1UCRA

Three-dimensional crystal structure of dissimilatory sulfite reductase d (dsrd)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
74
structure length
74
Chain Sequence
b'MEEAKQKVVDFLNSKSGSKSKFYFNDFTDLFPDMKQREVKKILTALVNDEVLEYWSSGSTTMYGLKGAGKQAAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein dsvD
publication title Crystal Structure of Dissimilatory Sulfite Reductase D (DsrD) Protein-Possible Interaction with B- and Z-DNA by Its Winged-Helix Motif
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Unknown function
total genus 23
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08679 DsrD Dissimilatory sulfite reductase D (DsrD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ucrA00
4G6DA 1R58A 4WWCA 4KMUX 4EJOA 4XRFA 2TDXA 3GYHX 4Q4ZF 5D5UB 3PFIA 1MGTA 1OMIA 2VONA 4MQVA 5HLHA 4U0VA 1UHWA 2GIVA 3FXRA 5BQTA 3COAC 2V9VA 3P7NA 4IHSA 4TV7A 1BC8C 1FBQA 1KQ9A 2VXZA 3Q9VA 4HX4A 5H6QA 4AIKA 2HFHA 2C6YA 4EJVA 2O3FA 4L5JA 4ZYHA 3F21A 5CLSA 5K5RA 3FMQA 5FFZA 3ELKA 2BBYA 3C7JA 2L4MA 1DUXC 5CVIA 3WGIA 5D5XB 1ZRFA 2FSWA 2CW0F 5HS8A 1NHAA 4LG0B 2IA1A 1H9GA 2ETHA 2PJPA 1YLFA 5F64A 5LHHA 3DQVC 3V8LA 3H3UA 5LRSA 1ZG5A 2QWWA 1AWCA 2DT5A 5DUIA 1IAWA 2FOKA 2UXNA 3GZ6A 2PMUA 3ABTA 4M6YA 1R36A 1RUOA 2OD5A 2P5KA 4QLCU 1IW7F 2W25A 4UV8A 3J80K 4YFKF 4MTEA 2EFOA 2ISYA 4FX4A 1G6NA 4WXDA 4UXNA 1SMTA 1T2KA 3T1BA 1UB9A 4G94A 2DU9A 2IPQX 1F1ZA 2LSOA 3KLOA 4U88A 2UXXA 1MJBA 2M87A 3ZMVA 1R1VA 1YIOA 2O8XA 1F9NA 2PLYA 2B0LA 3KP2A 3K1NA 4E70A 3J80Z 3BPVA 3DP7A 3SHFA 4EM0B 1KYWA 2ZMEA 2GA1A 4HX7A 1MDMA 4HF2A 1HKTA 2YX7A 3IKVA 3J7AO 2NYXA 2JT1A 3QOPA 3QU3A 1MZBA 5ICEA 1LJ9A 1ZG3A 1YW7A 4A12A 1X3UA 5ICGA 4EM2A 3FM5A 4B8XA 4MNUA 2EWNA 2D2WA 2P7CB 1QGPA 4OIRF 4UV9A 1A04A 3GVAA 3QP6A 1GXQA 2HTJA 4KIGA 2XROA 4CHUA 3IRRA 4YFXF 2AXLA 4A0YA 4I0BA 3NRVA 3SQNA 2DI3A 2QM3A 2HWVA 5FLXK 4G7HF 2CQKA 1IN4A 2E7WA 2QVOA 3JAMK 2ZO4A 1S6LA 3CJNA 4EJWA 4ZZLA 1J5YA 1TLHB 4CICA 5TRDA 1RI7A 4LLGF 1JHHA 4IF4A 2L02A 5FLXZ 3F72A 2LKPA 5BPDA 4R8HA 1ZN2A 2K7LA 3JAMZ 3WTSC 2ZFWA 2BEOA 4U7BA 3LAJA 1R00A 1ZARA 3RIRA 2O6GE 1YS7A 3HSRA 4EJUA 5KK1A 4U7DA 3R0AA 4DNCA 2NRAC 5HDGA 5JFRA 3U1DA 2ZJ2A 3GO5A 4PZJA 3IC7A 2MH2A 2DK8A 2Y48A 1FP1D 1XSDA 4IRHA 4I01A 3FMSA 1V4RA 3SZPA 1LDKB 2IA2A 2VBWA 3MZYA 1YYVA 5DCMA 1USSA 1BIBA 4WF2A 2DQRA 2D45A 1BI0A 3LSTA 2MH9A 4RB2C 1XGMA 3ZN0A 1FLIA 1ZYRF 1OPCA 2R7DA 4G7ZF 5ILSA 4AVPA 1YTYA 4PGHA 4IRIA 1K78B 2XIGA 2EV0A 3PQJA 2XAJA 4Y17A 1V3FA 3F8FA 1L0OC 2Y0MA 3E97A 3E6BA 2JTVA 1Z6RA 4K2EA 2Q8KA 3TDUC 2PMHA 5DV5A 5L3GA 1AOYA 2GWRA 3KETA 4S05A 4NQWA 2G7HA 3KE2A 3BPXA 4MHGA 5D4RA 4ENJA 3W6KB 1ZRCA 2XV4S 3ZPLA 5LHIA 5HDNA 2ACJA 4UVAA 3RYPA 5L3BA 1O3SA 4I7HA 1LNWA 5IT9K 1XDSA 1IN6A 3EUHA 1BC7C 3CO6C 1ZHFA 4LB6B 3I0TA 5ILVA 2DPUA 3ECHA 5ED4A 2KIUA 5E20A 4UVBA 5IT9Z 1IXSB 1ON2A 3LQQA 2EJRA 5HVQC 2KIMA 4OIQF 5F6FA 4HQEA 3KEOA 3LWFA 5DYMA 5FO5A 3FM3A 3R0JA 1ZAOA 2HGCA 4HDVA 1L3LA 1IRFA 2HKOA 2EFPA 4GYIA 5BMZA 4U0YA 4Y15A 1DPRA 2EK5A 1HBXG 2FBHA 2D1HA 3TOAA 1S29A 3C1DA 4KT5C 3CUOA 2E1CA 2XKPA 2H6BA 4L9NA 4Z2YA 3I4PA 1GVJA 1CF7B 5JVTA 1Q1HA 2F5CA 3ULQB 4YIIA 4RB1A 2EV5A 4LG0A 5CJ9A 2A68F 4G6QA 4BHPA 2YX4A 3DXJF 3I54A 5D8LB 3HRTA 2STWA 1J0RA 4GGGA 4XLNF 2QLZA 3DF8A 2O61A 2XVCA 4P9FA 3VOEA 1S7AA 4KNYA 3IHUA 4ETSA 2IA0A 1B9MA 1I1GA 5ERIA 3N97A 1O3RA 4ESJA 1J9IA 2WC2A 3F6VA 1S3JA 2JZYA 4Q48A 3ECOA 4I98B 5K5QA 1W4MA 1ZGJA 4HQMA 2Z3YA 4JQFA 2F2EA 3BROA 4R1HA 1XGOA 3F22A 3ERED 3FWEA 4ZYDA 3C18A 4MEYF 3M8EA 2KKOA 4PGGA 1O7LA 4LJZF 2DTRA 1K6OA 4OU0A 2EV6A 5CVUA 2BGCA 1J59A 4P96A 1JGSA 4G7OF 2DO7A 3L9FA 4HYEA 2MA3A 2GA2A 1FP2A 3GUDA 2PFBA 5FB2A 2XAHA 2EFNA 4HLXA 5L3FA 1GXPA 4HX8A 1TQIA 5E17F 1ZLKA 3I64A 1FYLA 3V7RA 3O6BB 2P4WA 1LDDA 1RUNA 4EQQA 2R7FA 5KVRA 3WTZA 3AAFA 2DAOA 2HZTA 4OINF 2A6HF 3I58A 4YFNF 3F6OA 4KN4X 2VN2A 3V7SA 4HZFA 5HS7A 5FD6A 1BI2A 4BHCA 3WTUC 2XAGA 3IWFA 2VE9A 1U78A 3LA7A 1ODDA 2G9WA 2VE8A 4ESFA 5E8IA 4Q5SF 3B73A 3RI4A 2Y75A 4S04A 4L9TA 2CGPA 2XAQA 1T0FA 1BJAA 2STTA 3R60A 4MTDA 1TNSA 3KZYA 3DFGA 3BY6A 2WTEA 1ZRDA 3W6JB 2VOPA 2PQ8A 1LB2A 3SFZA 4ENMA 1HSJA 3WTVC 3P9CA 4ZH4F 2EFWA 2FQ3A 2MBFA 5L3EA 2L01A 2P6TA 1TW2A 1O3TA 1HXDA 1FOKA 2HOEA 4KA4A 4KFCA 4ON0A 3K69A 5EEGA 2ESNA 2PEXA 1U8RA 1D5VA 3ZMSA 2K02A 1USTA 3LA2A 2M8EA 2V79A 5JHUA 1KU9A 3VODA 2QQBA 4XLPF 1G4DA 5K5OA 2W57A 2FNAA 3WU0A 3MWMA 3GFLA 4DQ2A 2J5PA 5LBQA 5HLGA 4L9VA 3VB2A 5IT3A 3QP5A 4LFUA 1P4XA 1R1TA 3H92A 2JSCA 2VT3A 3CUQB 5TJJA 3FMRA 2HTSA 2KRFA 3NQOA 2FXAA 2IP2A 2GXGA 5LGNA 1H9TA 4P55A 1I27A 3JTGA 4LK0F 1PP7U 1K78A 3FX3A 4FHTA 5FD5A 1XGNA 3IWZA 4CYDA 2DPDA 3BJAA 3WG9A 1Z7UA 3P9KA 1XMKA 2BE5F 3T0YA 2DFIA 4MGRA 1I1SA 4IPAA 4M73A 3RPUA 2DQLA 2RNJA 1VTNC 5FGMA 5LRRA 4H0EA 2Z9OA 1R5GA 1ONVA 3HRUA 4MQ9F 1SAXA 4KIBA 2HDCA 3ABUA 2R3SA 1ZH5A 1RNLA 4RS8A 3E3VA 3WGGA 4XBFA 1OYIA 1YQAA 1JXSA 2DBBA 1G3TA 1LQ1A 2RV8A 1P4WA 2HQRA 4OIOF 2M1BA 4HBLA 2IRFG 3DEUA 2NNNA 3HUGA 4OMYA 3JTHA 3T8RA 3SZTA 4M74A 4A2UA 3D5LA 2RVCA 4A5NA 4M9SA 2BYVE 3KP4A 4XSXF 2E1NA 5H6RA 5LLQA 1IZ1A 2OQRA 3WTWC 1H0MA 1U5TA 2O03A 2RGVA 1DP7P 1ULYA 4KYWA 4WK8F 4ZYEA 4UUVA 3V8JA 1WSUA 4IRGA 3HTSB 3OV8A 4BYYA 1UHMA 2QENA 4M6XA 5BOXA 4LLLA 2FBIA 1EH6A 1FT9A 5AONA 3CLOA 2V1DA 3HIFA 2K4JA 3MZHA 4RB3C 1CF7A 1QNTA 5ICFA 1D3YA 1JE8A 1U6GA 2IW5A 5E8GA 4KIFA 2RDPA 2OZUA 2Z33A 2CWEA 4BQAA 2PI0A 3I5UA 2PN6A 