1UCRA

Three-dimensional crystal structure of dissimilatory sulfite reductase d (dsrd)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
74
structure length
74
Chain Sequence
MEEAKQKVVDFLNSKSGSKSKFYFNDFTDLFPDMKQREVKKILTALVNDEVLEYWSSGSTTMYGLKGAGKQAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Dissimilatory Sulfite Reductase D (DsrD) Protein-Possible Interaction with B- and Z-DNA by Its Winged-Helix Motif
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Unknown function
molecule keywords Protein dsvD
total genus 23
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08679 DsrD Dissimilatory sulfite reductase D (DsrD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ucrA00
2EV0A 1TW2A 1FNNA 4KYWA 1XSVA 3GFIA 3Q9VA 2ZNYA 4IHSA 1TQMA 4BHBA 3BWGA 3RIRA 2QWWA 2O0YA 3B02A 1B9NA 3BJOA 5HDNA 1XD7A 5ILSA 2NNNA 5K5OA 4HQMA 2GQQA 4NB5A 5BMZA 1B1BA 2BV6A 3ULQB 3LA7A 2L02A 4ESBA 3QPHA 3R4KA 2Y75A 5IT9Z 3HRSA 3ELKA 1QO0D 1F4KA 3FHZA 1BI3A 4K2EA 1MKMA 1G3SA 5H20A 4WK8F 4LG0A 5TRDA 3F8NA 3RYRA 1EH6A 1TLHB 3L00A 5L3EA 2B0LA 2HOEA 3TOBA 1RI7A 2UZKA 4AWXB 4TV7A 4MEXF 2FF4A 1RIOH 3EYIA 4HX7A 2DI3A 5E17F 3LA3A 1ZRFA 4PZJA 1G3YA 4YFXF 2WC2A 5L3DA 4Q4ZF 1BI2A 3EETA 3HRUA 2P5KA 1HW1A 1J5YA 3BROA 2HZTA 3HUGA 4H0EA 5D5UB 2DBBA 2DLLA 2KJBA 1D8KA 1LDKB 3ZMZA 4MTDA 1YS7A 4EMSA 1USTA 5DD4A 1FSEA 3MZYA 4FX4A 5LGNA 4XSXF 2XAFA 1J2XA 4L9NA 1O3RA 1LEAA 4LFUA 1RUOA 2K27A 5CVIA 2QQAA 1BN5A 2DQRA 4AIKA 5LGTA 3S2WA 1KU2A 3KLOA 2X0LA 5BS6A 1HKSA 4OMZA 4O5VA 5FFXA 5DUIA 3O3KA 3WGIA 2IT0A 3L09A 3E5UA 1SD6A 3ZMUA 2FU4A 3KCCA 1YS6A 1EH8A 1W4MA 4XLPF 2E7XA 4L9VA 4EJWA 1PDNC 3DPLC 2ZO4A 5LEJA 3TOAA 2FNAA 2P6SA 3CLOA 2LSOA 1QZZA 3GZ5A 4XBFA 4LLGF 1R00A 4HDVA 2PMUA 3I53A 4P96A 2DPUA 2XVCA 2XASA 2DK8A 4Y17A 4KICA 4M9XA 3O6BB 5BQTA 3COAC 1H0MA 3LQRA 1W7PD 1W7PB 2EFOA 2XAGA 1D3YA 2F2EA 3ISPA 4Q47A 2L4MA 2VONA 1BM9A 1LEBA 2FMYA 1FBUA 3IRQA 1TW3A 5HS7A 4MHGA 1GXQA 2HS5A 1G4DA 3WG9A 3F6VA 2RQPA 1QNTA 2P5LC 5DYMA 1WKMA 2ESNA 3HRTA 5AONA 2D1VA 2K4BA 3EUHA 4A12A 3CJNA 1FP1D 2QLZA 5FLXK 4LK1F 3VB2A 4IRGA 2H09A 4RGUA 2O3FA 4KIGA 2PFBA 4R8HA 4D0PA 4G7ZF 3AAFA 2JRTA 2MLKA 3BZ6A 4P55A 1UHMA 1U78A 1T0FA 3R61A 5JR3A 4KFCA 4MGRA 2JSCA 2ZXJA 1ZH5A 3Q5FA 4GYGA 3EQLF 4KDPA 3M1EA 3R0AA 3SZTA 4ZYDA 3VOEA 4U0VA 4S05A 2DTRA 1LDDA 4CO8A 1YFHA 5AIQA 2DK5A 4RGXA 3RYPA 4IHTA 1C0WA 1WQ2A 4P5OA 1S8NA 5HLGA 2OQRA 3H92A 2PMHA 2GXGA 3GW2A 4HV6A 3L2CA 2HTSA 1OYYA 3P7NA 1BIBA 4U7DA 2DQLA 3LSTA 1U5TC 4I0AA 2BGCA 5DCMB 4B8XA 2IRFG 3P9KA 3OOPA 1O3TA 2YX4A 1BJAA 4OU0A 1FBQA 2HQNA 1T98A 4HLYA 4Q5SF 1YQAA 4RGRA 2HKOA 2Z33A 4UHTA 5DDGA 2D2WA 1YIOA 1W5TA 3RPQA 4ZZDA 4HX4A 2A5YB 4RB2C 3QOPA 3LFKA 1ULYA 2YR2A 3E5QA 2VT2A 2NAZA 2BYVE 1MZBA 3W6KB 3ZMTA 1Z91A 1P4XA 3DP7A 4AD9A 3DXJF 3KP2A 1OKRA 3E3VA 4UV8A 3WTZA 4NQWA 5CVJA 4BHPA 5ICCA 3F8FA 2M5WA 3OV8A 3KP5A 1J9IA 2DU9A 2CGPA 4LLNA 3BDDA 1TQPA 2V1XA 3E6BA 3E6CC 2OA4A 4MNUA 2VBZA 2MH2A 4ENJA 4R1HA 1K7AA 4OMYA 4U0YA 2MLGA 4G94A 2BE5F 3RPUA 4G7OF 2XKPA 3J7AO 2OD5A 1P4AA 4A5NA 1OR7A 4KT5C 3J80K 4CXFA 3BY6A 3TDZC 3KEOA 2O6GE 4CYDA 1XGSA 2XAQA 1Z9CA 1R7JA 1IXCA 4E70A 1EV7A 1XCVA 3WGHA 2ZKZA 1BIAA 5J6XA 2DFIA 3I0TA 1ZYRF 4EM0B 4UVCA 4UXNA 2A6EF 5A2QK 3ZMSA 3E6MA 1KYWA 2VE8A 1QQIA 2FNPA 2VC0A 1ZG1A 4RAYA 1FX7A 5IT3A 1KQ0A 1YLFA 4ZZLA 2RGVA 3QU6A 2CO5A 2XUBA 2A6HF 2ACJA 1IXRC 2CYYA 2MA3A 5ILVA 3ZMVA 3TO9A 3MZHA 1U3EM 1O3QA 3IWFA 2RC4A 2P6TA 5HDGA 2WTEA 1J75A 3MWMA 2L54A 4G6DA 3MCZA 5DV5A 4UVAA 1F5TA 2XROA 2EJRA 2PJPA 3NQOA 4PCQA 3T0YA 3SFZA 1Z05A 2LF8A 1IF1A 3FMSA 4CDGA 1ONVA 2CSOA 5BPDA 2ADUA 2JPCA 5D6EA 2CFXA 2CQKA 2J5PA 4LJZF 1LDJA 2OAZA 3U2RA 5F1RA 3WTUC 1BBYA 1MJ9A 4RAZA 1ZARA 3TQNA 2P5VA 2V1DA 3ROUA 1ZGJA 2Q2EA 3P9CA 1BI0A 4PGGA 4A0ZA 2AXLA 3N97A 1K6OA 2KIFA 1F9NA 2GAUA 3I59B 6PAXA 2QBYA 1XDSA 4UUVA 1H9GA 4EGZA 1R5HA 4EVIA 3F3XA 1G6NA 4O6JA 3ZQ7A 4BAYA 5CVUA 2L4AA 2MD5A 3IKVA 2M30A 3GLXA 2IW5A 1AOYA 2KRFA 1S29A 2P8TA 3TO7A 3W6JB 3JTGA 1Y0UA 1IRGA 2DW4A 2KJCA 3O2PE 3M9AA 2OBPA 5K1YA 2VC1A 2VBYA 1IW7F 3T8RA 1FYMA 3GF2A 2EWNA 4ZYGA 5LHGA 3KZYA 1K78A 4A6DA 2EV5A 5HOOA 4UV9A 3JSPA 1UFMA 2ZFWA 1O7FA 4JQFA 3HOTA 2GXBA 3V4GA 2XRNA 3I59A 4KNYA 2IPQX 3M8FA 3RJPA 2G7UA 4N9IA 4AVPA 2RKHA 4PDKA 3F8MA 4RGSA 3WE3A 2PBIA 2VT3A 1UHWA 3GUDA 1MDMA 1IAWA 2ZMEB 4HV5A 1T38A 1T6SA 4HAMA 1TQIA 1EH7A 5E1WA 5CYVA 2E1NA 3WTXC 1MJAA 1U5TA 5D4RA 1KU3A 5DEQA 4HBLA 1E17A 4HLXA 3SXYA 1U5TB 2EFNA 4CHUA 5HDKA 1IN6A 3KEQA 1STZA 4A2UA 1ZGAA 1K78B 2FA5A 2XIGA 3DFGA 3K2ZA 1MDMB 4KIFA 5K5RA 2VE9A 3HSFA 4L5JA 4IF4A 1OPCA 2FEZA 3VODA 1B9MA 1KQ9A 2OZUA 3GXOA 1MJBA 2ELHA 5DCFA 3HHGA 1J59A 1T39A 1HSTA 5J8FA 2HQRA 4CZZA 1CF7B 3V7RA 3HTUA 5L3GA 1FY7A 1IZ1A 3IKTA 2EB7A 5E1ZB 2MH9A 3U9GA 3J80Z 2IA2A 3BPXA 4EJTA 1ON1A 2C6YA 3WU0A 5E20A 1K79A 5H6RA 2QUFA 2ISZA 1JGSA 4XRFA 4S04A 1U8RA 2F5DA 2FBHA 2Z9OA 3V7SA 3ZP5A 3SQNA 4WXCA 4M73A 5CVVA 3F22A 2IJLA 4ZH4F 2G7HA 1WSUA 3M8EA 3TO6A 4EJOA 1HSJA 1WRJA 4L9JA 3JW4A 3NRVA 3MEXA 4A6EA 2JT1A 1O7LA 1TBXA 1HKQA 1LB2A 2R7FA 5D5VB 1FT9A 2NNYA 1J7KA 2KIMA 1X3UA 1ZG5A 3ABUA 2HEOA 3NEUA 5FFZA 4RB3C 3WTVC 1WWXA 3KLNA 3EDPA 5D8LB 4I7HA 1ZAOA 2H6CA 3DKWA 4EQQA 2V79A 2XAJA 2OU2A 3IC7A 1B4AA 2VBWA 3LA2A 4Y13A 2MC3A 1O57A 2P7CB 2HKXA 2K7LA 2XHKA 2W57A 4RS8A 1OYWA 2QZ8A 2W85A 4G7HF 2K02A 1B6AA 2FBKA 4P9UA 1REPC 1DPUA 5J8CA 4L5IA 4YFKF 3M7GA 4WCGA 1RZ4A 2Q0OA 2QQ9A 4KIBA 1E2XA 1R58A 2QM3A 3G73A 1XSDA 3WTTC 1L3LA 1PP8F 3WTWC 2G9WA 2XGXA 3QP6A 4HF2A 4OINF 4LD5A 1I6XA 1KGSA 1S7OA 3R60A 2YSRA 5HS9A 5F64A 5ILUA 3C7JA 2CWEA 2IA1A 3HSRA 5JVTA 5D4SA 3QAHA 2FSWA 2ZJ2A 1F1ZA 2EFPA 2HYGD 4A0YA 4I2OA 1MGTA 3TKYA 1D5VA 1HW2A 1O3SA 1QBJA 1SFXA 2HWVA 2H94A 4Z2YA 1JXSA 3WE2A 2X4HA 1I1GA 1WI9A 4O3MA 2RDPA 2QENA 4IRIA 3K1PA 2ETHA 2KIUA 2O61A 5JHUA 2EA2A 3ZN1A 5LLQA 2H6BA 3GFMA 3JTHA 1HW5A 1NHAA 3D0SA 2GA2A 5D8KB 5EEHA 2R3SA 1XCBA 3CO6C 2L01A 1VTNC 1R22A 4I98B 1LQ1A 2VN2A 3GFLA 2Z5UA 1YTYA 2UWMA 4A0XA 1W5SA 4YFNF 2IP2A 3K0LA 2EFQA 3I4PA 2W84A 5TJJA 3JAMK 5AIPA 2RVCA 2V9VA 1TNSA 3RKWA 3E97A 1YO5C 3K69A 2E1CA 1D8JA 1LNWA 3ECHA 1OMIA 3F8BA 5ICFA 3V8JA 3V8LA 2HYFA 2DO7A 4IXAA 3J81K 1FOKA 3FZVA 2FMLA 3GZ6A 2AS5F 4MTEA 2COMA 1S7AA 3QRFF 5CLSA 3F23A 3BJAA 5FB2A 3SHFA 3QPTA 1BC7C 1V3FA 4I09A 3K1NA 1IN7A 3ZPLA 1FYLA 4AIJA 2A68F 4M6XA 3WU1B 1P2FA 1JHFA 5D5WB 1PUEE 4WXHA 2ZNZA 3H3UA 2E7WA 1Z6TA 1W7PA 2A61A 1KYZA 4ZYHA 1MD0A 4EGYA 4IJAA 1FSHA 5E1XA 1KA8A 4FT8A 4Y15A 3HYIA 2JTVA 1SAXA 4GGGA 3CTAA 1A04A 3LWFA 4NHJA 1ZN2A 2GIVA 3FXQA 3KP7A 4U0WA 1TNTA 4M71A 2VOOA 1P92A 3FM5A 2NRAC 3HHHA 3HTSB 2M45A 4IPAA 4HYEA 3FMQA 4M9ZA 1LJ9A 3HOSA 5HS8A 2PG4A 2LF7A 3LQQA 1S3JA 3ZN0A 3T5XA 2M8EA 5ED4A 4EM2A 5K5QA 1Z1DA 5L3BA 4L0YB 4WX9A 1FLIA 5E18F 3ABTA 4KMFA 2IVMA 1U2WA 2PLYA 2VXZA 2NYXA 1UCRA 4YIIA 5FD5A 4L18B 4OIRF 2P7VB 3GX4X 5HLHA 1DUXC 1HBXG 1BC8C 3SZPA 1IN4A 4P9FA 5FD6A 4GCVA 4BNCA 4LB6B 3DF8A 1Z6RA 3FX3A 3I54A 2V1UA 5E8GA 1BI1A 1SD5A 2ZCWA 2EK5A 5H6QA 3GYHX 4GO1A 3PQJA 2V6CA 4LMYA 5E8IA 2GWRA 1CF7A 2FRHA 4L9TA 1HQCA 2DT5A 3E5XA 1P6RA 3IWZA 1GVJA 4JBAA 4MQVA 3CDHA 3GEZA 4U7BA 5EEGA 5L3FA 4ENNA 1ZRCA 3KP6A 1QZYA 1BOAA 3P9IA 3F8CA 4KUMA 3D5LA 3RDIA 3MQ0A 1V4RA 4UVBA 5ERIA 4KMUX 2HTJA 4IVNA 3J81Z 2RN7A 2NS0A 4XSZF 2K86A 5LHIA 3JSOA 3QU3A 2HR3A 5DUKA 3BPVA 3FXUA 4GYIA 2A07F 4OIPF 3FM3A 2VOPA 1B59A 4ESFA 2QYOA 2A3SA 2LKPA 2DAOA 5LRRA 5IT9K 1USSA 5BOXA 4KA4A 4AIHA 2ESHA 2IA0A 4LG0B 4IRHA 4OIOF 1ZHFA 4HF0A 1XSXA 3CUOA 4MEYF 1XGMA 4BXUA 1FC3A 4L0ZB 1XMAA 5HVQC 2LNBA 2YU3A 4LK0F 3MFKA 3WTYC 2PQ8A 3GVAA 2HGCA 5D6FA 2F5EA 3ECOA 4EJUA 1RNLA 3VEPA 3HRMA 4HZFA 1IUYA 3CUQB 2Q8KA 2H27A 2PEXA 3FF5A 3ML6A 1I27A 1R1UA 5DCMA 2A69F 3IL2A 4LLLA 2J5OA 4LB5A 3T1BA 4HW0A 3DV8A 2VODA 4ENKA 2STWA 4A5MA 2R7DA 3U1DA 1FP2A 3G3ZA 2W24A 2HDCA 2K4JA 4I02A 3L7WA 1ODDA 1FWZA 4YG2F 3HSEA 5LHHA 1YYVA 2QBYB 4EV0A 5HLIA 3WTSC 5FGMA 5LRSA 2PN6A 2EV6A 1R36A 2XV4S 2YPRA 3Q9SA 3MAJA 1HXDA 2EA4A 2OZ6A 2WV0A 3CUQC 4JK1X 1QPMA 3F6OA 1ZREA 1KQ8A 3K9TA 4HF1A 3JAMZ 3TGNA 1SFUA 2YX7A 2JPBA 3E6DA 4ETSA 2FOKA 5ICEA 5LGUA 1IN8A 1SD7A 4OIQF 2QQBA 3KZZA 4QWQA 4EJVA 1HKTA 3KFWX 2ZBKA 5L3CA 4WF2A 2KKOA 4DQ2A 5F6FA 1R23A 4WXDA 3CUQA 4BH9A 2L3DA 3GO5A 1R1VA 1FPQA 1I5ZA 3V8KA 3KETA 3WGGA 4YIFA 4G8XA 4ZYEA 2Y0MA 5JI6A 4M72A 1TTYA 3BP8A 4M9SA 2RV8A 2P4WA 4QLCU 4FHTA 2PI0A 1XGOA 3KE2A 2F5CA 4CICA 5A2QZ 1AWCA 1OYIA 1IXSB 3I64A 2D45A 1JE8A 4N0BA 3L9FA 1U6GA 4BQAA 2VBXA 2STTA 5FLXZ 1GHCA 1IN5A 4R79A 2HFHA 1XMKA 5D5XB 4F7ZA 1G3WA 5DD8A 2Y48A 3GWZA 1SD4A 3EYYA 5KVRA 2RNJA 4B09A 2UXXA 3C1DA 4I01A 4FX0A 4M6YA 4MQ9F 4UNOA 3B73A 5LEKA 2WWYA 1YW8A 3K1MA 4HX8A 2TDXA 2M1BA 2EFWA 3QP5A 1T2KA 4M74A 2FE3A 3C18A 3RKXA 4RB1A 4DNCA 1R1TA 1P4WA 2D1HA 4ENMA 2OQGA 5BPIA 1SFEA 3R0JA 1XDUA 1RUNA 1XB4A 4HOBA 3IHUA 1XGNA 2XKOA 3BJ6A 4HDUA 1FBSA 1DPRA 4G9YA 2JZYA 4PGHA 1YG2A 3T8TA 5FO5A 1FYKA 4G6QA 3DEUA 1ON2A 1H9TA 4KN7X 2BEOA 1KU9A 3F21A 3REOA 4OOIA 2FBIA 1YW7A 4N9HA 1ZRDA 3FMRA 1ZLJA 1ZG3A 4Q48A 4LGWA 3F72A 3ZMDA 1SMYF 1J0RA 2M87A 3PFIA 4HQEA 1CGPA 3DPTA 1L0OC 1DP7P 2GZWA 4KN4X 3RKYA 3V7CA 1I1SA 3LAPA 3KP3A 2FQ3A 1UB9A 5CJ9A 5CVRA 2CG4A 1XN7A 3LAJA 1JHHA 5ICGA 2CW0F 1ZLKA 1SMTA 1GXPA 1KU7A 2DPDA 2O03A 1R5GA 4GXOA 3RI4A 2MBFA 4WWCA 1Q1HA 4XLNF 3CO7C 4I0BA 2O8XA 2LDUA 2W25A 2QVOA 3GFJA 3DQVC 3FWEA 4BHCA 3ERED 3RTRA 3C3WA 2UXNA 1QGPA 4ON0A 4BYYA 1PP7U 1S6LA 5LBQA 3FXRA 1Z7UA 3BOQA 4RB0A 3R6SA 3WODF 3I71A 3N4MA 3PQKA 2ZMEA 4ASNA 4CGZA 2ISYA 5JFRA 2XAHA 2F5FA 3HIFA 3H3ZA 3IRRA 1IRFA 4EM1A 1G3TA 4ESJA 4HA8A 1LVAA 2FXAA 1YW9A 3I58A 1FZPB 3VFZA 5KK1A 3I5UA 2BBYA 2GA1A 4U88A 3KP4A 2Z3YA 1DDNA 3TDUC 2Z99A
chains in the Genus database with same CATH superfamily
2IS1A 3UKGA 3HGYA 2GOMA 2EV0A 1TW2A 1FNNA 4KYWA 1ZR2A 1XSVA 2W7NA 3GFIA 3Q9VA 2K5CA 2ZNYA 4IHSA 2MGQA 1GV5A 1N77A 1I3QJ 1TQMA 4BHBA 3BWGA 3RIRA 2QWWA 3GMEA 2DDBA 2O0YA 2LREA 4B4CA 3A02A 3B02A 1B9NA 1TWAJ 3BJOA 3LL7A 5HDNA 1XD7A 3AG3H 5ILSA 2R7TA 2NNNA 2R93J 2AQFA 5K5OA 4HQMA 5HODA 4BY1J 2GQQA 2BHYA 1EKEA 3DCFA 4NB5A 2X85A 3S1MJ 5BMZA 1B1BA 1NK2P 1S5LC 2BV6A 3ULQB 4DIQA 3LA7A 2L02A 1EJ9A 1GLNA 4ESBA 3QPHA 1K83J 1X58A 3K4LA 3R4KA 2Y75A 5IT9Z 1I3AA 3RKQA 1D1CA 1PVEA 3F9KA 3HRSA 3ELKA 1QO0D 3S1RJ 1F4KA 3FHZA 1IRXA 1BI3A 4K2EA 1S9HA 1MKMA 1G3SA 5H20A 2I8DA 4WK8F 4LG0A 5TRDA 3F8NA 3RYRA 1EH6A 3BC8A 2DCEA 2OTLI 1QU3A 3GTPJ 4D1QA 4M3DA 4ANJA 5J4YA 1TLHB 3L00A 5L3EA 1X4PA 2LOOA 3OS2A 2B0LA 2HOEA 3TOBA 1VQ6I 1RI7A 2UZKA 4AWXB 4TV7A 2M0CA 3OWTA 1U9NA 1TL8A 4MEXF 2FF4A 1RIOH 3EYIA 4HX7A 2DI3A 4BDYA 5E17F 3DBLB 1VZ0A 3LFUA 3LA3A 1ZRFA 3GTKJ 3DTKA 4IL6C 1H89C 3PNVA 2DTZA 4PZJA 1G3YA 4YFXF 2ZJQF 2WC2A 5L3DA 4Q4ZF 5HLTA 1BI2A 3EETA 1YOVB 3H35A 2CV0A 1VQKI 2DJIA 3HRUA 1XTAA 2P5KA 1HW1A 1J5YA 2FD5A 4XLHA 3BROA 2HZTA 1IGNA 3G1LA 4BJ6C 3HUGA 3FDYA 5TISC 1LFUP 4H0EA 4IOCF 3ZQLA 2F6CA 3BR6A 5D5UB 1R5ID 2DBBA 2DLLA 2KJBA 1D8KA 1LDKB 3ZMZA 4MTDA 2VJ4A 2L9RA 1YS7A 3BQYA 4EMSA 1USTA 5DD4A 1E0EA 1WI3A 3P5JA 1FSEA 3MZYA 3OL4A 2M4GA 5CPRB 4FX4A 1TC3C 2BY1A 2E35A 5LGNA 3S8PA 4XSXF 3JRDA 2XAFA 3AG2H 5JLWA 2DDAA 3HOUJ 2NOGA 1J2XA 4L9NA 1MW7A 4XKBA 1X4OA 3K70C 1O3RA 3LMMA 1LEAA 2KDZA 1A31A 2E2JJ 2DOEA 4LFUA 1RUOA 4DBQA 5EG0B 2K27A 2WA0A 5CVIA 2QQAA 1BN5A 2HYJA 5DM7F 3KX2A 2DQRA 4AIKA 2WAFA 3FBNB 3HOZJ 2L7KA 2O9LA 3L2VA 5LGTA 3S2WA 4YELA 1KU2A 3KLOA 4H4KC 2NVXJ 4A3LJ 1E3HA 3HBLA 2M7BA 2X0LA 2IGMA 2XB5A 3BR1A 5BS6A 4BUPA 1HKSA 4OMZA 4O5VA 5FFXA 1LUJB 4DZJA 4HPQA 3O3KA 5DUIA 3WGIA 3M07A 4X1EA 2IT0A 1HC8A 3L09A 5GADJ 1JUPA 3E5UA 3CP8A 3G1MA 1SD6A 3ZMUA 2FU4A 2X6OA 3PSFA 3KCCA 1YS6A 4MFDA 2YU9J 2L9NA 1EH8A 1W4MA 4F55A 5GAGJ 4XLPF 2E7XA 4L9VA 1IC8A 4EJWA 3GTQJ 1PDNC 3DPLC 2VQLA 