A;  1B8I B;  2HPM A;  2KRC A;  3F23 A;  4FTH A;  1AOY A;  4A3G J;  2CRG A;  2K7L A;  4I02 A;  3ABL H;  2NXN B;  1WI9 A;  3V8K A;  4GRI A;  2R5Y B;  4XN0 A;  2QKL B;  1G4D A;  2ZFW A;  4LLG F;  4BXF A;  4C3J J;  1FYK A;  5FLX Z;  2COB A;  5F0F A;  2CMP A;  5GPA A;  3TO6 A;  3HOU J;  1HC8 A;  1R1U A;  2IS1 A;  1YO5 C;  1I5Z A;  1TWH J;  1TQI A;  4V19 K;  1R58 A;  3RKQ A;  4A3K J;  1NH3 A;  1ETQ A;  2DOF A;  1MBH A;  4AIK A;  1W7P B;  3PNY A;  3G71 I;  1Z9C A;  1RUO A;  4KUM A;  3L2R A;  1PUF A;  2R7W A;  3WU1 B;  1W5T A;  1Z91 A;  2E5N A;  3JTG A;  2LRD A;  1FSE A;  4QIW N;  5HLT A;  2AHQ A;  3MEX A;  2TDX A;  4P55 A;  1N77 A;  2FUG 2;  3LSH A;  2JUC A;  2KP6 A;  4F92 B;  2UXX A;  2F5D A;  2DDB A;  2UUZ A;  1KYZ A;  1XB4 A;  3MQ0 A;  4WX9 A;  1RZ4 A;  4Y3O A;  4M9Z A;  1WWX A;  2F5F A;  4EMS A;  1YRN A;  3K1P A;  5LHI A;  1P2F A;  1FP2 A;  1ZK8 A;  3HSF A;  5IT3 A;  5L3E A;  2F2E A;  1MBJ A;  5K5R A;  1ZRD A;  2JZY A;  5LFA A;  1HKQ A;  2XHK A;  3VDX A;  3HC7 A;  2EFQ A;  4AYB A;  4YRV A;  5DM7 F;  2FX0 A;  3OYN A;  3HB9 A;  1USS A;  2OQR A;  4A69 C;  2K86 A;  1TP4 A;  3MCZ A;  4KT5 C;  1XCB A;  1HOM A;  5J3L A;  1ZYR F;  5ICC A;  4WCG A;  3OIO A;  1IRG A;  1HBX G;  4A3L J;  3E6C C;  5J4Y A;  3EYY A;  4LIU A;  3BDD A;  1RKW A;  2VN2 A;  3QQA A;  3DEE A;  4Y13 A;  5GTI C;  2VB6 A;  2K9N A;  2ZB9 A;  4KIC A;  2ESN A;  2JN6 A;  4TV7 A;  5L3F A;  1OR7 A;  1X4O A;  3S8P A;  2Z1D A;  5CQE A;  4XN3 A;  1DGR M;  2WC2 A;  4GCV A;  4PFO A;  3HOX J;  4XBF A;  3W6J B;  2TRT A;  4CH7 A;  4OOI A;  1MMN A;  3QU6 A;  1APL C;  3PL8 A;  2DMU A;  3MWM A;  5K1Y A;  3WTU C;  2MFZ A;  1B4A A;  3BT9 A;  2Z5U A;  4EM1 A;  3JRF A;  5LEJ A;  5E18 F;  3CC7 I;  3H1C A;  2IA1 A;  1ZEL A;  2K9S A;  3GWZ A;  2M3A A;  1P4W A;  2MYS A;  3I0T A;  3Q9S A;  5D5V B;  1VTN C;  4XKB A;  1ZN2 A;  3BR2 A;  2JMW A;  4A0Z A;  1WKM A;  1PP8 F;  2XRN A;  3K6G A;  2RDP A;  3AG1 H;  3FHN A;  1MW7 A;  3UR3 C;  3E97 A;  3FXR A;  2DYS H;  1UFM A;  4RAG A;  3AL0 B;  2A5Y B;  3V4G A;  3C2B A;  1BR1 A;  1FYL A;  2E1N A;  2C6Y A;  4DOZ A;  3JAM K;  2E1M B;  4XLP F;  1MD0 A;  3E6M A;  3A4C A;  4YIR X;  2IRF G;  1QQI A;  4U0W A;  1SD6 A;  4U0V A;  1LVA A;  1WQ2 A;  2ZXI A;  2L7Z A;  5HDN A;  4AVZ A;  2IPQ X;  4DYQ A;  1TQM A;  1FZP B;  4KFC A;  3DEU A;  3WU0 A;  3REO A;  3AFH A;  3VOD A;  1S7E A;  2BOL A;  4XKC A;  1FSH A;  3KZI C;  3M3Y J;  4I6Z A;  1TWC J;  2V26 A;  4C2U A;  1YIJ I;  2P0W A;  1BJZ A;  5K7F A;  5B1B H;  1GXP A;  5FRN A;  1VND A;  2AO9 A;  1XX5 A;  1JTX A;  2RNG A;  3FKJ A;  5BQT A;  3CCJ I;  5HOD A;  2IEK A;  4HAM A;  4A6E A;  2ISZ A;  1K83 J;  1FMV A;  3DKX A;  2LY9 A;  1BJA A;  5JLX A;  4RMN A;  2I8D A;  3P9K A;  2B7E A;  5K7Z A;  4YFX F;  4HOB A;  2OCE A;  2CO5 A;  4JX4 A;  5B3S H;  5HVQ C;  3FXJ A;  4D7N A;  3FWE A;  4PUS A;  2PMH A;  2M9H A;  3I53 A;  2EFO A;  3GW2 A;  4BXU A;  4E7S A;  1OYW A;  1N25 A;  2MLG A;  1IN7 A;  4RGU A;  1H88 C;  2ZJQ F;  2EJR A;  2XF7 A;  1R6R A;  2R4G A;  2ECB A;  4L0Z B;  4XLH A;  4HNU A;  4HF1 A;  3HL2 A;  1TWG J;  2ZXH A;  3ZCO A;  5E79 C;  3JRD A;  1FJL A;  4XSZ F;  2Y31 A;  3LAJ A;  3VYR B;  2W84 A;  1FEX A;  3KP6 A;  2JA6 J;  3KEO A;  1JUP A;  3VYU B;  3RKX A;  1BOA A;  3V42 A;  4HLX A;  1VQK I;  1QPI A;  3L9F A;  3OOP A;  3H36 A;  2BY0 A;  2W25 A;  1ZAO A;  1WRJ A;  3M1C A;  3KP5 A;  3ZQG A;  2DOD A;  4FE7 A;  2GA2 A;  4N4O B;  3C7J A;  5J47 A;  2QM3 A;  5DM6 F;  4XR6 A;  4E7H A;  2M5W A;  1U78 A;  3C3W A;  2B63 J;  3J7Z I;  1JUS A;  2BW3 A;  3DBH B;  2R7U A;  1D1B A;  9ANT A;  4WF2 A;  1YHQ I;  4X1E A;  4WXC A;  2W48 A;  4I7H A;  3ABT A;  2LDU A;  1VZ0 A;  2V7F A;  3ABK H;  2R92 J;  4AM3 A;  3AL0 C;  4HG2 A;  2E36 A;  4B09 A;  5M5Y J;  1GVJ A;  5GPC A;  3J80 K;  3CD6 I;  2E1M C;  2EFW A;  1UHS A;  2CV1 A;  1HXD A;  1IJW C;  3QAH A;  2NAZ A;  3DXJ F;  2M45 A;  1TLH B;  3ABU A;  3T5X A;  3BTC A;  3FBN B;  2E7W A;  2LSO A;  3FIS A;  3P5J A;  5LHH A;  4CA0 A;  3SEQ A;  4HDV A;  2G9W A;  2DTR A;  1Y56 A;  2IA0 A;  4BBS J;  2K3P A;  5D4S A;  4IXA A;  3T0Y A;  1YQA A;  2Y69 H;  1P4A A;  3BLY A;  1WVR A;  1MH3 A;  2JSP A;  3OL4 A;  2KRF A;  3SYT A;  1FMW A;  2ZCW A;  1DUX C;  2FBK A;  3G3Z A;  1V5E A;  3VEP A;  3RSN A;  2MH2 A;  1FBU A;  1G3Y A;  3QOP A;  3JRG A;  2LG4 A;  1W36 C;  2BW3 B;  4NNJ A;  1ZKG A;  4GYG A;  2ZBK A;  5DYM A;  5HS8 A;  5KVR A;  2DMN A;  3IL2 A;  1F9N A;  2XPU A;  1WH5 A;  1MGT A;  2WAD A;  3H35 A;  2IXS A;  3K2Z A;  2IGN A;  4B4C A;  4BQQ A;  2X51 A;  3ZQI A;  3B73 A;  2F48 A;  3FZV A;  3MD2 A;  5ICE A;  3DBL B;  4BGD A;  5LRS A;  1MKM A;  2LKX A;  2QCO A;  2Q2E A;  4A5N A;  4OWR B;  3TOA A;  2WAQ A;  2HNH A;  3LSM A;  