5LGUA 4M71A 2HKXA 4IHTA 1E2XA 3E5XA 1TNTA 2GXBA 4G8XA 3EETA 1XDUA 4NHJA 4HA8A 1Z6TA 2XRNA 4P9UA 2AS5F 4CXFA 2FBKA 1O7FA 4I09A 3J81K 3U9GA 3RDIA 1ZLJA 5DCFA 3IL2A 5LHGA 1J75A 2Q2EA 3DKWA 5L3DA 4RB0A 1C0WA 3RTRA 1FZPB 2EB7A 2JPBA 1SMYF 2FE3A 4UVCA 1KA8A 1BBYA 3DPLC 1WWXA 5A2QK 4HF0A 4RGUA 2ADUA 4B09A 3I71A 2ZCWA 1BIAA 1FY7A 3GFMA 2MLKA 4RAZA 2YR2A 4HAMA 3GEZA 5DUKA 3WODF 4A0XA 1SD5A 5AIPA 4AD9A 1FBUA 3HRSA 3BDDA 5E1XA 1FWZA 3GWZA 5JI6A 1IF1A 5A2QZ 2FEZA 3L2CA 2LF8A 1DPUA 5DD8A 3K2ZA 3QPTA 1SD6A 1WRJA 2LF7A 1W7PD 1JHFA 3F3XA 3WGHA 1HW5A 2FMYA 2ESHA 3FXQA 1F5TA 1MKMA 1XMAA 1J2XA 1ZREA 2RN7A 3WTTC 3KP5A 3KCCA 2KJBA 2RKHA 4CDGA 1U5TB 2EA2A 3Q9SA 4LB5A 1SFUA 2H27A 1W5SA 1XSXA 2L4AA 3I59A 1R1UA 2IJLA 3GW2A 4GYGA 2W85A 1SD7A 5HLIA 1LEBA 1EV7A 4A6EA 2K86A 4Q47A 1IXCA 2OU2A 1RZ4A 3FZVA 3HSFA 4HLYA 3ISPA 2X0LA 5K1YA 3M1EA 4IJAA 3U2RA 4BAYA 5BS6A 4ENKA 2IVMA 2DW4A 2OBPA 3T5XA 2A07F 4YG2F 4RAYA 1PDNC 3EDPA 3K1MA 4ZYGA 4LMYA 5J8CA 2BV6A 2OQGA 2H94A 3V4GA 4P5OA 2XASA 5AIQA 1ZGAA 2W84A 3R61A 1FNNA 1HW1A 5JR3A 2ZNZA 1YO5C 1TTYA 4M9XA 3HSEA 2HS5A 3ZN1A 1FPQA 4N0BA 3G73A 1IUYA 1R23A 3P9IA 4I02A 2M45A 3HOSA 3HRMA 4R79A 4HF1A 2VBZA 3CUQA 2EFQA 3FF5A 3GLXA 1Z91A 5D8KB 3ROUA 1REPC 1B6AA 3JSPA 5D5VB 4ASNA 1FYKA 2ISZA 2COMA 4HDUA 4HV5A 2XHKA 2P6SA 4HW0A 1U2WA 3MFKA 1ZG1A 3ZP5A 1W5TA 2J5OA 2FU4A 4GCVA 3QAHA 3QU6A 1RIOH 2V1UA 1LVAA 3REOA 1FC3A 3RKWA 3T8TA 4LGWA 2E7XA 3I53A 2L54A 1MJAA 2QBYB 2XGXA 2UZKA 1HSTA 5D6FA 5EEHA 4LK1F 4I2OA 3ZMUA 1R22A 1YS6A 3ZQ7A 3BP8A 1OYWA 2DK5A 3ZMZA 4PDKA 2YPRA 2CFXA 4EJTA 2ELHA 3QRFF 2K4BA 3HHHA 2CO5A 3I59B 5F1RA 1G3WA 1G3YA 2LDUA 3M8FA 1S7OA 2QQ9A 4M9ZA 4O5VA 3TO9A 1FSHA 1YG2A 4AIJA 2HR3A 4O6JA 4AIHA 1T38A 1KYZA 3EYYA 3TO6A 1MJ9A 3D0SA 3ZMTA 1TW3A 1O3QA 2G7UA 1QQIA 2ZXJA 2VC0A 3R6SA 1OKRA 1UFMA 4WX9A 1DDNA 4BHBA 4IVNA 3MCZA 1KQ8A 2FA5A 2HYGD 2RQPA 1PUEE 5LGTA 2GQQA 3GXOA 4ZZDA 4U0WA 1U5TC 4XSZF 3G3ZA 2OAZA 1G3SA 1BN5A 5LEJA 4L0YB 3F8BA 1W7PB 2CG4A 1WQ2A 1MD0A 5DD4A 4IXAA 3BOQA 3DPTA 4L0ZB 4OIPF 3LQRA 4OOIA 4UHTA 4N9IA 2H6CA 1IN8A 3L7WA 3ML6A 3EQLF 2FNPA 3QPHA 3H3ZA 1LEAA 1BM9A 3K1PA 2A3SA 2X4HA 4F7ZA 3KZZA 2KJCA 4RGSA 1YFHA 3RJPA 5DEQA 1XN7A 2V6CA 2UWMA 1TBXA 3RKYA 5D5WB 1UCRA 2Z99A 4JBAA 3CDHA 1BI3A 2XUBA 1I5ZA 4UNOA 2WWYA 1FX7A 2O0YA 1IN5A 3KEQA 1D8JA 2MC3A 3F23A 1B9NA 2YU3A 1T6SA 2QUFA 3HTUA 3HHGA 1T39A 1Z05A 2XAFA 2NS0A 3WTYC 3M9AA 1GHCA 3CTAA 4CZZA 4I0AA 3FXUA 2ZKZA 5E18F 5E1WA 5H20A 1P4AA 1P2FA 3KP7A 4Y13A 1U3EM 2H09A 1FBSA 2A6EF 2F5EA 3JW4A 1B59A 3GX4X 3EYIA 4MEXF 3RPQA 3TOBA 3TQNA 2P5LC 2K27A 3JSOA 4ENNA 3MEXA 3WE3A 4LD5A 2NAZA 1S8NA 3OOPA 4A0ZA 2OZ6A 3TGNA 2YSRA 3LAPA 1IRGA 4GXOA 2P7VB 2HYFA 1QPMA 3M7GA 3E6CC 4RGXA 1T98A 4D0PA 2KIFA 1P6RA 1B1BA 4KICA 2HQNA 3MQ0A 1XGSA 3C3WA 2MD5A 2QZ8A 3S2WA 3GFJA 1STZA 2F5FA 2ZBKA 3O2PE 4WXCA 5CYVA 5ICCA 1YW9A 4FT8A 1SFEA 1IN7A 4KDPA 1BI1A 1SFXA 3V8KA 2A5YB 4O3MA 3F8CA 1R5HA 1K7AA 5D6EA 3KLNA 2L3DA 4EV0A 4WXHA 3R4KA 3TDZC 4HOBA 3NEUA 1HQCA 3HOTA 3E6DA 1EH7A 3FHZA 1E17A 5L3CA 2A61A 4L5IA 2RC4A 2EA4A 2Q0OA 2M30A 3PQKA 2ZMEB 1BOAA 1MDMB 1QBJA 3J81Z 1HKQA 3B02A 3KP6A 3F8MA 2GAUA 5CVRA 1SD4A 2LNBA 4NB5A 3LA3A 2QYOA 4KN7X 1WI9A 4LLNA 1EH8A 1QZZA 3CUQC 3CO7C 1OYYA 4A5MA 5D4SA 4G9YA 1O57A 5CVVA 2QBYA 1KU2A 3KFWX 3E5UA 4AWXB 3BJ6A 1HKSA 1KU7A 4WCGA 3K9TA 2OA4A 3DV8A 4EGZA 3Q5FA 3RKXA 2V1XA 5HS9A 4ESBA 2JPCA 5ILUA 4EGYA 3MAJA 2DLLA 3K0LA 4PCQA 3WE2A 2VT2A 6PAXA 2VBXA 4A6DA 2WV0A 2P5VA 5J6XA 1Y0UA 1HW2A 4BH9A 2NNYA 1TQPA 4CO8A 1KU3A 2XKOA 2W24A 4QWQA 1R7JA 2CSOA 2PBIA 1B4AA 1KQ0A 3F8NA 1IXRC 5FFXA 4JK1X 4CGZA 3IKTA 1D8KA 1ON1A 4KUMA 1XSVA 1FSEA 4HV6A 2M5WA 3BWGA 5DCMB 3KP3A 3BJOA 5BPIA 4EM1A 3E6MA 3TO7A 3LFKA 2IT0A 5DDGA 4RGRA 4M72A 3WTXC 3TKYA 2P8TA 5HDKA 2VBYA 1Z9CA 1F4KA 3VEPA 1XD7A 2FRHA 1Z1DA 2VC1A 4KMFA 2D1VA 2Z5UA 4YIFA 2FMLA 1W7PA 3L00A 3SXYA 4N9HA 4OMZA 1LDJA 4BXUA 1XCVA 3VFZA 1I6XA 1P92A 5E1ZB 3N4MA 3IRQA 3HYIA 1FYMA 5HOOA 1CGPA 2VOOA 3RYRA 2FF4A 1PP8F 1OR7A 2PG4A 1WKMA 1YW8A 3E5QA 1XCBA 3GF2A 1J7KA 2QQAA 2ZNYA 3GFIA 4L9JA 4EVIA 1QZYA 3V7CA 1TQMA 2VODA 3GZ5A 3L09A 2HEOA 4L18B 2JRTA 1KGSA 3BZ6A 2GZWA 2MLGA 4GO1A 2CYYA 1XB4A 2A69F 5J8FA 3O3KA 5CVJA 4EMSA 2F5DA 5LEKA 4FX0A 3ZMDA 3WU1B 4BNCA 1QO0D 1K79A
chains in the Genus database with same CATH superfamily
4G6DA 1R58A 1U9NA 4OAYA 5F1JA 1SAUA 4WWCA 4KMUX 4EJOA 4J19A 3GTKJ 4XRFA 2TDXA 2JA5J 3GYHX 4Q4ZF 1OCPA 5D5UB 3E0JB 1X1AA 3PFIA 1MGTA 1OMIA 1RETA 2VONA 4MQVA 5HLHA 2NVTJ 4U0VA 1UHWA 2GIVA 3FXRA 4XLCA 2E71A 2HOAA 3K4NA 4DYQA 5BQTA 3K6GA 3COAC 1UG0A 1BW5A 5HNFA 2V9VA 3P7NA 2KL4A 4IHSA 3CCUI 2Q1ZB 4TV7A 1BC8C 1FBQA 1KQ9A 2VXZA 3Q9VA 4HX4A 5H6QA 4AIKA 5F27A 3RPUD 2HFHA 2C6YA 4M3BA 1NK3P 5GP9A 4EJVA 2O3FA 3DCFA 4L5JA 3AFHA 1GVDA 4ZYHA 4DBQA 3F21A 1JT0A 2VJJA 5IY5H 2DN0A 2LMDA 5CLSA 5K5RA 1IRXA 3FMQA 1MBKA 3A01B 5FFZA 5GTIC 3ELKA 2BBYA 2LK2A 1IDZA 1Y8RB 3DEEA 3C7JA 2L4MA 1DUXC 5CVIA 3WGIA 5D5XB 1RPWA 4CCKA 1ZRFA 2FSWA 2CW0F 5HS8A 5J4VA 2KT0A 2XC7A 1NHAA 3OYIA 4LG0B 3AG1H 2IA1A 1SVOA 1H9GA 1UZCA 2ETHA 2PJPA 1YLFA 5F64A 5LHHA 3DQVC 4RLFA 3V8LA 3H3UA 5LRSA 1ZG5A 1X1BA 2QWWA 1AWCA 4II3A 1GLNA 2DT5A 4XKCA 5DUIA 1IAWA 3L1PA 2FOKA 3OL4A 3CCLI 2UXNA 2IAIA 3GZ6A 2XGDA 2BY3A 4XLAA 2PMUA 2LY9A 1ETOA 3ABTA 3C2GA 1PYVA 4OAZA 4M6YA 1JT6A 1D5YA 4BY1J 4MO7A 2CV2A 1M1EB 1R36A 2AQEA 1RUOA 3S2HJ 1H89C 1T08B 4RBOA 2OD5A 2V26A 