3FISA 2ZO4A 5LEJA 2OC6A 3TOAA 2FNAA 5CQGA 2P6SA 3CLOA 3VPRA 3OYKA 2LSOA 3TP3A 4HNTA 1QZZA 2ME6A 3GZ5A 4XBFA 4LLGF 1R00A 3J7AY 1R4MB 4HDVA 1X1DA 2PMUA 4JX4A 3I53A 5DS9A 4P96A 1OCOH 4F91B 2FX0A 3SDBA 2DPUA 3L2QA 1V5FA 2XVCA 2XASA 4E7KA 2DK8A 4Y17A 4KICA 2MC4A 4M9XA 5M3MJ 3O6BB 2D5VA 5BQTA 4CYCB 3JCUC 3COAC 1H0MA 1W0UA 1T33A 1FOWA 3LQRA 4E4HA 1W7PD 1W7PB 2EFOA 2XAGA 4ZDOA 4DJAA 1D3YA 4X6AJ 3C2GA 2F2EA 2WAEA 3ISPA 4Y33A 1Y8QB 2HVRA 4XR6A 4Q47A 2L4MA 2HVSA 2VONA 1BM9A 1LEBA 2FMYA 1FBUA 2F48A 3FXLA 3CCVI 3IRQA 1TW3A 5HS7A 2ELKA 1GXQA 2HS5A 2KL4A 3O8HA 4MHGA 2GLOA 1HCRA 1G4DA 3WG9A 3F6VA 4D9JA 2RQPA 1TP4A 1QNTA 2P5LC 3OSGA 5DYMA 1WKMA 5J1RA 3SJMA 2ESNA 3HRTA 2OCEA 2MYSA 5AONA 2D1VA 5IYCJ 2L5QA 2CQNA 2K4BA 3EUHA 4A12A 3CJNA 1FP1D 1R6RA 2QLZA 5FLXK 5FLVA 4LK1F 3VB2A 4IRGA 2MD0A 3I9V2 2BW3B 2H09A 4RGUA 2O3FA 2JMWA 1DQUA 2Y69H 3MVPA 4KIGA 2PFBA 4R8HA 4RBOA 3KYDB 2R92J 2ZC2A 4D0PA 4G7ZF 3AAFA 4BKXA 2JRTA 3CLQA 2MLKA 3BZ6A 4FQGA 1HF0A 4P55A 2Y0SA 1B8IB 2M34A 2K9LA 2XGEA 4NQWB 4BJ5C 3CC7I 1UHMA 1T0FA 1U78A 3W2WA 3DEEA 3R61A 5JR3A 4KFCA 4MGRA 1UG2A 2JSCA 1X2MA 2IXSA 5E3MA 2ZXJA 3BCBA 4IHVA 1ZH5A 4XLCA 3Q5FA 3HKZA 4GYGA 1Y6IA 2XF7A 2VPRA 3EQLF 3K4BA 4KDPA 4BEHB 3M1EA 2JA6J 3R0AA 2E1MC 3SZTA 3W2VA 4XL9A 4ZYDA 3VOEA 4U0VA 2JQ7A 4S05A 2DTRA 3G6EI 1LDDA 4CO8A 1YFHA 3BG6A 2LFBA 5AIQA 3LSPA 3GTOJ 2DK5A 4RGXA 3RYPA 4IHYA 2LVSA 4IHTA 1C0WA 1WQ2A 5KAFC 4IEJA 4ZTJA 4P5OA 1S8NA 5HLGA 1VNDA 2EINH 1LKXA 1MBJA 2OQRA 5F0CA 1A5JA 3H92A 1MNEA 2PMHA 1IG7A 2GXGA 3GW2A 4HV6A 3CCLI 3L2CA 2HTSA 1PUFB 1OYYA 3P7NA 1BIBA 4U7DA 1K4TA 1ETYA 1MBFA 2DQLA 2XF6A 3LSTA 5FROA 2CUZA 3GCMA 1U5TC 3S32A 4I0AA 3ZQCA 2BGCA 5DCMB 1Z67A 5J1UA 4B8XA 5M5WJ 2IRFG 3P9KA 3PUBA 3OYJA 1S72I 2CQXA 2OJED 3OOPA 1O3TA 2YX4A 3IUOA 1BJAA 1Z7LA 4OU0A 1FBQA 2HQNA 1T98A 4HLYA 3S16J 4P1WA 4GFBA 4Q5SF 1YQAA 4XKVA 4RGRA 3DKYA 1T08B 5J3LA 2JRMA 2HKOA 2Z33A 1RESA 1MNDA 1ETVA 2ECBA 2Y0SN 4UHTA 5DDGA 2K9NA 1IDYA 2D2WA 1YIOA 1W5TA 3RPQA 4ZZDA 4HX4A 3PSIA 2ZMEC 2A5YB 5FKMA 3NARA 4C3JJ 4RB2C 3OYLA 1VQNI 3QOPA 3LFKA 1ULYA 2DOFA 2VKHA 2R5YA 4CH7A 2YR2A 3E5QA 2VT2A 3CCMI 2KZVA 2HPMA 2NAZA 5C4XJ 2BYVE 3CP2A 3S3MA 1MZBA 3W6KB 4BY7J 3ZMTA 2GXAA 5J47A 1Z91A 4A3KJ 2DMTA 1P4XA 5BNGA 4XRMA 3DP7A 4AD9A 4NC7A 3DXJF 1UAAA 3FK6A 5K7HA 3KP2A 2NOJB 1OKRA 3E3VA 4IX7A 1YX3A 1FJLA 2K9MA 4UV8A 3WTZA 3J7YJ 4NQWA 5CVJA 4BHPA 5ICCA 3F8FA 2M5WA 3HPGA 5IYBJ 3S2DJ 3OV8A 2TRTA 3KP5A 1J9IA 4D5CA 2DU9A 3DU5A 1ZGWA 4C9YA 3O8GA 2CGPA 3I3LA 4LLNA 2DYSH 3BDDA 1TQPA 2V1XA 2JUGA 3E6BA 3W3CA 3LSIA 4CCKA 3E6CC 1PJRA 1LVKA 3AG1H 4ZDPA 3HOWJ 2OA4A 1V54H 1HA8A 2E60A 4MNUA 2VBZA 2MH2A 2M4KA 5FKLA 4ENJA 3H5NA 4R1HA 1K7AA 3D5RC 1I50J 2DFEA 4OMYA 2V7FA 4CUGA 3A4CA 3EUAA 5B5EC 1N25A 4U0YA 2MLGA 4B3XA 5H2FC 4G94A 2BE5F 3RPUA 5DM6F 1I6HJ 4II2A 3M1CA 3JR9A 4G7OF 2KT0A 5GPCA 2XKPA 5F04A 3TP0A 5EG0A 3X2QH 2OD5A 3HOXJ 3J7AO 4BJTA 3L1PA 5IP6A 1P4AA 4A5NA 4NNJA 1OR7A 4KT5C 1D1BA 3J80K 3QODA 4J19A 4CXFA 3BY6A 1APLC 3RZDJ 3TDZC 3CDLA 3KZIC 5EDNA 4XOTA 2EIMH 4IOAF 1VQMI 3KEOA 2O6GE 4ZJZA 4CYDA 2KPMA 4DW6A 2E19A 1XGSA 2XAQA 1Z9CA 2L2OA 1T8IA 4HSTA 1MBGA 1R7JA 1IXCA 4E70A 1EV7A 2DA2A 2QKLB 2DMNA 2PMZN 1XCVA 2BXYA 3WGHA 2ZKZA 3SZGA 1BIAA 4XRSG 5J6XA 1XMXA 2DFIA 3I0TA 3RCOA 3LOCA 3J7ZI 1ZYRF 4EM0B 1QHHD 4HEA2 4UVCA 3MKLA 4UXNA 2A6EF 4A3EJ 5FRMA 5A2QK 2CQ7A 2YUSA 3E6MA 1KYWA 3ZMSA 3OYMA 3CCEI 1Y8RB 2VE8A 2VI6A 3CD6I 5IP7J 1QQIA 2F5VA 2FNPA 2K3FA 2VC0A 4JX6A 1W1WE 4GDFA 3OYEA 3OSFA 1WH5A 1E3OC 1YRNB 1ZG1A 1IRZA 4RAYA 1FX7A 5IT3A 2CU7A 3JRBA 1KQ0A 1YLFA 1TT5B 2L7ZA 4FETA 4ZZLA 2RGVA 1YIJI 3QU6A 2CO5A 3H3VK 3GTMJ 1RETA 2QF7A 2XUBA 4RAFA 1Z3XA 2A6HF 2ACJA 2HQ5A 1IXRC 2Z1DA 2CYYA 2MA3A 5ILVA 3ZMVA 4XKWA 1MMGA 3HZJA 3TO9A 3MZHA 1QVUA 1U3EM 3OYDA 1LFPA 3IWFA 1O3QA 2RC4A 2P6TA 2VL8A 1D5YA 1DGRM 4N4OB 5HDGA 2WTEA 1J75A 3MWMA 1ZELA 2L54A 4G6DA 2X1EA 3MCZA 5DV5A 4UVAA 2RAEA 1F5TA 2XROA 1BR1A 4C3IJ 2EJRA 3ZQFA 4BXFA 1DP3A 2JUCA 1MBKA 3HOVJ 1WJFA 2WBMA 2L7FP 2PJPA 3OL3A 3NQOA 4PCQA 3T0YA 3SFZA 3OYNA 1Z05A 2LF8A 3BTJA 3S3OA 2M8GX 2NVTJ 1IF1A 4IZZA 3FMSA 2R7VA 4CDGA 2DA1A 1ONVA 2CSOA 2DA6A 5BPDA 2XPUA 2ADUA 2PX9A 4G6TB 1YE9A 2JPCA 4Z6YA 3GTJJ 1WH7A 5D6EA 2CFXA 2W48A 3DWLE 2V9KA 3ZCOA 2HU9A 2O5RA 2CQKA 1RC9A 2LG4A 3C2BA 2VLAA 2P0WA 1QZEA 2J5PA 4LJZF 1LDJA 2OAZA 3U2RA 5F1RA 3WTUC 2CMPA 3TEDA 2HPIA 3OS1A 2K85A 3JRAA 1U9OA 1BBYA 1MJ9A 4RAZA 1SVLA 1ENHA 1ZARA 2JSPA 1OJLA 3TQNA 3HG9A 1BOBA 2P5VA 2V1DA 3ROUA 1ZGJA 1WPKA 3LSKA 2Q2EA 2CV2A 3P9CA 4B47A 3BG5A 1BI0A 2R7ZJ 1JKPC 1MMDA 4PGGA 4A0ZA 2AXLA 4L5EA 3N97A 1K6OA 1W36C 2KMUA 2KIFA 3ZGKA 1F9NA 1Q1VA 2HOAA 2GAUA 1LE8A 1IUFA 3TW6A 1JT0A 2E2HJ 3I59B 6PAXA 1OCPA 3DBHB 2QBYA 1SAUA 1OCCH 3IH2A 1XDSA 4UUVA 1Y1WJ 3FXOA 1Z77A 4XN0A 3SEQA 5IYDJ 1H9GA 1FMWA 2QSFX 1HDPA 4EGZA 1R5HA 1XPXA 2AXTC 2XGCA 3A0HC 1RR7A 4EVIA 3F3XA 1G6NA 2HXOA 4O6JA 4UUTA 3VYSB 3PM1A 2WADA 3H5AA 3ZQ7A 3QWLA 2JWTA 4BAYA 5CVUA 2L4AA 2MD5A 3IKVA 2M30A 3GLXA 1AHDP 2IW5A 1AOYA 3QYBA 3I56I 2KRFA 2ME0A 1S29A 2P8TA 3TO7A 4XICA 3W6JB 3S15J 3JTGA 1Y0UA 1IRGA 2DW4A 2KJCA 1SFKA 3O2PE 3M9AA 1OLTA 2OBPA 5K1YA 5FLMJ 2VC1A 3G4SI 2VBYA 1IW7F 3T8RA 1FYMA 3GF2A 4W97A 2EWNA 4ZYGA 5LHGA 1JUMA 3KZYA 1K78A 3F0CA 4A6DA 4A93J 2ICWG 2W4SA 2EV5A 5HOOA 4UV9A 3JSPA 1UFMA 4AM3A 2ZFWA 2BZTA 1O7FA 1UELB 4JQFA 3Q0VA 2IGKA 3HOTA 1VQLI 2LY1A 2GXBA 3S1NJ 1F43A 4PJJA 3V4GA 3H0DA 2XRNA 3I59A 2B7EA 5FJ8J 4KNYA 2IPQX 3M8FA 3RJPA 2G7UA 4N9IA 2DA5A 4AVPA 2RKHA 3OR1C 4PDKA 3F8MA 4RGSA 3WE3A 1JGGA 4HRIA 2VASA 1VI0A 5JLXA 2PBIA 2BXZA 2VT3A 4A3GJ 3VDXA 1UHWA 3GUDA 1MDMA 2F4MB 1IAWA 3QQAA 2KFDA 2ZMEB 4PJLA 4HV5A 1T38A 3RQIA 1T6SA 4AVZA 4HAMA 4FASD 1TQIA 2E71A 1EH7A 2VKDA 5E1WA 5EJCA 2KP6A 5CYVA 2E1NA 3WTXC 4PFOA 1MJAA 3KEYA 1U5TA 3CQZJ 5D4RA 2A5WA 1PUFA 1KU3A 3KIOA 4YIRX 5DEQA 4AIDA 1A35A 3IP4B 2Q1ZB 1N75A 4HBLA 1DU6A 1E17A 1XG1A 1DU0A 4HLXA 3SXYA 3K6GA 1U5TB 4CCNA 2EFNA 3IH3A 4CHUA 2DOAA 5HDKA 4CYCA 1IN6A 4FISA 5EZHA 3KEQA 4U87A 4IKFA 1STZA 3ZQIA 4A2UA 1H8AC 1ZGAA 1K78B 2FA5A 1T0FC 1TZLA 2XDVA 2XIGA 2ZFUA 4ZC3A 3ZOBA 2PJRB 3DFGA 1O4XA 3K2ZA 2XRLA 5GAEJ 1MDMB 2NS8A 2E1OA 4KIFA 3SFIA 5K5RA 2VE9A 1IO2A 3HSFA 1PYVA 4L5JA 4C2TA 3E7LA 1OPCA 1FMVA 4IF4A 2FEZA 2Y31A 3H36A 3OYCA 2EZIA 3BR3A 3VODA 1B9MA 1KQ9A 2OZUA 5E3LA 3GXOA 1MJBA 2IS6A 2ELHA 3JRIA 2ELJA 2E1MB 3HHGA 5DCFA 1GT0C 1J59A 1T39A 3FIWA 1YJ9I 1HSTA 5J8FA 2HQRA 4CZZA 1CF7B 3V7RA 3HTUA 5L3GA 1IV6A 1UJ8A 1FY7A 2WAQA 2DT7B 1IZ1A 1JTYA 3IKTA 2EB7A 5E1ZB 2MH9A 2DN0A 3IH4A 3U9GA 3J80Z 2GBYA 2IA2A 3S93A 3BPXA 4EJTA 1ON1A 2C6YA 3BCAA 3WU0A 2FOWA 5E20A 2N8GA 5H6RA 1K79A 2QUFA 2Q2EB 3KYLA 2ISZA 1JGSA 4DYRA 4XRFA 4XQFA 2L9VA 3HJEA 4S04A 1U8RA 2F5DA 2EZLA 2FBHA 4Y3OA 2Z9OA 1XS9A 5EGOA 3V7SA 3CCQI 3ZP5A 3SQNA 4WXCA 1R4NB 4Y4RA 1MSFC 4ZTFA 4M73A 5CVVA 3F22A 4BEHA 2ZJRF 2IJLA 2E36A 3OYAA 4ZYAA 2G7HA 2WY8Q 4ZH4F 2HOTA 1WSUA 3M8EA 3TO6A 3VYRB 4EJOA 4PUSA 2JA8J 1HSJA 1WRJA 4L9JA 2G0EA 3JW4A 3PIOF 2OUMA 1X1CA 2LMDA 3ABKH 4HNUA 5K7ZA 3NRVA 3MEXA 4A6EA 4RM3A 2JT1A 1O7LA 3ABLH 1TBXA 4D7NA 3BZCA 3DU6A 2JA5J 2V1NA 1HKQA 4RM2A 5FKNA 4JOMA 1SFOJ 1LB2A 2R7FA 3U21A 5D5VB 1FT9A 2HNHA 2NNYA 3GTLJ 1Z21A 1HLVA 4XLEA 1J7KA 2KIMA 1X3UA 4JP0A 1ZG5A 3ABUA 2HEOA 5EYRA 3TBIA 3HM5A 2LBFB 3NEUA 5FFZA 4RB3C 3WTVC 2RQQA 1WWXA 3K10A 3EDPA 3KLNA 5D8LB 1V5EA 4I7HA 1ZAOA 2H6CA 3DKWA 4EQQA 4NC8A 2A05A 2AHQA 4A3BJ 2K9SA 2V79A 4Y7NJ 2O8KA 2XAJA 1JJ6C 3B6CA 2OU2A 3IC7A 4I6ZA 1BR2A 1B4AA 3S1QJ 1JKOC 2VBWA 1OFCX 3LA2A 4Y13A 2MC3A 1O57A 2P7CB 2HKXA 2K7LA 3MKWB 3K4NA 2XHKA 5E79C 2X6YA 2W57A 4RS8A 4E7SA 1OYWA 1QA6A 2QZ8A 2W85A 4G7HF 2K02A 4XORA 4QIWN 3MD2A 1B6AA 1Y39A 3Q3SA 2DA3A 3CJRB 4BDZA 3OS0A 5K7FA 2FBKA 2HZDA 4P9UA 4RDUA 1REPC 4C30A 1DPUA 3GBGA 1BJZA 2CJJA 3JREA 1X19A 3OYHA 4E7HA 1V5GA 3TW7A 5KNLA 5J8CA 4L5IA 4YFKF 2E5ZA 3M7GA 4WCGA 2M3AA 2XPVA 1RZ4A 2JA2A 1WFXA 2R5YB 3M3YJ 2Q0OA 1QHGA 2QQ9A 4KIBA 1E2XA 1R58A 2QM3A 3BLYA 3DKXA 3H1CA 3G73A 1XSDA 1WCMJ 1D0YA 3VYUB 2JJ7A 3WTTC 1L3LA 3EPZA 4KISA 4PSXA 1PP8F 1F36A 3CC4I 2OF7A 2AO9A 2XC7A 3FHNA 1FTZA 1BW5A 2LR8A 3WTWC 2G9WA 2XGXA 3QP6A 2OV7A 3BTCA 1NG6A 1ETWA 4HF2A 3K4MA 2DMUA 4DBRA 2DXIA 1J09A 4OINF 3JRFA 4LD5A 2QSHX 3M8JA 1FIPA 2WB1N 2QQ8A 1I6XA 2CUEA 1IV8A 1KGSA 1S7OA 3HPHA 2CW8A 3A0BC 3R60A 5B3SH 2FQ4A 2YSRA 4I99C 5F64A 5HS9A 3C7JA 2CWEA 2IA1A 2VJJA 5ILUA 4CCMA 2EZHA 5KHDA 3HSRA 5JVTA 5D4SA 3QAHA 2FSWA 2ZJ2A 1F1ZA 1WJBA 2EFPA 3LSGA 4NDLA 2HYGD 4A0YA 3S2HJ 2X1CA 4N4NB 5GTHC 1Y1VJ 4I2OA 2DMPA 2LTPA 4QSHA 5F1JA 3DPUA 4KT6A 3SYTA 2VUMJ 4BQNA 1UG0A 1MGTA 2TCTA 1OCTC 1JTXA 1QVTA 3TKYA 1A6IA 4UB6C 1D5VA 1HW2A 1O3SA 2MG4A 3PO3J 1QBJA 1E3PA 1RRJA 1SFXA 3CCSI 5IPAA 2HWVA 1Z0XA 1GDTA 2CUFA 2H94A 5EGOB 4Z2YA 4XM3A 1JXSA 3WE2A 4AC0A 4B3AA 2X4HA 2IEKA 3HGGA 1ETKA 2W82A 2WAQN 3ZQGA 3UR3C 2ZXHA 1I1GA 1WI9A 1MBHA 4O3MA 3KYCB 3ASNH 2RDPA 2QENA 3K4CA 4AUXA 5F08A 2IAIA 4IRIA 4XKCA 3CESA 3K1PA 2ETHA 2KIUA 4CCOA 4BU2A 1ORKA 2O61A 5JHUA 2EA2A 3BT9A 3ZN1A 2B9SA 5LLQA 1HDDC 1T56A 2H6BA 2VXDA 3UNGC 3GFMA 3JTHA 4V2GA 2NS7A 1HW5A 2VJIA 4IHWA 2EBIA 3ZQHA 4FE4A 1NHAA 3HB9A 3D0SA 2GA2A 5D8KB 4XLFA 3WHBA 3K70D 5EEHA 2LP0A 2R3SA 1XCBA 3MN2A 3CO6C 2L01A 2P81A 2BW3A 3KPHA 1VTNC 1R22A 2COBA 2M0MA 4I98B 1LQ1A 3CMYA 2VN2A 3CCJI 3GFLA 2Z5UA 1YTYA 3OR2C 2UWMA 2HXIA 4A0XA 3VSKA 1W5SA 2W00A 4YFNF 1OQYA 1OCZH 2IP2A 3K0LA 2X9DA 1KZHA 2EFQA 4GRIA 3I4PA 2W84A 5IOZA 5TJJA 3CCYA 5AIPA 3JAMK 3K7AJ 2RVCA 2V9VA 1MIJA 3NWSA 1TNSA 3RKWA 2NVQJ 3QPSA 3E97A 4XNFA 1YO5C 3TL4X 3K69A 2E1CA 4UUSA 1D8JA 3H5RA 1LNWA 2X6XA 4J01A 3ECHA 2E2IJ 2JN6A 1ACIA 1MNMC 1OMIA 3F8BA 5ICFA 3V8JA 3V8LA 3D5SC 3FKIJ 1ERDA 4C3HJ 3ZXSA 5GP9A 5C4JJ 2I5UA 4AYBN 2HYFA 2DO7A 2R7RA 2L9SA 4IXAA 3J81K 5B1AH 4OWRB 1FOKA 3FZVA 2B63J 2FMLA 1JT6A 1I39A 3GZ6A 2AS5F 4MTEA 2COMA 1S7AA 2ZXWH 3FBIB 2VPLA 3QRFF 3FXJA 2EQRA 2IS2A 5F27A 5CLSA 3F23A 2LKXA 1N78A 2BY0A 3BJAA 1MMNA 2O7OA 1BW6A 2UV1A 2VKEA 4HNVA 5FB2A 3SHFA 3QPTA 3OY9A 1BC7C 1V3FA 4EATA 4I09A 4DYCA 3K1NA 1IN7A 4X0GA 3ZPLA 1FYLA 4AIJA 2A68F 1A36A 4M3BA 1MMAA 4M6XA 2HDWA 5IP9J 3WU1B 1P2FA 1W5CC 1JHFA 5D5WB 1PUEE 4WXHA 2JVHA 2Z2SB 2VKVA 2X51A 3ZQQA 5IOYA 2ZNZA 3H3UA 2E7WA 1WVRA 1Z6TA 1W7PA 2A61A 1KYZA 4NBQA 4ZYHA 2QA4I 3H9GA 1MD0A 1MH4A 4RLQA 4IJAA 4EGYA 1FSHA 5E1XA 1KA8A 5LD2C 3LSRA 4FT8A 4Y15A 4UB8C 4RAGA 4XMYA 3HYIA 2JTVA 4BQQA 1SAXA 1WZ2A 4F92B 2HOSA 3G2BA 4GGGA 3TMOA 1R9TJ 2QSGX 5KCMA 3CTAA 1A04A 3LWFA 3HDDA 4NHJA 2MFZA 5B66C 2R5ZB 1ZN2A 1NH3A 2XF5A 2GIVA 3FXQA 3KP7A 4U0WA 1TNTA 4M71A 3HOYJ 2E34A 2VOOA 5FKKA 3LSHA 1H88C 1P92A 3FM5A 2NRAC 3HHHA 3HTSB 4XLAA 3A2KA 2M45A 1VQ4I 2EZKA 3HUGB 4IPAA 1R49A 4HYEA 4PJNA 3FMQA 4ZDLA 1G8XA 4M9ZA 4D7MA 1W36D 1LJ9A 5IY5H 5HS8A 3HOSA 3ESWB 2PG4A 3ONQA 5M5YJ 3OYIA 2LF7A 2MABA 3LQQA 3H9JA 1W0TA 1S3JA 3ZN0A 3T5XA 1YJNI 2M8EA 5ED4A 4EM2A 5K5QA 1Z1DA 2ZXIA 5L3BA 2CH0A 3FXKA 4WX9A 4L0YB 1FLIA 5E18F 3GZNB 3ASOH 3ABTA 4KMFA 2IVMA 3BR5A 5F0FA 1U2WA 3CZ6A 2PLYA 3BG7A 2KDOA 2VXZA 2BVMA 2NYXA 1UCRA 4DOZA 5GAHJ 3QYFA 4YIIA 4LIUA 2LH9A 5FD5A 4L18B 1D1AA 4OIRF 2P7VB 1DGWY 4B44A 2RNGA 3GX4X 2XAUA 3LSJA 3IAM2 4D5FA 5HLHA 1DUXC 5FRNA 4OAZA 2LD5A 1HBXG 3RSNA 4FTHA 1BC8C 3SZPA 2H1KA 1IN4A 3WG7H 1YITI 3V42A 1VQ8I 4P9FA 5FD6A 5JVGF 3OIOA 3HXLA 3A01B 1G2HA 4GCVA 1SC7A 4LB6B 4BNCA 3DF8A 2CUJA 2WY7Q 4A3CJ 1Z6RA 3FX3A 3HEFA 4RMNA 3I54A 2V1UA 5E8GA 2ZCWA 1BI1A 1SD5A 3DEWA 1UZCA 4CCJA 1JJ8C 2EK5A 5H6QA 4F52A 3G71I 2R0QC 2A6TA 3DBRB 3CMEI 3GYHX 3L2WA 2HQAA 4GO1A 3PQJA 3RQ4A 5GTIC 2V6CA 4MFEA 4E7LA 4E7ZA 4LMYA 2OTJI 2Y9ZA 3QOEA 5E8IA 2GWRA 2VJ5A 1SVMA 1XC5A 3FK7A 1D0ZA 4PK4A 2OPTA 1CF7A 2KIQA 2FRHA 2FUG2 2CRGA 4L9TA 1HQCA 2DT5A 3E5XA 1P6RA 2EPFA 3IWZA 1GVJA 3LSMA 4JBAA 1MSEC 