1XC5 A;  4NC7 A;  1I3Q J;  3PUF A;  2FOK A;  5IYB J;  3SEZ A;  1J59 A;  5ICG A;  1R1T A;  2L0K A;  3CUQ A;  4AIH A;  4J00 A;  1LEA A;  4XOT A;  4AUX A;  4Q4Z F;  2WV0 A;  3DPT A;  3HOY J;  3LA7 A;  3F9K A;  4A12 A;  1DP3 A;  2QSF X;  4U7D A;  4L9V A;  5K7H A;  5LGT A;  1SAX A;  4PGG A;  1BN5 A;  1FIA A;  1R4N B;  1R5I D;  2QQ9 A;  1JJ6 C;  1I1S A;  1BA5 A;  1KZH A;  3OYF A;  3VFZ A;  4MQV A;  3KP2 A;  5D5X B;  2OAZ A;  3KCC A;  2GOM A;  4UY8 I;  2OV7 A;  1TW2 A;  2WA0 A;  2V6E A;  3CCQ I;  3O6B B;  2DA3 A;  1LFP A;  2V9V A;  1ULY A;  4ZTF A;  1U8B A;  1FBQ A;  2DFE A;  1XSV A;  2KIM A;  4P96 A;  2PJR A;  4ZDL A;  3M1E A;  3M07 A;  3BR5 A;  4RA2 A;  3HTS B;  4UB8 C;  1TNS A;  3BTJ A;  3F0C A;  2CGP A;  3NQO A;  4CYD A;  4KIB A;  1W5C C;  2YX4 A;  1TNT A;  3HZJ A;  2STT A;  3S2H J;  4XSX F;  4ZYE A;  2KJC A;  3H9Q A;  4M73 A;  3S14 J;  3CUQ B;  2RQQ A;  4B44 A;  2R7S A;  1OCO H;  1SD4 A;  1XMX A;  3R0J A;  3S2W A;  2AQE A;  2R3S A;  4G6T B;  2QLZ A;  3I54 A;  4M3B A;  4IL6 C;  2IW5 A;  5KAF C;  3LA3 A;  1YYV A;  3NRV A;  4B3X A;  5EZH A;  1FT9 A;  2HQN A;  2VQL A;  1O3S A;  4HF2 A;  1EH6 A;  2HOT A;  1ZG5 A;  3ZMD A;  2E2I J;  2PN6 A;  4YIF A;  1H9G A;  4UVA A;  2HTS A;  3X2Q H;  1B9M A;  2E19 A;  2QZ8 A;  4XRS G;  1R49 A;  4EGZ A;  1W36 D;  1POG A;  2H6C A;  1CF7 A;  5HNF A;  5FD6 A;  1BBY A;  1SFK A;  2ELJ A;  2QVO A;  4UUT A;  4MFD A;  3EUA A;  3S32 A;  3LL7 A;  1ZRC A;  2O6G E;  2PJR B;  2ZC2 A;  3HXL A;  4P1W A;  2W82 A;  1X19 A;  4EM0 B;  4IRI A;  1GDT A;  4G8X A;  1R71 A;  1Z3Y A;  3K1N A;  1RIO H;  2E1O A;  3FIW A;  5AIP A;  4HRI A;  4XNF A;  1XN7 A;  3A03 A;  4EV0 A;  2V6C A;  1XPX A;  2VJ5 A;  3ZQH A;  1T33 A;  3LSI A;  3OYK A;  2MSY A;  4IHY A;  3BR0 A;  4RS8 A;  5FKN A;  3VYT B;  5DUI A;  2R7V A;  3ZN1 A;  3BP8 A;  4L9T A;  3ZMV A;  3PUB A;  3PIO F;  4R8H A;  5E20 A;  4IO9 F;  3F6V A;  4IQ4 A;  3HKZ A;  3H3Z A;  4AVP A;  4NB5 A;  1G3T A;  3GVA A;  1NG7 A;  2XKP A;  2V9K A;  4LMY A;  3LNQ A;  3QWL A;  1U8R A;  1HKT A;  3DTK A;  2DA4 A;  1PVE A;  2DBB A;  4F91 B;  1T6S A;  2DXI A;  4BH9 A;  5HLH A;  3L09 A;  2BYV E;  2LBF A;  4C30 A;  2VKE A;  1O3R A;  1KON A;  3IH2 A;  2R7Q A;  2HOS A;  3BG7 A;  1ENH A;  4BUP A;  4LLN A;  2CSO A;  3OR1 C;  1DU6 A;  3ERE D;  3BPX A;  5IY5 H;  2DO7 A;  2AXL A;  4D1Q A;  1O3T A;  2HZT A;  1ZAR A;  1P7I A;  2HKO A;  1P7J A;  1LDK B;  3PJR A;  3D5S C;  2FSW A;  3V7C A;  2O5R A;  3CF5 F;  5B1A H;  3LFU A;  4ESJ A;  2L01 A;  2LNB A;  2P5L C;  2IS2 A;  1SFX A;  1SVO A;  1U2W A;  2Y75 A;  1PYV A;  4BBR J;  4LD5 A;  2DT5 A;  3I71 A;  1V3F A;  2BVM A;  5B66 C;  2DMT A;  2VQG A;  1ON2 A;  2ACJ A;  1VQ4 I;  1VQ5 I;  3MZH A;  4BHB A;  3F6O A;  3QYF A;  1ZHF A;  1FTT A;  4YEJ A;  6PAX A;  3ZQF A;  4JYK A;  1T0F A;  2JPB A;  5ILS A;  1DPR A;  1P6R A;  4EJO A;  1T2K A;  3KP4 A;  5D8L B;  2Z9O A;  4H0E A;  3GFJ A;  3S1R J;  3K69 A;  4M72 A;  2DMQ A;  1ZQ3 P;  3FBI B;  4HX4 A;  3IAM 2;  3DLA A;  1IXR C;  3OYD A;  1IDY A;  2CH0 A;  2N8G A;  2LBF B;  2I10 A;  3OSF A;  2IGK A;  4EJT A;  1I6X A;  2R7O A;  3F8B A;  3OSG A;  3RPU D;  3OYI A;  1DP7 P;  1QU3 A;  3LMM A;  2CQN A;  3SZT A;  5D6E A;  2CYY A;  2V1X A;  3RQI A;  3K4J A;  2QA4 I;  2VAS A;  2EIM H;  2OUM A;  4BS9 A;  4ZYG A;  1VQO I;  4XKW A;  1K6Y A;  5DEQ A;  2EZI A;  2BY1 A;  2WY7 Q;  2OF7 A;  5EEA A;  3A01 B;  2GOX B;  4H4K C;  2OJE D;  2WB1 A;  2X6O A;  3GF2 A;  1IO2 A;  4HYE A;  1U5T A;  2OD5 A;  4NQW A;  3FF5 A;  1W5S A;  1BR4 A;  2KMU A;  2MBF A;  2X4H A;  3CCE I;  1FX7 A;  3HEF A;  3LSP A;  1UB9 A;  2F5V A;  2M0C A;  4V2G A;  1YJW I;  4LB6 B;  2LY1 A;  3GEZ A;  5JR3 A;  3MN2 A;  2Y0S N;  3HOW J;  2EV6 A;  1ZGA A;  1YFH A;  4EAT A;  1GLN A;  4ZC3 A;  5LHG A;  2LTP A;  1T56 A;  5HLI A;  4OIO F;  2DK5 A;  1ETK A;  2CWE A;  2ZJP F;  3PO3 J;  4XLA A;  4IJA A;  3J81 K;  2VKH A;  1IV8 A;  5GAH J;  1ZR4 A;  1ZGJ A;  4L5J A;  2CW0 F;  3OYG A;  1R5G A;  3HGY A;  5DCM A;  2XKO A;  1P4X A;  2X85 A;  5KK1 A;  5L3C A;  2Y30 A;  3OY9 A;  2PFB A;  4BXX J;  2LR8 A;  2X1D A;  2MH9 A;  3ZXS A;  4BE1 A;  1X58 A;  1E3H A;  4PZJ A;  2KDZ A;  1QGP A;  4BEH A;  3PSF A;  3U1K A;  1SMT A;  1QA6 A;  2BBY A;  2JA7 J;  1A6Q A;  2ZSH B;  1UMQ A;  3K70 D;  4ENK A;  3SZP A;  3RTR A;  1BW5 A;  5FLV A;  3M9A A;  3MFK A;  2XAQ A;  2HOA A;  2E2H J;  1WJB A;  3H9J A;  2A61 A;  2VLA A;  5HLG A;  1BIB A;  2XSD C;  4KYW A;  1FNN A;  3G2B A;  2VE9 A;  1T38 A;  1U5T B;  2BZT A;  3K2A A;  2R7T A;  3ESW B;  4NQW B;  3RPQ A;  3H5N A;  4D0P A;  2CV0 A;  4UUS A;  4QPO A;  4CCJ A;  1YX3 A;  2CQ7 A;  1GVD A;  4HZF A;  2EIN H;  3CMY A;  4MIM A;  3H9G A;  2CQQ A;  2UV1 A;  4EEF G;  4XID A;  3GLL A;  