1YI2I 2P5KA 4EATA 1JTYA 4QLCU 1IW7F 3OYMA 2W25A 4DOZA 4XICA 4ZDPA 4ANJA 4KT6A 4C3HJ 4UV8A 1JTXA 2BHZA 3BR3A 3J80K 4YFKF 1RESA 4MTEA 5FLVA 2EFOA 2ISYA 1X58A 4PJMA 3ESWB 4FX4A 1XTAA 1G6NA 4UB6C 1MIJA 1MH3A 4WXDA 4UXNA 2QGUA 1SMTA 1T2KA 3T1BA 1UB9A 2AO9A 4G94A 1OCOH 4QPQA 3A03A 2DU9A 2IPQX 1F1ZA 2LSOA 3KLOA 3MVPA 4M3FA 4U88A 2UXXA 2M87A 1MJBA 3ZMVA 1R1VA 1YIOA 3BTLA 2JA2A 2O8XA 3CMYA 2DA7A 2LBFA 1F9NA 2PLYA 2B0LA 2BXYA 3SDBA 3AL0C 3KP2A 3K1NA 4E70A 3J80Z 2JUGA 3BPVA 3DP7A 2VQCA 4XOTA 3SHFA 4EM0B 3DLAA 3H0GJ 1KYWA 1A6IA 3ASNH 2GA1A 2X9DA 2ZMEA 4HX7A 1SC7A 2YX7A 1MDMA 3IKVA 4HF2A 2NYXA 3J7AO 1HKTA 2JT1A 3QOPA 3QU3A 1B8IA 1MZBA 5ICEA 1LJ9A 1ZG3A 4X6AJ 3WHBA 1YW7A 2R7XA 2GOMA 4A12A 1X3UA 2L5QA 3TP0A 5ICGA 4EM2A 1HLVA 4CCMA 1LKXA 3CJRB 3FM5A 4B8XA 4MNUA 2EWNA 2NS8A 3HG9A 3VYTB 2P0WA 1RR8C 2D2WA 2P7CB 1QGPA 3VYUB 4XRMA 1HC8A 4OIRF 1SFKA 2Y9ZA 2LLKA 3S17J 4UV9A 1A04A 5LFAA 3GVAA 2VASA 3QP6A 1GXQA 2HTJA 4KIGA 4W1UA 2BY1A 1VQ7I 2XF5A 3JREA 2VPLA 4IO9F 2XROA 3PNYA 4CHUA 1ETKA 3IRRA 4E7HA 4YFXF 1P7JA 1Y56A 2AXLA 3VSKA 4A0YA 4I0BA 3NRVA 3SQNA 5F0HA 2DI3A 2QM3A 3J7AY 4GDFA 2I8DA 1WHUA 1FTZA 2HWVA 5FLXK 2OC6A 4L5EA 4G7HF 1T95A 3LSGA 2CQKA 1IN4A 2E7WA 2QVOA 3JAMK 2ZO4A 1S6LA 1UMQA 3CJNA 4EEFG 3QQAA 2OPTA 4PFOA 4JOMA 3SEZA 5GPAA 4EJWA 1U9OA 3L2WA 2EILH 4ZZLA 3BG5A 1J5YA 3QWLA 1XMXA 1TLHB 2R7RA 4CICA 2CS3A 1A31A 4GRIA 5TRDA 2VB6A 1RI7A 4LLGF 1JHHA 4BDZA 3OS2A 1V54H 2Y30A 1SFOJ 5EGOB 1DGWY 4IF4A 2R7OA 2L02A 5FLXZ 3F72A 2LKPA 1WJAA 2WAEA 5BPDA 4R8HA 1ZN2A 2X6OA 1YE9A 1QHGA 2K7LA 3JAMZ 2ZFWA 1YX5A 3WTSC 2VUMJ 3KPHA 3NWTA 2GBYA 4D5FA 3BZKA 2BEOA 4U7BA 4CCOA 1QVTA 2W82A 3LAJA 2FOWA 1R00A 1ZARA 4FASD 3FK6A 3RIRA 3ERMA 2O6GE 4A3BJ 4BJTA 1YS7A 1K4TA 3HSRA 1WPKA 5EF6A 4EJUA 5KK1A 4U7DA 3R0AA 4DNCA 5J1RA 2NRAC 5HDGA 4MLOA 5JFRA 3U1DA 2ZJ2A 3GO5A 2ZJQF 4PZJA 2R5YB 5EZGA 4C30A 1Z77A 1S72I 3FDYA 1YJ9I 3IC7A 3CCEI 4QSHA 1HDPA 4IQJA 2MH2A 3CC4I 2DK8A 2YS9A 2Y48A 2GXAA 1FP1D 1XSDA 4IRHA 4I01A 1QHHD 3FMSA 4RM3A 1V4RA 3SZPA 1QA6A 2VKHA 1LDKB 2IA2A 2VBWA 3QODA 1AKHB 1OCCH 1S9HA 3MZYA 1IRZA 3BTIA 1YYVA 5DCMA 3G2BA 1USSA 4XKBA 3BG9A 4V2GA 1BIBA 4WF2A 2DQRA 1ZELA 2D45A 1BI0A 5B3SH 3LSTA 2MH9A 1Z67A 4HNTA 1MBHA 3S8PA 5IYDJ 2K9NA 4BXXJ 2DODA 1UAAA 3DPUA 3ZQGA 4AC0A 4RB2C 1VQ4I 1XGMA 3ZN0A 2MC4A 3LSJA 1FLIA 1ZYRF 1OPCA 4FCYA 3FKJA 2Y2ZA 2E1MC 2R7DA 4G7ZF 1FOWA 5ILSA 4AVPA 1YTYA 4PGHA 4IRIA 1K78B 1Z0XA 3FHNA 2KZVA 2XIGA 5DM6F 3Q0UA 2EV0A 3W2AA 3PQJA 1OCZH 2GIZA 2XAJA 4Y17A 1V3FA 4IOCF 3ABMH 3SEQA 2MG4A 3F8FA 2M8GX 3SJMA 1L0OC 2W4SA 2NVUB 2Y0MA 1OCRH 2CUEA 3E97A 3E6BA 2JTVA 1Z6RA 3Q0VA 2XPWA 3G1OA 4K2EA 2Q8KA 3FBIB 4LITA 3TDUC 3NAUA 2PMHA 2M4KA 3LOCA 5DV5A 5L3GA 1AOYA 2KIQA 2GWRA 3W2WA 2EZLA 5IOYA 3KETA 2Y69H 4S05A 4NQWA 4XK4A 2G7HA 3KE2A 2RNGA 3BPXA 4MHGA 5D4RA 1MBEA 2Y0SA 3M1CA 2HZDA 3BZCA 4ENJA 3W6KB 1ZRCA 2XV4S 2CQXA 3ZPLA 5LHIA 1PUFB 3DU6A 3BT9A 1ITYA 5HDNA 3DKYA 3ONQA 2ACJA 3OR1C 4UVAA 3RYPA 3BLYA 1OLTA 5L3BA 1MMSA 3HDDA 2HDWA 3S32A 1O3SA 4I7HA 2L9SA 1LNWA 2BZTA 4XN3A 1OCTC 5IT9K 1FEXA 3OYBA 1XDSA 1IN6A 3EUHA 1BC7C 3CO6C 3LSIA 4ZDOA 2CFOA 1N78A 2R7VA 1ZHFA 4LB6B 2M0MA 4HSTA 2HOSA 4RLQA 3HOWJ 3I0TA 1FOXA 4HEA2 1E0EA 2JSPA 5ILVA 5CPRB 4N4OB 2DPUA 3ECHA 5M3FJ 5GPCA 5B1BH 2QF7A 5ED4A 2JJ7A 1VQ8I 2KIUA 4RDUA 4PUSA 3G1LA 5E20A 2XSJC 3HUGB 3GTOJ 4UVBA 4CH7A 5IT9Z 3I4NJ 1IXSB 1ON2A 3LQQA 1IV8A 2EJRA 1OR7C 1BR1A 5HVQC 3IAS2 2CUJA 4A3IJ 2KIMA 4OIQF 1MMDA 5F6FA 4HQEA 3KEOA 3LWFA 2ECBA 4XM3A 5DYMA 5FO5A 3FM3A 2LKSA 1LUJB 3R0JA 1ZAOA 2HGCA 3C2HA 5HODA 4HDVA 1L3LA 3B6AA 2R7QA 1IRFA 2HU9A 2LRDA 2HKOA 2AXTC 3P5JA 1W0UA 2RQQA 2EFPA 2OF7A 3KZIC 4NUBA 3G71I 1OQYA 4XL9A 2FD5A 4GYIA 5BMZA 4U0YA 2XRLA 4Y15A 1DPRA 2EK5A 5E3NA 1HBXG 1FIPA 2L7KA 4MFEA 2FBHA 1Y8QB 3U21A 2D1HA 3TOAA 5CKTA 1S29A 3G6EI 1KZHA 3LL7A 2DA4A 3CESA 3C1DA 2LP0A 2M7BA 4KT5C 3CUOA 3GMEA 4HG2A 2E1CA 3OYJA 3BCBA 3A01A 1X19A 3WG7H 2XKPA 2H6BA 2V7FA 4L9NA 4Z2YA 3I4PA 1LE8B 5DS9A 1BA5A 1GVJA 3H5RA 1CF7B 3VSLA 1R4MB 5JVTA 1W36C 5KAIC 1Q1HA 2F5CA 3ULQB 4YIIA 4DYRA 4RB1A 1VI0A 1RKWA 2EV5A 1MMNA 4LG0A 5FROA 3AG2H 2A68F 5CJ9A 1BW6A 4G6QA 4BHPA 2YX4A 5J3LA 3DXJF 3I54A 5E3LA 4CZCA 3JRAA 2KDZA 4IHXA 5D8LB 1BR2A 2DOEA 3HRTA 2STWA 1J0RA 4GGGA 4XLNF 2QLZA 2Y0SN 4NNJA 3RZDJ 1EJ9A 3DF8A 2O61A 2QSFX 2VPRA 5EEAA 1HDDC 1VF9A 2XVCA 4P9FA 3VOEA 1S7AA 4M3DA 1VQLI 3IHUA 3CMEI 4KNYA 3KX2A 2E5ZA 4ETSA 3OSGA 2Z16A 3HJEA 2IA0A 1B9MA 1I1GA 1TZLA 5ERIA 3H5NA 3N97A 1O3RA 4QIWN 2X48A 1V5GA 3K4KA 4ESJA 3PO3J 2WC2A 1J9IA 4QTRA 3F6VA 3OS0A 1S3JA 3A0BC 2JZYA 4Q48A 3ECOA 4I98B 3X2QH 1GV5A 4FQGA 5K5QA 3PJRA 1W4MA 3OS1A 1ZGJA 3A4CA 3CQZJ 4HQMA 2Q2EB 2Z3YA 4DBRA 2VJ5A 2VLAA 4JQFA 4DGWB 4ZYAA 2QEXI 2F2EA 5M5WJ 3BROA 4R1HA 2UV1A 2VQGA 1XGOA 1YX3A 3F22A 3H9QA 3HOUJ 3ERED 5J1UA 3FWEA 4ZTFA 2FJ1A 2HYJA 4ZYDA 1ETYA 3C18A 3ZQLA 4MEYF 3M8EA 2KKOA 4XRSA 4XIDA 4FISA 1X4OA 4PGGA 1O7LA 1IUFA 4LJZF 2DTRA 2CQ7A 1W0TA 1K6OA 5KHDA 4DW6A 2DMQA 4OU0A 2EV6A 5CVUA 1K6YA 2BGCA 2NOGA 1J59A 4P96A 3MKYB 1JGSA 4G7OF 2IBDA 2OCEA 2CUZA 2DO7A 1POGA 3L9FA 4HYEA 2MA3A 2GA2A 1R49A 1ACIA 1FP2A 3GUDA 2PFBA 5FB2A 3GTJJ 2KPMA 2XAHA 2EFNA 4HLXA 3W6VA 1FTTA 1WGXA 1VQ5I 5L3FA 2WV1A 1GXPA 4HX8A 4B43A 3ABLH 1TQIA 4BJ6C 5C44J 3GTQJ 2R7UA 4W97A 5E17F 2K3PA 4PJLA 2DT7B 1ZLKA 2CJJA 3I64A 1FYLA 4B3XA 3M4OJ 3V7RA 3O6BB 3BG3A 2P4WA 4NC7A 4AIDA 1LDDA 1GDTA 3HOZJ 2VQHA 3B6CA 