4MQVA 4IQJA 3CDHA 3GEZA 2UUZA 3A1YA 1UMQA 4U7BA 1B72A 2DA7A 4RA2A 5EEGA 2DMQA 2LC2A 4BXXJ 5L3FA 4ENNA 1ZRCA 2NVYJ 2R7UA 2V26A 1OCRH 3KP6A 1QZYA 1BOAA 3P9IA 1TWCJ 1YRNA 3S14J 1Z3YA 3F8CA 2XGDA 4KUMA 3Q0WA 3D5LA 1MH3A 1WJEA 2CW7A 2JK3A 3RDIA 3MQ0A 3CCUI 1V4RA 1YI2I 1WGXA 2ID3A 5FKOA 4QTRA 4BE2A 3MKZA 4UVBA 5ERIA 4KMUX 2HTJA 1RKWA 4IVNA 1POGA 3WU2C 3J81Z 2RN7A 3IV5A 2DJNA 2NS0A 4XSZF 2K86A 3ERMA 5LHIA 5J4VA 3JSOA 3QU3A 2DODA 3IAS2 3MZ8A 1ITYA 3C2HA 4M3EA 4CSWA 2HR3A 5DUKA 3BPVA 2R7OA 3FXUA 4GYIA 2A07F 4OIPF 3FM3A 1AA7A 3DTIA 4AYBA 2VOPA 1B59A 4ESFA 3BR0A 2QYOA 2A3SA 2LKPA 2DAOA 1P7IA 2X6WA 5LRRA 4E6KG 5IT9K 1USSA 5BOXA 2CV1A 4Y52J 3BR2A 4KA4A 3D1NI 4UY8I 4AIHA 2ESHA 2IA0A 3BG3A 4LG0B 4IRHA 4OIOF 2M9HA 1U8BA 1ZHFA 4HF0A 3BQZA 1XSXA 3CUOA 4MEYF 1XGMA 4BXUA 1FC3A 4L0ZB 3RZOJ 4QPOA 1XMAA 5HVQC 3A03A 3K4KA 1JKRC 3W6VA 2LNBA 1X3ZB 1Y0NA 2HI3A 2YU3A 4LK0F 2OCCH 1JUSA 5CKTA 3MFKA 3WTYC 2PQ8A 4LIVA 3GVAA 3AL0C 2HGCA 4M3GA 5D6FA 2F5EA 1IDZA 3ECOA 1ZTRA 2EH3A 5LFAA 3DLAA 2R4GA 1LFBA 4EJUA 1Y56A 3M4OJ 1RNLA 3VEPA 3AG4H 3HRMA 4QPQA 3S3NA 4HZFA 1IUYA 2LY2A 3CMAI 2E5NA 1ZR4A 5EF6A 3CUQB 2Q8KA 1OISA 3WHCA 3I55I 3CF5F 2H27A 2PEXA 3FF5A 3SEZA 3ML6A 2QCOA 5HNFA 1I27A 1R1UA 3ABMH 2KISA 5DCMA 3LNQA 1IJWC 2A69F 2LRDA 3IL2A 4LLLA 2J5OA 4M3FA 4LB5A 3T1BA 4AU7A 1D0XA 2BOLA 4HW0A 3DV8A 2VODA 3CF2A 4ENKA 2STWA 4A5MA 2KRCA 2R7DA 4A3JJ 2ZJPF 3U1DA 1X1BA 1FP2A 2CFOA 3E1SA 2VQHA 3G3ZA 1B8IA 4IO9F 3VWBA 4BQOA 1YX5A 2W24A 2HDCA 2K4JA 4I02A 3L7WA 1ETOA 4PJMA 2ZB9A 1ODDA 3NAUA 1FWZA 2F4IA 4YG2F 3HSEA 5LHHA 1YYVA 2M2EA 3GTGJ 3JRHA 1GUUA 2QBYB 1NK3P 4EV0A 5HLIA 2KZGA 3L2UA 1OR7C 1LE8B 3CDIA 1K4SA 3WTSC 3PJRA 5FGMA 2KHMA 2R7WA 5LRSA 2PN6A 2EV6A 1R36A 4FCYA 2XV4S 2YPRA 3Q9SA 1V55H 3DTEA 1AKHA 3MAJA 2YS9A 3PL8A 3BTIA 5J1YA 1LPQA 1HXDA 2EA4A 2OZ6A 2WB1A 2WV0A 4NUBA 1RPWA 3CUQC 4JK1X 1QPMA 3F6OA 1ZREA 1KQ8A 3K9TA 1X1PA 3JAMZ 4HF1A 4YEJA 3TGNA 1SFUA 2YX7A 1MBEA 1BL0A 2CQQA 3HC7A 2JPBA 2IBDA 3E6DA 4ETSA 5M5XJ 2GIZA 4A3FJ 1ZQ3P 2FOKA 1WHUA 5ICEA 5LGUA 1IN8A 5J40A 1SD7A 2H8RA 2QQBA 4OIQF 1VQ5I 3KZZA 1TWHJ 4QWQA 4EJVA 5F0HA 4XRSA 1HKTA 4MIMA 3KFWX 2DFHA 3MMYB 2Z16A 4MLOA 5JHFA 2ZBKA 4F3QA 5L3CA 2EIKH 1ZK8A 4WF2A 4RLFA 2KKOA 4DQ2A 9ANTA 5C3EJ 3K4JA 4A3DJ 3OIPA 5F6FA 1KONA 3PFYA 3W2AA 3K2AA 1R23A 3FKJA 4WXDA 4BGDA 5M3FJ 1T95A 3JRCA 3CUQA 4XN3A 4BH9A 2L3DA 4IQ4A 4DGWB 3G1OA 3GO5A 1R1VA 1FPQA 1I5ZA 3V8KA 2LK2A 3VSLA 2XSDC 3KETA 3WGGA 4YIFA 4G8XA 1FTTA 4ZYEA 2Y0MA 4NC6A 5JI6A 4M72A 1TTYA 3BP8A 1SVOA 4M9SA 2RV8A 4BBRJ 4B48A 5E3NA 1EA3A 2P4WA 4QLCU 3S17J 4FHTA 2PI0A 1XGOA 2XB0X 5DTDA 3KE2A 2F5CA 4CZCA 3OYFA 4CICA 5A2QZ 1AWCA 1OYIA 1IXSB 2JVGA 1S7EA 3I64A 2D45A 1JE8A 2I10A 3EUKL 1FIAA 4N0BA 2DA4A 3L9FA 1U6GA 3H9QA 4BQAA 2VBXA 2H8WA 5FLXZ 2STTA 4V19K 1GHCA 1IN5A 4R79A 2HFHA 1SANA 3HL2A 4JYKA 1XMKA 3OOUA 5D5XB 3ZRGA 3I4NJ 2BY2A 4F7ZA 1G3WA 3I4MJ 1RR8C 5DD8A 2Y48A 3GWZA 1SD4A 1WJDA 1P7JA 1TWGJ 1QRYA 3EYYA 3DLLF 4HG2A 1ZKGA 5KVRA 2RNJA 4B09A 2UXXA 3QPLA 3C1DA 4I01A 4FX0A 2NXNB 3SDGA 4M6YA 4MQ9F 2LYCA 4UNOA 3QYEA 2Y30A 2V6EA 3B73A 5LEKA 2F4OB 2WWYA 1YW8A 3K1MA 2FJ1A 1VFCA 3FXMA 4S0HB 4HX8A 2TDXA 2M1BA 2EFWA 3QP5A 3PIPF 3CC2I 2IGNA 2WV1A 1T2KA 4MO7A 4M74A 3AKZA 2VQGA 2FE3A 3C18A 3RKXA 4C2MJ 4RB1A 4XK4A 4DNCA 1M1EB 1R1TA 3A01A 1UHSA 1P4WA 1WJCA 2D1HA 4II3A 2QEXI 4ENMA 4KJZA 2K3PA 2OQGA 5BPIA 1SFEA 3R0JA 3BZKA 4E7JA 2LLKA 3PNYA 1XDUA 2ECCA 1XB4A 2VB6A 1RUNA 2X48A 4HOBA 1VF9A 2M7AA 4KITB 2LY9A 3IHUA 1XGNA 4A69C 2XKOA 3JRGA 1GV2A 3BJ6A 4HDUA 5KAIC 4A3IJ 4J00A 1FBSA 1NTCA 2Y9YA 1DPRA 4G9YA 2JZYA 3N05A 2VIXA 4W1UA 4PGHA 1YG2A 4IHXA 3T8TA 2EILH 3RPUD 1ETXA 1P9QC 2QGUA 2K40A 5FO5A 1FYKA 4G6QA 3E0JB 3DEUA 2BY3A 1ON2A 1H9TA 2LBFA 1X1AA 4KN7X 2KRHA 1YJWI 2BEOA 2CS3A 1RKTA 1KU9A 3F21A 4HSRA 3REOA 4OOIA 2FBIA 1YW7A 3OYGA 5TGTA 4N9HA 4B1RA 1ZRDA 3FMRA 4V2FA 4ABZA 1ZLJA 4M6VA 1ZG3A 4Q48A 4XOPA 5EZGA 1CQTA 1XX5A 2JA7J 4LITA 4LGWA 3F72A 3ZMDA 2PMZA 1SMYF 4OAYA 1J0RA 2KLOA 2Y2ZA 3BTLA 2M87A 2K9QA 3PFIA 3PUFA 2R5ZA 4HQEA 2HDDA 1CGPA 2AQEA 3DPTA 1GVDA 1NG7A 4B43A 2DT6A 1VQPI 1L0OC 2EIJH 4EEFG 1DP7P 2GZWA 4KN4X 2DYRH 4PJ0C 3CCRI 3RKYA 5C44J 3V7CA 1I1SA 3LAPA 3KP3A 2FQ3A 3PO2J 1JKQC 1MMSA 1UB9A 5CJ9A 2QKMB 4JX5A 2NVUB 5CVRA 5E3OA 5B1BH 3GLLA 3CMMA 1HOMA 2CG4A 1XN7A 2GM4A 1FOXA 4PSWA 3LAJA 1JHHA 1TWFJ 2CW0F 5ICGA 1FOYA 2L0KA 1ZLKA 3ZR8X 1SMTA 1TT0A 1GXPA 1KU7A 2DPDA 2O03A 2XPWA 1R5GA 4GXOA 1X3WB 2V9PA 2MBFA 3CJTB 3RI4A 1A6QA 4WWCA 3BG9A 3U1KA 3B6AA 4DZPA 1Q1HA 2ZSIB 2ID6A 1VQ7I 4XLNF 1AU7A 4G12A 2MW8A 5HNHA 1BA5A 2R7QA 4BBSJ 1WJ5A 2MSYA 4I0BA 2VQCA 3CO7C 2O8XA 2LDUA 2W25A 2QVOA 3GFJA 3CJQB 4UUSB 3DQVC 3FWEA 4BE0A 2ZSHB 1K61A 3RTRA 4BHCA 4CA0A 3ERED 3C3WA 4ITVA 5CQEA 5EEAA 3L2RA 1VQOI 2UXNA 1QGPA 4ON0A 4BYYA 1PP7U 3AFHA 4DYQA 1AKHB 1S6LA 4A3MJ 1U0JA 2HVQA 5LBQA 3FXRA 4LG3A 1Z7UA 2W1OA 3MKYB 2R7SA 1FEXA 3BOQA 3H0GJ 4RB0A 3EUHC 3R6SA 1R71A 1JI8A 3WODF 4C2UA 1WJAA 3I71A 3N4MA 3PQKA 2ZMEA 4PFPA 4ASNA 4CGZA 2ISYA 3OMYA 3Q0UA 2XAHA 5JFRA 4E7IA 2F5FA 3OYBA 2PJRA 2RREA 1QPIA 4I76A 3AL0B 3HIFA 3NWTA 4LOCA 3H3ZA 2H1LA 3IRRA 4YRVA 2XSJC 4CCLA 1IRFA 1VQ9I 4EM1A 2BVLA 2IGOA 1G3TA 5GPAA 2GOXB 2BHZA 3VYTB 4BL0B 4F93B 2LKSA 4ESJA 3HKZN 3PNTA 4HA8A 1LVAA 2L7MP 1BR4A 1EF4A 1X2NA 2FXAA 4FE7A 2DFFA 4BS9A 2X1DA 1ETQA 1YW9A 4BACA 4BE1A 3I58A 1FZPB 3VFZA 5KK1A 3I5UA 4XIDA 1YHQI 3OIQA 2V4JC 2BBYA 2GA1A 4U88A 4XONA 1SEUA 2IS4A 2KQRA 3KP4A 1K6YA 2Z3YA 1B72B 1DDNA 3TDUC 1G59A 2Z99A 2R7XA
chains in the Genus database with same CATH topology
2EV0A 1TW2A 1FNNA 4KYWA 1XSVA 3GFIA 3Q9VA 2ZNYA 4IHSA 1TQMA 4BHBA 3BWGA 3RIRA 2QWWA 2O0YA 3B02A 1B9NA 3BJOA 5HDNA 1XD7A 5ILSA 2NNNA 5K5OA 4HQMA 2GQQA 4NB5A 5BMZA 1B1BA 2BV6A 3ULQB 3LA7A 2L02A 4ESBA 3QPHA 3R4KA 2Y75A 5IT9Z 3HRSA 3ELKA 1QO0D 1F4KA 3FHZA 1BI3A 4K2EA 1MKMA 1G3SA 5H20A 4WK8F 4LG0A 5TRDA 3F8NA 3RYRA 1EH6A 1TLHB 3L00A 5L3EA 2B0LA 2HOEA 3TOBA 1RI7A 2UZKA 4AWXB 4TV7A 4MEXF 2FF4A 1RIOH 3EYIA 4HX7A 2DI3A 5E17F 3LA3A 1ZRFA 4PZJA 1G3YA 4YFXF 2WC2A 5L3DA 4Q4ZF 1BI2A 3EETA 3HRUA 2P5KA 1HW1A 1J5YA 3BROA 2HZTA 3HUGA 4H0EA 5D5UB 2DBBA 2DLLA 2KJBA 1D8KA 1LDKB 3ZMZA 4MTDA 1YS7A 4EMSA 1USTA 5DD4A 1FSEA 3MZYA 4FX4A 5LGNA 4XSXF 2XAFA 1J2XA 4L9NA 1O3RA 1LEAA 4LFUA 1RUOA 2K27A 5CVIA 2QQAA 1BN5A 2DQRA 4AIKA 5LGTA 3S2WA 1KU2A 3KLOA 2X0LA 5BS6A 1HKSA 4OMZA 4O5VA 5FFXA 5DUIA 3O3KA 3WGIA 2IT0A 3L09A 3E5UA 1SD6A 3ZMUA 2FU4A 3KCCA 1YS6A 1EH8A 1W4MA 4XLPF 2E7XA 4L9VA 4EJWA 1PDNC 3DPLC 2ZO4A 5LEJA 3TOAA 2FNAA 2P6SA 3CLOA 2LSOA 1QZZA 3GZ5A 4XBFA 4LLGF 1R00A 4HDVA 2PMUA 3I53A 4P96A 2DPUA 2XVCA 2XASA 2DK8A 4Y17A 4KICA 4M9XA 3O6BB 5BQTA 3COAC 1H0MA 3LQRA 1W7PD 1W7PB 2EFOA 2XAGA 1D3YA 2F2EA 3ISPA 4Q47A 2L4MA 2VONA 1BM9A 1LEBA 2FMYA 1FBUA 3IRQA 1TW3A 5HS7A 4MHGA 1GXQA 2HS5A 1G4DA 3WG9A 3F6VA 2RQPA 1QNTA 2P5LC 5DYMA 1WKMA 2ESNA 3HRTA 5AONA 2D1VA 2K4BA 3EUHA 4A12A 3CJNA 1FP1D 2QLZA 5FLXK 4LK1F 3VB2A 4IRGA 2H09A 4RGUA 2O3FA 4KIGA 2PFBA 4R8HA 4D0PA 4G7ZF 3AAFA 2JRTA 2MLKA 3BZ6A 4P55A 1UHMA 1U78A 1T0FA 3R61A 5JR3A 4KFCA 4MGRA 2JSCA 2ZXJA 1ZH5A 3Q5FA 4GYGA 3EQLF 4KDPA 3M1EA 3R0AA 3SZTA 4ZYDA 3VOEA 4U0VA 4S05A 2DTRA 1LDDA 4CO8A 1YFHA 5AIQA 2DK5A 4RGXA 3RYPA 4IHTA 1C0WA 1WQ2A 4P5OA 1S8NA 5HLGA 2OQRA 3H92A 2PMHA 2GXGA 3GW2A 4HV6A 3L2CA 2HTSA 1OYYA 3P7NA 1BIBA 4U7DA 2DQLA 3LSTA 1U5TC 4I0AA 2BGCA 5DCMB 4B8XA 2IRFG 3P9KA 3OOPA 1O3TA 2YX4A 1BJAA 4OU0A 1FBQA 2HQNA 1T98A 4HLYA 4Q5SF 1YQAA 4RGRA 2HKOA 2Z33A 4UHTA 5DDGA 2D2WA 1YIOA 1W5TA 3RPQA 4ZZDA 4HX4A 2A5YB 4RB2C 3QOPA 3LFKA 1ULYA 2YR2A 3E5QA 2VT2A 2NAZA 2BYVE 1MZBA 3W6KB 3ZMTA 1Z91A 1P4XA 3DP7A 4AD9A 3DXJF 3KP2A 1OKRA 3E3VA 4UV8A 3WTZA 4NQWA 5CVJA 4BHPA 5ICCA 3F8FA 2M5WA 3OV8A 3KP5A 1J9IA 2DU9A 2CGPA 4LLNA 3BDDA 1TQPA 2V1XA 3E6BA 3E6CC 2OA4A 4MNUA 2VBZA 2MH2A 4ENJA 4R1HA 1K7AA 4OMYA 4U0YA 2MLGA 4G94A 2BE5F 3RPUA 4G7OF 2XKPA 3J7AO 2OD5A 1P4AA 4A5NA 1OR7A 4KT5C 3J80K 4CXFA 3BY6A 3TDZC 3KEOA 2O6GE 4CYDA 1XGSA 2XAQA 1Z9CA 1R7JA 1IXCA 4E70A 1EV7A 1XCVA 3WGHA 2ZKZA 1BIAA 5J6XA 2DFIA 3I0TA 1ZYRF 4EM0B 4UVCA 4UXNA 2A6EF 5A2QK 3ZMSA 3E6MA 1KYWA 2VE8A 1QQIA 2FNPA 2VC0A 1ZG1A 4RAYA 1FX7A 5IT3A 1KQ0A 1YLFA 4ZZLA 2RGVA 3QU6A 2CO5A 2XUBA 2A6HF 2ACJA 1IXRC 2CYYA 2MA3A 5ILVA 3ZMVA 3TO9A 3MZHA 1U3EM 1O3QA 3IWFA 2RC4A 2P6TA 5HDGA 2WTEA 1J75A 3MWMA 2L54A 4G6DA 3MCZA 5DV5A 4UVAA 1F5TA 2XROA 2EJRA 2PJPA 3NQOA 4PCQA 3T0YA 3SFZA 1Z05A 2LF8A 1IF1A 3FMSA 4CDGA 1ONVA 2CSOA 5BPDA 2ADUA 2JPCA 5D6EA 2CFXA 2CQKA 2J5PA 4LJZF 1LDJA 2OAZA 3U2RA 5F1RA 3WTUC 1BBYA 1MJ9A 4RAZA 1ZARA 3TQNA 2P5VA 2V1DA 3ROUA 1ZGJA 2Q2EA 3P9CA 1BI0A 4PGGA 4A0ZA 2AXLA 3N97A 1K6OA 2KIFA 1F9NA 2GAUA 3I59B 6PAXA 2QBYA 1XDSA 4UUVA 1H9GA 4EGZA 1R5HA 4EVIA 3F3XA 1G6NA 4O6JA 3ZQ7A 4BAYA 5CVUA 2L4AA 2MD5A 3IKVA 2M30A 3GLXA 2IW5A 1AOYA 2KRFA 1S29A 2P8TA 3TO7A 3W6JB 3JTGA 1Y0UA 1IRGA 2DW4A 2KJCA 3O2PE 3M9AA 2OBPA 5K1YA 2VC1A 2VBYA 1IW7F 3T8RA 1FYMA 3GF2A 2EWNA 4ZYGA 5LHGA 3KZYA 1K78A 4A6DA 2EV5A 5HOOA 4UV9A 3JSPA 1UFMA 2ZFWA 1O7FA 4JQFA 3HOTA 2GXBA 3V4GA 2XRNA 3I59A 4KNYA 2IPQX 3M8FA 3RJPA 2G7UA 4N9IA 4AVPA 2RKHA 4PDKA 3F8MA 4RGSA 3WE3A 2PBIA 2VT3A 1UHWA 3GUDA 1MDMA 1IAWA 2ZMEB 4HV5A 1T38A 1T6SA 4HAMA 1TQIA 1EH7A 5E1WA 5CYVA 2E1NA 3WTXC 1MJAA 1U5TA 5D4RA 1KU3A 5DEQA 4HBLA 1E17A 4HLXA 3SXYA 1U5TB 2EFNA 4CHUA 5HDKA 1IN6A 3KEQA 1STZA 4A2UA 1ZGAA 1K78B 2FA5A 2XIGA 3DFGA 3K2ZA 1MDMB 4KIFA 5K5RA 2VE9A 3HSFA 4L5JA 4IF4A 1OPCA 2FEZA 3VODA 1B9MA 1KQ9A 2OZUA 3GXOA 1MJBA 2ELHA 5DCFA 3HHGA 1J59A 1T39A 1HSTA 5J8FA 2HQRA 4CZZA 1CF7B 3V7RA 3HTUA 5L3GA 1FY7A 1IZ1A 3IKTA 2EB7A 5E1ZB 2MH9A 3U9GA 3J80Z 2IA2A 3BPXA 4EJTA 1ON1A 2C6YA 3WU0A 5E20A 1K79A 5H6RA 2QUFA 2ISZA 1JGSA 4XRFA 4S04A 1U8RA 2F5DA 2FBHA 2Z9OA 3V7SA 3ZP5A 3SQNA 4WXCA 4M73A 5CVVA 3F22A 2IJLA 4ZH4F 2G7HA 1WSUA 3M8EA 3TO6A 4EJOA 1HSJA 1WRJA 4L9JA 3JW4A 3NRVA 3MEXA 4A6EA 2JT1A 1O7LA 1TBXA 1HKQA 1LB2A 2R7FA 5D5VB 1FT9A 2NNYA 1J7KA 2KIMA 1X3UA 1ZG5A 3ABUA 2HEOA 3NEUA 5FFZA 4RB3C 3WTVC 1WWXA 3KLNA 3EDPA 5D8LB 4I7HA 1ZAOA 2H6CA 3DKWA 4EQQA 2V79A 2XAJA 2OU2A 3IC7A 1B4AA 2VBWA 3LA2A 4Y13A 2MC3A 1O57A 2P7CB 2HKXA 2K7LA 2XHKA 2W57A 4RS8A 1OYWA 2QZ8A 2W85A 4G7HF 2K02A 1B6AA 2FBKA 4P9UA 1REPC 1DPUA 5J8CA 4L5IA 4YFKF 3M7GA 4WCGA 1RZ4A 2Q0OA 2QQ9A 4KIBA 1E2XA 1R58A 2QM3A 3G73A 1XSDA 3WTTC 1L3LA 1PP8F 3WTWC 2G9WA 2XGXA 3QP6A 4HF2A 4OINF 4LD5A 1I6XA 1KGSA 1S7OA 3R60A 2YSRA 5HS9A 5F64A 5ILUA 3C7JA 2CWEA 2IA1A 3HSRA 5JVTA 5D4SA 3QAHA 2FSWA 2ZJ2A 1F1ZA 2EFPA 2HYGD 4A0YA 4I2OA 1MGTA 3TKYA 1D5VA 1HW2A 1O3SA 1QBJA 1SFXA 2HWVA 2H94A 4Z2YA 1JXSA 3WE2A 2X4HA 1I1GA 1WI9A 4O3MA 2RDPA 2QENA 4IRIA 3K1PA 2ETHA 2KIUA 2O61A 5JHUA 2EA2A 3ZN1A 5LLQA 2H6BA 3GFMA 3JTHA 1HW5A 1NHAA 3D0SA 2GA2A 5D8KB 5EEHA 2R3SA 1XCBA 3CO6C 2L01A 1VTNC 1R22A 4I98B 1LQ1A 2VN2A 3GFLA 2Z5UA 1YTYA 2UWMA 4A0XA 1W5SA 4YFNF 2IP2A 3K0LA 2EFQA 3I4PA 2W84A 5TJJA 3JAMK 5AIPA 2RVCA 2V9VA 1TNSA 3RKWA 3E97A 1YO5C 3K69A 2E1CA 1D8JA 1LNWA 3ECHA 1OMIA 3F8BA 5ICFA 3V8JA 3V8LA 2HYFA 2DO7A 4IXAA 3J81K 1FOKA 3FZVA 2FMLA 3GZ6A 2AS5F 4MTEA 2COMA 1S7AA 3QRFF 5CLSA 3F23A 3BJAA 5FB2A 3SHFA 3QPTA 1BC7C 1V3FA 4I09A 3K1NA 1IN7A 3ZPLA 1FYLA 4AIJA 2A68F 4M6XA 3WU1B 1P2FA 1JHFA 5D5WB 1PUEE 4WXHA 2ZNZA 3H3UA 2E7WA 1Z6TA 1W7PA 2A61A 1KYZA 4ZYHA 1MD0A 4EGYA 4IJAA 1FSHA 5E1XA 1KA8A 4FT8A 4Y15A 3HYIA 2JTVA 1SAXA 4GGGA 3CTAA 1A04A 3LWFA 4NHJA 1ZN2A 2GIVA 3FXQA 3KP7A 4U0WA 1TNTA 4M71A 2VOOA 1P92A 3FM5A 2NRAC 3HHHA 3HTSB 2M45A 4IPAA 4HYEA 3FMQA 4M9ZA 1LJ9A 3HOSA 5HS8A 2PG4A 2LF7A 3LQQA 1S3JA 3ZN0A 3T5XA 2M8EA 5ED4A 4EM2A 5K5QA 1Z1DA 5L3BA 4L0YB 4WX9A 1FLIA 5E18F 3ABTA 4KMFA 2IVMA 1U2WA 2PLYA 2VXZA 2NYXA 1UCRA 4YIIA 5FD5A 4L18B 4OIRF 2P7VB 3GX4X 5HLHA 1DUXC 1HBXG 1BC8C 3SZPA 1IN4A 4P9FA 