4ENM A;  3E1S A;  4HV6 A;  2VJ4 A;  1OCR H;  3W6K B;  2XGC A;  2EFN A;  4A3D J;  4YFK F;  4M3G A;  3JTH A;  3WGG A;  3JAM Z;  2O61 A;  4HLY A;  3CF2 A;  1G8X A;  2VPL A;  2MC4 A;  2K4J A;  4LFU A;  4WWC A;  4XON A;  1KQ9 A;  1WJE A;  2EZL A;  5H6R A;  5DCM B;  4AD9 A;  4ZTJ A;  2H09 A;  4HX7 A;  2D1H A;  3PQK A;  2EA4 A;  5JFR A;  3EUH C;  1SD5 A;  1IG7 A;  2O8K A;  2V9P A;  5DD8 A;  4LG0 A;  1WSU A;  2ZME A;  4BEH B;  2FQ4 A;  3OIP A;  2NOG A;  2XAS A;  1VFC A;  3VWB A;  2XUB A;  2L3D A;  1Z77 A;  3BZC A;  2KFD A;  4KMU X;  3SDB A;  2NVQ J;  2Y0S A;  4CUG A;  4MQ9 F;  2NYX A;  4ENN A;  3OOU A;  3HHH A;  1U6G A;  3EYI A;  2Y48 A;  3BC8 A;  2W57 A;  1B6A A;  1GUU A;  2EZH A;  3T8T A;  2MA3 A;  2Q1Z B;  3JR9 A;  1F36 A;  4CCL A;  1QZE A;  1WJC A;  2QF7 A;  3S2D J;  3FK7 A;  1Z6T A;  2CG4 A;  1IRX A;  4XM3 A;  2YU9 J;  4XRM A;  1SFO J;  2R93 J;  4I0A A;  1PUF B;  3G4S I;  1H89 C;  1ZRE A;  2HYF A;  3MMY B;  4UUS B;  2KHM A;  4KJZ A;  3TP0 A;  3QPL A;  3R60 A;  4XLF A;  2MD0 A;  3BR3 A;  4Y15 A;  4A3E J;  1LDJ A;  2BHZ A;  5ILU A;  4HW0 A;  1XGS A;  1RC9 A;  2P7V B;  4XOR A;  1VQ9 I;  2D2W A;  5A2Q K;  2H94 A;  3F72 A;  2EA2 A;  2V1D A;  5DUK A;  2VJI A;  4KIF A;  1HQC A;  2KIF A;  3BCB A;  3LSK A;  1KU7 A;  3UNG C;  4CDG A;  4J19 A;  1YRN B;  2J5P A;  3COA C;  2O3F A;  1QPM A;  3JRC A;  3L1P A;  4BE0 A;  4G9Y A;  1UST A;  1E3O C;  3FXM A;  1QZZ A;  2HVS A;  2FOW A;  1XSX A;  1WJF A;  2XIG A;  3LSR A;  4LG0 B;  4CCK A;  2ZME B;  3QPS A;  1Z67 A;  3G1M A;  1RET A;  1QNT A;  3TO9 A;  1JKR C;  2LH9 A;  1HW5 A;  2H8W A;  3BTL A;  1IGN A;  2ZKZ A;  1RI7 A;  4HST A;  2NVY J;  2R7F A;  1SFE A;  2FF4 A;  2EPF A;  1Y1V J;  1Z7L A;  3U21 A;  5F1J A;  4EJU A;  2XSJ C;  1NG6 A;  2L02 A;  3FM3 A;  3VSK A;  2UWM A;  3S16 J;  3H5R A;  1D3Y A;  2COM A;  4I2O A;  2A07 F;  5E3O A;  1PP7 U;  3JRE A;  4QLC U;  5EEH A;  2M7A A;  1E0E A;  2K9L A;  5J4V A;  5L3B A;  4NC8 A;  3TGN A;  2OCC H;  1TTY A;  3Q3S A;  1Z0X A;  1K4S A;  2EWN A;  3B6A A;  1U0J A;  2ME6 A;  1JKO C;  5FKK A;  1XD7 A;  2HS5 A;  1YOV B;  2GZW A;  1YJ9 I;  4CIC A;  2P4W A;  2B9S A;  3J80 Z;  3I55 I;  1REP C;  3DLL F;  4JX6 A;  2L7K A;  2DT7 B;  1U9N A;  3A0B C;  3MZY A;  1RUN A;  2CW7 A;  3KLO A;  3LWF A;  2JQ7 A;  1I27 A;  2YUS A;  1RES A;  5J40 A;  1WJ5 A;  4OAZ A;  1MBK A;  4O3M A;  1EH7 A;  1Z1D A;  2WV1 A;  1SAN A;  4U0Y A;  1QZY A;  4P9F A;  3HOZ J;  4LG3 A;  2MGQ A;  3RCO A;  1IUF A;  5IP7 J;  3J7A Y;  2M1B A;  4IOC F;  1OCP A;  3GUD A;  5E1W A;  2BXZ A;  1NHA A;  2Y9Z A;  1MH4 A;  2XPV A;  2ZSI B;  3MKZ A;  3CME I;  3ZMS A;  3CQZ J;  1AHD P;  5JI6 A;  3GFI A;  1AWC A;  1BOB A;  4HF0 A;  4F52 A;  3T8R A;  1LFU P;  4JP0 A;  1IXS B;  3OWT A;  2NRA C;  3K4M A;  3ECH A;  3HRS A;  1JUM A;  1BL0 A;  4ZDP A;  4IHW A;  2XB5 A;  2V4J C;  4B47 A;  3E7L A;  1I3A A;  2MD5 A;  1TZL A;  2CUJ A;  3LFK A;  2GIZ A;  4LIT A;  1ETO A;  2VUM J;  5M5W J;  2HKX A;  3VSL A;  2AQF A;  1J75 A;  2MG4 A;  4C2T A;  3HRT A;  3K10 A;  4E7L A;  1QO0 D;  2LKP A;  4IKF A;  4K2E A;  1HDP A;  2PEX A;  4PK4 A;  3GBG A;  5FJ8 J;  1W0T A;  5E8I A;  1U9O A;  2P7C B;  4L9J A;  1EKE A;  2FE3 A;  4RB1 A;  2CFX A;  3TOB A;  2KIU A;  2X9D A;  2XF6 A;  4RB3 C;  1J09 A;  4M3E A;  1LKX A;  1XGM A;  1O57 A;  4EQQ A;  2EZK A;  2GIV A;  1TL8 A;  3ROU A;  1MMA A;  1KA8 A;  4HEA 2;  3H92 A;  4A0X A;  2QSH X;  4ZH4 F;  1MBG A;  2TCT A;  3CES A;  1SFU A;  4PFP A;  3VB2 A;  4PSW A;  1X1P A;  4PSX A;  3RKY A;  1IN4 A;  3W6V A;  3CZ6 A;  2VXZ A;  1D1C A;  3WTX C;  3HSE A;  4OMZ A;  2NS0 A;  1MJB A;  1HCR A;  3HRU A;  4Y17 A;  2PMU A;  2W85 A;  1W7P D;  3BJA A;  4BKX A;  1PJR A;  1EJ9 A;  3KYC B;  3PNV A;  5D5U B;  4OIP F;  1JHF A;  2WY8 Q;  1YW8 A;  2IJL A;  3DKY A;  2M30 A;  2G0E A;  3HJE A;  3FXO A;  1K78 A;  1MMD A;  2H1K A;  4L9N A;  1MBF A;  2QWW A;  1I6H J;  4FCY A;  3K9T A;  4S0H B;  3GTQ J;  2XGE A;  2FU4 A;  2B0L A;  1XGN A;  4M6V A;  2L7M P;  2PMZ N;  4HV5 A;  1T8I A;  4PDK A;  3S15 J;  2DFI A;  2QBY A;  5DCF A;  4B43 A;  1UJ8 A;  4CZZ A;  4IX7 A;  2V79 A;  3L7W A;  1T08 B;  1H9T A;  3WTZ A;  2IS6 A;  5DD4 A;  1YIO A;  4DNC A;  2HGC A;  1D0X A;  1A5J A;  3KEQ A;  2UXN A;  3GCM A;  4JK1 X;  1JKQ C;  4CCM A;  1VI0 A;  3W2W A;  3F8F A;  3NAR A;  3WGH A;  2JJ7 A;  1OJL A;  2R7R A;  2E35 A;  2GLO A;  4AIJ A;  1F4K A;  4G6D A;  3B6C A;  5D4R A;  2CW8 A;  2YSR A;  3KZZ A;  3RZD J;  2BGC A;  3WE3 A;  4L18 B;  4KIG A;  5CVJ A;  3KFW X;  4FIS A;  1D8K A;  5E3N A;  3I4N J;  3IP4 B;  4B48 A;  2DA7 A;  4A3I J;  2KZG A;  4IRH A;  4RAF A;  1O4X A;  1D1A A;  1NK2 P;  4CGZ A;  4DBQ A;  2OPT A;  2IGM A;  1L0O C;  2GXG A;  2OA4 A;  1QHH D;  4BQN A;  1IN8 