3K70D 4EQQA 1RUNA 3GBGA 1A6QA 2R7FA 2RAEA 3CP8A 2NVXJ 2ZMEC 5KVRA 3K4CA 4NC8A 2VL8A 3WTZA 1ETWA 3AAFA 2DAOA 2HZTA 4F55A 4OINF 2A6HF 3I58A 4YRVA 4YFNF 3K2AA 3F6OA 4A3LJ 4KN4X 2VN2A 2ELKA 3CZ6A 3V7SA 3O8GA 4HZFA 5HS7A 2FUG2 3SYTA 5FD6A 1BI2A 4CCLA 4BHCA 2L2OA 5EG0B 1W1WE 3WTUC 2XAGA 5CQGA 3JRDA 2M7AA 3IWFA 2VE9A 1U78A 2DOAA 3LA7A 1ODDA 2G9WA 2VE8A 2Z2SB 1I39A 4ESFA 5E8IA 4Q5SF 4XONA 3B73A 1BL0A 3RI4A 2Y75A 4S04A 4L9TA 2HPIA 2TCTA 2CGPA 2LG4A 2XAQA 1T0FA 5EGOA 1U0JA 1BJAA 3JRGA 2STTA 3R60A 5F0CA 2DFFA 4MTDA 3EUKL 1TNSA 3CCQI 3KZYA 3DFGA 3BY6A 2F6CA 2WTEA 3W6JB 1IJWC 1ZRDA 2VOPA 2PQ8A 1LB2A 3SFZA 4ENMA 5FKMA 3S16J 3U1KA 1HSJA 2X1EA 3WTVC 3MKZA 4PSXA 3FBNB 1WJEA 3P9CA 4ZH4F 2EFWA 2FQ3A 2MBFA 1JJ8C 2DA6A 3BR6A 4ITVA 2H8RA 5L3EA 2L01A 5F04A 2P6TA 2L7MP 3BTJA 4BGDA 1TW2A 3OL3A 1O3TA 1TC3C 2KRCA 1HXDA 1FOKA 2H8WA 2HOEA 4KA4A 4KFCA 2E5NA 4ON0A 2K9LA 3HEFA 3K69A 5EEGA 3F0CA 1E3PA 2R5YA 2ESNA 4JX5A 2PEXA 2A6TA 2XF6A 4J00A 2R93J 2DYRH 1U8RA 1P9QC 1D5VA 2KISA 3ZMSA 4FTHA 2K02A 4KJZA 1USTA 3LA2A 2M8EA 2V79A 5JHUA 1KU9A 3VODA 2QQBA 4XLPF 5M3MJ 1G4DA 2R7TA 5K5OA 2W57A 1VNDA 2FNAA 3WU0A 3DLLF 1R4NB 3MWMA 3GFLA 4RMNA 4DQ2A 2J5PA 1AKHA 5LBQA 5HLGA 4E7KA 4L9VA 3Q0WA 2W00A 3VB2A 3TW6A 5IT3A 2JA6J 3QP5A 4B48A 4LFUA 1P4XA 1R1TA 5JHFA 3ZQCA 3H92A 2JSCA 1NG6A 2VT3A 3ZQFA 3CUQB 4V2FA 4ZTJA 5TJJA 3FMRA 2HTSA 2KRFA 1X2NA 3CJQB 4CCNA 2DXIA 3OYGA 3NQOA 2FXAA 4DZPA 2CU7A 2IP2A 2GXGA 3GCMA 5LGNA 1QRYA 1H9TA 1JI8A 4UUSB 4P55A 4IX7A 3DTIA 2QSHX 1I27A 2DMPA 3JTGA 4JX6A 5JVGF 4JYKA 4LK0F 1PP7U 1K78A 2HNHA 5CQEA 3RQ4A 3FX3A 1WH7A 2XPVA 4FHTA 5FD5A 1XGNA 3IWZA 4CYDA 4I76A 1HOMA 2DPDA 3UR3C 3BJAA 3LSKA 3WG9A 1JUPA 1Z7UA 3P9KA 1FMWA 1XMKA 2BE5F 2DFIA 3T0YA 5M5YJ 4FE7A 4MGRA 1IDYA 1DQUA 1I1SA 1ETXA 3V42A 3ZGKA 2B7EA 4IPAA 4M73A 3RPUA 2R0QC 1G2HA 1JUSA 3DBHB 2DQLA 2RNJA 3OYEA 1VTNC 1YRNB 3M3YJ 2M0CA 5FGMA 5LRRA 4H0EA 4RM2A 2Z9OA 1R5GA 1ONVA 3HRUA 4MQ9F 1WJDA 3CCJI 1I6HJ 1SAXA 4BJ5C 4KIBA 4BKXA 1Y1WJ 2HDCA 1MH4A 2R3SA 3ABUA 1PUFA 1ZH5A 1RNLA 5K7HA 5JLWA 4RS8A 3ZCOA 2DA1A 3EUAA 1P7IA 4BE1A 3E3VA 3WGGA 1IGNA 3S1NJ 3PO2J 3ZQHA 2IGNA 1SANA 4XBFA 1OYIA 1YQAA 2LY2A 1JXSA 2DBBA 1G3TA 1LQ1A 2RV8A 3PFYA 3HXLA 2BY0A 1P4WA 2HQRA 2UUZA 3I4MJ 1A36A 4A69C 4OIOF 2M1BA 2Y9YA 5B66C 4HBLA 2IRFG 3DEUA 4PK4A 2NNNA 1ZTRA 1HF0A 2R5ZB 3HUGA 4OMYA 4E7LA 3OIPA 2DCEA 1LFUP 2E2HJ 3JTHA 3T8RA 3ZQIA 3SZTA 2IS2A 4XN0A 4M74A 4JX4A 2H1LA 4II2A 1MSEC 4A2UA 1RKTA 3D5LA 2AHQA 3VYSB 1Z21A 1R71A 3LSRA 3H36A 2RVCA 1TWHJ 4A5NA 3EUHC 3K4JA 5LD2C 1HA8A 2EQRA 4M9SA 4A3JJ 4C2MJ 2BYVE 3KP4A 4XSXF 3TEDA 2E1NA 3MKLA 5H6RA 5LLQA 1IZ1A 3DTEA 1T56A 2OQRA 3WTWC 3CP2A 1U5TA 1H0MA 2O03A 2RGVA 4FETA 1DP7P 1ULYA 2IS1A 3PUBA 4PJNA 4KYWA 4BACA 4WK8F 4ZYEA 4UUVA 4BE0A 2ME6A 5IP6A 4HPQA 3V8JA 1WSUA 4PJ0C 2ZJPF 1UG2A 2ECCA 4XKWA 4IRGA 3BQZA 2WAFA 3HTSB 3CCVI 3DBRB 3QYFA 4XKVA 1PVEA 3OV8A 4J01A 4CSWA 4BYYA 1UHMA 2QENA 4M6XA 5BOXA 4LLLA 2FBIA 1EH6A 1FT9A 1X3ZB 5AONA 3CLOA 2V1DA 3HIFA 2K4JA 3MZHA 1LE8A 4HRIA 1RRJA 2BXZA 4RB3C 1CF7A 1QNTA 5C4XJ 5ICFA 2X85A 5GAHJ 1D3YA 3LNQA 3H3VK 5FKLA 2HXOA 3HPHA 1JE8A 2BY2A 1U6GA 2IW5A 5E8GA 1O4XA 4KIFA 2RDPA 3MKWB 2OZUA 2Z33A 2IGMA 2CWEA 5FRMA 4BQAA 2PI0A 3PSIA 3I5UA 2VIXA 4F3QA 2PN6A 5LGUA 3OWTA 2JVGA 3MN2A 4M71A 2HKXA 4IHTA 1E2XA 2LOOA 5GADJ 3E5XA 1TNTA 2GXBA 4G8XA 3EETA 1XDUA 2EIKH 4S0HB 4NHJA 3BR0A 5FRNA 2L7ZA 4HA8A 1TL8A 1Z6TA 2XRNA 4P9UA 2AS5F 4CXFA 3BQYA 2HQ5A 1NG7A 2FBKA 2HVSA 1O7FA 4I09A 2QCOA 2K5CA 3J81K 1X3WB 3U9GA 3RDIA 1ZLJA 5DCFA 3IL2A 4NDLA 5LHGA 1ZR2A 2WAQA 1J75A 2Q2EA 3ABKH 3DKWA 4BQOA 5L3DA 2QKMB 3FXLA 4RB0A 1C0WA 3GTGJ 1D0XA 2JK3A 3RTRA 1YJWI 2ZXIA 3DEWA 1FZPB 1XPXA 1YOVB 2EB7A 2JPBA 4DIQA 1SMYF 2FE3A 4UVCA 5FKOA 1KA8A 3RCOA 1BBYA 3DPLC 4A3EJ 1WWXA 5A2QK 4AUXA 4HF0A 2O5RA 2K9SA 4RGUA 1JGGA 2ADUA 4B09A 2W1OA 2DA2A 3I71A 2ZCWA 1BIAA 2V6EA 2R7SA 1FY7A 1JJ6C 3GFMA 2MLKA 1YHQI 4RAZA 2LVSA 2YR2A 4HAMA 3GEZA 1X1PA 5DUKA 3WODF 4D7MA 2IS4A 2IGOA 4A0XA 1SD5A 5AIPA 1JKPC 1ENHA 4AD9A 1FBUA 3HRSA 3BDDA 5E1XA 3NWSA 4BS9A 1AHDP 1FWZA 1WJBA 4GFBA 4AYBA 3GWZA 5JI6A 2F48A 1IF1A 2X6XA 5A2QZ 2FEZA 3L2CA 1ZGWA 1SEUA 2W7NA 1MBJA 1Z7LA 2LF8A 1DPUA 4IOAF 3BR2A 4B3AA 4IZZA 5DD8A 2V4JC 3K2ZA 2VQLA 3QPTA 5DM7F 2XSDC 3KEYA 4A3MJ 5IPAA 1SD6A 1WRJA 1XG1A 2LF7A 1W7PD 1JHFA 3F3XA 3VWBA 4BBRJ 3WGHA 1HW5A 2FMYA 4IEJA 2O7OA 3HZJA 3AG3H 4BQQA 3NARA 1TWAJ 2JVHA 5C4JJ 2ESHA 3FXQA 1F5TA 1D1BA 1MKMA 1XMAA 1J2XA 4XORA 4C9YA 2OV7A 2BW3B 3SZGA 2CQNA 1ZREA 3GTLJ 2RN7A 3WTTC 3KP5A 2FQ4A 3KCCA 1A5JA 2KJBA 2RKHA 1WH5A 4CDGA 2EINH 2DYSH 1U5TB 1WJFA 2EA2A 3TMOA 2QA4I 1EF4A 3Q9SA 2K85A 5EG0A 1VQ6I 2ZXHA 4LB5A 1SFUA 4MIMA 1N75A 2NOJB 2H27A 1W5SA 1XSXA 2L4AA 1XX5A 1R1UA 3I59A 2IJLA 3GW2A 5FLMJ 5KCMA 1NK2P 1QU3A 2MGQA 4GYGA 2W85A 2MFZA 1SD7A 3PIOF 1BOBA 2EIMH 4CYCB 3K4LA 5HLIA 1LEBA 3HGYA 1A35A 3PNVA 1ETVA 3HKZA 1EV7A 2LR8A 4A6EA 2K86A 3KYCB 4Q47A 1IXCA 2OU2A 1RZ4A 2CQQA 1MNDA 3FZVA 3HSFA 3QOEA 3RZOJ 1EA3A 4HLYA 3CDIA 3ISPA 3CCRI 5K7FA 3D5SC 2X0LA 3VYRB 5K1YA 4YIRX 3M1EA 1JKRC 2MD0A 4H4KC 4IJAA 1SVMA 4PFPA 3U2RA 2IVMA 2ZXWH 3ZOBA 4BAYA 5BS6A 4ENKA 2DW4A 4YEJA 2OBPA 1G59A 2WAQN 3T5XA 2A07F 4YG2F 1TWCJ 4RAYA 3E1SA 3EDPA 3KYDB 3K1MA 1PDNC 4ZYGA 3OR2C 4LMYA 3PUFA 4C2TA 5J8CA 2BV6A 3OIQA 3CMAI 2OQGA 2H94A 3V4GA 3AL0B 5EYRA 3BR5A 4P5OA 2XASA 5AIQA 2ZSIB 3CC7I 1ZGAA 2W84A 2G0EA 3R61A 1FNNA 5J47A 3J7ZI 