5FD6A 4GCVA 4BNCA 4LB6B 3DF8A 1Z6RA 3FX3A 3I54A 2V1UA 5E8GA 1BI1A 1SD5A 2ZCWA 2EK5A 5H6QA 3GYHX 4GO1A 3PQJA 2V6CA 4LMYA 5E8IA 2GWRA 1CF7A 2FRHA 4L9TA 1HQCA 2DT5A 3E5XA 1P6RA 3IWZA 1GVJA 4JBAA 4MQVA 3CDHA 3GEZA 4U7BA 5EEGA 5L3FA 4ENNA 1ZRCA 3KP6A 1QZYA 1BOAA 3P9IA 3F8CA 4KUMA 3D5LA 3RDIA 3MQ0A 1V4RA 4UVBA 5ERIA 4KMUX 2HTJA 4IVNA 3J81Z 2RN7A 2NS0A 4XSZF 2K86A 5LHIA 3JSOA 3QU3A 2HR3A 5DUKA 3BPVA 3FXUA 4GYIA 2A07F 4OIPF 3FM3A 2VOPA 1B59A 4ESFA 2QYOA 2A3SA 2LKPA 2DAOA 5LRRA 5IT9K 1USSA 5BOXA 4KA4A 4AIHA 2ESHA 2IA0A 4LG0B 4IRHA 4OIOF 1ZHFA 4HF0A 1XSXA 3CUOA 4MEYF 1XGMA 4BXUA 1FC3A 4L0ZB 1XMAA 5HVQC 2LNBA 2YU3A 4LK0F 3MFKA 3WTYC 2PQ8A 3GVAA 2HGCA 5D6FA 2F5EA 3ECOA 4EJUA 1RNLA 3VEPA 3HRMA 4HZFA 1IUYA 3CUQB 2Q8KA 2H27A 2PEXA 3FF5A 3ML6A 1I27A 1R1UA 5DCMA 2A69F 3IL2A 4LLLA 2J5OA 4LB5A 3T1BA 4HW0A 3DV8A 2VODA 4ENKA 2STWA 4A5MA 2R7DA 3U1DA 1FP2A 3G3ZA 2W24A 2HDCA 2K4JA 4I02A 3L7WA 1ODDA 1FWZA 4YG2F 3HSEA 5LHHA 1YYVA 2QBYB 4EV0A 5HLIA 3WTSC 5FGMA 5LRSA 2PN6A 2EV6A 1R36A 2XV4S 2YPRA 3Q9SA 3MAJA 1HXDA 2EA4A 2OZ6A 2WV0A 3CUQC 4JK1X 1QPMA 3F6OA 1ZREA 1KQ8A 3K9TA 4HF1A 3JAMZ 3TGNA 1SFUA 2YX7A 2JPBA 3E6DA 4ETSA 2FOKA 5ICEA 5LGUA 1IN8A 1SD7A 4OIQF 2QQBA 3KZZA 4QWQA 4EJVA 1HKTA 3KFWX 2ZBKA 5L3CA 4WF2A 2KKOA 4DQ2A 5F6FA 1R23A 4WXDA 3CUQA 4BH9A 2L3DA 3GO5A 1R1VA 1FPQA 1I5ZA 3V8KA 3KETA 3WGGA 4YIFA 4G8XA 4ZYEA 2Y0MA 5JI6A 4M72A 1TTYA 3BP8A 4M9SA 2RV8A 2P4WA 4QLCU 4FHTA 2PI0A 1XGOA 3KE2A 2F5CA 4CICA 5A2QZ 1AWCA 1OYIA 1IXSB 3I64A 2D45A 1JE8A 4N0BA 3L9FA 1U6GA 4BQAA 2VBXA 2STTA 5FLXZ 1GHCA 1IN5A 4R79A 2HFHA 1XMKA 5D5XB 4F7ZA 1G3WA 5DD8A 2Y48A 3GWZA 1SD4A 3EYYA 5KVRA 2RNJA 4B09A 2UXXA 3C1DA 4I01A 4FX0A 4M6YA 4MQ9F 4UNOA 3B73A 5LEKA 2WWYA 1YW8A 3K1MA 4HX8A 2TDXA 2M1BA 2EFWA 3QP5A 1T2KA 4M74A 2FE3A 3C18A 3RKXA 4RB1A 4DNCA 1R1TA 1P4WA 2D1HA 4ENMA 2OQGA 5BPIA 1SFEA 3R0JA 1XDUA 1RUNA 1XB4A 4HOBA 3IHUA 1XGNA 2XKOA 3BJ6A 4HDUA 1FBSA 1DPRA 4G9YA 2JZYA 4PGHA 1YG2A 3T8TA 5FO5A 1FYKA 4G6QA 3DEUA 1ON2A 1H9TA 4KN7X 2BEOA 1KU9A 3F21A 3REOA 4OOIA 2FBIA 1YW7A 4N9HA 1ZRDA 3FMRA 1ZLJA 1ZG3A 4Q48A 4LGWA 3F72A 3ZMDA 1SMYF 1J0RA 2M87A 3PFIA 4HQEA 1CGPA 3DPTA 1L0OC 1DP7P 2GZWA 4KN4X 3RKYA 3V7CA 1I1SA 3LAPA 3KP3A 2FQ3A 1UB9A 5CJ9A 5CVRA 2CG4A 1XN7A 3LAJA 1JHHA 5ICGA 2CW0F 1ZLKA 1SMTA 1GXPA 1KU7A 2DPDA 2O03A 1R5GA 4GXOA 3RI4A 2MBFA 4WWCA 1Q1HA 4XLNF 3CO7C 4I0BA 2O8XA 2LDUA 2W25A 2QVOA 3GFJA 3DQVC 3FWEA 4BHCA 3ERED 3RTRA 3C3WA 2UXNA 1QGPA 4ON0A 4BYYA 1PP7U 1S6LA 5LBQA 3FXRA 1Z7UA 3BOQA 4RB0A 3R6SA 3WODF 3I71A 3N4MA 3PQKA 2ZMEA 4ASNA 4CGZA 2ISYA 5JFRA 2XAHA 2F5FA 3HIFA 3H3ZA 3IRRA 1IRFA 4EM1A 1G3TA 4ESJA 4HA8A 1LVAA 2FXAA 1YW9A 3I58A 1FZPB 3VFZA 5KK1A 3I5UA 2BBYA 2GA1A 4U88A 3KP4A 2Z3YA 1DDNA 3TDUC 2Z99A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EV0 A;  1TW2 A;  1FNN A;  4KYW A;  1XSV A;  3GFI A;  3Q9V A;  2ZNY A;  4IHS A;  1TQM A;  4BHB A;  3BWG A;  3RIR A;  2QWW A;  2O0Y A;  3B02 A;  1B9N A;  3BJO A;  5HDN A;  1XD7 A;  5ILS A;  2NNN A;  5K5O A;  4HQM A;  2GQQ A;  4NB5 A;  5BMZ A;  1B1B A;  2BV6 A;  3ULQ B;  3LA7 A;  2L02 A;  4ESB A;  3QPH A;  3R4K A;  2Y75 A;  5IT9 Z;  3HRS A;  3ELK A;  1QO0 D;  1F4K A;  3FHZ A;  1BI3 A;  4K2E A;  1MKM A;  1G3S A;  5H20 A;  4WK8 F;  4LG0 A;  5TRD A;  3F8N A;  3RYR A;  1EH6 A;  1TLH B;  3L00 A;  5L3E A;  2B0L A;  2HOE A;  3TOB A;  1RI7 A;  2UZK A;  4AWX B;  4TV7 A;  4MEX F;  2FF4 A;  1RIO H;  3EYI A;  4HX7 A;  2DI3 A;  5E17 F;  3LA3 A;  1ZRF A;  4PZJ A;  1G3Y A;  4YFX F;  2WC2 A;  5L3D A;  4Q4Z F;  1BI2 A;  3EET A;  3HRU A;  2P5K A;  1HW1 A;  1J5Y A;  3BRO A;  2HZT A;  3HUG A;  4H0E A;  5D5U B;  2DBB A;  2DLL A;  2KJB A;  1D8K A;  1LDK B;  3ZMZ A;  4MTD A;  1YS7 A;  4EMS A;  1UST A;  5DD4 A;  1FSE A;  3MZY A;  4FX4 A;  5LGN A;  4XSX F;  2XAF A;  1J2X A;  4L9N A;  1O3R A;  1LEA A;  4LFU A;  1RUO A;  2K27 A;  5CVI A;  2QQA A;  1BN5 A;  2DQR A;  4AIK A;  5LGT A;  3S2W A;  1KU2 A;  3KLO A;  2X0L A;  5BS6 A;  1HKS A;  4OMZ A;  4O5V A;  5FFX A;  5DUI A;  3O3K A;  3WGI A;  2IT0 A;  3L09 A;  3E5U A;  1SD6 A;  3ZMU A;  2FU4 A;  3KCC A;  1YS6 A;  1EH8 A;  1W4M A;  4XLP F;  2E7X A;  4L9V A;  4EJW A;  1PDN C;  3DPL C;  2ZO4 A;  5LEJ A;  3TOA A;  2FNA A;  2P6S A;  3CLO A;  2LSO A;  1QZZ A;  3GZ5 A;  4XBF A;  4LLG F;  1R00 A;  4HDV A;  2PMU A;  3I53 A;  4P96 A;  2DPU A;  2XVC A;  2XAS A;  2DK8 A;  4Y17 A;  4KIC A;  4M9X A;  3O6B B;  5BQT A;  3COA C;  1H0M A;  3LQR A;  1W7P D;  1W7P B;  2EFO A;  2XAG A;  1D3Y A;  2F2E A;  3ISP A;  4Q47 A;  2L4M A;  2VON A;  1BM9 A;  1LEB A;  2FMY A;  1FBU A;  3IRQ A;  1TW3 A;  5HS7 A;  4MHG A;  1GXQ A;  2HS5 A;  1G4D A;  3WG9 A;  3F6V A;  2RQP A;  1QNT A;  2P5L C;  5DYM A;  1WKM A;  2ESN A;  3HRT A;  5AON A;  2D1V A;  2K4B A;  3EUH A;  4A12 A;  3CJN A;  1FP1 D;  2QLZ A;  5FLX K;  4LK1 F;  3VB2 A;  4IRG A;  2H09 A;  4RGU A;  2O3F A;  4KIG A;  2PFB A;  4R8H A;  4D0P A;  4G7Z F;  3AAF A;  2JRT A;  2MLK A;  3BZ6 A;  4P55 A;  1UHM A;  1U78 A;  1T0F A;  3R61 A;  5JR3 A;  4KFC A;  4MGR A;  2JSC A;  2ZXJ A;  1ZH5 A;  3Q5F A;  4GYG A;  3EQL F;  4KDP A;  3M1E A;  3R0A A;  3SZT A;  4ZYD A;  3VOE A;  4U0V A;  4S05 A;  2DTR A;  1LDD A;  4CO8 A;  1YFH A;  5AIQ A;  2DK5 A;  4RGX A;  3RYP A;  4IHT A;  1C0W A;  1WQ2 A;  4P5O A;  1S8N A;  5HLG A;  2OQR A;  3H92 A;  2PMH A;  2GXG A;  3GW2 A;  4HV6 A;  3L2C A;  2HTS A;  1OYY A;  3P7N A;  1BIB A;  4U7D A;  2DQL A;  3LST A;  1U5T C;  4I0A A;  2BGC A;  5DCM B;  4B8X A;  2IRF G;  3P9K A;  3OOP A;  1O3T A;  2YX4 A;  1BJA A;  4OU0 A;  1FBQ A;  2HQN A;  1T98 A;  4HLY A;  4Q5S F;  1YQA A;  4RGR A;  2HKO A;  2Z33 A;  4UHT A;  5DDG A;  2D2W A;  1YIO A;  1W5T A;  3RPQ A;  4ZZD A;  4HX4 A;  2A5Y B;  4RB2 C;  3QOP A;  3LFK A;  1ULY A;  2YR2 A;  3E5Q A;  2VT2 A;  2NAZ A;  2BYV E;  1MZB A;  3W6K B;  3ZMT A;  1Z91 A;  1P4X A;  3DP7 A;  4AD9 A;  3DXJ F;  3KP2 A;  1OKR A;  3E3V A;  4UV8 A;  3WTZ A;  4NQW A;  5CVJ A;  4BHP A;  5ICC A;  3F8F A;  2M5W A;  3OV8 A;  3KP5 A;  1J9I A;  2DU9 A;  2CGP A;  4LLN A;  3BDD A;  1TQP A;  2V1X A;  3E6B A;  3E6C C;  2OA4 A;  4MNU A;  2VBZ A;  2MH2 A;  4ENJ A;  4R1H A;  1K7A A;  4OMY A;  4U0Y A;  2MLG A;  4G94 A;  2BE5 F;  3RPU A;  4G7O F;  2XKP A;  3J7A O;  2OD5 A;  1P4A A;  4A5N A;  1OR7 A;  4KT5 C;  3J80 K;  4CXF A;  3BY6 A;  3TDZ C;  3KEO A;  2O6G E;  4CYD A;  1XGS A;  2XAQ A;  1Z9C A;  1R7J A;  1IXC A;  4E70 A;  1EV7 A;  1XCV A;  3WGH A;  2ZKZ A;  1BIA A;  5J6X A;  2DFI A;  3I0T A;  1ZYR F;  4EM0 B;  4UVC A;  4UXN A;  2A6E F;  5A2Q K;  3ZMS A;  3E6M A;  1KYW A;  2VE8 A;  1QQI A;  2FNP A;  2VC0 A;  1ZG1 A;  4RAY A;  1FX7 A;  5IT3 A;  1KQ0 A;  1YLF A;  4ZZL A;  2RGV A;  3QU6 A;  2CO5 A;  2XUB A;  2A6H F;  2ACJ A;  1IXR C;  2CYY A;  2MA3 A;  5ILV A;  3ZMV A;  3TO9 A;  3MZH A;  1U3E M;  1O3Q A;  3IWF A;  2RC4 A;  2P6T A;  5HDG A;  2WTE A;  1J75 A;  3MWM A;  2L54 A;  4G6D A;  3MCZ A;  5DV5 A;  4UVA A;  1F5T A;  2XRO A;  2EJR A;  2PJP A;  3NQO A;  4PCQ A;  3T0Y A;  3SFZ A;  1Z05 A;  2LF8 A;  1IF1 A;  3FMS A;  4CDG A;  1ONV A;  2CSO A;  5BPD A;  2ADU A;  2JPC A;  5D6E A;  2CFX A;  2CQK A;  2J5P A;  4LJZ F;  1LDJ A;  2OAZ A;  3U2R A;  5F1R A;  3WTU C;  1BBY A;  1MJ9 A;  4RAZ A;  1ZAR A;  3TQN A;  2P5V A;  2V1D A;  3ROU A;  1ZGJ A;  2Q2E A;  3P9C A;  1BI0 A;  4PGG A;  4A0Z A;  2AXL A;  3N97 A;  1K6O A;  2KIF A;  1F9N A;  2GAU A;  3I59 B;  6PAX A;  2QBY A;  1XDS A;  4UUV A;  1H9G A;  4EGZ A;  1R5H A;  4EVI A;  3F3X A;  1G6N A;  4O6J A;  3ZQ7 A;  4BAY A;  5CVU A;  2L4A A;  2MD5 A;  3IKV A;  2M30 A;  3GLX A;  2IW5 A;  1AOY A;  2KRF A;  1S29 A;  2P8T A;  3TO7 A;  3W6J B;  3JTG A;  1Y0U A;  1IRG A;  2DW4 A;  2KJC A;  3O2P E;  3M9A A;  2OBP A;  5K1Y A;  2VC1 A;  2VBY A;  1IW7 F;  3T8R A;  1FYM A;  3GF2 A;  2EWN A;  4ZYG A;  5LHG A;  3KZY A;  1K78 A;  4A6D A;  2EV5 A;  5HOO A;  4UV9 A;  3JSP A;  1UFM A;  2ZFW A;  1O7F A;  4JQF A;  3HOT A;  2GXB A;  3V4G A;  2XRN A;  3I59 A;  4KNY A;  2IPQ X;  3M8F A;  3RJP A;  2G7U A;  4N9I A;  4AVP A;  2RKH A;  4PDK A;  3F8M A;  4RGS A;  3WE3 A;  2PBI A;  2VT3 A;  1UHW A;  3GUD A;  1MDM A;  1IAW A;  2ZME B;  4HV5 A;  1T38 A;  1T6S A;  4HAM A;  1TQI A;  1EH7 A;  5E1W A;  5CYV A;  2E1N A;  3WTX C;  1MJA A;  1U5T A;  5D4R A;  1KU3 A;  5DEQ A;  4HBL A;  1E17 A;  4HLX A;  3SXY A;  1U5T B;  2EFN A;  4CHU A;  5HDK A;  1IN6 A;  3KEQ A;  1STZ A;  4A2U A;  1ZGA A;  1K78 B;  2FA5 A;  2XIG A;  3DFG A;  3K2Z A;  1MDM B;  4KIF A;  5K5R A;  2VE9 A;  3HSF A;  4L5J A;  4IF4 A;  1OPC A;  2FEZ A;  3VOD A;  1B9M A;  1KQ9 A;  2OZU A;  3GXO A;  1MJB A;  2ELH A;  5DCF A;  3HHG A;  1J59 A;  1T39 A;  1HST A;  5J8F A;  2HQR A;  4CZZ A;  1CF7 B;  3V7R A;  3HTU A;  5L3G A;  1FY7 A;  1IZ1 A;  3IKT A;  2EB7 A;  5E1Z B;  2MH9 A;  3U9G A;  3J80 Z;  2IA2 A;  3BPX A;  4EJT A;  1ON1 A;  2C6Y A;  3WU0 A;  5E20 A;  1K79 A;  5H6R A;  2QUF A;  2ISZ A;  1JGS A;  4XRF A;  4S04 A;  1U8R A;  2F5D A;  2FBH A;  2Z9O A;  3V7S A;  3ZP5 A;  3SQN A;  4WXC A;  4M73 A;  5CVV A;  3F22 A;  2IJL A;  4ZH4 F;  2G7H A;  1WSU A;  3M8E A;  3TO6 A;  4EJO A;  1HSJ A;  1WRJ A;  4L9J A;  3JW4 A;  3NRV A;  3MEX A;  4A6E A;  2JT1 A;  1O7L A;  1TBX A;  1HKQ A;  1LB2 A;  2R7F A;  5D5V B;  1FT9 A;  2NNY A;  1J7K A;  2KIM A;  1X3U A;  1ZG5 A;  3ABU A;  2HEO A;  3NEU A;  5FFZ A;  4RB3 C;  3WTV C;  1WWX A;  3KLN A;  3EDP A;  5D8L B;  4I7H A;  1ZAO A;  2H6C A;  3DKW A;  4EQQ A;  2V79 A;  2XAJ A;  2OU2 A;  3IC7 A;  1B4A A;  2VBW A;  3LA2 A;  4Y13 A;  2MC3 A;  1O57 A;  2P7C B;  2HKX A;  2K7L A;  2XHK A;  2W57 A;  4RS8 A;  1OYW A;  2QZ8 A;  2W85 A;  4G7H F;  2K02 A;  1B6A A;  2FBK A;  4P9U A;  1REP C;  1DPU A;  5J8C A;  4L5I A;  4YFK F;  3M7G A;  4WCG A;  1RZ4 A;  2Q0O A;  2QQ9 A;  4KIB A;  1E2X A;  1R58 A;  2QM3 A;  3G73 A;  1XSD A;  3WTT C;  1L3L A;  1PP8 F;  3WTW C;  2G9W A;  2XGX A;  3QP6 A;  4HF2 A;  4OIN F;  4LD5 A;  1I6X A;  1KGS A;  1S7O A;  3R60 A;  2YSR A;  5HS9 A;  5F64 A;  5ILU A;  3C7J A;  2CWE A;  2IA1 A;  3HSR A;  5JVT A;  5D4S A;  3QAH A;  2FSW A;  2ZJ2 A;  1F1Z A;  2EFP A;  2HYG D;  4A0Y A;  4I2O A;  1MGT A;  3TKY A;  1D5V A;  1HW2 A;  1O3S A;  1QBJ A;  1SFX A;  2HWV A;  2H94 A;  4Z2Y A;  1JXS A;  3WE2 A;  2X4H A;  1I1G A;  1WI9 A;  4O3M A;  2RDP A;  2QEN A;  4IRI A;  3K1P A;  2ETH A;  2KIU A;  2O61 A;  5JHU A;  2EA2 A;  3ZN1 A;  5LLQ A;  2H6B A;  3GFM A;  3JTH A;  1HW5 A;  1NHA A;  3D0S A;  2GA2 A;  5D8K B;  5EEH A;  2R3S A;  1XCB A;  3CO6 C;  2L01 A;  1VTN C;  1R22 A;  4I98 B;  1LQ1 A;  2VN2 A;  3GFL A;  2Z5U A;  1YTY A;  2UWM A;  4A0X A;  1W5S A;  4YFN F;  2IP2 A;  3K0L A;  2EFQ A;  3I4P A;  2W84 A;  5TJJ A;  3JAM K;  5AIP A;  2RVC A;  2V9V A;  1TNS A;  3RKW A;  3E97 A;  1YO5 C;  3K69 A;  2E1C A;  1D8J A;  1LNW A;  3ECH A;  1OMI A;  3F8B A;  5ICF A;  3V8J A;  3V8L A;  2HYF A;  2DO7 A;  4IXA A;  3J81 K;  1FOK A;  3FZV A;  2FML A;  3GZ6 A;  2AS5 F;  4MTE A;  2COM A;  1S7A A;  3QRF F;  5CLS A;  3F23 A;  3BJA A;  5FB2 A;  3SHF A;  3QPT A;  1BC7 C;  1V3F A;  4I09 A;  3K1N A;  1IN7 A;  3ZPL A;  1FYL A;  4AIJ A;  2A68 F;  4M6X A;  3WU1 B;  1P2F A;  1JHF A;  5D5W B;  1PUE E;  4WXH A;  2ZNZ A;  3H3U A;  2E7W A;  1Z6T A;  1W7P A;  2A61 A;  1KYZ A;  4ZYH A;  1MD0 A;  4EGY A;  4IJA A;  1FSH A;  5E1X A;  1KA8 A;  4FT8 A;  4Y15 A;  3HYI A;  2JTV A;  1SAX A;  4GGG A;  3CTA A;  1A04 A;  3LWF A;  4NHJ A;  1ZN2 A;  2GIV A;  3FXQ A;  3KP7 A;  4U0W A;  1TNT A;  4M71 A;  2VOO A;  1P92 A;  3FM5 A;  2NRA C;  3HHH A;  3HTS B;  2M45 A;  4IPA A;  4HYE A;  3FMQ A;  4M9Z A;  1LJ9 A;  3HOS A;  5HS8 A;  