A;  4HQE A;  2L7F P;  4II2 A;  4MTD A;  2X6Y A;  1SC7 A;  2R7X A;  3EPZ A;  3ONQ A;  5LRR A;  3B02 A;  2IAI A;  2XDV A;  1KQ8 A;  2D5V A;  4E7J A;  3WG7 H;  2PG4 A;  3DBR B;  1EF4 A;  2L4M A;  3RIR A;  1FLI A;  2O7O A;  3RDI A;  1MBE A;  2ZNY A;  2EB7 A;  3SZG A;  4EVI A;  1FIP A;  3DQV C;  3MKW B;  2JVH A;  2K5C A;  2F4O B;  2DOA A;  4UV9 A;  1OCT C;  2E60 A;  2CV2 A;  2BEO A;  2FEZ A;  3C18 A;  1TWA J;  3LA2 A;  3IUO A;  1JHH A;  4N9H A;  4LIV A;  4OIN F;  3BOQ A;  1U3E M;  3QPH A;  3GTG J;  2GAU A;  1C0W A;  5IPA A;  4HX8 A;  2HYJ A;  3FXL A;  1FY7 A;  2KJB A;  3GTM J;  1A36 A;  3QYE A;  3H0D A;  3SJM A;  4M9S A;  2RC4 A;  2Q2E B;  2KT0 A;  3F8C A;  1HW2 A;  2R5Z A;  1FOX A;  3K4L A;  3I5U A;  2YR2 A;  3WU2 C;  2MW8 A;  1ERD A;  2R7D A;  4XIC A;  3AKZ A;  2ESH A;  2FML A;  3WTW C;  5FB2 A;  2VBW A;  3HYI A;  2HR3 A;  2M34 A;  4JX5 A;  3CP2 A;  3GTO J;  2AS5 F;  1AA7 A;  1J9I A;  1X1C A;  2GBY A;  1KU9 A;  5FO5 A;  3NEU A;  5LD2 C;  3HGG A;  1XDU A;  4IHS A;  3CCU I;  3GFL A;  3KE2 A;  2BXY A;  2IGO A;  4FQG A;  4A0Y A;  2JA5 J;  2IA2 A;  1YW9 A;  3WTV C;  3MKY B;  1LJ9 A;  1HW1 A;  4C9Y A;  2E1C A;  1G3W A;  2KLO A;  5M3F J;  3TO7 A;  3A0H C;  1Z7U A;  2NNY A;  3FXK A;  1EV7 A;  2CJJ A;  3RJP A;  1P9Q C;  1R7J A;  2K27 A;  2WAE A;  1S5L C;  3RZO J;  2KQR A;  2QEX I;  4BQA A;  2MAB A;  3F21 A;  1Z3X A;  2LFB A;  2VJJ A;  3V7S A;  4O6J A;  2X0L A;  4U88 A;  3C2H A;  2DPD A;  1HLV A;  2E5Z A;  3E5U A;  3S1N J;  2YS9 A;  2H8R A;  1S3J A;  1HSJ A;  2EIL H;  2R5Z B;  4BJ6 C;  5EJC A;  1BR2 A;  2DT6 A;  5AON A;  1S72 I;  4FX4 A;  4Z6Y A;  1RKT A;  3ELK A;  2Z33 A;  3ZRG A;  4Q47 A;  4BJT A;  1GHC A;  3K4K A;  4RB2 C;  4R1H A;  2VQH A;  1K61 A;  2A6E F;  3F22 A;  3TDZ C;  3RKW A;  4ESF A;  3LQQ A;  4YII A;  2FJ1 A;  3K4N A;  2JK3 A;  2RV8 A;  5HDG A;  1R36 A;  1DDN A;  5CVV A;  2GA1 A;  2EFP A;  5M5X J;  3DKW A;  2DI3 A;  4D7M A;  3Q0U A;  4A3F J;  3RYP A;  3CO7 C;  4A93 J;  4X6A J;  3HOT A;  4BY1 J;  3PQJ A;  2RQP A;  4JQF A;  5B5E C;  3L2Q A;  4FHT A;  4RLF A;  2FQ3 A;  1IAW A;  5HOO A;  1TT5 B;  5H2F C;  1DGW Y;  1V5G A;  2KPM A;  3ASO H;  3FM5 A;  3ERM A;  1YLF A;  2VC1 A;  2MC3 A;  3C2G A;  4CSW A;  2DN0 A;  3K70 C;  1R9T J;  4B3A A;  1R5H A;  1MJA A;  1CF7 B;  3TBI A;  3I4P A;  3WGI A;  1KQ0 A;  3V8J A;  2A05 A;  4MHG A;  4AC0 A;  4UXN A;  3KPH A;  4HDU A;  1S29 A;  1HST A;  2MLK A;  2ZO4 A;  2LKS A;  5E1X A;  1LVK A;  1D0Y A;  2VKV A;  3BG9 A;  2LF7 A;  2ZFU A;  3DU5 A;  3BY6 A;  1I39 A;  4W97 A;  1ORK A;  2ECC A;  3CUQ C;  1K6O A;  4I98 B;  2BV6 A;  3J81 Z;  4W1U A;  3SFZ A;  1UHM A;  4HQM A;  1UG0 A;  2DA1 A;  5H6Q A;  5EZG A;  3ZMZ A;  3RQ4 A;  2WTE A;  5AIQ A;  5EGO A;  3GTL J;  5FFZ A;  2DYR H;  5ED4 A;  1NK3 P;  4HNT A;  1Z6R A;  4XMY A;  3E5X A;  1VQN I;  3ULQ B;  3IV5 A;  1IXC A;  5K5O A;  1FOY A;  4QTR A;  2QQ8 A;  4Y33 A;  2JRM A;  4M6Y A;  1I1G A;  4UHT A;  1HF0 A;  4E4H A;  3JSO A;  1OMI A;  4NBQ A;  3BPV A;  3TL4 X;  4BE2 A;  5IT9 K;  2Y0M A;  3HUG A;  3GTP J;  5E17 F;  4N0B A;  2FBH A;  3AG3 H;  1E2X A;  3N4M A;  2L4A A;  3I58 A;  2A69 F;  2KRH A;  4E7I A;  3U2R A;  5GAE J;  3WG9 A;  2M0M A;  3WTS C;  3BJ6 A;  3FMR A;  2ETH A;  4CCN A;  1B8I A;  1BI2 A;  4A3C J;  1QVU A;  4KN4 X;  2VT3 A;  3KIO A;  4S05 A;  2XAH A;  3WE2 A;  1OFC X;  3LST A;  5L3D A;  2JUG A;  4DW6 A;  3J7Y J;  2AXT C;  2DK8 A;  3GFM A;  3FKI J;  4UVB A;  2UZK A;  1LPQ A;  2XF5 A;  3MAJ A;  3A02 A;  2I5U A;  1CQT A;  2DDA A;  4Q48 A;  2LY2 A;  5FFX A;  3I9V 2;  3HTU A;  3CDH A;  3E6D A;  4L5E A;  1LUJ B;  3IHU A;  4E70 A;  4WXD A;  1MZB A;  1CGP A;  1OYI A;  3FMQ A;  2NS8 A;  4P5O A;  1IV6 A;  3RYR A;  2DTZ A;  4ITV A;  4E6K G;  2Y2Z A;  4PJ0 C;  4AID A;  3OR2 C;  1ZH5 A;  4Y7N J;  4AYB N;  4PCQ A;  1S8N A;  2PBI A;  5F27 A;  5CQG A;  1LB2 A;  2FNA A;  3FXU A;  4I01 A;  2LOO A;  2LP0 A;  2JWT A;  1YI2 I;  3LOC A;  4UVC A;  2HDD A;  2FXA A;  4C3H J;  1AKH A;  1X1A A;  4KN7 X;  5M3M J;  4EJW A;  2A6H F;  2M87 A;  5GTH C;  3L2C A;  4J01 A;  5GAG J;  3OYL A;  1T39 A;  3HUG B;  4G7Z F;  2Q8K A;  3V8L A;  3OYM A;  4CZC A;  5E1Z B;  1E3P A;  4GDF A;  5EG0 A;  4IQJ A;  2D45 A;  4LB5 A;  4RM3 A;  2XPW A;  1EH8 A;  2VBY A;  3JW4 A;  2ZNZ A;  2CUZ A;  3ZPL A;  1FP1 D;  1FTZ A;  1A31 A;  2IBD A;  4NC6 A;  1MMS A;  5TJJ A;  2ID3 A;  4S04 A;  5TGT A;  5JLW A;  4DIQ A;  3GYH X;  1JT6 A;  3ASN H;  5J1R A;  5ERI A;  3K4C A;  3KEY A;  4MO7 A;  2L5Q A;  5A2Q Z;  1XCV A;  2P5V A;  3N97 A;  1YTY A;  2VC0 A;  3E0J B;  4MTE A;  3S3N A;  2DW4 A;  1QRY A;  5KAI C;  2HPI A;  3IAS 2;  2LF8 A;  1NTC A;  2EK5 A;  1F43 A;  5TRD A;  2L2O A;  4A6D A;  3TMO A;  3ZMT A;  3LQR A;  3TKY