2W48A 4I99C 2XPUA 1T0FC 1HW1A 3MZ8A 5JR3A 2ZNZA 4C2UA 1YO5C 1KONA 1TTYA 4M9XA 2LH9A 3HSEA 4XLFA 2HS5A 3ZN1A 1FPQA 4N0BA 1W36D 3G73A 1IUYA 4RAGA 1SVLA 1H88C 1R23A 3RKQA 3P9IA 4I02A 2M45A 3HOSA 1S7EA 2V9KA 3OYNA 4JP0A 3HRMA 1DGRM 1WJCA 4R79A 4AYBN 4HF1A 2ZB9A 2ELJA 2VBZA 3CUQA 4P1WA 1Y39A 5KNLA 4RAFA 2E2IJ 2EFQA 5IOZA 3FF5A 4FE4A 3GLXA 1Z91A 1FMVA 3OYLA 3JR9A 2OCCH 1TWGJ 3WU2C 5D8KB 3ROUA 1REPC 2NXNB 3ZR8X 1B6AA 3JSPA 4Y7NJ 2DDBA 2I10A 5D5VB 4ASNA 4UUSA 1FYKA 2L9NA 1PJRA 2ISZA 2COMA 2CW8A 4HDUA 4HV5A 2XHKA 2P6SA 4HW0A 3HPGA 5K7ZA 5H2FC 2OTLI 2COBA 4F52A 1U2WA 3MFKA 1ZG1A 1D0YA 4D9JA 1W5TA 3ZP5A 3K4BA 1B72B 2J5OA 1IV6A 2FU4A 4GCVA 1F43A 2KFDA 3QAHA 2M3AA 3QU6A 1RIOH 2V1UA 1Y6IA 1LVAA 3REOA 2DFHA 3CJTB 5F0FA 1FC3A 4G12A 3RKWA 4IHVA 3T8TA 2X6YA 2ZSHB 1WVRA 1AU7A 1YRNA 4LGWA 5GAGJ 2E7XA 3I53A 4X1EA 4E7SA 2L54A 1MJAA 2KZGA 4BU2A 4F92B 4AU7A 2QBYB 2EPFA 2CH0A 5E79C 3PNTA 2L7FP 3HKZN 2K9QA 2XGXA 1VQMI 2UZKA 1HSTA 1Y1VJ 3S1MJ 3QYEA 2LFBA 5D6FA 5EEHA 2A05A 4LK1F 2LY1A 3JCUC 4I2OA 2L9VA 3ZMUA 1R22A 1VFCA 1YS6A 4IQ4A 3GTPJ 3ZQ7A 4HNUA 3BP8A 3O8HA 3M8JA 1OYWA 2DK5A 1DU6A 3ZMZA 2AQFA 2KRHA 4PDKA 2YPRA 4U87A 4Y33A 2CFXA 4EJTA 2ELHA 3QRFF 3BC8A 2K4BA 4NBQA 3HHHA 2CO5A 1X1CA 3I59B 3CLQA 5F1RA 2R5ZA 1K4SA 5FJ8J 3CCMI 1G3WA 1G3YA 4D7NA 1MMAA 4B1RA 3H5AA 4F93B 2LDUA 3CMMA 1OISA 3LSHA 4RA2A 2WY8Q 2VI6A 3M8FA 3BCAA 1S7OA 2QQ9A 5KAFC 3HOXJ 4M9ZA 4O5VA 2IGKA 3TO9A 3GLLA 3GZNB 5C3EJ 1MBGA 1MNEA 2D5VA 1FSHA 2JWTA 1YG2A 2DFEA 4CUGA 4AIJA 2JA8J 3ZQQA 2E35A 2HR3A 4O6JA 4AIHA 5IYCJ 1T38A 3HB9A 3H9JA 3PSFA 4BL0B 1K61A 1KYZA 1TT0A 2BOLA 3A1YA 3EYYA 3TO6A 2M4GA 1MJ9A 1UJ8A 3D0SA 3ZMTA 3I55I 1TW3A 3H35A 2E1MB 3FKIJ 1O3QA 3LSMA 4BEHA 2G7UA 2CRGA 1QPIA 3HOYJ 3CC2I 1QQIA 2ZXJA 2VC0A 2BVMA 2KMUA 2X1CA 1G8XA 5TISC 3R6SA 1OKRA 1UFMA 4WX9A 4ZJZA 1DDNA 2DDAA 4XRSG 2CW7A 4BHBA 3CCYA 4IVNA 3MCZA 3JRBA 2PX9A 1KQ8A 2PJRB 2R7WA 3FIWA 2FA5A 2HYGD 2XAUA 2RQPA 1OFCX 1PUEE 5LGTA 2GQQA 3GXOA 4ZZDA 2M9HA 1R5ID 3HBLA 4U0WA 2EH3A 3ASOH 1U5TC 1V5FA 3S3NA 3CD6I 3BG6A 1Q1VA 3CF2A 4XSZF 3G1MA 3G3ZA 1FOYA 2OAZA 2KP6A 2QQ8A 1G3SA 3K10A 5FKKA 1BN5A 5LEJA 1W5CC 4L0YB 3HGGA 3F8BA 1W7PB 2CG4A 3DKXA 1WQ2A 3IH3A 1MD0A 1IC8A 5BNGA 5DD4A 4IXAA 1T33A 3BOQA 3DPTA 2O8KA 4L0ZB 4OIPF 2L0KA 4IL6C 5IP9J 3D5RC 3LQRA 4OOIA 4UHTA 4N9IA 2H6CA 5E3OA 1IN8A 3L7WA 3ML6A 3HL2A 4BBSJ 1D1CA 3EQLF 5IP7J 2FNPA 3QPHA 3H3ZA 1LEAA 2OJED 3OSFA 1LFBA 3MMYB 1DU0A 1BM9A 4XNFA 3K1PA 3H0DA 2A3SA 2XF7A 2X4HA 4F7ZA 1LFPA 3KZZA 2KJCA 4RGSA 3RSNA 2M2EA 1YFHA 2EIJH 3OIOA 5DEQA 3RJPA 3TL4X 1XN7A 2V6CA 2V1NA 2UWMA 1X4PA 1TBXA 1CQTA 3RKYA 4LIVA 5D5WB 1UCRA 2Z99A 4JBAA 1NTCA 3CDHA 1FIAA 2DJIA 1BI3A 2JRMA 2XB5A 1VQKI 1MNMC 2XUBA 1I5ZA 4UNOA 3BG7A 4XLEA 2WWYA 4A3CJ 1FX7A 2O0YA 1IN5A 3KEQA 2E19A 1D8JA 2MC3A 3F23A 1B9NA 2YU3A 3IV5A 1T6SA 2QUFA 1ERDA 1JUMA 2IXSA 3HTUA 2XGEA 3HHGA 1T39A 3C2BA 1Z05A 2XAFA 2ME0A 5J1YA 4A3KJ 2NS0A 3WTYC 1X1DA 3M9AA 4B44A 4E7JA 2PMZA 1WFXA 3JRIA 3N05A 2DTZA 1GHCA 3CTAA 2K40A 4CZZA 4I0AA 3FXUA 4UY8I 2JMWA 2ZKZA 5E18F 9ANTA 5B5EC 5E1WA 3F9KA 5H20A 1ZK8A 1H8AC 1Z3YA 3KIOA 1T8IA 1P4AA 2HPMA 2TRTA 1P2FA 3KP7A 3AG4H 3W3CA 4PJJA 4Y13A 4PSWA 1U3EM 2H09A 2E34A 1FBSA 2A6EF 3A2KA 2WY7Q 2F5EA 3JW4A 1B59A 3HM5A 3GX4X 3EYIA 5EJCA 3RPQA 3TOBA 3TQNA 4MEXF 2P5LC 4XLHA 1X2MA 2E60A 2K27A 4C3IJ 2F4MB 3JSOA 4ENNA 1S5LC 3MEXA 4LOCA 3WE3A 4LD5A 2NAZA 1N25A 1S8NA 2K9MA 2BW3A 4AVZA 3OOPA 4A0ZA 1OJLA 2OZ6A 3TGNA 4XQFA 5B1AH 2YSRA 1U8BA 4D5CA 3LAPA 1LPQA 4KITB 2MABA 1IRGA 4GXOA 2P7VB 2HYFA 1QPMA 3HC7A 3M7GA 3E6CC 1TT5B 4RGXA 1BR4A 1ZQ3P 4BEHB 3S3OA 1D1AA 2WB1A 1T98A 4D0PA 4CYCA 3LSPA 1VZ0A 4A3FJ 2KIFA 1P6RA 1Y0NA 1B1BA 4KICA 2HQNA 3MQ0A 5E3MA 3UKGA 2VJ4A 1XGSA 3C3WA 4E7ZA 1F36A 4E6KG 2MD5A 2QZ8A 3S2WA 2A5WA 3GFJA 1STZA 5TGTA 3K4MA 2JUCA 2F5FA 2XB0X 3CF5F 2ZBKA 1JKQC 1VQ9I 2HVQA 3O2PE 4WXCA 3S14J 4M3EA 3OY9A 3IAM2 3A0HC 5CYVA 5ICCA 3S1RJ 1YW9A 4FT8A 3HOVJ 1SFEA 1IN7A 4KDPA 1BI1A 1V5EA 2V9PA 2WBMA 3L2QA 1SFXA 3V8KA 2A5YB 2DA5A 3F8CA 4O3MA 1R5HA 2GM4A 1K7AA 5D6EA 3IH4A 3LFUA 3CDLA 2MYSA 3OMYA 2LC2A 2R4GA 2HQAA 1WCMJ 3KLNA 2HVRA 3AKZA 2ZJRF 2L3DA 4EV0A 2EZHA 1APLC 4M3GA 1MW7A 3OOUA 4WXHA 2RREA 2XGCA 2HDDA 3S15J 3R4KA 2ZC2A 2PMZN 3TDZC 4HOBA 3NEUA 1XC5A 4NC6A 4ZDLA 2IS6A 3OYKA 1ORKA 1LVKA 1HQCA 1JKOC 2O9LA 3TP3A 2NVQJ 3HOTA 3E6DA 4UB8C 1EH7A 2LBFB 2NS7A 3FHZA 1UELB 4C3JJ 3PL8A 1E17A 5L3CA 2HOTA 4Y52J 1Z3XA 5IYBJ 2A61A 4L5IA 2RC4A 2F4OB 2EA4A 2Q0OA 4XMYA 2M30A 3PQKA 2B63J 2ZMEB 1BOAA 1MDMB 1QBJA 3EPZA 5EDNA 3J81Z 1B8IB 2VKDA 1HKQA 2R92J 3B02A 4A3DJ 1I50J 3FXJA 3KP6A 3F8MA 3OYFA 2H1KA 5J40A 2GAUA 5CVRA 3VDXA 3L2RA 1SD4A 2LNBA 2GOXB 4NB5A 4BQNA 2X1DA 1B72A 2CV0A 3LA3A 3PM1A 3IH2A 4DYCA 2QYOA 4KN7X 4G6TB 1WI9A 3S1QJ 4LLNA 3Q3SA 2YUSA 3JRFA 1EH8A 1QZZA 3CUQC 1WI3A 3CCSI 3CO7C 1OYYA 4A5MA 4N4NB 4Y4RA 3L2UA 2JA7J 5D4SA 3FXMA 4G9YA 3GTMJ 1O57A 5CVVA 4ABZA 3OYCA 3FXKA 4LIUA 3S93A 5F08A 2WB1N 3M07A 2QBYA 1KU2A 1E3HA 4M6VA 1WZ2A 4DJAA 3KFWX 2XDVA 3E5UA 3SFIA 1ETQA 3UNGC 4AWXB 3BJ6A 1HKSA 1KU7A 1TWFJ 2X51A 3TBIA 4WCGA 3BTCA 3K9TA 1YITI 1GUUA 4QPOA 2OA4A 3DV8A 4YELA 4B4CA 3J7YJ 1HCRA 3I3LA 4IKFA 4XOPA 1MBFA 4EGZA 3Q5FA 5GTHC 3JRHA 3RKXA 2V1XA 5HS9A 3D1NI 3A02A 4ESBA 2JPCA 5ILUA 4EGYA 2LD5A 3QYBA 3WHCA 1R9TJ 3LMMA 1NH3A 3MAJA 2DLLA 4F91B 3OYHA 3K0LA 2NVYJ 4PCQA 3WE2A 2FX0A 2VT2A 3S3MA 4A93J 6PAXA 2F4IA 2VBXA 3H9GA 1MMGA 