2PG4 A;  2LF7 A;  3LQQ A;  1S3J A;  3ZN0 A;  3T5X A;  2M8E A;  5ED4 A;  4EM2 A;  5K5Q A;  1Z1D A;  5L3B A;  4L0Y B;  4WX9 A;  1FLI A;  5E18 F;  3ABT A;  4KMF A;  2IVM A;  1U2W A;  2PLY A;  2VXZ A;  2NYX A;  1UCR A;  4YII A;  5FD5 A;  4L18 B;  4OIR F;  2P7V B;  3GX4 X;  5HLH A;  1DUX C;  1HBX G;  1BC8 C;  3SZP A;  1IN4 A;  4P9F A;  5FD6 A;  4GCV A;  4BNC A;  4LB6 B;  3DF8 A;  1Z6R A;  3FX3 A;  3I54 A;  2V1U A;  5E8G A;  1BI1 A;  1SD5 A;  2ZCW A;  2EK5 A;  5H6Q A;  3GYH X;  4GO1 A;  3PQJ A;  2V6C A;  4LMY A;  5E8I A;  2GWR A;  1CF7 A;  2FRH A;  4L9T A;  1HQC A;  2DT5 A;  3E5X A;  1P6R A;  3IWZ A;  1GVJ A;  4JBA A;  4MQV A;  3CDH A;  3GEZ A;  4U7B A;  5EEG A;  5L3F A;  4ENN A;  1ZRC A;  3KP6 A;  1QZY A;  1BOA A;  3P9I A;  3F8C A;  4KUM A;  3D5L A;  3RDI A;  3MQ0 A;  1V4R A;  4UVB A;  5ERI A;  4KMU X;  2HTJ A;  4IVN A;  3J81 Z;  2RN7 A;  2NS0 A;  4XSZ F;  2K86 A;  5LHI A;  3JSO A;  3QU3 A;  2HR3 A;  5DUK A;  3BPV A;  3FXU A;  4GYI A;  2A07 F;  4OIP F;  3FM3 A;  2VOP A;  1B59 A;  4ESF A;  2QYO A;  2A3S A;  2LKP A;  2DAO A;  5LRR A;  5IT9 K;  1USS A;  5BOX A;  4KA4 A;  4AIH A;  2ESH A;  2IA0 A;  4LG0 B;  4IRH A;  4OIO F;  1ZHF A;  4HF0 A;  1XSX A;  3CUO A;  4MEY F;  1XGM A;  4BXU A;  1FC3 A;  4L0Z B;  1XMA A;  5HVQ C;  2LNB A;  2YU3 A;  4LK0 F;  3MFK A;  3WTY C;  2PQ8 A;  3GVA A;  2HGC A;  5D6F A;  2F5E A;  3ECO A;  4EJU A;  1RNL A;  3VEP A;  3HRM A;  4HZF A;  1IUY A;  3CUQ B;  2Q8K A;  2H27 A;  2PEX A;  3FF5 A;  3ML6 A;  1I27 A;  1R1U A;  5DCM A;  2A69 F;  3IL2 A;  4LLL A;  2J5O A;  4LB5 A;  3T1B A;  4HW0 A;  3DV8 A;  2VOD A;  4ENK A;  2STW A;  4A5M A;  2R7D A;  3U1D A;  1FP2 A;  3G3Z A;  2W24 A;  2HDC A;  2K4J A;  4I02 A;  3L7W A;  1ODD A;  1FWZ A;  4YG2 F;  3HSE A;  5LHH A;  1YYV A;  2QBY B;  4EV0 A;  5HLI A;  3WTS C;  5FGM A;  5LRS A;  2PN6 A;  2EV6 A;  1R36 A;  2XV4 S;  2YPR A;  3Q9S A;  3MAJ A;  1HXD A;  2EA4 A;  2OZ6 A;  2WV0 A;  3CUQ C;  4JK1 X;  1QPM A;  3F6O A;  1ZRE A;  1KQ8 A;  3K9T A;  4HF1 A;  3JAM Z;  3TGN A;  1SFU A;  2YX7 A;  2JPB A;  3E6D A;  4ETS A;  2FOK A;  5ICE A;  5LGU A;  1IN8 A;  1SD7 A;  4OIQ F;  2QQB A;  3KZZ A;  4QWQ A;  4EJV A;  1HKT A;  3KFW X;  2ZBK A;  5L3C A;  4WF2 A;  2KKO A;  4DQ2 A;  5F6F A;  1R23 A;  4WXD A;  3CUQ A;  4BH9 A;  2L3D A;  3GO5 A;  1R1V A;  1FPQ A;  1I5Z A;  3V8K A;  3KET A;  3WGG A;  4YIF A;  4G8X A;  4ZYE A;  2Y0M A;  5JI6 A;  4M72 A;  1TTY A;  3BP8 A;  4M9S A;  2RV8 A;  2P4W A;  4QLC U;  4FHT A;  2PI0 A;  1XGO A;  3KE2 A;  2F5C A;  4CIC A;  5A2Q Z;  1AWC A;  1OYI A;  1IXS B;  3I64 A;  2D45 A;  1JE8 A;  4N0B A;  3L9F A;  1U6G A;  4BQA A;  2VBX A;  2STT A;  5FLX Z;  1GHC A;  1IN5 A;  4R79 A;  2HFH A;  1XMK A;  5D5X B;  4F7Z A;  1G3W A;  5DD8 A;  2Y48 A;  3GWZ A;  1SD4 A;  3EYY A;  5KVR A;  2RNJ A;  4B09 A;  2UXX A;  3C1D A;  4I01 A;  4FX0 A;  4M6Y A;  4MQ9 F;  4UNO A;  3B73 A;  5LEK A;  2WWY A;  1YW8 A;  3K1M A;  4HX8 A;  2TDX A;  2M1B A;  2EFW A;  3QP5 A;  1T2K A;  4M74 A;  2FE3 A;  3C18 A;  3RKX A;  4RB1 A;  4DNC A;  1R1T A;  1P4W A;  2D1H A;  4ENM A;  2OQG A;  5BPI A;  1SFE A;  3R0J A;  1XDU A;  1RUN A;  1XB4 A;  4HOB A;  3IHU A;  1XGN A;  2XKO A;  3BJ6 A;  4HDU A;  1FBS A;  1DPR A;  4G9Y A;  2JZY A;  4PGH A;  1YG2 A;  3T8T A;  5FO5 A;  1FYK A;  4G6Q A;  3DEU A;  1ON2 A;  1H9T A;  4KN7 X;  2BEO A;  1KU9 A;  3F21 A;  3REO A;  4OOI A;  2FBI A;  1YW7 A;  4N9H A;  1ZRD A;  3FMR A;  1ZLJ A;  1ZG3 A;  4Q48 A;  4LGW A;  3F72 A;  3ZMD A;  1SMY F;  1J0R A;  2M87 A;  3PFI A;  4HQE A;  1CGP A;  3DPT A;  1L0O C;  1DP7 P;  2GZW A;  4KN4 X;  3RKY A;  3V7C A;  1I1S A;  3LAP A;  3KP3 A;  2FQ3 A;  1UB9 A;  5CJ9 A;  5CVR A;  2CG4 A;  1XN7 A;  3LAJ A;  1JHH A;  5ICG A;  2CW0 F;  1ZLK A;  1SMT A;  1GXP A;  1KU7 A;  2DPD A;  2O03 A;  1R5G A;  4GXO A;  3RI4 A;  2MBF A;  4WWC A;  1Q1H A;  4XLN F;  3CO7 C;  4I0B A;  2O8X A;  2LDU A;  2W25 A;  2QVO A;  3GFJ A;  3DQV C;  3FWE A;  4BHC A;  3ERE D;  3RTR A;  3C3W A;  2UXN A;  1QGP A;  4ON0 A;  4BYY A;  1PP7 U;  1S6L A;  5LBQ A;  3FXR A;  1Z7U A;  3BOQ A;  4RB0 A;  3R6S A;  3WOD F;  3I71 A;  3N4M A;  3PQK A;  2ZME A;  4ASN A;  4CGZ A;  2ISY A;  5JFR A;  2XAH A;  2F5F A;  3HIF A;  3H3Z A;  3IRR A;  1IRF A;  4EM1 A;  1G3T A;  4ESJ A;  4HA8 A;  1LVA A;  2FXA A;  1YW9 A;  3I58 A;  1FZP B;  3VFZ A;  5KK1 A;  3I5U A;  2BBY A;  2GA1 A;  4U88 A;  3KP4 A;  2Z3Y A;  1DDN A;  3TDU C;  2Z99 A; 
#chains in the Genus database with same CATH topology
 2IS1 A;  3UKG A;  3HGY A;  2GOM A;  2EV0 A;  1TW2 A;  1FNN A;  4KYW A;  1ZR2 A;  1XSV A;  2W7N A;  3GFI A;  3Q9V A;  2K5C A;  2ZNY A;  4IHS A;  2MGQ A;  1GV5 A;  1N77 A;  1I3Q J;  1TQM A;  4BHB A;  3BWG A;  3RIR A;  2QWW A;  3GME A;  2DDB A;  2O0Y A;  2LRE A;  4B4C A;  3A02 A;  3B02 A;  1B9N A;  1TWA J;  3BJO A;  3LL7 A;  5HDN A;  1XD7 A;  3AG3 H;  5ILS A;  2R7T A;  2NNN A;  2R93 J;  2AQF A;  5K5O A;  4HQM A;  5HOD A;  4BY1 J;  2GQQ A;  2BHY A;  1EKE A;  3DCF A;  4NB5 A;  2X85 A;  3S1M J;  5BMZ A;  1B1B A;  1NK2 P;  1S5L C;  2BV6 A;  3ULQ B;  4DIQ A;  3LA7 A;  2L02 A;  1EJ9 A;  1GLN A;  4ESB A;  3QPH A;  1K83 J;  1X58 A;  3K4L A;  3R4K A;  2Y75 A;  5IT9 Z;  1I3A A;  3RKQ A;  1D1C A;  1PVE A;  3F9K A;  3HRS A;  3ELK A;  1QO0 D;  3S1R J;  1F4K A;  3FHZ A;  1IRX A;  1BI3 A;  4K2E A;  1S9H A;  1MKM A;  1G3S A;  5H20 A;  2I8D A;  4WK8 F;  4LG0 A;  5TRD A;  3F8N A;  3RYR A;  1EH6 A;  3BC8 A;  2DCE A;  2OTL I;  1QU3 A;  3GTP J;  4D1Q A;  4M3D A;  4ANJ A;  5J4Y A;  1TLH B;  3L00 A;  5L3E A;  1X4P A;  2LOO A;  3OS2 A;  2B0L A;  2HOE A;  3TOB A;  1VQ6 I;  1RI7 A;  2UZK A;  4AWX B;  4TV7 A;  2M0C A;  3OWT A;  1U9N A;  1TL8 A;  4MEX F;  2FF4 A;  1RIO H;  3EYI A;  4HX7 A;  2DI3 A;  4BDY A;  5E17 F;  3DBL B;  1VZ0 A;  3LFU A;  3LA3 A;  1ZRF A;  3GTK J;  3DTK A;  4IL6 C;  1H89 C;  3PNV A;  2DTZ A;  4PZJ A;  1G3Y A;  4YFX F;  2ZJQ F;  2WC2 A;  5L3D A;  4Q4Z F;  5HLT A;  1BI2 A;  3EET A;  1YOV B;  3H35 A;  2CV0 A;  1VQK I;  2DJI A;  3HRU A;  1XTA A;  2P5K A;  1HW1 A;  1J5Y A;  2FD5 A;  4XLH A;  3BRO A;  2HZT A;  1IGN A;  3G1L A;  4BJ6 C;  3HUG A;  3FDY A;  5TIS C;  1LFU P;  4H0E A;  4IOC F;  3ZQL A;  2F6C A;  3BR6 A;  5D5U B;  1R5I D;  2DBB A;  2DLL A;  2KJB A;  1D8K A;  1LDK B;  3ZMZ A;  4MTD A;  2VJ4 A;  2L9R A;  1YS7 A;  3BQY A;  4EMS A;  1UST A;  5DD4 A;  1E0E A;  1WI3 A;  3P5J A;  1FSE A;  3MZY A;  3OL4 A;  2M4G A;  5CPR B;  4FX4 A;  1TC3 C;  2BY1 A;  2E35 A;  5LGN A;  3S8P A;  4XSX F;  3JRD A;  2XAF A;  3AG2 H;  5JLW A;  2DDA A;  3HOU J;  2NOG A;  1J2X A;  4L9N A;  1MW7 A;  4XKB A;  1X4O A;  3K70 C;  1O3R A;  3LMM A;  1LEA A;  2KDZ A;  1A31 A;  2E2J J;  2DOE A;  4LFU A;  1RUO A;  4DBQ A;  5EG0 B;  2K27 A;  2WA0 A;  5CVI A;  2QQA A;  1BN5 A;  2HYJ A;  5DM7 F;  3KX2 A;  2DQR A;  4AIK A;  2WAF A;  3FBN B;  3HOZ J;  2L7K A;  2O9L A;  3L2V A;  5LGT A;  3S2W A;  4YEL A;  1KU2 A;  3KLO A;  4H4K C;  2NVX J;  4A3L J;  1E3H A;  3HBL A;  2M7B A;  2X0L A;  2IGM A;  2XB5 A;  3BR1 A;  5BS6 A;  4BUP A;  1HKS A;  4OMZ A;  4O5V A;  5FFX A;  1LUJ B;  4DZJ A;  4HPQ A;  3O3K A;  5DUI A;  3WGI A;  3M07 A;  4X1E A;  2IT0 A;  1HC8 A;  3L09 A;  5GAD J;  1JUP A;  3E5U A;  3CP8 A;  3G1M A;  1SD6 A;  3ZMU A;  2FU4 A;  2X6O A;  3PSF A;  3KCC A;  1YS6 A;  4MFD A;  2YU9 J;  2L9N A;  1EH8 A;  1W4M A;  4F55 A;  5GAG J;  4XLP F;  2E7X A;  4L9V A;  1IC8 A;  4EJW A;  3GTQ J;  1PDN C;  3DPL C;  2VQL A;  3FIS A;  2ZO4 A;  5LEJ A;  2OC6 A;  3TOA A;  2FNA A;  5CQG A;  2P6S A;  3CLO A;  3VPR A;  3OYK A;  2LSO A;  3TP3 A;  4HNT A;  1QZZ A;  2ME6 A;  3GZ5 A;  4XBF A;  4LLG F;  1R00 A;  3J7A Y;  1R4M B;  4HDV A;  1X1D A;  2PMU A;  4JX4 A;  3I53 A;  5DS9 A;  4P96 A;  1OCO H;  4F91 B;  2FX0 A;  3SDB A;  2DPU A;  3L2Q A;  1V5F A;  2XVC A;  2XAS A;  4E7K A;  2DK8 A;  4Y17 A;  4KIC A;  2MC4 A;  4M9X A;  5M3M J;  3O6B B;  2D5V A;  5BQT A;  4CYC B;  3JCU C;  3COA C;  1H0M A;  1W0U A;  1T33 A;  1FOW A;  3LQR A;  4E4H A;  1W7P D;  1W7P B;  2EFO A;  2XAG A;  4ZDO A;  4DJA A;  1D3Y A;  4X6A J;  3C2G A;  2F2E A;  2WAE A;  3ISP A;  4Y33 A;  1Y8Q B;  2HVR A;  4XR6 A;  4Q47 A;  2L4M A;  2HVS A;  2VON A;  1BM9 A;  1LEB A;  2FMY A;  1FBU A;  2F48 A;  3FXL A;  3CCV I;  3IRQ A;  1TW3 A;  5HS7 A;  2ELK A;  1GXQ A;  2HS5 A;  2KL4 A;  3O8H A;  4MHG A;  2GLO A;  1HCR A;  1G4D A;  3WG9 A;  3F6V A;  4D9J A;  2RQP A;  1TP4 A;  1QNT A;  2P5L C;  3OSG A;  5DYM A;  1WKM A;  5J1R A;  3SJM A;  2ESN A;  3HRT A;  2OCE A;  2MYS A;  5AON A;  2D1V A;  5IYC J;  2L5Q A;  2CQN A;  2K4B A;  3EUH A;  4A12 A;  3CJN A;  1FP1 D;  1R6R A;  2QLZ A;  5FLX K;  5FLV A;  4LK1 F;  3VB2 A;  4IRG A;  2MD0 A;  3I9V 2;  2BW3 B;  2H09 A;  4RGU A;  2O3F A;  2JMW A;  1DQU A;  2Y69 H;  3MVP A;  4KIG A;  2PFB A;  4R8H A;  4RBO A;  3KYD B;  2R92 J;  2ZC2 A;  4D0P A;  4G7Z F;  3AAF A;  4BKX A;  2JRT A;  3CLQ A;  2MLK A;  3BZ6 A;  4FQG A;  1HF0 A;  4P55 A;  2Y0S A;  1B8I B;  2M34 A;  2K9L A;  2XGE A;  4NQW B;  4BJ5 C;  3CC7 I;  1UHM A;  1T0F A;  1U78 A;  3W2W A;  3DEE A;  3R61 A;  5JR3 A;  4KFC A;  4MGR A;  1UG2 A;  2JSC A;  1X2M A;  2IXS A;  5E3M A;  2ZXJ A;  3BCB A;  4IHV A;  1ZH5 A;  4XLC A;  3Q5F A;  3HKZ A;  4GYG A;  1Y6I A;  2XF7 A;  2VPR A;  3EQL F;  3K4B A;  4KDP A;  4BEH B;  3M1E A;  2JA6 J;  3R0A A;  2E1M C;  3SZT A;  3W2V A;  4XL9 A;  4ZYD A;  3VOE A;  4U0V A;  2JQ7 A;  4S05 A;  2DTR A;  3G6E I;  1LDD A;  4CO8 A;  1YFH A;  3BG6 A;  2LFB A;  5AIQ A;  3LSP A;  3GTO J;  2DK5 A;  4RGX A;  3RYP A;  4IHY A;  2LVS A;  4IHT A;  1C0W A;  1WQ2 A;  5KAF C;  4IEJ A;  4ZTJ A;  4P5O A;  1S8N A;  5HLG A;  1VND A;  2EIN H;  1LKX A;  1MBJ A;  2OQR A;  5F0C A;  1A5J A;  3H92 A;  1MNE A;  2PMH A;  1IG7 A;  2GXG A;  3GW2 A;  4HV6 A;  3CCL I;  3L2C A;  2HTS A;  1PUF B;  1OYY A;  3P7N A;  1BIB A;  4U7D A;  1K4T A;  1ETY A;  1MBF A;  2DQL A;  2XF6 A;  3LST A;  5FRO A;  2CUZ A;  3GCM A;  1U5T C;  3S32 A;  4I0A A;  3ZQC A;  2BGC A;  5DCM B;  1Z67 A;  5J1U A;  4B8X A;  5M5W J;  2IRF G;  3P9K A;  3PUB A;  3OYJ A;  1S72 I;  2CQX A;  2OJE D;  3OOP A;  1O3T A;  2YX4 A;  3IUO A;  1BJA A;  1Z7L A;  4OU0 A;  1FBQ A;  2HQN A;  1T98 A;  4HLY A;  3S16 J;  4P1W A;  4GFB A;  4Q5S F;  1YQA A;  4XKV A;  4RGR A;  3DKY A;  1T08 B;  5J3L A;  2JRM A;  2HKO A;  2Z33 A;  1RES A;  1MND A;  1ETV A;  2ECB A;  2Y0S N;  4UHT A;  5DDG A;  2K9N A;  1IDY A;  2D2W A;  1YIO A;  1W5T A;  3RPQ A;  4ZZD A;  4HX4 A;  3PSI A;  2ZME C;  2A5Y B;  5FKM A;  3NAR A;  4C3J J;  4RB2 C;  3OYL A;  1VQN I;  3QOP A;  3LFK A;  1ULY A;  2DOF A;  2VKH A;  2R5Y A;  4CH7 A;  2YR2 A;  3E5Q A;  2VT2 A;  3CCM I;  2KZV A;  2HPM A;  2NAZ A;  5C4X J;  2BYV E;  3CP2 A;  3S3M A;  1MZB A;  3W6K B;  4BY7 J;  3ZMT A;  2GXA A;  5J47 A;  1Z91 A;  4A3K J;  2DMT A;  1P4X A;  5BNG A;  4XRM A;  3DP7 A;  4AD9 A;  4NC7 A;  3DXJ F;  1UAA A;  3FK6 A;  5K7H A;  3KP2 A;  2NOJ B;  1OKR A;  3E3V A;  4IX7 A;  1YX3 A;  1FJL A;  2K9M A;  4UV8 A;  3WTZ A;  3J7Y J;  4NQW A;  5CVJ A;  4BHP A;  5ICC A;  3F8F A;  2M5W A;  3HPG A;  5IYB J;  3S2D J;  3OV8 A;  2TRT A;  3KP5 A;  1J9I A;  4D5C A;  2DU9 A;  3DU5 A;  1ZGW A;  4C9Y A;  3O8G A;  2CGP A;  3I3L A;  4LLN A;  2DYS H;  3BDD A;  1TQP A;  2V1X A;  2JUG A;  3E6B A;  3W3C A;  3LSI A;  4CCK A;  3E6C C;  1PJR A;  1LVK A;  3AG1 H;  4ZDP A;  3HOW J;  2OA4 A;  1V54 H;  1HA8 A;  2E60 A;  4MNU A;  2VBZ A;  2MH2 A;  2M4K A;  5FKL A;  4ENJ A;  3H5N A;  4R1H A;  1K7A A;  3D5R C;  1I50 J;  2DFE A;  4OMY A;  2V7F A;  4CUG A;  3A4C A;  3EUA A;  5B5E C;  1N25 A;  4U0Y A;  2MLG A;  