A;  2K9Q A;  1B72 A;  1ETW A;  1Z05 A;  4CYC A;  3KZY A;  5J1Y A;  5FLM J;  2KDO A;  1T95 A;  3NAU A;  5CPR B;  3ZQ7 A;  1ZTR A;  2KKO A;  1L3L A;  1X1B A;  4HSR A;  4ZDO A;  2K85 A;  3Q5F A;  1JE8 A;  1AKH B;  1LEB A;  1P92 A;  3DP7 A;  4QSH A;  4F7Z A;  3HOV J;  3SHF A;  3M4O J;  3V7R A;  1SEU A;  4XLE A;  3KYD B;  2JPC A;  1J2X A;  3Q9V A;  3HPH A;  3DCF A;  5EG0 B;  4XLC A;  1UAA A;  4PJN A;  3A2K A;  2BE5 F;  1BI0 A;  4IVN A;  3D1N I;  3K7A J;  4Y52 J;  1Y39 A;  2Y9Y A;  1N75 A;  2G7U A;  3K0L A;  2XGX A;  2RRE A;  3E5Q A;  1LFB A;  4KA4 A;  1MSF C;  1FC3 A;  5C3E J;  4HBL A;  4RB0 A;  3CTA A;  3UKG A;  1FPQ A;  1RRJ A;  3CCL I;  4ZYA A;  4BQO A;  3CUO A;  3CC2 I;  1X3Z B;  4GYI A;  4YFN F;  2O9L A;  4JOM A;  3IWF A;  3BWG A;  1BI1 A;  4ON0 A;  2RN7 A;  4G7O F;  1A6I A;  1DU0 A;  3VOE A;  2KZV A;  2VKD A;  5KCM A;  2HEO A;  2VQC A;  1VQ7 I;  5FKM A;  3OYH A;  1Y8R B;  4UNO A;  1TQP A;  4MLO A;  4NUB A;  3FDY A;  1J0R A;  4BJ5 C;  5BOX A;  1S6L A;  1B72 B;  4CYC B;  1VQL I;  2M2E A;  3P9C A;  1T0F C;  1H0M A;  1YS7 A;  4N9I A;  4A2U A;  5FLX K;  5CVR A;  4N4N B;  4PJM A;  3FK6 A;  5JHF A;  4O5V A;  1FYM A;  3DEW A;  1VQ8 I;  3OL3 A;  1Y6I A;  3K4B A;  1JXS A;  1O7F A;  3QOD A;  1X2N A;  1DQU A;  4OAY A;  5JHU A;  2IP2 A;  3OYC A;  3ML6 A;  3O8G A;  4I0B A;  2VBX A;  3I3L A;  2EBI A;  4RGX A;  4PGH A;  3CDI A;  2ZJR F;  1AU7 A;  1WCM J;  3CJN A;  3OS0 A;  2DFF A;  5LGU A;  1IDZ A;  1ZRF A;  3PM1 A;  4G6Q A;  2HXO A;  3CMA I;  4DZP A;  4ZZD A;  1KU2 A;  3OMY A;  2K3F A;  4M9X A;  1YE9 A;  2DAO A;  3D5R C;  3M7G A;  2X1C A;  1U5T C;  4XRF A;  1ZLJ A;  5LLQ A;  5J8C A;  3SQN A;  1YIT I;  4ETS A;  2DFH A;  5F08 A;  5BPD A;  5CVU A;  3W3C A;  4DQ2 A;  1OQY A;  3BQY A;  3DV8 A;  3OYB A;  3D0S A;  1Z21 A;  2OZU A;  2Z2S B;  3T1B A;  2JRT A;  3D5L A;  3IKV A;  3JRA A;  2LYC A;  3JCU C;  2A68 F;  4HPQ A;  1MNE A;  5IOY A;  3DTE A;  2BY3 A;  4IPA A;  4G94 A;  4RGS A;  4OU0 A;  5BS6 A;  2L9V A;  3O3K A;  1WFX A;  1A35 A;  1Y0U A;  2RAE A;  2VOD A;  1WJA A;  2FNP A;  2D1V A;  1XMK A;  2F6C A;  3F8N A;  5HS7 A;  2A6T A;  3WTY C;  2HDW A;  3FMS A;  3QP5 A;  1XSD A;  1IW7 F;  1FOK A;  2K4B A;  1RR8 C;  4LLL A;  3MKL A;  1JTY A;  4E7K A;  3CP8 A;  1JJ8 C;  2LVS A;  4I99 C;  2X48 A;  5KNL A;  2PLY A;  2ZXW H;  3JRB A;  3L00 A;  5CJ9 A;  3L2W A;  2CFO A;  1PUE E;  1TBX A;  2PQ8 A;  3M8F A;  2WAF A;  4BHC A;  5BMZ A;  4RM2 A;  3O2P E;  5F64 A;  2VOP A;  2CQK A;  3CDL A;  4M6X A;  2RNJ A;  2E34 A;  4OIQ F;  1ITY A;  3R0A A;  3H5A A;  2FBI A;  2LLK A;  2E2J J;  3K1M A;  5LBQ A;  3HHG A;  2K40 A;  1IN6 A;  1ETV A;  4V2F A;  2XAJ A;  1OKR A;  4GO1 A;  4BYY A;  2L9S A;  2YPR A;  5EYR A;  4ASN A;  3WTT C;  3W2A A;  5J6X A;  1X2M A;  4KIT B;  4GFB A;  2R7Z J;  1SAU A;  4RAZ A;  1ZGW A;  1K79 A;  1BW6 A;  5F0H A;  2PI0 A;  3S17 J;  5C4X J;  3MZ8 A;  1WHU A;  5HS9 A;  2XAF A;  1TT0 A;  2A3S A;  2JTV A;  2ELH A;  1A04 A;  4CCO A;  3BG5 A;  4MNU A;  3DPL C;  3P9I A;  1O3Q A;  3KLN A;  3FX3 A;  2XAU A;  4X0G A;  5KHD A;  4NHJ A;  1VQ6 I;  4OMY A;  4Z2Y A;  5FRO A;  2IT0 A;  1HKS A;  3QYB A;  3TW7 A;  1KYW A;  4U7B A;  1X3W B;  2WAQ N;  1WZ2 A;  2DMP A;  2ICW G;  2ZME C;  2F4I A;  3ZGK A;  4GXO A;  4L5I A;  2EIJ H;  4XKV A;  1GV2 A;  3W2V A;  3HIF A;  2DJN A;  2IVM A;  2V1U A;  2HI3 A;  4PJJ A;  4LJZ F;  3OS1 A;  2M7B A;  5F04 A;  2FRH A;  3LSG A;  1S9H A;  4RBO A;  3ZR8 X;  4FX0 A;  1WGX A;  3CCS I;  3RPU A;  5FD5 A;  2CUE A;  3GTJ J;  2FA5 A;  1OR7 C;  3DF8 A;  3ISP A;  3HOS A;  1MMG A;  3TQN A;  3ZN0 A;  3CCM I;  4KDP A;  1T98 A;  3E6B A;  3E3V A;  4B1R A;  3CJT B;  4IHX A;  4BY7 J;  3IWZ A;  2E71 A;  1W1W E;  5EEG A;  3AG4 H;  2R0Q C;  4KT6 A;  4BAY A;  3TED A;  5CVI A;  2LC2 A;  3M8E A;  4ABZ A;  2M8E A;  4UUV A;  4A3M J;  1D5Y A;  2XV4 S;  4BNC A;  2W1O A;  2DA2 A;  3BCA A;  1F1Z A;  2DLL A;  4MGR A;  1WH7 A;  1OLT A;  3QOE A;  4XOP A;  3KET A;  2LRE A;  2DJI A;  2P6S A;  5DS9 A;  3C1D A;  3JRH A;  3IH3 A;  2P81 A;  3QRF F;  3BRO A;  1YX5 A;  5IYC J;  3L2U A;  2Q0O A;  1RR7 A;  2HFH A;  2QQB A;  3CJQ B;  2LMD A;  4D5C A;  2P6T A;  3BZ6 A;  3Q0W A;  2QUF A;  1V5F A;  3CCR I;  2HQ5 A;  2FMY A;  1ETX A;  1QVT A;  1QHG A;  4BDY A;  2YU3 A;  2ID6 A;  4FAS D;  3G1L A;  2BVL A;  4MEY F;  2OTJ I;  2ZJ2 A;  4XK4 A;  3BTI A;  1G2H A;  3NWT A;  2BHY A;  2BY2 A;  2L9R A;  1JGS A;  3H0G J;  5C4J J;  2H1L A;  3BZK A;  3DU6 A;  3EUK L;  2HQR A;  1S7O A;  4U87 A;  4OIR F;  2RKH A;  5LEK A;  1MNM C;  1UZC A;  1V4R A;  1TW3 A;  1JGG A;  1FOW A;  3ZMU A;  2HVR A;  4C2M J;  2E7X A;  2Z99 A;  2HDC A;  2DU9 A;  4E7Z A;  1J5Y A;  2ADU A;  3S3O A;  1BIA A;  5FKL A;  3PIP F;  1LNW A;  