1MSFC 3DWLE 4B47A 4DZJA 2LTPA 2MSYA 4OWRB 1XS9A 4A6DA 4MFDA 2WV0A 2BHYA 1IO2A 2P5VA 5J6XA 1Y0UA 5EZHA 2B9SA 1HW2A 4V19K 5J4YA 1GT0C 4Z6YA 5M5XJ 4BH9A 2NNYA 1TQPA 1VQOI 4CO8A 2WADA 2HI3A 4BE2A 1KU3A 2BVLA 2XKOA 2EZIA 3G4SI 1E3OC 3E7LA 4UUTA 1D0ZA 2LREA 2VKEA 3QPLA 2E1OA 3VPRA 2W24A 4QWQA 1R7JA 2CSOA 5HNHA 1WJ5A 4AM3A 2PBIA 1B4AA 1KQ0A 1BJZA 1K83J 3F8NA 2IEKA 1J09A 3W2VA 2X6WA 1ZKGA 1IXRC 3DBLB 3SDGA 5FFXA 3S2DJ 4JK1X 1TP4A 4CGZA 2EZKA 4XR6A 2I5UA 5JLXA 2E36A 2CUFA 2DMNA 4HSRA 2VXDA 3MD2A 3IP4B 4A3GJ 3IKTA 1D8KA 3ZXSA 1ON1A 4KUMA 2P81A 1XSVA 2DA3A 2DJNA 1FSEA 1QO0D 4HV6A 2M5WA 3BWGA 5DCMB 3KP3A 3BJOA 2QKLB 5BPIA 3FK7A 3DU5A 4EM1A 3E6MA 3TO7A 2KLOA 3LFKA 2PJRA 2IT0A 3FXOA 5DDGA 4RGRA 4M72A 3WTXC 3TKYA 1R6RA 1YJNI 4IHYA 2P8TA 5HDKA 2JN6A 2VBYA 1Z9CA 1F4KA 2ID6A 2DT6A 2QSGX 3QPSA 1VQPI 4Y3OA 2JQ7A 5DTDA 3VEPA 1AA7A 1XD7A 1Z1DA 2FRHA 3H1CA 1YIJI 2VC1A 4BY7J 3FISA 4KMFA 2D1VA 2Z5UA 4YIFA 3JRCA 4I6ZA 2FMLA 4KISA 2WA0A 1W7PA 2L9RA 3TW7A 2LYCA 1RC9A 2E2JJ 2M34A 3L00A 3SXYA 1I3AA 4N9HA 4HNVA 4E7IA 1UHSA 4OMZA 1LDJA 4BXUA 2HXIA 1XCVA 3VFZA 1I6XA 1P92A 5E1ZB 3N4MA 1EKEA 3IRQA 2ICWG 4ZC3A 1VQNI 2DMUA 3DTKA 3HYIA 1FYMA 2CV1A 4BXFA 4NQWB 5HOOA 1CGPA 2VOOA 1I3QJ 3KYLA 3I56I 2DOFA 3RYRA 4IHWA 1DP3A 3K7AJ 2FF4A 1PP8F 4BUPA 3OYDA 1QVUA 2OTJI 1ZR4A 2EBIA 2K3FA 1OR7A 2PG4A 2VJIA 1WKMA 3I9V2 1QZEA 1YW8A 3E5QA 4LG3A 3K70C 1XCBA 3GF2A 1J7KA 2QQAA 2ZNYA 3GFIA 1N77A 4L9JA 4D1QA 1QZYA 2KHMA 3RQIA 3V7CA 4EVIA 1TQMA 3PIPF 5HLTA 2MW8A 1RR7A 4CCJA 4BDYA 3L2VA 2F5VA 2VODA 2Y31A 3GZ5A 3L09A 2DMTA 4X0GA 2HEOA 4L18B 2R7ZJ 2VKVA 3IUOA 2JRTA 2KDOA 1KGSA 1IG7A 2LKXA 3BZ6A 2GZWA 2MLGA 2Z1DA 4GO1A 2CYYA 3BR1A 1XB4A 2A69F 2CMPA 5J8FA 3O3KA 5CVJA 2GLOA 2ZFUA 2YU9J 1GV2A 5GAEJ 4CA0A 4EMSA 1FJLA 2KQRA 2F5DA 2N8GA 3OYAA 2OUMA 4E4HA 4FX0A 3ZMDA 5LEKA 3WU1B 4BNCA 1V55H 5FKNA 2ID3A 3ZRGA 1K79A
chains in the Genus database with same CATH topology
4G6DA 1R58A 4WWCA 4KMUX 4EJOA 4XRFA 2TDXA 3GYHX 4Q4ZF 5D5UB 3PFIA 1MGTA 1OMIA 2VONA 4MQVA 5HLHA 4U0VA 1UHWA 2GIVA 3FXRA 5BQTA 3COAC 2V9VA 3P7NA 4IHSA 4TV7A 1BC8C 1FBQA 1KQ9A 2VXZA 3Q9VA 4HX4A 5H6QA 4AIKA 2HFHA 2C6YA 4EJVA 2O3FA 4L5JA 4ZYHA 3F21A 5CLSA 5K5RA 3FMQA 5FFZA 3ELKA 2BBYA 3C7JA 2L4MA 1DUXC 5CVIA 3WGIA 5D5XB 1ZRFA 2FSWA 2CW0F 5HS8A 1NHAA 4LG0B 2IA1A 1H9GA 2ETHA 2PJPA 1YLFA 5F64A 5LHHA 3DQVC 3V8LA 3H3UA 5LRSA 1ZG5A 2QWWA 1AWCA 2DT5A 5DUIA 1IAWA 2FOKA 2UXNA 3GZ6A 2PMUA 3ABTA 4M6YA 1R36A 1RUOA 2OD5A 2P5KA 4QLCU 1IW7F 2W25A 4UV8A 3J80K 4YFKF 4MTEA 2EFOA 2ISYA 4FX4A 1G6NA 4WXDA 4UXNA 1SMTA 1T2KA 3T1BA 1UB9A 4G94A 2DU9A 2IPQX 1F1ZA 2LSOA 3KLOA 4U88A 2UXXA 1MJBA 2M87A 3ZMVA 1R1VA 1YIOA 2O8XA 1F9NA 2PLYA 2B0LA 3KP2A 3K1NA 4E70A 3J80Z 3BPVA 3DP7A 3SHFA 4EM0B 1KYWA 2ZMEA 2GA1A 4HX7A 1MDMA 4HF2A 1HKTA 2YX7A 3IKVA 3J7AO 2NYXA 2JT1A 3QOPA 3QU3A 1MZBA 5ICEA 1LJ9A 1ZG3A 1YW7A 4A12A 1X3UA 5ICGA 4EM2A 3FM5A 4B8XA 4MNUA 2EWNA 2D2WA 2P7CB 1QGPA 4OIRF 4UV9A 1A04A 3GVAA 3QP6A 1GXQA 2HTJA 4KIGA 2XROA 4CHUA 3IRRA 4YFXF 2AXLA 4A0YA 4I0BA 3NRVA 3SQNA 2DI3A 2QM3A 2HWVA 5FLXK 4G7HF 2CQKA 1IN4A 2E7WA 2QVOA 3JAMK 2ZO4A 1S6LA 3CJNA 4EJWA 4ZZLA 1J5YA 1TLHB 4CICA 5TRDA 1RI7A 4LLGF 1JHHA 4IF4A 2L02A 5FLXZ 3F72A 2LKPA 5BPDA 4R8HA 1ZN2A 2K7LA 3JAMZ 3WTSC 2ZFWA 2BEOA 4U7BA 3LAJA 1R00A 1ZARA 3RIRA 2O6GE 1YS7A 3HSRA 4EJUA 5KK1A 4U7DA 3R0AA 4DNCA 2NRAC 5HDGA 5JFRA 3U1DA 2ZJ2A 3GO5A 4PZJA 3IC7A 2MH2A 2DK8A 2Y48A 1FP1D 1XSDA 4IRHA 4I01A 3FMSA 1V4RA 3SZPA 1LDKB 2IA2A 2VBWA 3MZYA 1YYVA 5DCMA 1USSA 1BIBA 4WF2A 2DQRA 2D45A 1BI0A 3LSTA 2MH9A 4RB2C 1XGMA 3ZN0A 1FLIA 1ZYRF 1OPCA 2R7DA 4G7ZF 5ILSA 4AVPA 1YTYA 4PGHA 4IRIA 1K78B 2XIGA 2EV0A 3PQJA 2XAJA 4Y17A 1V3FA 3F8FA 1L0OC 2Y0MA 3E97A 3E6BA 2JTVA 1Z6RA 4K2EA 2Q8KA 3TDUC 2PMHA 5DV5A 5L3GA 1AOYA 2GWRA 3KETA 4S05A 4NQWA 2G7HA 3KE2A 3BPXA 4MHGA 5D4RA 4ENJA 3W6KB 1ZRCA 2XV4S 3ZPLA 5LHIA 5HDNA 2ACJA 4UVAA 3RYPA 5L3BA 1O3SA 4I7HA 1LNWA 5IT9K 1XDSA 1IN6A 3EUHA 1BC7C 3CO6C 1ZHFA 4LB6B 3I0TA 5ILVA 2DPUA 3ECHA 5ED4A 2KIUA 5E20A 4UVBA 5IT9Z 1IXSB 1ON2A 3LQQA 2EJRA 5HVQC 2KIMA 4OIQF 5F6FA 4HQEA 3KEOA 3LWFA 5DYMA 5FO5A 3FM3A 3R0JA 1ZAOA 2HGCA 4HDVA 1L3LA 1IRFA 2HKOA 2EFPA 4GYIA 5BMZA 4U0YA 4Y15A 1DPRA 2EK5A 1HBXG 2FBHA 2D1HA 3TOAA 1S29A 3C1DA 4KT5C 3CUOA 2E1CA 2XKPA 2H6BA 4L9NA 4Z2YA 3I4PA 1GVJA 1CF7B 5JVTA 1Q1HA 2F5CA 3ULQB 4YIIA 4RB1A 2EV5A 4LG0A 5CJ9A 2A68F 4G6QA 4BHPA 2YX4A 3DXJF 3I54A 5D8LB 3HRTA 2STWA 1J0RA 4GGGA 4XLNF 2QLZA 3DF8A 2O61A 2XVCA 4P9FA 3VOEA 1S7AA 4KNYA 3IHUA 4ETSA 2IA0A 1B9MA 1I1GA 5ERIA 3N97A 1O3RA 4ESJA 1J9IA 2WC2A 3F6VA 1S3JA 2JZYA 4Q48A 3ECOA 4I98B 5K5QA 1W4MA 1ZGJA 4HQMA 2Z3YA 4JQFA 2F2EA 3BROA 4R1HA 1XGOA 3F22A 3ERED 3FWEA 4ZYDA 3C18A 4MEYF 3M8EA 2KKOA 4PGGA 1O7LA 4LJZF 2DTRA 1K6OA 4OU0A 2EV6A 5CVUA 2BGCA 1J59A 4P96A 1JGSA 4G7OF 2DO7A 3L9FA 4HYEA 2MA3A 2GA2A 1FP2A 3GUDA 2PFBA 5FB2A 2XAHA 2EFNA 4HLXA 5L3FA 1GXPA 4HX8A 1TQIA 5E17F 1ZLKA 3I64A 1FYLA 3V7RA 3O6BB 2P4WA 1LDDA 1RUNA 4EQQA 2R7FA 5KVRA 3WTZA 3AAFA 2DAOA 2HZTA 4OINF 2A6HF 3I58A 4YFNF 3F6OA 4KN4X 2VN2A 3V7SA 4HZFA 5HS7A 5FD6A 1BI2A 4BHCA 3WTUC 2XAGA 3IWFA 2VE9A 1U78A 3LA7A 1ODDA 2G9WA 2VE8A 4ESFA 5E8IA 4Q5SF 3B73A 3RI4A 2Y75A 4S04A 4L9TA 2CGPA 2XAQA 1T0FA 1BJAA 2STTA 3R60A 4MTDA 1TNSA 3KZYA 3DFGA 3BY6A 2WTEA 1ZRDA 3W6JB 2VOPA 2PQ8A 1LB2A 3SFZA 4ENMA 1HSJA 3WTVC 3P9CA 4ZH4F 2EFWA 2FQ3A 2MBFA 5L3EA 2L01A 2P6TA 1TW2A 1O3TA 