4B3X A;  5H2F C;  4G94 A;  2BE5 F;  3RPU A;  5DM6 F;  1I6H J;  4II2 A;  3M1C A;  3JR9 A;  4G7O F;  2KT0 A;  5GPC A;  2XKP A;  5F04 A;  3TP0 A;  5EG0 A;  3X2Q H;  2OD5 A;  3HOX J;  3J7A O;  4BJT A;  3L1P A;  5IP6 A;  1P4A A;  4A5N A;  4NNJ A;  1OR7 A;  4KT5 C;  1D1B A;  3J80 K;  3QOD A;  4J19 A;  4CXF A;  3BY6 A;  1APL C;  3RZD J;  3TDZ C;  3CDL A;  3KZI C;  5EDN A;  4XOT A;  2EIM H;  4IOA F;  1VQM I;  3KEO A;  2O6G E;  4ZJZ A;  4CYD A;  2KPM A;  4DW6 A;  2E19 A;  1XGS A;  2XAQ A;  1Z9C A;  2L2O A;  1T8I A;  4HST A;  1MBG A;  1R7J A;  1IXC A;  4E70 A;  1EV7 A;  2DA2 A;  2QKL B;  2DMN A;  2PMZ N;  1XCV A;  2BXY A;  3WGH A;  2ZKZ A;  3SZG A;  1BIA A;  4XRS G;  5J6X A;  1XMX A;  2DFI A;  3I0T A;  3RCO A;  3LOC A;  3J7Z I;  1ZYR F;  4EM0 B;  1QHH D;  4HEA 2;  4UVC A;  3MKL A;  4UXN A;  2A6E F;  4A3E J;  5FRM A;  5A2Q K;  2CQ7 A;  2YUS A;  3E6M A;  1KYW A;  3ZMS A;  3OYM A;  3CCE I;  1Y8R B;  2VE8 A;  2VI6 A;  3CD6 I;  5IP7 J;  1QQI A;  2F5V A;  2FNP A;  2K3F A;  2VC0 A;  4JX6 A;  1W1W E;  4GDF A;  3OYE A;  3OSF A;  1WH5 A;  1E3O C;  1YRN B;  1ZG1 A;  1IRZ A;  4RAY A;  1FX7 A;  5IT3 A;  2CU7 A;  3JRB A;  1KQ0 A;  1YLF A;  1TT5 B;  2L7Z A;  4FET A;  4ZZL A;  2RGV A;  1YIJ I;  3QU6 A;  2CO5 A;  3H3V K;  3GTM J;  1RET A;  2QF7 A;  2XUB A;  4RAF A;  1Z3X A;  2A6H F;  2ACJ A;  2HQ5 A;  1IXR C;  2Z1D A;  2CYY A;  2MA3 A;  5ILV A;  3ZMV A;  4XKW A;  1MMG A;  3HZJ A;  3TO9 A;  3MZH A;  1QVU A;  1U3E M;  3OYD A;  1LFP A;  3IWF A;  1O3Q A;  2RC4 A;  2P6T A;  2VL8 A;  1D5Y A;  1DGR M;  4N4O B;  5HDG A;  2WTE A;  1J75 A;  3MWM A;  1ZEL A;  2L54 A;  4G6D A;  2X1E A;  3MCZ A;  5DV5 A;  4UVA A;  2RAE A;  1F5T A;  2XRO A;  1BR1 A;  4C3I J;  2EJR A;  3ZQF A;  4BXF A;  1DP3 A;  2JUC A;  1MBK A;  3HOV J;  1WJF A;  2WBM A;  2L7F P;  2PJP A;  3OL3 A;  3NQO A;  4PCQ A;  3T0Y A;  3SFZ A;  3OYN A;  1Z05 A;  2LF8 A;  3BTJ A;  3S3O A;  2M8G X;  2NVT J;  1IF1 A;  4IZZ A;  3FMS A;  2R7V A;  4CDG A;  2DA1 A;  1ONV A;  2CSO A;  2DA6 A;  5BPD A;  2XPU A;  2ADU A;  2PX9 A;  4G6T B;  1YE9 A;  2JPC A;  4Z6Y A;  3GTJ J;  1WH7 A;  5D6E A;  2CFX A;  2W48 A;  3DWL E;  2V9K A;  3ZCO A;  2HU9 A;  2O5R A;  2CQK A;  1RC9 A;  2LG4 A;  3C2B A;  2VLA A;  2P0W A;  1QZE A;  2J5P A;  4LJZ F;  1LDJ A;  2OAZ A;  3U2R A;  5F1R A;  3WTU C;  2CMP A;  3TED A;  2HPI A;  3OS1 A;  2K85 A;  3JRA A;  1U9O A;  1BBY A;  1MJ9 A;  4RAZ A;  1SVL A;  1ENH A;  1ZAR A;  2JSP A;  1OJL A;  3TQN A;  3HG9 A;  1BOB A;  2P5V A;  2V1D A;  3ROU A;  1ZGJ A;  1WPK A;  3LSK A;  2Q2E A;  2CV2 A;  3P9C A;  4B47 A;  3BG5 A;  1BI0 A;  2R7Z J;  1JKP C;  1MMD A;  4PGG A;  4A0Z A;  2AXL A;  4L5E A;  3N97 A;  1K6O A;  1W36 C;  2KMU A;  2KIF A;  3ZGK A;  1F9N A;  1Q1V A;  2HOA A;  2GAU A;  1LE8 A;  1IUF A;  3TW6 A;  1JT0 A;  2E2H J;  3I59 B;  6PAX A;  1OCP A;  3DBH B;  2QBY A;  1SAU A;  1OCC H;  3IH2 A;  1XDS A;  4UUV A;  1Y1W J;  3FXO A;  1Z77 A;  4XN0 A;  3SEQ A;  5IYD J;  1H9G A;  1FMW A;  2QSF X;  1HDP A;  4EGZ A;  1R5H A;  1XPX A;  2AXT C;  2XGC A;  3A0H C;  1RR7 A;  4EVI A;  3F3X A;  1G6N A;  2HXO A;  4O6J A;  4UUT A;  3VYS B;  3PM1 A;  2WAD A;  3H5A A;  3ZQ7 A;  3QWL A;  2JWT A;  4BAY A;  5CVU A;  2L4A A;  2MD5 A;  3IKV A;  2M30 A;  3GLX A;  1AHD P;  2IW5 A;  1AOY A;  3QYB A;  3I56 I;  2KRF A;  2ME0 A;  1S29 A;  2P8T A;  3TO7 A;  4XIC A;  3W6J B;  3S15 J;  3JTG A;  1Y0U A;  1IRG A;  2DW4 A;  2KJC A;  1SFK A;  3O2P E;  3M9A A;  1OLT A;  2OBP A;  5K1Y A;  5FLM J;  2VC1 A;  3G4S I;  2VBY A;  1IW7 F;  3T8R A;  1FYM A;  3GF2 A;  4W97 A;  2EWN A;  4ZYG A;  5LHG A;  1JUM A;  3KZY A;  1K78 A;  3F0C A;  4A6D A;  4A93 J;  2ICW G;  2W4S A;  2EV5 A;  5HOO A;  4UV9 A;  3JSP A;  1UFM A;  4AM3 A;  2ZFW A;  2BZT A;  1O7F A;  1UEL B;  4JQF A;  3Q0V A;  2IGK A;  3HOT A;  1VQL I;  2LY1 A;  2GXB A;  3S1N J;  1F43 A;  4PJJ A;  3V4G A;  3H0D A;  2XRN A;  3I59 A;  2B7E A;  5FJ8 J;  4KNY A;  2IPQ X;  3M8F A;  3RJP A;  2G7U A;  4N9I A;  2DA5 A;  4AVP A;  2RKH A;  3OR1 C;  4PDK A;  3F8M A;  4RGS A;  3WE3 A;  1JGG A;  4HRI A;  2VAS A;  1VI0 A;  5JLX A;  2PBI A;  2BXZ A;  2VT3 A;  4A3G J;  3VDX A;  1UHW A;  3GUD A;  1MDM A;  2F4M B;  1IAW A;  3QQA A;  2KFD A;  2ZME B;  4PJL A;  4HV5 A;  1T38 A;  3RQI A;  1T6S A;  4AVZ A;  4HAM A;  4FAS D;  1TQI A;  2E71 A;  1EH7 A;  2VKD A;  5E1W A;  5EJC A;  2KP6 A;  5CYV A;  2E1N A;  3WTX C;  4PFO A;  1MJA A;  3KEY A;  1U5T A;  3CQZ J;  5D4R A;  2A5W A;  1PUF A;  1KU3 A;  3KIO A;  4YIR X;  5DEQ A;  4AID A;  1A35 A;  3IP4 B;  2Q1Z B;  1N75 A;  4HBL A;  1DU6 A;  1E17 A;  1XG1 A;  1DU0 A;  4HLX A;  3SXY A;  3K6G A;  1U5T B;  4CCN A;  2EFN A;  3IH3 A;  4CHU A;  2DOA A;  5HDK A;  4CYC A;  1IN6 A;  4FIS A;  5EZH A;  3KEQ A;  4U87 A;  4IKF A;  1STZ A;  3ZQI A;  4A2U A;  1H8A C;  1ZGA A;  1K78 B;  2FA5 A;  1T0F C;  1TZL A;  2XDV A;  2XIG A;  2ZFU A;  4ZC3 A;  3ZOB A;  2PJR B;  3DFG A;  1O4X A;  3K2Z A;  2XRL A;  5GAE J;  1MDM B;  2NS8 A;  2E1O A;  4KIF A;  3SFI A;  5K5R A;  2VE9 A;  1IO2 A;  3HSF A;  1PYV A;  4L5J A;  4C2T A;  3E7L A;  1OPC A;  1FMV A;  4IF4 A;  2FEZ A;  2Y31 A;  3H36 A;  3OYC A;  2EZI A;  3BR3 A;  3VOD A;  1B9M A;  1KQ9 A;  2OZU A;  5E3L A;  3GXO A;  1MJB A;  2IS6 A;  2ELH A;  3JRI A;  2ELJ A;  2E1M B;  3HHG A;  5DCF A;  1GT0 C;  1J59 A;  1T39 A;  3FIW A;  1YJ9 I;  1HST A;  5J8F A;  2HQR A;  4CZZ A;  1CF7 B;  3V7R A;  3HTU A;  5L3G A;  1IV6 A;  1UJ8 A;  1FY7 A;  2WAQ A;  2DT7 B;  1IZ1 A;  1JTY A;  3IKT A;  2EB7 A;  5E1Z B;  2MH9 A;  2DN0 A;  3IH4 A;  3U9G A;  3J80 Z;  2GBY A;  2IA2 A;  3S93 A;  3BPX A;  4EJT A;  1ON1 A;  2C6Y A;  3BCA A;  3WU0 A;  2FOW A;  5E20 A;  2N8G A;  5H6R A;  1K79 A;  2QUF A;  2Q2E B;  3KYL A;  2ISZ A;  1JGS A;  4DYR A;  4XRF A;  4XQF A;  2L9V A;  3HJE A;  4S04 A;  1U8R A;  2F5D A;  2EZL A;  2FBH A;  4Y3O A;  2Z9O A;  1XS9 A;  5EGO A;  3V7S A;  3CCQ I;  3ZP5 A;  3SQN A;  4WXC A;  1R4N B;  4Y4R A;  1MSF C;  4ZTF A;  4M73 A;  5CVV A;  3F22 A;  4BEH A;  2ZJR F;  2IJL A;  2E36 A;  3OYA A;  4ZYA A;  2G7H A;  2WY8 Q;  4ZH4 F;  2HOT A;  1WSU A;  3M8E A;  3TO6 A;  3VYR B;  4EJO A;  4PUS A;  2JA8 J;  1HSJ A;  1WRJ A;  4L9J A;  2G0E A;  3JW4 A;  3PIO F;  2OUM A;  1X1C A;  2LMD A;  3ABK H;  4HNU A;  5K7Z A;  3NRV A;  3MEX A;  4A6E A;  4RM3 A;  2JT1 A;  1O7L A;  3ABL H;  1TBX A;  4D7N A;  3BZC A;  3DU6 A;  2JA5 J;  2V1N A;  1HKQ A;  4RM2 A;  5FKN A;  4JOM A;  1SFO J;  1LB2 A;  2R7F A;  3U21 A;  5D5V B;  1FT9 A;  2HNH A;  2NNY A;  3GTL J;  1Z21 A;  1HLV A;  4XLE A;  1J7K A;  2KIM A;  1X3U A;  4JP0 A;  1ZG5 A;  3ABU A;  2HEO A;  5EYR A;  3TBI A;  3HM5 A;  2LBF B;  3NEU A;  5FFZ A;  4RB3 C;  3WTV C;  2RQQ A;  1WWX A;  3K10 A;  3EDP A;  3KLN A;  5D8L B;  1V5E A;  4I7H A;  1ZAO A;  2H6C A;  3DKW A;  4EQQ A;  4NC8 A;  2A05 A;  2AHQ A;  4A3B J;  2K9S A;  2V79 A;  4Y7N J;  2O8K A;  2XAJ A;  1JJ6 C;  3B6C A;  2OU2 A;  3IC7 A;  4I6Z A;  1BR2 A;  1B4A A;  3S1Q J;  1JKO C;  2VBW A;  1OFC X;  3LA2 A;  4Y13 A;  2MC3 A;  1O57 A;  2P7C B;  2HKX A;  2K7L A;  3MKW B;  3K4N A;  2XHK A;  5E79 C;  2X6Y A;  2W57 A;  4RS8 A;  4E7S A;  1OYW A;  1QA6 A;  2QZ8 A;  2W85 A;  4G7H F;  2K02 A;  4XOR A;  4QIW N;  3MD2 A;  1B6A A;  1Y39 A;  3Q3S A;  2DA3 A;  3CJR B;  4BDZ A;  3OS0 A;  5K7F A;  2FBK A;  2HZD A;  4P9U A;  4RDU A;  1REP C;  4C30 A;  1DPU A;  3GBG A;  1BJZ A;  2CJJ A;  3JRE A;  1X19 A;  3OYH A;  4E7H A;  1V5G A;  3TW7 A;  5KNL A;  5J8C A;  4L5I A;  4YFK F;  2E5Z A;  3M7G A;  4WCG A;  2M3A A;  2XPV A;  1RZ4 A;  2JA2 A;  1WFX A;  2R5Y B;  3M3Y J;  2Q0O A;  1QHG A;  2QQ9 A;  4KIB A;  1E2X A;  1R58 A;  2QM3 A;  3BLY A;  3DKX A;  3H1C A;  3G73 A;  1XSD A;  1WCM J;  1D0Y A;  3VYU B;  2JJ7 A;  3WTT C;  1L3L A;  3EPZ A;  4KIS A;  4PSX A;  1PP8 F;  1F36 A;  3CC4 I;  2OF7 A;  2AO9 A;  2XC7 A;  3FHN A;  1FTZ A;  1BW5 A;  2LR8 A;  3WTW C;  2G9W A;  2XGX A;  3QP6 A;  2OV7 A;  3BTC A;  1NG6 A;  1ETW A;  4HF2 A;  3K4M A;  2DMU A;  4DBR A;  2DXI A;  1J09 A;  4OIN F;  3JRF A;  4LD5 A;  2QSH X;  3M8J A;  1FIP A;  2WB1 N;  2QQ8 A;  1I6X A;  2CUE A;  1IV8 A;  1KGS A;  1S7O A;  3HPH A;  2CW8 A;  3A0B C;  3R60 A;  5B3S H;  2FQ4 A;  2YSR A;  4I99 C;  5F64 A;  5HS9 A;  3C7J A;  2CWE A;  2IA1 A;  2VJJ A;  5ILU A;  4CCM A;  2EZH A;  5KHD A;  3HSR A;  5JVT A;  5D4S A;  3QAH A;  2FSW A;  2ZJ2 A;  1F1Z A;  1WJB A;  2EFP A;  3LSG A;  4NDL A;  2HYG D;  4A0Y A;  3S2H J;  2X1C A;  4N4N B;  5GTH C;  1Y1V J;  4I2O A;  2DMP A;  2LTP A;  4QSH A;  5F1J A;  3DPU A;  4KT6 A;  3SYT A;  2VUM J;  4BQN A;  1UG0 A;  1MGT A;  2TCT A;  1OCT C;  1JTX A;  1QVT A;  3TKY A;  1A6I A;  4UB6 C;  1D5V A;  1HW2 A;  1O3S A;  2MG4 A;  3PO3 J;  1QBJ A;  1E3P A;  1RRJ A;  1SFX A;  3CCS I;  5IPA A;  2HWV A;  1Z0X A;  1GDT A;  2CUF A;  2H94 A;  5EGO B;  4Z2Y A;  4XM3 A;  1JXS A;  3WE2 A;  4AC0 A;  4B3A A;  2X4H A;  2IEK A;  3HGG A;  1ETK A;  2W82 A;  2WAQ N;  3ZQG A;  3UR3 C;  2ZXH A;  1I1G A;  1WI9 A;  1MBH A;  4O3M A;  3KYC B;  3ASN H;  2RDP A;  2QEN A;  3K4C A;  4AUX A;  5F08 A;  2IAI A;  4IRI A;  4XKC A;  3CES A;  3K1P A;  2ETH A;  2KIU A;  4CCO A;  4BU2 A;  1ORK A;  2O61 A;  5JHU A;  2EA2 A;  3BT9 A;  3ZN1 A;  2B9S A;  5LLQ A;  1HDD C;  1T56 A;  2H6B A;  2VXD A;  3UNG C;  3GFM A;  3JTH A;  4V2G A;  2NS7 A;  1HW5 A;  2VJI A;  4IHW A;  2EBI A;  3ZQH A;  4FE4 A;  1NHA A;  3HB9 A;  3D0S A;  2GA2 A;  5D8K B;  4XLF A;  3WHB A;  3K70 D;  5EEH A;  2LP0 A;  2R3S A;  1XCB A;  3MN2 A;  3CO6 C;  2L01 A;  2P81 A;  2BW3 A;  3KPH A;  1VTN C;  1R22 A;  2COB A;  2M0M A;  4I98 B;  1LQ1 A;  3CMY A;  2VN2 A;  3CCJ I;  3GFL A;  2Z5U A;  1YTY A;  3OR2 C;  2UWM A;  2HXI A;  4A0X A;  3VSK A;  1W5S A;  2W00 A;  4YFN F;  1OQY A;  1OCZ H;  2IP2 A;  3K0L A;  2X9D A;  1KZH A;  2EFQ A;  4GRI A;  3I4P A;  2W84 A;  5IOZ A;  5TJJ A;  3CCY A;  5AIP A;  3JAM K;  3K7A J;  2RVC A;  2V9V A;  1MIJ A;  3NWS A;  1TNS A;  3RKW A;  2NVQ J;  3QPS A;  3E97 A;  4XNF A;  1YO5 C;  3TL4 X;  3K69 A;  2E1C A;  4UUS A;  1D8J A;  3H5R A;  1LNW A;  2X6X A;  4J01 A;  3ECH A;  2E2I J;  2JN6 A;  1ACI A;  1MNM C;  1OMI A;  3F8B A;  5ICF A;  3V8J A;  3V8L A;  3D5S C;  3FKI J;  1ERD A;  4C3H J;  3ZXS A;  5GP9 A;  5C4J J;  2I5U A;  4AYB N;  2HYF A;  2DO7 A;  2R7R A;  2L9S A;  4IXA A;  3J81 K;  5B1A H;  4OWR B;  1FOK A;  3FZV A;  2B63 J;  2FML A;  1JT6 A;  1I39 A;  3GZ6 A;  2AS5 F;  4MTE A;  2COM A;  1S7A A;  2ZXW H;  3FBI B;  2VPL A;  3QRF F;  3FXJ A;  2EQR A;  2IS2 A;  5F27 A;  5CLS A;  3F23 A;  2LKX A;  1N78 A;  2BY0 A;  3BJA A;  1MMN A;  2O7O A;  1BW6 A;  2UV1 A;  2VKE A;  4HNV A;  5FB2 A;  3SHF A;  3QPT A;  3OY9 A;  1BC7 C;  1V3F A;  4EAT A;  4I09 A;  4DYC A;  3K1N A;  1IN7 A;  4X0G A;  3ZPL A;  1FYL A;  4AIJ A;  2A68 F;  1A36 A;  4M3B A;  1MMA A;  4M6X A;  2HDW A;  5IP9 J;  3WU1 B;  1P2F A;  1W5C C;  1JHF A;  5D5W B;  1PUE E;  4WXH A;  2JVH A;  2Z2S B;  2VKV A;  2X51 A;  3ZQQ A;  5IOY A;  2ZNZ A;  3H3U A;  2E7W A;  1WVR A;  1Z6T A;  1W7P A;  2A61 A;  1KYZ A;  4NBQ A;  4ZYH A;  2QA4 I;  3H9G A;  1MD0 A;  1MH4 A;  4RLQ A;  4IJA A;  4EGY A;  1FSH A;  5E1X A;  1KA8 A;  5LD2 C;  3LSR A;  4FT8 A;  4Y15 A;  4UB8 C;  4RAG A;  4XMY A;  3HYI A;  2JTV A;  4BQQ A;  1SAX A;  1WZ2 A;  4F92 B;  2HOS A;  3G2B A;  4GGG A;  3TMO A;  1R9T J;  2QSG X;  5KCM A;  3CTA A;  1A04 A;  3LWF A;  3HDD A;  4NHJ A;  2MFZ A;  5B66 C;  2R5Z B;  1ZN2 A;  1NH3 A;  2XF5 A;  2GIV A;  3FXQ A;  3KP7 A;  4U0W A;  1TNT A;  4M71 A;  3HOY J;  2E34 A;  2VOO A;  5FKK A;  3LSH A;  1H88 C;  1P92 A;  3FM5 A;  2NRA C;  3HHH A;  3HTS B;  