1OCZ H;  2GQQ A;  2LK2 A;  1X3U A;  3NWS A;  4HA8 A;  3H3U A;  1IRZ A;  4M3F A;  1GT0 C;  5FRM A;  3U1D A;  4B8X A;  1K78 B;  1G3S A;  3BG3 A;  4I09 A;  5H20 A;  2ZXJ A;  2F5C A;  3QP6 A;  4RDU A;  5F1R A;  2W4S A;  1MDM A;  2VON A;  2HZD A;  2M4K A;  4IOA F;  2DOE A;  2KIQ A;  1R22 A;  2HVQ A;  5GP9 A;  2G7H A;  4MEX F;  3ZQC A;  3DPU A;  2NS7 A;  1JT0 A;  1WPK A;  3H3V K;  2XRO A;  4AU7 A;  2QBY B;  2ISY A;  2QEN A;  2HYG D;  2FD5 A;  4QPQ A;  2JA2 A;  3IC7 A;  4A5M A;  1J7K A;  3GX4 X;  4DYR A;  4EGY A;  1FBS A;  2CUF A;  2GWR A;  2STW A;  2QKM B;  1STZ A;  1WI3 A;  2Z3Y A;  3CLO A;  1N78 A;  5ILV A;  1ONV A;  1D8J A;  3KX2 A;  5C44 J;  3J7A O;  4NDL A;  4R79 A;  2CU7 A;  2JA8 J;  2EV5 A;  2RVC A;  1WJD A;  3OIQ A;  5F6F A;  5J8F A;  3CO6 C;  2DQR A;  2A5W A;  4AWX B;  4Y4R A;  3SFI A;  1B59 A;  1B1B A;  2YX7 A;  3WHB A;  1K7A A;  2PMZ A;  3ZQQ A; 
#chains in the Genus database with same CATH homology
 4UV8 A;  2HTJ A;  3IKT A;  3AAF A;  4WK8 F;  4ZZL A;  1BI3 A;  5E8G A;  2OU2 A;  4BHP A;  1KGS A;  3F8M A;  5D6F A;  4RGR A;  1XGO A;  2F5E A;  2XAG A;  1F5T A;  1R1V A;  2QYO A;  3BJO A;  1MDM B;  2L54 A;  1OYY A;  1UCR A;  3PFI A;  4IHT A;  2JSC A;  3I59 A;  1B9N A;  3GZ6 A;  1BM9 A;  1IUY A;  1KU3 A;  3HRM A;  3KP7 A;  3GLX A;  3P7N A;  4ENJ A;  4CHU A;  1R00 A;  4JBA A;  3U9G A;  1XMA A;  2W24 A;  3ECO A;  4CXF A;  4M71 A;  1R23 A;  1E17 A;  1O7L A;  5DV5 A;  4EM2 A;  1SMY F;  2HOE A;  3ZP5 A;  2OZ6 A;  5ICF A;  1DPU A;  4G7H F;  5JVT A;  1IF1 A;  5IT9 Z;  2O0Y A;  1OPC A;  4CO8 A;  1LDD A;  1YS6 A;  4FT8 A;  2OBP A;  2XVC A;  3GXO A;  1G6N A;  4IRG A;  4EJV A;  3IRQ A;  2DQL A;  3TDU C;  3I59 B;  1IRF A;  4L0Y B;  3QU3 A;  3KP3 A;  2K02 A;  2RGV A;  3DFG A;  4RAY A;  4ESB A;  5FGM A;  3LAP A;  1W4M A;  4M74 A;  2H27 A;  4Q5S F;  3EET A;  2QQA A;  3GO5 A;  3EUH A;  2OQG A;  2PJP A;  3FXQ A;  2GXB A;  1FWZ A;  5HDK A;  1XDS A;  3R61 A;  3EQL F;  1QBJ A;  1ZG1 A;  1ZG3 A;  3R4K A;  2WWY A;  4LGW A;  4LK0 F;  4P9U A;  3G73 A;  2P5K A;  3OV8 A;  1RNL A;  2EV0 A;  1PDN C;  2O03 A;  4KNY A;  5LGN A;  1BC8 C;  3HSR A;  5D8K B;  4XLN F;  4GGG A;  4ZYD A;  1ODD A;  3RI4 A;  3I64 A;  4LK1 F;  3EDP A;  5K5Q A;  1BC7 C;  2O8X A;  2VOO A;  1ZLK A;  2VE8 A;  3IRR A;  3FHZ A;  1SD7 A;  2NNN A;  2HWV A;  4IF4 A;  1LQ1 A;  1ON1 A;  2P8T A;  1GXQ A;  3R6S A;  1IZ1 A;  4KMF A;  2JT1 A;  1YG2 A;  1Q1H A;  3JSP A;  3GZ5 A;  4YG2 F;  3SXY A;  5BPI A;  3F3X A;  1W7P A;  1S7A A;  2VBZ A;  5CYV A;  1UHW A;  5DDG A;  4WXH A;  4QWQ A;  3WOD F;  2VT2 A;  1D5V A;  4ZYH A;  1YW7 A;  3QPT A;  2H6B A;  2J5O A;  5D5W B;  1IN5 A;  5L3G A;  2DPU A;  1MJ9 A;  5CLS A;  3F23 A;  1AOY A;  2K7L A;  4I02 A;  1WI9 A;  3V8K A;  1G4D A;  2ZFW A;  4LLG F;  1FYK A;  5FLX Z;  3TO6 A;  1R1U A;  1YO5 C;  1I5Z A;  1TQI A;  1R58 A;  4AIK A;  1W7P B;  1Z9C A;  1RUO A;  4KUM A;  3WU1 B;  1W5T A;  1Z91 A;  3JTG A;  1FSE A;  3MEX A;  2TDX A;  4P55 A;  2UXX A;  2F5D A;  1KYZ A;  1XB4 A;  4WX9 A;  3MQ0 A;  1RZ4 A;  4M9Z A;  1WWX A;  2F5F A;  4EMS A;  3K1P A;  5LHI A;  1P2F A;  1FP2 A;  5IT3 A;  3HSF A;  5L3E A;  2F2E A;  5K5R A;  1ZRD A;  2JZY A;  1HKQ A;  2XHK A;  2EFQ A;  1USS A;  2OQR A;  2K86 A;  3MCZ A;  4KT5 C;  1XCB A;  1ZYR F;  5ICC A;  4WCG A;  1IRG A;  1HBX G;  3E6C C;  3EYY A;  3BDD A;  2VN2 A;  4Y13 A;  4KIC A;  2ESN A;  4TV7 A;  5L3F A;  1OR7 A;  2WC2 A;  4GCV A;  4XBF A;  3W6J B;  4OOI A;  3QU6 A;  3MWM A;  5K1Y A;  3WTU C;  1B4A A;  2Z5U A;  4EM1 A;  5LEJ A;  5E18 F;  2IA1 A;  3GWZ A;  1P4W A;  3I0T A;  3Q9S A;  5D5V B;  1VTN C;  1ZN2 A;  4A0Z A;  1WKM A;  1PP8 F;  2XRN A;  2RDP A;  3E97 A;  3FXR A;  1UFM A;  2A5Y B;  3V4G A;  1FYL A;  2E1N A;  2C6Y A;  3JAM K;  4XLP F;  1MD0 A;  3E6M A;  2IRF G;  1QQI A;  4U0W A;  1SD6 A;  4U0V A;  1LVA A;  1WQ2 A;  5HDN A;  1FZP B;  2IPQ X;  1TQM A;  4KFC A;  3DEU A;  3WU0 A;  3REO A;  3VOD A;  1FSH A;  1GXP A;  5BQT A;  4HAM A;  4A6E A;  2ISZ A;  1BJA A;  3P9K A;  4YFX F;  4HOB A;  2CO5 A;  5HVQ C;  3FWE A;  2PMH A;  3I53 A;  4BXU A;  2EFO A;  3GW2 A;  1OYW A;  2MLG A;  1IN7 A;  4RGU A;  2EJR A;  4L0Z B;  4HF1 A;  4XSZ F;  3LAJ A;  2W84 A;  3KP6 A;  3KEO A;  3RKX A;  1BOA A;  4HLX A;  3L9F A;  3OOP A;  2W25 A;  1ZAO A;  1WRJ A;  3KP5 A;  2GA2 A;  3C7J A;  2QM3 A;  2M5W A;  1U78 A;  3C3W A;  4WF2 A;  4WXC A;  4I7H A;  3ABT A;  2LDU A;  4B09 A;  1GVJ A;  3J80 K;  2EFW A;  1HXD A;  3QAH A;  2NAZ A;  3DXJ F;  2M45 A;  1TLH B;  3ABU A;  3T5X A;  2E7W A;  2LSO A;  5LHH A;  4HDV A;  2G9W A;  2DTR A;  2IA0 A;  5D4S A;  4IXA A;  3T0Y A;  1YQA A;  1P4A A;  2KRF A;  2ZCW A;  1DUX C;  2FBK A;  3G3Z A;  3VEP A;  2MH2 A;  1FBU A;  1G3Y A;  3QOP A;  