1HXDA 1FOKA 2HOEA 4KA4A 4KFCA 4ON0A 3K69A 5EEGA 2ESNA 2PEXA 1U8RA 1D5VA 3ZMSA 2K02A 1USTA 3LA2A 2M8EA 2V79A 5JHUA 1KU9A 3VODA 2QQBA 4XLPF 1G4DA 5K5OA 2W57A 2FNAA 3WU0A 3MWMA 3GFLA 4DQ2A 2J5PA 5LBQA 5HLGA 4L9VA 3VB2A 5IT3A 3QP5A 4LFUA 1P4XA 1R1TA 3H92A 2JSCA 2VT3A 3CUQB 5TJJA 3FMRA 2HTSA 2KRFA 3NQOA 2FXAA 2IP2A 2GXGA 5LGNA 1H9TA 4P55A 1I27A 3JTGA 4LK0F 1PP7U 1K78A 3FX3A 4FHTA 5FD5A 1XGNA 3IWZA 4CYDA 2DPDA 3BJAA 3WG9A 1Z7UA 3P9KA 1XMKA 2BE5F 3T0YA 2DFIA 4MGRA 1I1SA 4IPAA 4M73A 3RPUA 2DQLA 2RNJA 1VTNC 5FGMA 5LRRA 4H0EA 2Z9OA 1R5GA 1ONVA 3HRUA 4MQ9F 1SAXA 4KIBA 2HDCA 3ABUA 2R3SA 1ZH5A 1RNLA 4RS8A 3E3VA 3WGGA 4XBFA 1OYIA 1YQAA 1JXSA 2DBBA 1G3TA 1LQ1A 2RV8A 1P4WA 2HQRA 4OIOF 2M1BA 4HBLA 2IRFG 3DEUA 2NNNA 3HUGA 4OMYA 3JTHA 3T8RA 3SZTA 4M74A 4A2UA 3D5LA 2RVCA 4A5NA 4M9SA 2BYVE 3KP4A 4XSXF 2E1NA 5H6RA 5LLQA 1IZ1A 2OQRA 3WTWC 1H0MA 1U5TA 2O03A 2RGVA 1DP7P 1ULYA 4KYWA 4WK8F 4ZYEA 4UUVA 3V8JA 1WSUA 4IRGA 3HTSB 3OV8A 4BYYA 1UHMA 2QENA 4M6XA 5BOXA 4LLLA 2FBIA 1EH6A 1FT9A 5AONA 3CLOA 2V1DA 3HIFA 2K4JA 3MZHA 4RB3C 1CF7A 1QNTA 5ICFA 1D3YA 1JE8A 1U6GA 2IW5A 5E8GA 4KIFA 2RDPA 2OZUA 2Z33A 2CWEA 4BQAA 2PI0A 3I5UA 2PN6A 5LGUA 4M71A 2HKXA 4IHTA 1E2XA 3E5XA 1TNTA 2GXBA 4G8XA 3EETA 1XDUA 4NHJA 4HA8A 1Z6TA 2XRNA 4P9UA 2AS5F 4CXFA 2FBKA 1O7FA 4I09A 3J81K 3U9GA 3RDIA 1ZLJA 5DCFA 3IL2A 5LHGA 1J75A 2Q2EA 3DKWA 5L3DA 4RB0A 1C0WA 3RTRA 1FZPB 2EB7A 2JPBA 1SMYF 2FE3A 4UVCA 1KA8A 1BBYA 3DPLC 1WWXA 5A2QK 4HF0A 4RGUA 2ADUA 4B09A 3I71A 2ZCWA 1BIAA 1FY7A 3GFMA 2MLKA 4RAZA 2YR2A 4HAMA 3GEZA 5DUKA 3WODF 4A0XA 1SD5A 5AIPA 4AD9A 1FBUA 3HRSA 3BDDA 5E1XA 1FWZA 3GWZA 5JI6A 1IF1A 5A2QZ 2FEZA 3L2CA 2LF8A 1DPUA 5DD8A 3K2ZA 3QPTA 1SD6A 1WRJA 2LF7A 1W7PD 1JHFA 3F3XA 3WGHA 1HW5A 2FMYA 2ESHA 3FXQA 1F5TA 1MKMA 1XMAA 1J2XA 1ZREA 2RN7A 3WTTC 3KP5A 3KCCA 2KJBA 2RKHA 4CDGA 1U5TB 2EA2A 3Q9SA 4LB5A 1SFUA 2H27A 1W5SA 1XSXA 2L4AA 3I59A 1R1UA 2IJLA 3GW2A 4GYGA 2W85A 1SD7A 5HLIA 1LEBA 1EV7A 4A6EA 2K86A 4Q47A 1IXCA 2OU2A 1RZ4A 3FZVA 3HSFA 4HLYA 3ISPA 2X0LA 5K1YA 3M1EA 4IJAA 3U2RA 4BAYA 5BS6A 4ENKA 2IVMA 2DW4A 2OBPA 3T5XA 2A07F 4YG2F 4RAYA 1PDNC 3EDPA 3K1MA 4ZYGA 4LMYA 5J8CA 2BV6A 2OQGA 2H94A 3V4GA 4P5OA 2XASA 5AIQA 1ZGAA 2W84A 3R61A 1FNNA 1HW1A 5JR3A 2ZNZA 1YO5C 1TTYA 4M9XA 3HSEA 2HS5A 3ZN1A 1FPQA 4N0BA 3G73A 1IUYA 1R23A 3P9IA 4I02A 2M45A 3HOSA 3HRMA 4R79A 4HF1A 2VBZA 3CUQA 2EFQA 3FF5A 3GLXA 1Z91A 5D8KB 3ROUA 1REPC 1B6AA 3JSPA 5D5VB 4ASNA 1FYKA 2ISZA 2COMA 4HDUA 4HV5A 2XHKA 2P6SA 4HW0A 1U2WA 3MFKA 1ZG1A 3ZP5A 1W5TA 2J5OA 2FU4A 4GCVA 3QAHA 3QU6A 1RIOH 2V1UA 1LVAA 3REOA 1FC3A 3RKWA 3T8TA 4LGWA 2E7XA 3I53A 2L54A 1MJAA 2QBYB 2XGXA 2UZKA 1HSTA 5D6FA 5EEHA 4LK1F 4I2OA 3ZMUA 1R22A 1YS6A 3ZQ7A 3BP8A 1OYWA 2DK5A 3ZMZA 4PDKA 2YPRA 2CFXA 4EJTA 2ELHA 3QRFF 2K4BA 3HHHA 2CO5A 3I59B 5F1RA 1G3WA 1G3YA 2LDUA 3M8FA 1S7OA 2QQ9A 4M9ZA 4O5VA 3TO9A 1FSHA 1YG2A 4AIJA 2HR3A 4O6JA 4AIHA 1T38A 1KYZA 3EYYA 3TO6A 1MJ9A 3D0SA 3ZMTA 1TW3A 1O3QA 2G7UA 1QQIA 2ZXJA 2VC0A 3R6SA 1OKRA 1UFMA 4WX9A 1DDNA 4BHBA 4IVNA 3MCZA 1KQ8A 2FA5A 2HYGD 2RQPA 1PUEE 5LGTA 2GQQA 3GXOA 4ZZDA 4U0WA 1U5TC 4XSZF 3G3ZA 2OAZA 1G3SA 1BN5A 5LEJA 4L0YB 3F8BA 1W7PB 2CG4A 1WQ2A 1MD0A 5DD4A 4IXAA 3BOQA 3DPTA 4L0ZB 4OIPF 3LQRA 4OOIA 4UHTA 4N9IA 2H6CA 1IN8A 3L7WA 3ML6A 3EQLF 2FNPA 3QPHA 3H3ZA 1LEAA 1BM9A 3K1PA 2A3SA 2X4HA 4F7ZA 3KZZA 2KJCA 4RGSA 1YFHA 3RJPA 5DEQA 1XN7A 2V6CA 2UWMA 1TBXA 3RKYA 5D5WB 1UCRA 2Z99A 4JBAA 3CDHA 1BI3A 2XUBA 1I5ZA 4UNOA 2WWYA 1FX7A 2O0YA 1IN5A 3KEQA 1D8JA 2MC3A 3F23A 1B9NA 2YU3A 1T6SA 2QUFA 3HTUA 3HHGA 1T39A 1Z05A 2XAFA 2NS0A 3WTYC 3M9AA 1GHCA 3CTAA 4CZZA 4I0AA 3FXUA 2ZKZA 5E18F 5E1WA 5H20A 1P4AA 1P2FA 3KP7A 4Y13A 1U3EM 2H09A 1FBSA 2A6EF 2F5EA 3JW4A 1B59A 3GX4X 3EYIA 4MEXF 3RPQA 3TOBA 3TQNA 2P5LC 2K27A 3JSOA 4ENNA 3MEXA 3WE3A 4LD5A 2NAZA 1S8NA 3OOPA 4A0ZA 2OZ6A 3TGNA 2YSRA 3LAPA 1IRGA 4GXOA 2P7VB 2HYFA 1QPMA 3M7GA 3E6CC 4RGXA 1T98A 4D0PA 2KIFA 1P6RA 1B1BA 4KICA 2HQNA 3MQ0A 1XGSA 3C3WA 2MD5A 2QZ8A 3S2WA 3GFJA 1STZA 2F5FA 2ZBKA 3O2PE 4WXCA 5CYVA 5ICCA 1YW9A 4FT8A 1SFEA 1IN7A 4KDPA 1BI1A 1SFXA 3V8KA 2A5YB 4O3MA 3F8CA 1R5HA 1K7AA 5D6EA 3KLNA 2L3DA 4EV0A 4WXHA 3R4KA 3TDZC 4HOBA 3NEUA 1HQCA 3HOTA 3E6DA 1EH7A 3FHZA 1E17A 5L3CA 2A61A 4L5IA 2RC4A 2EA4A 2Q0OA 2M30A 3PQKA 2ZMEB 1BOAA 1MDMB 1QBJA 3J81Z 1HKQA 3B02A 3KP6A 3F8MA 2GAUA 5CVRA 1SD4A 2LNBA 4NB5A 3LA3A 2QYOA 4KN7X 1WI9A 4LLNA 1EH8A 1QZZA 3CUQC 3CO7C 1OYYA 4A5MA 5D4SA 4G9YA 1O57A 5CVVA 2QBYA 1KU2A 3KFWX 3E5UA 4AWXB 3BJ6A 1HKSA 1KU7A 4WCGA 3K9TA 2OA4A 3DV8A 4EGZA 3Q5FA 3RKXA 2V1XA 5HS9A 4ESBA 2JPCA 5ILUA 4EGYA 3MAJA 2DLLA 3K0LA 4PCQA 3WE2A 2VT2A 6PAXA 2VBXA 4A6DA 2WV0A 2P5VA 5J6XA 1Y0UA 1HW2A 4BH9A 2NNYA 1TQPA 4CO8A 1KU3A 2XKOA 2W24A 4QWQA 1R7JA 2CSOA 2PBIA 1B4AA 1KQ0A 3F8NA 1IXRC 5FFXA 4JK1X 4CGZA 3IKTA 1D8KA 1ON1A 4KUMA 1XSVA 1FSEA 4HV6A 2M5WA 3BWGA 5DCMB 3KP3A 3BJOA 5BPIA 4EM1A 3E6MA 3TO7A 3LFKA 2IT0A 5DDGA 4RGRA 4M72A 3WTXC 3TKYA 2P8TA 5HDKA 2VBYA 1Z9CA 1F4KA 3VEPA 1XD7A 2FRHA 1Z1DA 2VC1A 4KMFA 2D1VA 2Z5UA 4YIFA 2FMLA 1W7PA 3L00A 3SXYA 4N9HA 4OMZA 1LDJA 4BXUA 1XCVA 3VFZA 1I6XA 1P92A 5E1ZB 3N4MA 3IRQA 3HYIA 1FYMA 5HOOA 1CGPA 2VOOA 3RYRA 2FF4A 1PP8F 1OR7A 2PG4A 1WKMA 1YW8A 3E5QA 1XCBA 3GF2A 1J7KA 2QQAA 2ZNYA 3GFIA 4L9JA 4EVIA 1QZYA 3V7CA 1TQMA 2VODA 3GZ5A 3L09A 2HEOA 4L18B 2JRTA 1KGSA 3BZ6A 2GZWA 2MLGA 4GO1A 2CYYA 1XB4A 2A69F 5J8FA 3O3KA 5CVJA 4EMSA 2F5DA 