4XLA A;  3A2K A;  2M45 A;  1VQ4 I;  2EZK A;  3HUG B;  4IPA A;  1R49 A;  4HYE A;  4PJN A;  3FMQ A;  4ZDL A;  1G8X A;  4M9Z A;  4D7M A;  1W36 D;  1LJ9 A;  5IY5 H;  5HS8 A;  3HOS A;  3ESW B;  2PG4 A;  3ONQ A;  5M5Y J;  3OYI A;  2LF7 A;  2MAB A;  3LQQ A;  3H9J A;  1W0T A;  1S3J A;  3ZN0 A;  3T5X A;  1YJN I;  2M8E A;  5ED4 A;  4EM2 A;  5K5Q A;  1Z1D A;  2ZXI A;  5L3B A;  2CH0 A;  3FXK A;  4WX9 A;  4L0Y B;  1FLI A;  5E18 F;  3GZN B;  3ASO H;  3ABT A;  4KMF A;  2IVM A;  3BR5 A;  5F0F A;  1U2W A;  3CZ6 A;  2PLY A;  3BG7 A;  2KDO A;  2VXZ A;  2BVM A;  2NYX A;  1UCR A;  4DOZ A;  5GAH J;  3QYF A;  4YII A;  4LIU A;  2LH9 A;  5FD5 A;  4L18 B;  1D1A A;  4OIR F;  2P7V B;  1DGW Y;  4B44 A;  2RNG A;  3GX4 X;  2XAU A;  3LSJ A;  3IAM 2;  4D5F A;  5HLH A;  1DUX C;  5FRN A;  4OAZ A;  2LD5 A;  1HBX G;  3RSN A;  4FTH A;  1BC8 C;  3SZP A;  2H1K A;  1IN4 A;  3WG7 H;  1YIT I;  3V42 A;  1VQ8 I;  4P9F A;  5FD6 A;  5JVG F;  3OIO A;  3HXL A;  3A01 B;  1G2H A;  4GCV A;  1SC7 A;  4LB6 B;  4BNC A;  3DF8 A;  2CUJ A;  2WY7 Q;  4A3C J;  1Z6R A;  3FX3 A;  3HEF A;  4RMN A;  3I54 A;  2V1U A;  5E8G A;  2ZCW A;  1BI1 A;  1SD5 A;  3DEW A;  1UZC A;  4CCJ A;  1JJ8 C;  2EK5 A;  5H6Q A;  4F52 A;  3G71 I;  2R0Q C;  2A6T A;  3DBR B;  3CME I;  3GYH X;  3L2W A;  2HQA A;  4GO1 A;  3PQJ A;  3RQ4 A;  5GTI C;  2V6C A;  4MFE A;  4E7L A;  4E7Z A;  4LMY A;  2OTJ I;  2Y9Z A;  3QOE A;  5E8I A;  2GWR A;  2VJ5 A;  1SVM A;  1XC5 A;  3FK7 A;  1D0Z A;  4PK4 A;  2OPT A;  1CF7 A;  2KIQ A;  2FRH A;  2FUG 2;  2CRG A;  4L9T A;  1HQC A;  2DT5 A;  3E5X A;  1P6R A;  2EPF A;  3IWZ A;  1GVJ A;  3LSM A;  4JBA A;  1MSE C;  4MQV A;  4IQJ A;  3CDH A;  3GEZ A;  2UUZ A;  3A1Y A;  1UMQ A;  4U7B A;  1B72 A;  2DA7 A;  4RA2 A;  5EEG A;  2DMQ A;  2LC2 A;  4BXX J;  5L3F A;  4ENN A;  1ZRC A;  2NVY J;  2R7U A;  2V26 A;  1OCR H;  3KP6 A;  1QZY A;  1BOA A;  3P9I A;  1TWC J;  1YRN A;  3S14 J;  1Z3Y A;  3F8C A;  2XGD A;  4KUM A;  3Q0W A;  3D5L A;  1MH3 A;  1WJE A;  2CW7 A;  2JK3 A;  3RDI A;  3MQ0 A;  3CCU I;  1V4R A;  1YI2 I;  1WGX A;  2ID3 A;  5FKO A;  4QTR A;  4BE2 A;  3MKZ A;  4UVB A;  5ERI A;  4KMU X;  2HTJ A;  1RKW A;  4IVN A;  1POG A;  3WU2 C;  3J81 Z;  2RN7 A;  3IV5 A;  2DJN A;  2NS0 A;  4XSZ F;  2K86 A;  3ERM A;  5LHI A;  5J4V A;  3JSO A;  3QU3 A;  2DOD A;  3IAS 2;  3MZ8 A;  1ITY A;  3C2H A;  4M3E A;  4CSW A;  2HR3 A;  5DUK A;  3BPV A;  2R7O A;  3FXU A;  4GYI A;  2A07 F;  4OIP F;  3FM3 A;  1AA7 A;  3DTI A;  4AYB A;  2VOP A;  1B59 A;  4ESF A;  3BR0 A;  2QYO A;  2A3S A;  2LKP A;  2DAO A;  1P7I A;  2X6W A;  5LRR A;  4E6K G;  5IT9 K;  1USS A;  5BOX A;  2CV1 A;  4Y52 J;  3BR2 A;  4KA4 A;  3D1N I;  4UY8 I;  4AIH A;  2ESH A;  2IA0 A;  3BG3 A;  4LG0 B;  4IRH A;  4OIO F;  2M9H A;  1U8B A;  1ZHF A;  4HF0 A;  3BQZ A;  1XSX A;  3CUO A;  4MEY F;  1XGM A;  4BXU A;  1FC3 A;  4L0Z B;  3RZO J;  4QPO A;  1XMA A;  5HVQ C;  3A03 A;  3K4K A;  1JKR C;  3W6V A;  2LNB A;  1X3Z B;  1Y0N A;  2HI3 A;  2YU3 A;  4LK0 F;  2OCC H;  1JUS A;  5CKT A;  3MFK A;  3WTY C;  2PQ8 A;  4LIV A;  3GVA A;  3AL0 C;  2HGC A;  4M3G A;  5D6F A;  2F5E A;  1IDZ A;  3ECO A;  1ZTR A;  2EH3 A;  5LFA A;  3DLA A;  2R4G A;  1LFB A;  4EJU A;  1Y56 A;  3M4O J;  1RNL A;  3VEP A;  3AG4 H;  3HRM A;  4QPQ A;  3S3N A;  4HZF A;  1IUY A;  2LY2 A;  3CMA I;  2E5N A;  1ZR4 A;  5EF6 A;  3CUQ B;  2Q8K A;  1OIS A;  3WHC A;  3I55 I;  3CF5 F;  2H27 A;  2PEX A;  3FF5 A;  3SEZ A;  3ML6 A;  2QCO A;  5HNF A;  1I27 A;  1R1U A;  3ABM H;  2KIS A;  5DCM A;  3LNQ A;  1IJW C;  2A69 F;  2LRD A;  3IL2 A;  4LLL A;  2J5O A;  4M3F A;  4LB5 A;  3T1B A;  4AU7 A;  1D0X A;  2BOL A;  4HW0 A;  3DV8 A;  2VOD A;  3CF2 A;  4ENK A;  2STW A;  4A5M A;  2KRC A;  2R7D A;  4A3J J;  2ZJP F;  3U1D A;  1X1B A;  1FP2 A;  2CFO A;  3E1S A;  2VQH A;  3G3Z A;  1B8I A;  4IO9 F;  3VWB A;  4BQO A;  1YX5 A;  2W24 A;  2HDC A;  2K4J A;  4I02 A;  3L7W A;  1ETO A;  4PJM A;  2ZB9 A;  1ODD A;  3NAU A;  1FWZ A;  2F4I A;  4YG2 F;  3HSE A;  5LHH A;  1YYV A;  2M2E A;  3GTG J;  3JRH A;  1GUU A;  2QBY B;  1NK3 P;  4EV0 A;  5HLI A;  2KZG A;  3L2U A;  1OR7 C;  1LE8 B;  3CDI A;  1K4S A;  3WTS C;  3PJR A;  5FGM A;  2KHM A;  2R7W A;  5LRS A;  2PN6 A;  2EV6 A;  1R36 A;  4FCY A;  2XV4 S;  2YPR A;  3Q9S A;  1V55 H;  3DTE A;  1AKH A;  3MAJ A;  2YS9 A;  3PL8 A;  3BTI A;  5J1Y A;  1LPQ A;  1HXD A;  2EA4 A;  2OZ6 A;  2WB1 A;  2WV0 A;  4NUB A;  1RPW A;  3CUQ C;  4JK1 X;  1QPM A;  3F6O A;  1ZRE A;  1KQ8 A;  3K9T A;  1X1P A;  3JAM Z;  4HF1 A;  4YEJ A;  3TGN A;  1SFU A;  2YX7 A;  1MBE A;  1BL0 A;  2CQQ A;  3HC7 A;  2JPB A;  2IBD A;  3E6D A;  4ETS A;  5M5X J;  2GIZ A;  4A3F J;  1ZQ3 P;  2FOK A;  1WHU A;  5ICE A;  5LGU A;  1IN8 A;  5J40 A;  1SD7 A;  2H8R A;  2QQB A;  4OIQ F;  1VQ5 I;  3KZZ A;  1TWH J;  4QWQ A;  4EJV A;  5F0H A;  4XRS A;  1HKT A;  4MIM A;  3KFW X;  2DFH A;  3MMY B;  2Z16 A;  4MLO A;  5JHF A;  2ZBK A;  4F3Q A;  5L3C A;  2EIK H;  1ZK8 A;  4WF2 A;  4RLF A;  2KKO A;  4DQ2 A;  9ANT A;  5C3E J;  3K4J A;  4A3D J;  3OIP A;  5F6F A;  1KON A;  3PFY A;  3W2A A;  3K2A A;  1R23 A;  3FKJ A;  4WXD A;  4BGD A;  5M3F J;  1T95 A;  3JRC A;  3CUQ A;  4XN3 A;  4BH9 A;  2L3D A;  4IQ4 A;  4DGW B;  3G1O A;  3GO5 A;  1R1V A;  1FPQ A;  1I5Z A;  3V8K A;  2LK2 A;  3VSL A;  2XSD C;  3KET A;  3WGG A;  4YIF A;  4G8X A;  1FTT A;  4ZYE A;  2Y0M A;  4NC6 A;  5JI6 A;  4M72 A;  1TTY A;  3BP8 A;  1SVO A;  4M9S A;  2RV8 A;  4BBR J;  4B48 A;  5E3N A;  1EA3 A;  2P4W A;  4QLC U;  3S17 J;  4FHT A;  2PI0 A;  1XGO A;  2XB0 X;  5DTD A;  3KE2 A;  2F5C A;  4CZC A;  3OYF A;  4CIC A;  5A2Q Z;  1AWC A;  1OYI A;  1IXS B;  2JVG A;  1S7E A;  3I64 A;  2D45 A;  1JE8 A;  2I10 A;  3EUK L;  1FIA A;  4N0B A;  2DA4 A;  3L9F A;  1U6G A;  3H9Q A;  4BQA A;  2VBX A;  2H8W A;  5FLX Z;  2STT A;  4V19 K;  1GHC A;  1IN5 A;  4R79 A;  2HFH A;  1SAN A;  3HL2 A;  4JYK A;  1XMK A;  3OOU A;  5D5X B;  3ZRG A;  3I4N J;  2BY2 A;  4F7Z A;  1G3W A;  3I4M J;  1RR8 C;  5DD8 A;  2Y48 A;  3GWZ A;  1SD4 A;  1WJD A;  1P7J A;  1TWG J;  1QRY A;  3EYY A;  3DLL F;  4HG2 A;  1ZKG A;  5KVR A;  2RNJ A;  4B09 A;  2UXX A;  3QPL A;  3C1D A;  4I01 A;  4FX0 A;  2NXN B;  3SDG A;  4M6Y A;  4MQ9 F;  2LYC A;  4UNO A;  3QYE A;  2Y30 A;  2V6E A;  3B73 A;  5LEK A;  2F4O B;  2WWY A;  1YW8 A;  3K1M A;  2FJ1 A;  1VFC A;  3FXM A;  4S0H B;  4HX8 A;  2TDX A;  2M1B A;  2EFW A;  3QP5 A;  3PIP F;  3CC2 I;  2IGN A;  2WV1 A;  1T2K A;  4MO7 A;  4M74 A;  3AKZ A;  2VQG A;  2FE3 A;  3C18 A;  3RKX A;  4C2M J;  4RB1 A;  4XK4 A;  4DNC A;  1M1E B;  1R1T A;  3A01 A;  1UHS A;  1P4W A;  1WJC A;  2D1H A;  4II3 A;  2QEX I;  4ENM A;  4KJZ A;  2K3P A;  2OQG A;  5BPI A;  1SFE A;  3R0J A;  3BZK A;  4E7J A;  2LLK A;  3PNY A;  1XDU A;  2ECC A;  1XB4 A;  2VB6 A;  1RUN A;  2X48 A;  4HOB A;  1VF9 A;  2M7A A;  4KIT B;  2LY9 A;  3IHU A;  1XGN A;  4A69 C;  2XKO A;  3JRG A;  1GV2 A;  3BJ6 A;  4HDU A;  5KAI C;  4A3I J;  4J00 A;  1FBS A;  1NTC A;  2Y9Y A;  1DPR A;  4G9Y A;  2JZY A;  3N05 A;  2VIX A;  4W1U A;  4PGH A;  1YG2 A;  4IHX A;  3T8T A;  2EIL H;  3RPU D;  1ETX A;  1P9Q C;  2QGU A;  2K40 A;  5FO5 A;  1FYK A;  4G6Q A;  3E0J B;  3DEU A;  2BY3 A;  1ON2 A;  1H9T A;  2LBF A;  1X1A A;  4KN7 X;  2KRH A;  1YJW I;  2BEO A;  2CS3 A;  1RKT A;  1KU9 A;  3F21 A;  4HSR A;  3REO A;  4OOI A;  2FBI A;  1YW7 A;  3OYG A;  5TGT A;  4N9H A;  4B1R A;  1ZRD A;  3FMR A;  4V2F A;  4ABZ A;  1ZLJ A;  4M6V A;  1ZG3 A;  4Q48 A;  4XOP A;  5EZG A;  1CQT A;  1XX5 A;  2JA7 J;  4LIT A;  4LGW A;  3F72 A;  3ZMD A;  2PMZ A;  1SMY F;  4OAY A;  1J0R A;  2KLO A;  2Y2Z A;  3BTL A;  2M87 A;  2K9Q A;  3PFI A;  3PUF A;  2R5Z A;  4HQE A;  2HDD A;  1CGP A;  2AQE A;  3DPT A;  1GVD A;  1NG7 A;  4B43 A;  2DT6 A;  1VQP I;  1L0O C;  2EIJ H;  4EEF G;  1DP7 P;  2GZW A;  4KN4 X;  2DYR H;  4PJ0 C;  3CCR I;  3RKY A;  5C44 J;  3V7C A;  1I1S A;  3LAP A;  3KP3 A;  2FQ3 A;  3PO2 J;  1JKQ C;  1MMS A;  1UB9 A;  5CJ9 A;  2QKM B;  4JX5 A;  2NVU B;  5CVR A;  5E3O A;  5B1B H;  3GLL A;  3CMM A;  1HOM A;  2CG4 A;  1XN7 A;  2GM4 A;  1FOX A;  4PSW A;  3LAJ A;  1JHH A;  1TWF J;  2CW0 F;  5ICG A;  1FOY A;  2L0K A;  1ZLK A;  3ZR8 X;  1SMT A;  1TT0 A;  1GXP A;  1KU7 A;  2DPD A;  2O03 A;  2XPW A;  1R5G A;  4GXO A;  1X3W B;  2V9P A;  2MBF A;  3CJT B;  3RI4 A;  1A6Q A;  4WWC A;  3BG9 A;  3U1K A;  3B6A A;  4DZP A;  1Q1H A;  2ZSI B;  2ID6 A;  1VQ7 I;  4XLN F;  1AU7 A;  4G12 A;  2MW8 A;  5HNH A;  1BA5 A;  2R7Q A;  4BBS J;  1WJ5 A;  2MSY A;  4I0B A;  2VQC A;  3CO7 C;  2O8X A;  2LDU A;  2W25 A;  2QVO A;  3GFJ A;  3CJQ B;  4UUS B;  3DQV C;  3FWE A;  4BE0 A;  2ZSH B;  1K61 A;  3RTR A;  4BHC A;  4CA0 A;  3ERE D;  3C3W A;  4ITV A;  5CQE A;  5EEA A;  3L2R A;  1VQO I;  2UXN A;  1QGP A;  4ON0 A;  4BYY A;  1PP7 U;  3AFH A;  4DYQ A;  1AKH B;  1S6L A;  4A3M J;  1U0J A;  2HVQ A;  5LBQ A;  3FXR A;  4LG3 A;  1Z7U A;  2W1O A;  3MKY B;  2R7S A;  1FEX A;  3BOQ A;  3H0G J;  4RB0 A;  3EUH C;  3R6S A;  1R71 A;  1JI8 A;  3WOD F;  4C2U A;  1WJA A;  3I71 A;  3N4M A;  3PQK A;  2ZME A;  4PFP A;  4ASN A;  4CGZ A;  2ISY A;  3OMY A;  3Q0U A;  2XAH A;  5JFR A;  4E7I A;  2F5F A;  3OYB A;  2PJR A;  2RRE A;  1QPI A;  4I76 A;  3AL0 B;  3HIF A;  3NWT A;  4LOC A;  3H3Z A;  2H1L A;  3IRR A;  4YRV A;  2XSJ C;  4CCL A;  1IRF A;  1VQ9 I;  4EM1 A;  2BVL A;  2IGO A;  1G3T A;  5GPA A;  2GOX B;  2BHZ A;  3VYT B;  4BL0 B;  4F93 B;  2LKS A;  4ESJ A;  3HKZ N;  3PNT A;  4HA8 A;  1LVA A;  2L7M P;  1BR4 A;  1EF4 A;  1X2N A;  2FXA A;  4FE7 A;  2DFF A;  4BS9 A;  2X1D A;  1ETQ A;  1YW9 A;  4BAC A;  4BE1 A;  3I58 A;  1FZP B;  3VFZ A;  5KK1 A;  3I5U A;  4XID A;  1YHQ I;  3OIQ A;  2V4J C;  2BBY A;  2GA1 A;  4U88 A;  4XON A;  1SEU A;  2IS4 A;  2KQR A;  3KP4 A;  1K6Y A;  2Z3Y A;  1B72 B;  1DDN A;  3TDU C;  1G59 A;  2Z99 A;  2R7X A; 
#chains in the Genus database with same CATH homology