4GYG A;  2ZBK A;  5DYM A;  5HS8 A;  5KVR A;  3IL2 A;  1F9N A;  3K2Z A;  1MGT A;  3B73 A;  3FZV A;  5ICE A;  5LRS A;  1MKM A;  2Q2E A;  4A5N A;  3TOA A;  2FOK A;  1J59 A;  5ICG A;  1R1T A;  3CUQ A;  4AIH A;  1LEA A;  4Q4Z F;  2WV0 A;  3DPT A;  3LA7 A;  4A12 A;  4U7D A;  4L9V A;  5LGT A;  1SAX A;  4PGG A;  1BN5 A;  1I1S A;  2QQ9 A;  3VFZ A;  4MQV A;  3KP2 A;  5D5X B;  2OAZ A;  3KCC A;  1TW2 A;  3O6B B;  2V9V A;  1ULY A;  1FBQ A;  1XSV A;  2KIM A;  4P96 A;  3M1E A;  3HTS B;  1TNS A;  2CGP A;  3NQO A;  4CYD A;  4KIB A;  2YX4 A;  1TNT A;  2STT A;  4XSX F;  4ZYE A;  2KJC A;  4M73 A;  3CUQ B;  1SD4 A;  3R0J A;  3S2W A;  2R3S A;  2QLZ A;  3I54 A;  2IW5 A;  3LA3 A;  1YYV A;  3NRV A;  1FT9 A;  2HQN A;  1O3S A;  4HF2 A;  1EH6 A;  1ZG5 A;  3ZMD A;  2PN6 A;  4YIF A;  1H9G A;  4UVA A;  2HTS A;  1B9M A;  2QZ8 A;  4EGZ A;  2H6C A;  1CF7 A;  5FD6 A;  1BBY A;  2QVO A;  1ZRC A;  2O6G E;  4EM0 B;  4IRI A;  4G8X A;  3K1N A;  1RIO H;  5AIP A;  1XN7 A;  4EV0 A;  2V6C A;  4RS8 A;  5DUI A;  3ZN1 A;  3BP8 A;  4L9T A;  3ZMV A;  4R8H A;  5E20 A;  3F6V A;  3H3Z A;  4AVP A;  4NB5 A;  1G3T A;  3GVA A;  2XKP A;  4LMY A;  1U8R A;  1HKT A;  2DBB A;  1T6S A;  4BH9 A;  5HLH A;  3L09 A;  2BYV E;  1O3R A;  4LLN A;  2CSO A;  3ERE D;  3BPX A;  2DO7 A;  2AXL A;  1O3T A;  2HZT A;  1ZAR A;  2HKO A;  1LDK B;  2FSW A;  3V7C A;  4ESJ A;  2L01 A;  2LNB A;  2P5L C;  1SFX A;  1U2W A;  2Y75 A;  4LD5 A;  2DT5 A;  3I71 A;  1V3F A;  2ACJ A;  1ON2 A;  3MZH A;  4BHB A;  3F6O A;  1ZHF A;  6PAX A;  1T0F A;  2JPB A;  5ILS A;  1DPR A;  1P6R A;  4EJO A;  1T2K A;  3KP4 A;  5D8L B;  2Z9O A;  4H0E A;  3GFJ A;  3K69 A;  4M72 A;  4HX4 A;  1IXR C;  4EJT A;  1I6X A;  3F8B A;  1DP7 P;  3SZT A;  5D6E A;  2CYY A;  2V1X A;  4ZYG A;  5DEQ A;  4HYE A;  3GF2 A;  1U5T A;  2OD5 A;  4NQW A;  3FF5 A;  1W5S A;  2MBF A;  2X4H A;  1FX7 A;  1UB9 A;  4LB6 B;  3GEZ A;  5JR3 A;  2EV6 A;  1ZGA A;  1YFH A;  5LHG A;  5HLI A;  4OIO F;  2DK5 A;  2CWE A;  4IJA A;  3J81 K;  1ZGJ A;  4L5J A;  2CW0 F;  1R5G A;  5DCM A;  5KK1 A;  1P4X A;  2XKO A;  5L3C A;  2PFB A;  2MH9 A;  4PZJ A;  1QGP A;  1SMT A;  2BBY A;  4ENK A;  3SZP A;  3RTR A;  3M9A A;  3MFK A;  2XAQ A;  2A61 A;  5HLG A;  1BIB A;  4KYW A;  1FNN A;  2VE9 A;  1T38 A;  1U5T B;  3RPQ A;  4D0P A;  4HZF A;  4ENM A;  4HV6 A;  3W6K B;  2EFN A;  4YFK F;  3JTH A;  3WGG A;  3JAM Z;  2O61 A;  4HLY A;  4LFU A;  2K4J A;  4WWC A;  1KQ9 A;  5H6R A;  5DCM B;  4AD9 A;  2H09 A;  4HX7 A;  2D1H A;  3PQK A;  2EA4 A;  5JFR A;  1SD5 A;  5DD8 A;  4LG0 A;  1WSU A;  2ZME A;  2XAS A;  2XUB A;  2L3D A;  4KMU X;  4MQ9 F;  2NYX A;  4ENN A;  3HHH A;  1U6G A;  3EYI A;  2Y48 A;  2W57 A;  1B6A A;  3T8T A;  2MA3 A;  1Z6T A;  2CG4 A;  4I0A A;  1ZRE A;  2HYF A;  3R60 A;  4Y15 A;  1LDJ A;  5ILU A;  4HW0 A;  1XGS A;  2P7V B;  2D2W A;  5A2Q K;  2H94 A;  3F72 A;  2EA2 A;  2V1D A;  5DUK A;  4KIF A;  1HQC A;  2KIF A;  1KU7 A;  4CDG A;  2J5P A;  3COA C;  2O3F A;  1QPM A;  4G9Y A;  1UST A;  1QZZ A;  1XSX A;  2XIG A;  4LG0 B;  2ZME B;  1QNT A;  3TO9 A;  1HW5 A;  2ZKZ A;  1RI7 A;  2R7F A;  1SFE A;  2FF4 A;  4EJU A;  2L02 A;  3FM3 A;  2UWM A;  1D3Y A;  2COM A;  4I2O A;  2A07 F;  1PP7 U;  4QLC U;  5EEH A;  5L3B A;  3TGN A;  1TTY A;  2EWN A;  1XD7 A;  2HS5 A;  2GZW A;  4CIC A;  2P4W A;  3J80 Z;  1REP C;  3MZY A;  1RUN A;  3KLO A;  3LWF A;  1I27 A;  4O3M A;  1EH7 A;  1Z1D A;  4U0Y A;  1QZY A;  4P9F A;  2M1B A;  3GUD A;  5E1W A;  1NHA A;  3ZMS A;  5JI6 A;  3GFI A;  1AWC A;  4HF0 A;  3T8R A;  1IXS B;  2NRA C;  3ECH A;  3HRS A;  2MD5 A;  3LFK A;  2HKX A;  1J75 A;  3HRT A;  1QO0 D;  2LKP A;  4K2E A;  2PEX A;  5E8I A;  2P7C B;  4L9J A;  2FE3 A;  4RB1 A;  2CFX A;  3TOB A;  2KIU A;  4RB3 C;  1XGM A;  1O57 A;  4EQQ A;  2GIV A;  3ROU A;  1KA8 A;  3H92 A;  4A0X A;  4ZH4 F;  1SFU A;  3VB2 A;  3RKY A;  1IN4 A;  2VXZ A;  3WTX C;  3HSE A;  4OMZ A;  2NS0 A;  1MJB A;  3HRU A;  4Y17 A;  2PMU A;  2W85 A;  1W7P D;  3BJA A;  5D5U B;  4OIP F;  1JHF A;  1YW8 A;  2IJL A;  2M30 A;  1K78 A;  4L9N A;  2QWW A;  3K9T A;  2FU4 A;  2B0L A;  1XGN A;  4HV5 A;  4PDK A;  2DFI A;  2QBY A;  5DCF A;  4CZZ A;  2V79 A;  3L7W A;  1H9T A;  3WTZ A;  5DD4 A;  1YIO A;  4DNC A;  2HGC A;  3KEQ A;  2UXN A;  4JK1 X;  3F8F A;  3WGH A;  4AIJ A;  1F4K A;  4G6D A;  5D4R A;  2YSR A;  3KZZ A;  2BGC A;  3WE3 A;  4L18 B;  4KIG A;  5CVJ A;  3KFW X;  1D8K A;  4IRH A;  4CGZ A;  1L0O C;  2GXG A;  2OA4 A;  1IN8 A;  4HQE A;  4MTD A;  5LRR A;  3B02 A;  1KQ8 A;  2PG4 A;  2L4M A;  3RIR A;  1FLI A;  3RDI A;  2ZNY A;  2EB7 A;  4EVI A;  3DQV C;  4UV9 A;  2BEO A;  2FEZ A;  3C18 A;  3LA2 A;  1JHH A;  4N9H A;  4OIN F;  3BOQ A;  1U3E M;  3QPH A;  2GAU A;  1C0W A;  4HX8 A;  1FY7 A;  2KJB A;  4M9S A;  2RC4 A;  3F8C A;  1HW2 A;  3I5U A;  2YR2 A;  2R7D A;  2ESH A;  2FML A;  3WTW C;  5FB2 A;  2VBW A;  3HYI A;  2HR3 A;  2AS5 F;  1J9I A;  1KU9 A;  5FO5 A;  3NEU A;  1XDU A;  4IHS A;  3GFL A;  3KE2 A;  4A0Y A;  2IA2 A;  1YW9 A;  3WTV C;  1LJ9 A;  1HW1 A;  2E1C A;  1G3W A;  3TO7 A;  1Z7U A;  2NNY A;  1EV7 A;  3RJP A;  1R7J A;  2K27 A;  4BQA A;  3F21 A;  3V7S A;  4O6J A;  2X0L A;  4U88 A;  2DPD A;  3E5U A;  1S3J A;  1HSJ A;  5AON A;  4FX4 A;  3ELK A;  2Z33 A;  4Q47 A;  1GHC A;  4RB2 C;  4R1H A;  2A6E F;  3F22 A;  3TDZ C;  3RKW A;  4ESF A;  3LQQ A;  4YII A;  2RV8 A;  5HDG A;  1R36 A;  1DDN A;  5CVV A;  2GA1 A;  2EFP A;  3DKW A;  2DI3 A;  3RYP A;  3CO7 C;  3HOT A;  3PQJ A;  2RQP A;  4JQF A;  4FHT A;  2FQ3 A;  1IAW A;  5HOO A;  3FM5 A;  1YLF A;  2VC1 A;  2MC3 A;  1R5H A;  1MJA A;  1CF7 B;  3I4P A;  3WGI A;  1KQ0 A;  3V8J A;  4MHG A;  4UXN A;  4HDU A;  1S29 A;  1HST A;  2MLK A;  2ZO4 A;  5E1X A;  2LF7 A;  3BY6 A;  3CUQ C;  1K6O A;  4I98 B;  2BV6 A;  3J81 Z;  3SFZ A;  1UHM A;  4HQM A;  5H6Q A;  3ZMZ A;  2WTE A;  5AIQ A;  5FFZ A;  5ED4 A;  1Z6R A;  3E5X A;  3ULQ B;  1IXC A;  5K5O A;  4M6Y A;  1I1G A;  4UHT A;  3JSO A;  1OMI A;  3BPV A;  5IT9 K;  2Y0M A;  3HUG A;  5E17 F;  4N0B A;  2FBH A;  1E2X A;  3N4M A;  2L4A A;  3I58 A;  2A69 F;  3U2R A;  3WG9 A;  3WTS C;  3BJ6 A;  3FMR A;  2ETH A;  1BI2 A;  4KN4 X;  2VT3 A;  4S05 A;  2XAH A;  3WE2 A;  3LST A;  5L3D A;  2DK8 A;  3GFM A;  4UVB A;  2UZK A;  3MAJ A;  4Q48 A;  5FFX A;  3HTU A;  3CDH A;  3E6D A;  4E70 A;  3IHU A;  4WXD A;  1MZB A;  1CGP A;  1OYI A;  3FMQ A;  4P5O A;  3RYR A;  1ZH5 A;  4PCQ A;  1S8N A;  2PBI A;  1LB2 A;  2FNA A;  3FXU A;  4I01 A;  4UVC A;  2FXA A;  4KN7 X;  4EJW A;  2A6H F;  2M87 A;  3L2C A;  1T39 A;  4G7Z F;  2Q8K A;  3V8L A;  5E1Z B;  2D45 A;  4LB5 A;  1EH8 A;  2VBY A;  3JW4 A;  2ZNZ A;  3ZPL A;  1FP1 D;  5TJJ A;  4S04 A;  3GYH X;  5ERI A;  5A2Q Z;  1XCV A;  2P5V A;  3N97 A;  1YTY A;  2VC0 A;  4MTE A;  2DW4 A;  2LF8 A;  2EK5 A;  5TRD A;  4A6D A;  3ZMT A;  3LQR A;  3TKY A;  1Z05 A;  3KZY A;  3ZQ7 A;  2KKO A;  1L3L A;  3Q5F A;  1JE8 A;  1LEB A;  1P92 A;  3DP7 A;  4F7Z A;  3SHF A;  3V7R A;  2JPC A;  1J2X A;  3Q9V A;  2BE5 F;  1BI0 A;  4IVN A;  2G7U A;  3K0L A;  2XGX A;  3E5Q A;  4KA4 A;  1FC3 A;  4HBL A;  4RB0 A;  3CTA A;  1FPQ A;  3CUO A;  4YFN F;  4GYI A;  3IWF A;  3BWG A;  1BI1 A;  4ON0 A;  2RN7 A;  4G7O F;  3VOE A;  2HEO A;  4UNO A;  1TQP A;  1J0R A;  5BOX A;  1S6L A;  3P9C A;  1H0M A;  1YS7 A;  4N9I A;  4A2U A;  5FLX K;  5CVR A;  1FYM A;  4O5V A;  1JXS A;  1O7F A;  5JHU A;  2IP2 A;  3ML6 A;  4I0B A;  2VBX A;  4RGX A;  4PGH A;  3CJN A;  5LGU A;  1ZRF A;  4G6Q A;  4ZZD A;  1KU2 A;  4M9X A;  2DAO A;  3M7G A;  1U5T C;  4XRF A;  1ZLJ A;  5LLQ A;  5J8C A;  3SQN A;  4ETS A;  5BPD A;  5CVU A;  4DQ2 A;  3DV8 A;  3D0S A;  2OZU A;  3T1B A;  2JRT A;  3D5L A;  3IKV A;  2A68 F;  4IPA A;  4G94 A;  4RGS A;  4OU0 A;  5BS6 A;  3O3K A;  1Y0U A;  2VOD A;  2FNP A;  2D1V A;  1XMK A;  3F8N A;  5HS7 A;  3WTY C;  3QP5 A;  3FMS A;  1XSD A;  1IW7 F;  1FOK A;  2K4B A;  4LLL A;  2PLY A;  3L00 A;  5CJ9 A;  1PUE E;  1TBX A;  2PQ8 A;  3M8F A;  4BHC A;  5BMZ A;  3O2P E;  5F64 A;  2VOP A;  2CQK A;  4M6X A;  2RNJ A;  4OIQ F;  3R0A A;  2FBI A;  3K1M A;  5LBQ A;  3HHG A;  1IN6 A;  2XAJ A;  1OKR A;  4BYY A;  4GO1 A;  2YPR A;  4ASN A;  3WTT C;  5J6X A;  4RAZ A;  1K79 A;  2PI0 A;  5HS9 A;  2XAF A;  2A3S A;  2JTV A;  2ELH A;  1A04 A;  4MNU A;  3DPL C;  3P9I A;  1O3Q A;  3KLN A;  3FX3 A;  4NHJ A;  4OMY A;  4Z2Y A;  2IT0 A;  1HKS A;  1KYW A;  4U7B A;  4GXO A;  4L5I A;  3HIF A;  2IVM A;  2V1U A;  4LJZ F;  2FRH A;  4FX0 A;  3RPU A;  5FD5 A;  2FA5 A;  3DF8 A;  3ISP A;  3HOS A;  3ZN0 A;  3TQN A;  4KDP A;  1T98 A;  3E6B A;  3E3V A;  3IWZ A;  5EEG A;  4BAY A;  5CVI A;  4UUV A;  3M8E A;  2M8E A;  4BNC A;  2XV4 S;  4MGR A;  1F1Z A;  2DLL A;  3KET A;  2P6S A;  3C1D A;  3QRF F;  3BRO A;  2Q0O A;  2HFH A;  2QQB A;  2P6T A;  3BZ6 A;  2QUF A;  2FMY A;  2YU3 A;  4MEY F;  2ZJ2 A;  1JGS A;  2HQR A;  1S7O A;  4OIR F;  2RKH A;  5LEK A;  1V4R A;  1TW3 A;  3ZMU A;  2E7X A;  2Z99 A;  2HDC A;  2DU9 A;  1J5Y A;  2ADU A;  1BIA A;  1LNW A;  2GQQ A;  1X3U A;  4HA8 A;  3H3U A;  3U1D A;  4B8X A;  1K78 B;  1G3S A;  4I09 A;  5H20 A;  2ZXJ A;  2F5C A;  3QP6 A;  5F1R A;  2VON A;  1MDM A;  1R22 A;  2G7H A;  4MEX F;  2XRO A;  2QBY B;  2ISY A;  2QEN A;  2HYG D;  3IC7 A;  4A5M A;  1J7K A;  3GX4 X;  4EGY A;  1FBS A;  2GWR A;  2STW A;  1STZ A;  2Z3Y A;  3CLO A;  5ILV A;  1ONV A;  1D8J A;  3J7A O;  4R79 A;  2EV5 A;  2RVC A;  5J8F A;  5F6F A;  3CO6 C;  2DQR A;  4AWX B;  1B59 A;  2YX7 A;  1K7A A;  1B1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...