 2EV0 A;  1TW2 A;  1FNN A;  4KYW A;  1XSV A;  3GFI A;  3Q9V A;  2ZNY A;  4IHS A;  1TQM A;  4BHB A;  3BWG A;  3RIR A;  2QWW A;  2O0Y A;  3B02 A;  1B9N A;  3BJO A;  5HDN A;  1XD7 A;  5ILS A;  2NNN A;  5K5O A;  4HQM A;  2GQQ A;  4NB5 A;  5BMZ A;  1B1B A;  2BV6 A;  3ULQ B;  3LA7 A;  2L02 A;  4ESB A;  3QPH A;  3R4K A;  2Y75 A;  5IT9 Z;  3HRS A;  3ELK A;  1QO0 D;  1F4K A;  3FHZ A;  1BI3 A;  4K2E A;  1MKM A;  1G3S A;  5H20 A;  4WK8 F;  4LG0 A;  5TRD A;  3F8N A;  3RYR A;  1EH6 A;  1TLH B;  3L00 A;  5L3E A;  2B0L A;  2HOE A;  3TOB A;  1RI7 A;  2UZK A;  4AWX B;  4TV7 A;  4MEX F;  2FF4 A;  1RIO H;  3EYI A;  4HX7 A;  2DI3 A;  5E17 F;  3LA3 A;  1ZRF A;  4PZJ A;  1G3Y A;  4YFX F;  2WC2 A;  5L3D A;  4Q4Z F;  1BI2 A;  3EET A;  3HRU A;  2P5K A;  1HW1 A;  1J5Y A;  3BRO A;  2HZT A;  3HUG A;  4H0E A;  5D5U B;  2DBB A;  2DLL A;  2KJB A;  1D8K A;  1LDK B;  3ZMZ A;  4MTD A;  1YS7 A;  4EMS A;  1UST A;  5DD4 A;  1FSE A;  3MZY A;  4FX4 A;  5LGN A;  4XSX F;  2XAF A;  1J2X A;  4L9N A;  1O3R A;  1LEA A;  4LFU A;  1RUO A;  2K27 A;  5CVI A;  2QQA A;  1BN5 A;  2DQR A;  4AIK A;  5LGT A;  3S2W A;  1KU2 A;  3KLO A;  2X0L A;  5BS6 A;  1HKS A;  4OMZ A;  4O5V A;  5FFX A;  5DUI A;  3O3K A;  3WGI A;  2IT0 A;  3L09 A;  3E5U A;  1SD6 A;  3ZMU A;  2FU4 A;  3KCC A;  1YS6 A;  1EH8 A;  1W4M A;  4XLP F;  2E7X A;  4L9V A;  4EJW A;  1PDN C;  3DPL C;  2ZO4 A;  5LEJ A;  3TOA A;  2FNA A;  2P6S A;  3CLO A;  2LSO A;  1QZZ A;  3GZ5 A;  4XBF A;  4LLG F;  1R00 A;  4HDV A;  2PMU A;  3I53 A;  4P96 A;  2DPU A;  2XVC A;  2XAS A;  2DK8 A;  4Y17 A;  4KIC A;  4M9X A;  3O6B B;  5BQT A;  3COA C;  1H0M A;  3LQR A;  1W7P D;  1W7P B;  2EFO A;  2XAG A;  1D3Y A;  2F2E A;  3ISP A;  4Q47 A;  2L4M A;  2VON A;  1BM9 A;  1LEB A;  2FMY A;  1FBU A;  3IRQ A;  1TW3 A;  5HS7 A;  4MHG A;  1GXQ A;  2HS5 A;  1G4D A;  3WG9 A;  3F6V A;  2RQP A;  1QNT A;  2P5L C;  5DYM A;  1WKM A;  2ESN A;  3HRT A;  5AON A;  2D1V A;  2K4B A;  3EUH A;  4A12 A;  3CJN A;  1FP1 D;  2QLZ A;  5FLX K;  4LK1 F;  3VB2 A;  4IRG A;  2H09 A;  4RGU A;  2O3F A;  4KIG A;  2PFB A;  4R8H A;  4D0P A;  4G7Z F;  3AAF A;  2JRT A;  2MLK A;  3BZ6 A;  4P55 A;  1UHM A;  1U78 A;  1T0F A;  3R61 A;  5JR3 A;  4KFC A;  4MGR A;  2JSC A;  2ZXJ A;  1ZH5 A;  3Q5F A;  4GYG A;  3EQL F;  4KDP A;  3M1E A;  3R0A A;  3SZT A;  4ZYD A;  3VOE A;  4U0V A;  4S05 A;  2DTR A;  1LDD A;  4CO8 A;  1YFH A;  5AIQ A;  2DK5 A;  4RGX A;  3RYP A;  4IHT A;  1C0W A;  1WQ2 A;  4P5O A;  1S8N A;  5HLG A;  2OQR A;  3H92 A;  2PMH A;  2GXG A;  3GW2 A;  4HV6 A;  3L2C A;  2HTS A;  1OYY A;  3P7N A;  1BIB A;  4U7D A;  2DQL A;  3LST A;  1U5T C;  4I0A A;  2BGC A;  5DCM B;  4B8X A;  2IRF G;  3P9K A;  3OOP A;  1O3T A;  2YX4 A;  1BJA A;  4OU0 A;  1FBQ A;  2HQN A;  1T98 A;  4HLY A;  4Q5S F;  1YQA A;  4RGR A;  2HKO A;  2Z33 A;  4UHT A;  5DDG A;  2D2W A;  1YIO A;  1W5T A;  3RPQ A;  4ZZD A;  4HX4 A;  2A5Y B;  4RB2 C;  3QOP A;  3LFK A;  1ULY A;  2YR2 A;  3E5Q A;  2VT2 A;  2NAZ A;  2BYV E;  1MZB A;  3W6K B;  3ZMT A;  1Z91 A;  1P4X A;  3DP7 A;  4AD9 A;  3DXJ F;  3KP2 A;  1OKR A;  3E3V A;  4UV8 A;  3WTZ A;  4NQW A;  5CVJ A;  4BHP A;  5ICC A;  3F8F A;  2M5W A;  3OV8 A;  3KP5 A;  1J9I A;  2DU9 A;  2CGP A;  4LLN A;  3BDD A;  1TQP A;  2V1X A;  3E6B A;  3E6C C;  2OA4 A;  4MNU A;  2VBZ A;  2MH2 A;  4ENJ A;  4R1H A;  1K7A A;  4OMY A;  4U0Y A;  2MLG A;  4G94 A;  2BE5 F;  3RPU A;  4G7O F;  2XKP A;  3J7A O;  2OD5 A;  1P4A A;  4A5N A;  1OR7 A;  4KT5 C;  3J80 K;  4CXF A;  3BY6 A;  3TDZ C;  3KEO A;  2O6G E;  4CYD A;  1XGS A;  2XAQ A;  1Z9C A;  1R7J A;  1IXC A;  4E70 A;  1EV7 A;  1XCV A;  3WGH A;  2ZKZ A;  1BIA A;  5J6X A;  2DFI A;  3I0T A;  1ZYR F;  4EM0 B;  4UVC A;  4UXN A;  2A6E F;  5A2Q K;  3ZMS A;  3E6M A;  1KYW A;  2VE8 A;  1QQI A;  2FNP A;  2VC0 A;  1ZG1 A;  4RAY A;  1FX7 A;  5IT3 A;  1KQ0 A;  1YLF A;  4ZZL A;  2RGV A;  3QU6 A;  2CO5 A;  2XUB A;  2A6H F;  2ACJ A;  1IXR C;  2CYY A;  2MA3 A;  5ILV A;  3ZMV A;  3TO9 A;  3MZH A;  1U3E M;  1O3Q A;  3IWF A;  2RC4 A;  2P6T A;  5HDG A;  2WTE A;  1J75 A;  3MWM A;  2L54 A;  4G6D A;  3MCZ A;  5DV5 A;  4UVA A;  1F5T A;  2XRO A;  2EJR A;  2PJP A;  3NQO A;  4PCQ A;  3T0Y A;  3SFZ A;  1Z05 A;  2LF8 A;  1IF1 A;  3FMS A;  4CDG A;  1ONV A;  2CSO A;  5BPD A;  2ADU A;  2JPC A;  5D6E A;  2CFX A;  2CQK A;  2J5P A;  4LJZ F;  1LDJ A;  2OAZ A;  3U2R A;  5F1R A;  3WTU C;  1BBY A;  1MJ9 A;  4RAZ A;  1ZAR A;  3TQN A;  2P5V A;  2V1D A;  3ROU A;  1ZGJ A;  2Q2E A;  3P9C A;  1BI0 A;  4PGG A;  4A0Z A;  2AXL A;  3N97 A;  1K6O A;  2KIF A;  1F9N A;  2GAU A;  3I59 B;  6PAX A;  2QBY A;  1XDS A;  4UUV A;  1H9G A;  4EGZ A;  1R5H A;  4EVI A;  3F3X A;  1G6N A;  4O6J A;  3ZQ7 A;  4BAY A;  5CVU A;  2L4A A;  2MD5 A;  3IKV A;  2M30 A;  3GLX A;  2IW5 A;  1AOY A;  2KRF A;  1S29 A;  2P8T A;  3TO7 A;  3W6J B;  3JTG A;  1Y0U A;  1IRG A;  2DW4 A;  2KJC A;  3O2P E;  3M9A A;  2OBP A;  5K1Y A;  2VC1 A;  2VBY A;  1IW7 F;  3T8R A;  1FYM A;  3GF2 A;  2EWN A;  4ZYG A;  5LHG A;  3KZY A;  1K78 A;  4A6D A;  2EV5 A;  5HOO A;  4UV9 A;  3JSP A;  1UFM A;  2ZFW A;  1O7F A;  4JQF A;  3HOT A;  2GXB A;  3V4G A;  2XRN A;  3I59 A;  4KNY A;  2IPQ X;  3M8F A;  3RJP A;  2G7U A;  4N9I A;  4AVP A;  2RKH A;  4PDK A;  3F8M A;  4RGS A;  3WE3 A;  2PBI A;  2VT3 A;  1UHW A;  3GUD A;  1MDM A;  1IAW A;  2ZME B;  4HV5 A;  1T38 A;  1T6S A;  4HAM A;  1TQI A;  1EH7 A;  5E1W A;  5CYV A;  2E1N A;  3WTX C;  1MJA A;  1U5T A;  5D4R A;  1KU3 A;  5DEQ A;  4HBL A;  1E17 A;  4HLX A;  3SXY A;  1U5T B;  2EFN A;  4CHU A;  5HDK A;  1IN6 A;  3KEQ A;  1STZ A;  4A2U A;  1ZGA A;  1K78 B;  2FA5 A;  2XIG A;  3DFG A;  3K2Z A;  1MDM B;  4KIF A;  5K5R A;  2VE9 A;  3HSF A;  4L5J A;  4IF4 A;  1OPC A;  2FEZ A;  3VOD A;  1B9M A;  1KQ9 A;  2OZU A;  3GXO A;  1MJB A;  2ELH A;  5DCF A;  3HHG A;  1J59 A;  1T39 A;  1HST A;  5J8F A;  2HQR A;  4CZZ A;  1CF7 B;  3V7R A;  3HTU A;  5L3G A;  1FY7 A;  1IZ1 A;  3IKT A;  2EB7 A;  5E1Z B;  2MH9 A;  3U9G A;  3J80 Z;  2IA2 A;  3BPX A;  4EJT A;  1ON1 A;  2C6Y A;  3WU0 A;  5E20 A;  1K79 A;  5H6R A;  2QUF A;  2ISZ A;  1JGS A;  4XRF A;  4S04 A;  1U8R A;  2F5D A;  2FBH A;  2Z9O A;  3V7S A;  3ZP5 A;  3SQN A;  4WXC A;  4M73 A;  5CVV A;  3F22 A;  2IJL A;  4ZH4 F;  2G7H A;  1WSU A;  3M8E A;  3TO6 A;  4EJO A;  1HSJ A;  1WRJ A;  4L9J A;  3JW4 A;  3NRV A;  3MEX A;  4A6E A;  2JT1 A;  1O7L A;  1TBX A;  1HKQ A;  1LB2 A;  2R7F A;  5D5V B;  1FT9 A;  2NNY A;  1J7K A;  2KIM A;  1X3U A;  1ZG5 A;  3ABU A;  2HEO A;  3NEU A;  5FFZ A;  4RB3 C;  3WTV C;  1WWX A;  3KLN A;  3EDP A;  5D8L B;  4I7H A;  1ZAO A;  2H6C A;  3DKW A;  4EQQ A;  2V79 A;  2XAJ A;  2OU2 A;  3IC7 A;  1B4A A;  2VBW A;  3LA2 A;  4Y13 A;  2MC3 A;  1O57 A;  2P7C B;  2HKX A;  2K7L A;  2XHK A;  2W57 A;  4RS8 A;  1OYW A;  2QZ8 A;  2W85 A;  4G7H F;  2K02 A;  1B6A A;  2FBK A;  4P9U A;  1REP C;  1DPU A;  5J8C A;  4L5I A;  4YFK F;  3M7G A;  4WCG A;  1RZ4 A;  2Q0O A;  2QQ9 A;  4KIB A;  1E2X A;  1R58 A;  2QM3 A;  3G73 A;  1XSD A;  3WTT C;  1L3L A;  1PP8 F;  3WTW C;  2G9W A;  2XGX A;  3QP6 A;  4HF2 A;  4OIN F;  4LD5 A;  1I6X A;  1KGS A;  1S7O A;  3R60 A;  2YSR A;  5HS9 A;  5F64 A;  5ILU A;  3C7J A;  2CWE A;  2IA1 A;  3HSR A;  5JVT A;  5D4S A;  3QAH A;  2FSW A;  2ZJ2 A;  1F1Z A;  2EFP A;  2HYG D;  4A0Y A;  4I2O A;  1MGT A;  3TKY A;  1D5V A;  1HW2 A;  1O3S A;  1QBJ A;  1SFX A;  2HWV A;  2H94 A;  4Z2Y A;  1JXS A;  3WE2 A;  2X4H A;  1I1G A;  1WI9 A;  4O3M A;  2RDP A;  2QEN A;  4IRI A;  3K1P A;  2ETH A;  2KIU A;  2O61 A;  5JHU A;  2EA2 A;  3ZN1 A;  5LLQ A;  2H6B A;  3GFM A;  3JTH A;  1HW5 A;  1NHA A;  3D0S A;  2GA2 A;  5D8K B;  5EEH A;  2R3S A;  1XCB A;  3CO6 C;  2L01 A;  1VTN C;  1R22 A;  4I98 B;  1LQ1 A;  2VN2 A;  3GFL A;  2Z5U A;  1YTY A;  2UWM A;  4A0X A;  1W5S A;  4YFN F;  2IP2 A;  3K0L A;  2EFQ A;  3I4P A;  2W84 A;  5TJJ A;  3JAM K;  5AIP A;  2RVC A;  2V9V A;  1TNS A;  3RKW A;  3E97 A;  1YO5 C;  3K69 A;  2E1C A;  1D8J A;  1LNW A;  3ECH A;  1OMI A;  3F8B A;  5ICF A;  3V8J A;  3V8L A;  2HYF A;  2DO7 A;  4IXA A;  3J81 K;  1FOK A;  3FZV A;  2FML A;  3GZ6 A;  2AS5 F;  4MTE A;  2COM A;  1S7A A;  3QRF F;  5CLS A;  3F23 A;  3BJA A;  5FB2 A;  3SHF A;  3QPT A;  1BC7 C;  1V3F A;  4I09 A;  3K1N A;  1IN7 A;  3ZPL A;  1FYL A;  4AIJ A;  2A68 F;  4M6X A;  3WU1 B;  1P2F A;  1JHF A;  5D5W B;  1PUE E;  4WXH A;  2ZNZ A;  3H3U A;  2E7W A;  1Z6T A;  1W7P A;  2A61 A;  1KYZ A;  4ZYH A;  1MD0 A;  4EGY A;  4IJA A;  1FSH A;  5E1X A;  1KA8 A;  4FT8 A;  4Y15 A;  3HYI A;  2JTV A;  1SAX A;  4GGG A;  3CTA A;  1A04 A;  3LWF A;  4NHJ A;  1ZN2 A;  2GIV A;  3FXQ A;  3KP7 A;  4U0W A;  1TNT A;  4M71 A;  2VOO A;  1P92 A;  3FM5 A;  2NRA C;  3HHH A;  3HTS B;  2M45 A;  4IPA A;  4HYE A;  3FMQ A;  4M9Z A;  1LJ9 A;  3HOS A;  5HS8 A;  2PG4 A;  2LF7 A;  3LQQ A;  1S3J A;  3ZN0 A;  3T5X A;  2M8E A;  5ED4 A;  4EM2 A;  5K5Q A;  1Z1D A;  5L3B A;  4L0Y B;  4WX9 A;  1FLI A;  5E18 F;  3ABT A;  4KMF A;  2IVM A;  1U2W A;  2PLY A;  2VXZ A;  2NYX A;  1UCR A;  4YII A;  5FD5 A;  4L18 B;  4OIR F;  2P7V B;  3GX4 X;  5HLH A;  1DUX C;  1HBX G;  1BC8 C;  3SZP A;  1IN4 A;  4P9F A;  5FD6 A;  4GCV A;  4BNC A;  4LB6 B;  3DF8 A;  1Z6R A;  3FX3 A;  3I54 A;  2V1U A;  5E8G A;  1BI1 A;  1SD5 A;  2ZCW A;  2EK5 A;  5H6Q A;  3GYH X;  4GO1 A;  3PQJ A;  2V6C A;  4LMY A;  5E8I A;  2GWR A;  1CF7 A;  2FRH A;  4L9T A;  1HQC A;  2DT5 A;  3E5X A;  1P6R A;  3IWZ A;  1GVJ A;  4JBA A;  4MQV A;  3CDH A;  3GEZ A;  4U7B A;  5EEG A;  5L3F A;  4ENN A;  1ZRC A;  3KP6 A;  1QZY A;  1BOA A;  3P9I A;  3F8C A;  4KUM A;  3D5L A;  3RDI A;  3MQ0 A;  1V4R A;  4UVB A;  5ERI A;  4KMU X;  2HTJ A;  4IVN A;  3J81 Z;  2RN7 A;  2NS0 A;  4XSZ F;  2K86 A;  5LHI A;  3JSO A;  3QU3 A;  2HR3 A;  5DUK A;  3BPV A;  3FXU A;  4GYI A;  2A07 F;  4OIP F;  3FM3 A;  2VOP A;  1B59 A;  4ESF A;  2QYO A;  2A3S A;  2LKP A;  2DAO A;  5LRR A;  5IT9 K;  1USS A;  5BOX A;  4KA4 A;  4AIH A;  2ESH A;  2IA0 A;  4LG0 B;  4IRH A;  4OIO F;  1ZHF A;  4HF0 A;  1XSX A;  3CUO A;  4MEY F;  1XGM A;  4BXU A;  1FC3 A;  4L0Z B;  1XMA A;  5HVQ C;  2LNB A;  2YU3 A;  4LK0 F;  3MFK A;  3WTY C;  2PQ8 A;  3GVA A;  2HGC A;  5D6F A;  2F5E A;  3ECO A;  4EJU A;  1RNL A;  3VEP A;  3HRM A;  4HZF A;  1IUY A;  3CUQ B;  2Q8K A;  2H27 A;  2PEX A;  3FF5 A;  3ML6 A;  1I27 A;  1R1U A;  5DCM A;  2A69 F;  3IL2 A;  4LLL A;  2J5O A;  4LB5 A;  3T1B A;  4HW0 A;  3DV8 A;  2VOD A;  4ENK A;  2STW A;  4A5M A;  2R7D A;  3U1D A;  1FP2 A;  3G3Z A;  2W24 A;  2HDC A;  2K4J A;  4I02 A;  3L7W A;  1ODD A;  1FWZ A;  4YG2 F;  3HSE A;  5LHH A;  1YYV A;  2QBY B;  4EV0 A;  5HLI A;  3WTS C;  5FGM A;  5LRS A;  2PN6 A;  2EV6 A;  1R36 A;  2XV4 S;  2YPR A;  3Q9S A;  3MAJ A;  1HXD A;  2EA4 A;  2OZ6 A;  2WV0 A;  3CUQ C;  4JK1 X;  1QPM A;  3F6O A;  1ZRE A;  1KQ8 A;  3K9T A;  4HF1 A;  3JAM Z;  3TGN A;  1SFU A;  2YX7 A;  2JPB A;  3E6D A;  4ETS A;  2FOK A;  5ICE A;  5LGU A;  1IN8 A;  1SD7 A;  4OIQ F;  2QQB A;  3KZZ A;  4QWQ A;  4EJV A;  1HKT A;  3KFW X;  2ZBK A;  5L3C A;  4WF2 A;  2KKO A;  4DQ2 A;  5F6F A;  1R23 A;  4WXD A;  3CUQ A;  4BH9 A;  2L3D A;  3GO5 A;  1R1V A;  1FPQ A;  1I5Z A;  3V8K A;  3KET A;  3WGG A;  4YIF A;  4G8X A;  4ZYE A;  2Y0M A;  5JI6 A;  4M72 A;  1TTY A;  3BP8 A;  4M9S A;  2RV8 A;  2P4W A;  4QLC U;  4FHT A;  2PI0 A;  1XGO A;  3KE2 A;  2F5C A;  4CIC A;  5A2Q Z;  1AWC A;  1OYI A;  1IXS B;  3I64 A;  2D45 A;  1JE8 A;  4N0B A;  3L9F A;  1U6G A;  4BQA A;  2VBX A;  2STT A;  5FLX Z;  1GHC A;  1IN5 A;  4R79 A;  2HFH A;  1XMK A;  5D5X B;  4F7Z A;  1G3W A;  5DD8 A;  2Y48 A;  3GWZ A;  1SD4 A;  3EYY A;  5KVR A;  2RNJ A;  4B09 A;  2UXX A;  3C1D A;  4I01 A;  4FX0 A;  4M6Y A;  4MQ9 F;  4UNO A;  3B73 A;  5LEK A;  2WWY A;  1YW8 A;  3K1M A;  4HX8 A;  2TDX A;  2M1B A;  2EFW A;  3QP5 A;  1T2K A;  4M74 A;  2FE3 A;  3C18 A;  3RKX A;  4RB1 A;  4DNC A;  1R1T A;  1P4W A;  2D1H A;  4ENM A;  2OQG A;  5BPI A;  1SFE A;  3R0J A;  1XDU A;  1RUN A;  1XB4 A;  4HOB A;  3IHU A;  1XGN A;  2XKO A;  3BJ6 A;  4HDU A;  1FBS A;  1DPR A;  4G9Y A;  2JZY A;  4PGH A;  1YG2 A;  3T8T A;  5FO5 A;  1FYK A;  4G6Q A;  3DEU A;  1ON2 A;  1H9T A;  4KN7 X;  2BEO A;  1KU9 A;  3F21 A;  3REO A;  4OOI A;  2FBI A;  1YW7 A;  4N9H A;  1ZRD A;  3FMR A;  1ZLJ A;  1ZG3 A;  4Q48 A;  4LGW A;  3F72 A;  3ZMD A;  1SMY F;  1J0R A;  2M87 A;  3PFI A;  4HQE A;  1CGP A;  3DPT A;  1L0O C;  1DP7 P;  2GZW A;  4KN4 X;  3RKY A;  3V7C A;  1I1S A;  3LAP A;  3KP3 A;  2FQ3 A;  1UB9 A;  5CJ9 A;  5CVR A;  2CG4 A;  1XN7 A;  3LAJ A;  1JHH A;  5ICG A;  2CW0 F;  1ZLK A;  1SMT A;  1GXP A;  1KU7 A;  2DPD A;  2O03 A;  1R5G A;  4GXO A;  3RI4 A;  2MBF A;  4WWC A;  1Q1H A;  4XLN F;  3CO7 C;  4I0B A;  2O8X A;  2LDU A;  2W25 A;  2QVO A;  3GFJ A;  3DQV C;  3FWE A;  4BHC A;  3ERE D;  3RTR A;  3C3W A;  2UXN A;  1QGP A;  4ON0 A;  4BYY A;  1PP7 U;  1S6L A;  5LBQ A;  3FXR A;  1Z7U A;  3BOQ A;  4RB0 A;  3R6S A;  3WOD F;  3I71 A;  3N4M A;  3PQK A;  2ZME A;  4ASN A;  4CGZ A;  2ISY A;  5JFR A;  2XAH A;  2F5F A;  3HIF A;  3H3Z A;  3IRR A;  1IRF A;  4EM1 A;  1G3T A;  4ESJ A;  4HA8 A;  1LVA A;  2FXA A;  1YW9 A;  3I58 A;  1FZP B;  3VFZ A;  5KK1 A;  3I5U A;  2BBY A;  2GA1 A;  4U88 A;  3KP4 A;  2Z3Y A;  1DDN A;  3TDU C;  2Z99 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...