5LEKA 4FX0A 3ZMDA 3WU1B 4BNCA 1QO0D 1K79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G6D A;  1R58 A;  4WWC A;  4KMU X;  4EJO A;  4XRF A;  2TDX A;  3GYH X;  4Q4Z F;  5D5U B;  3PFI A;  1MGT A;  1OMI A;  2VON A;  4MQV A;  5HLH A;  4U0V A;  1UHW A;  2GIV A;  3FXR A;  5BQT A;  3COA C;  2V9V A;  3P7N A;  4IHS A;  4TV7 A;  1BC8 C;  1FBQ A;  1KQ9 A;  2VXZ A;  3Q9V A;  4HX4 A;  5H6Q A;  4AIK A;  2HFH A;  2C6Y A;  4EJV A;  2O3F A;  4L5J A;  4ZYH A;  3F21 A;  5CLS A;  5K5R A;  3FMQ A;  5FFZ A;  3ELK A;  2BBY A;  3C7J A;  2L4M A;  1DUX C;  5CVI A;  3WGI A;  5D5X B;  1ZRF A;  2FSW A;  2CW0 F;  5HS8 A;  1NHA A;  4LG0 B;  2IA1 A;  1H9G A;  2ETH A;  2PJP A;  1YLF A;  5F64 A;  5LHH A;  3DQV C;  3V8L A;  3H3U A;  5LRS A;  1ZG5 A;  2QWW A;  1AWC A;  2DT5 A;  5DUI A;  1IAW A;  2FOK A;  2UXN A;  3GZ6 A;  2PMU A;  3ABT A;  4M6Y A;  1R36 A;  1RUO A;  2OD5 A;  2P5K A;  4QLC U;  1IW7 F;  2W25 A;  4UV8 A;  3J80 K;  4YFK F;  4MTE A;  2EFO A;  2ISY A;  4FX4 A;  1G6N A;  4WXD A;  4UXN A;  1SMT A;  1T2K A;  3T1B A;  1UB9 A;  4G94 A;  2DU9 A;  2IPQ X;  1F1Z A;  2LSO A;  3KLO A;  4U88 A;  2UXX A;  1MJB A;  2M87 A;  3ZMV A;  1R1V A;  1YIO A;  2O8X A;  1F9N A;  2PLY A;  2B0L A;  3KP2 A;  3K1N A;  4E70 A;  3J80 Z;  3BPV A;  3DP7 A;  3SHF A;  4EM0 B;  1KYW A;  2ZME A;  2GA1 A;  4HX7 A;  1MDM A;  4HF2 A;  1HKT A;  2YX7 A;  3IKV A;  3J7A O;  2NYX A;  2JT1 A;  3QOP A;  3QU3 A;  1MZB A;  5ICE A;  1LJ9 A;  1ZG3 A;  1YW7 A;  4A12 A;  1X3U A;  5ICG A;  4EM2 A;  3FM5 A;  4B8X A;  4MNU A;  2EWN A;  2D2W A;  2P7C B;  1QGP A;  4OIR F;  4UV9 A;  1A04 A;  3GVA A;  3QP6 A;  1GXQ A;  2HTJ A;  4KIG A;  2XRO A;  4CHU A;  3IRR A;  4YFX F;  2AXL A;  4A0Y A;  4I0B A;  3NRV A;  3SQN A;  2DI3 A;  2QM3 A;  2HWV A;  5FLX K;  4G7H F;  2CQK A;  1IN4 A;  2E7W A;  2QVO A;  3JAM K;  2ZO4 A;  1S6L A;  3CJN A;  4EJW A;  4ZZL A;  1J5Y A;  1TLH B;  4CIC A;  5TRD A;  1RI7 A;  4LLG F;  1JHH A;  4IF4 A;  2L02 A;  5FLX Z;  3F72 A;  2LKP A;  5BPD A;  4R8H A;  1ZN2 A;  2K7L A;  3JAM Z;  3WTS C;  2ZFW A;  2BEO A;  4U7B A;  3LAJ A;  1R00 A;  1ZAR A;  3RIR A;  2O6G E;  1YS7 A;  3HSR A;  4EJU A;  5KK1 A;  4U7D A;  3R0A A;  4DNC A;  2NRA C;  5HDG A;  5JFR A;  3U1D A;  2ZJ2 A;  3GO5 A;  4PZJ A;  3IC7 A;  2MH2 A;  2DK8 A;  2Y48 A;  1FP1 D;  1XSD A;  4IRH A;  4I01 A;  3FMS A;  1V4R A;  3SZP A;  1LDK B;  2IA2 A;  2VBW A;  3MZY A;  1YYV A;  5DCM A;  1USS A;  1BIB A;  4WF2 A;  2DQR A;  2D45 A;  1BI0 A;  3LST A;  2MH9 A;  4RB2 C;  1XGM A;  3ZN0 A;  1FLI A;  1ZYR F;  1OPC A;  2R7D A;  4G7Z F;  5ILS A;  4AVP A;  1YTY A;  4PGH A;  4IRI A;  1K78 B;  2XIG A;  2EV0 A;  3PQJ A;  2XAJ A;  4Y17 A;  1V3F A;  3F8F A;  1L0O C;  2Y0M A;  3E97 A;  3E6B A;  2JTV A;  1Z6R A;  4K2E A;  2Q8K A;  3TDU C;  2PMH A;  5DV5 A;  5L3G A;  1AOY A;  2GWR A;  3KET A;  4S05 A;  4NQW A;  2G7H A;  3KE2 A;  3BPX A;  4MHG A;  5D4R A;  4ENJ A;  3W6K B;  1ZRC A;  2XV4 S;  3ZPL A;  5LHI A;  5HDN A;  2ACJ A;  4UVA A;  3RYP A;  5L3B A;  1O3S A;  4I7H A;  1LNW A;  5IT9 K;  1XDS A;  1IN6 A;  3EUH A;  1BC7 C;  3CO6 C;  1ZHF A;  4LB6 B;  3I0T A;  5ILV A;  2DPU A;  3ECH A;  5ED4 A;  2KIU A;  5E20 A;  4UVB A;  5IT9 Z;  1IXS B;  1ON2 A;  3LQQ A;  2EJR A;  5HVQ C;  2KIM A;  4OIQ F;  5F6F A;  4HQE A;  3KEO A;  3LWF A;  5DYM A;  5FO5 A;  3FM3 A;  3R0J A;  1ZAO A;  2HGC A;  4HDV A;  1L3L A;  1IRF A;  2HKO A;  2EFP A;  4GYI A;  5BMZ A;  4U0Y A;  4Y15 A;  1DPR A;  2EK5 A;  1HBX G;  2FBH A;  2D1H A;  3TOA A;  1S29 A;  3C1D A;  4KT5 C;  3CUO A;  2E1C A;  2XKP A;  2H6B A;  4L9N A;  4Z2Y A;  3I4P A;  1GVJ A;  1CF7 B;  5JVT A;  1Q1H A;  2F5C A;  3ULQ B;  4YII A;  4RB1 A;  2EV5 A;  4LG0 A;  5CJ9 A;  2A68 F;  4G6Q A;  4BHP A;  2YX4 A;  3DXJ F;  3I54 A;  5D8L B;  3HRT A;  2STW A;  1J0R A;  4GGG A;  4XLN F;  2QLZ A;  3DF8 A;  2O61 A;  2XVC A;  4P9F A;  3VOE A;  1S7A A;  4KNY A;  3IHU A;  4ETS A;  2IA0 A;  1B9M A;  1I1G A;  5ERI A;  3N97 A;  1O3R A;  4ESJ A;  1J9I A;  2WC2 A;  3F6V A;  1S3J A;  2JZY A;  4Q48 A;  3ECO A;  4I98 B;  5K5Q A;  1W4M A;  1ZGJ A;  4HQM A;  2Z3Y A;  4JQF A;  2F2E A;  3BRO A;  4R1H A;  1XGO A;  3F22 A;  3ERE D;  3FWE A;  4ZYD A;  3C18 A;  4MEY F;  3M8E A;  2KKO A;  4PGG A;  1O7L A;  4LJZ F;  2DTR A;  1K6O A;  4OU0 A;  2EV6 A;  5CVU A;  2BGC A;  1J59 A;  4P96 A;  1JGS A;  4G7O F;  2DO7 A;  3L9F A;  4HYE A;  2MA3 A;  2GA2 A;  1FP2 A;  3GUD A;  2PFB A;  5FB2 A;  2XAH A;  2EFN A;  4HLX A;  5L3F A;  1GXP A;  4HX8 A;  1TQI A;  5E17 F;  1ZLK A;  3I64 A;  1FYL A;  3V7R A;  3O6B B;  2P4W A;  1LDD A;  1RUN A;  4EQQ A;  2R7F A;  5KVR A;  3WTZ A;  3AAF A;  2DAO A;  2HZT A;  4OIN F;  2A6H F;  3I58 A;  4YFN F;  3F6O A;  4KN4 X;  2VN2 A;  3V7S A;  4HZF A;  5HS7 A;  5FD6 A;  1BI2 A;  4BHC A;  3WTU C;  2XAG A;  3IWF A;  2VE9 A;  1U78 A;  3LA7 A;  1ODD A;  2G9W A;  2VE8 A;  4ESF A;  5E8I A;  4Q5S F;  3B73 A;  3RI4 A;  2Y75 A;  4S04 A;  4L9T A;  2CGP A;  2XAQ A;  1T0F A;  1BJA A;  2STT A;  3R60 A;  4MTD A;  1TNS A;  3KZY A;  3DFG A;  3BY6 A;  2WTE A;  1ZRD A;  3W6J B;  2VOP A;  2PQ8 A;  1LB2 A;  3SFZ A;  4ENM A;  1HSJ A;  3WTV C;  3P9C A;  4ZH4 F;  2EFW A;  2FQ3 A;  2MBF A;  5L3E A;  2L01 A;  2P6T A;  1TW2 A;  1O3T A;  1HXD A;  1FOK A;  2HOE A;  4KA4 A;  4KFC A;  4ON0 A;  3K69 A;  5EEG A;  2ESN A;  2PEX A;  1U8R A;  1D5V A;  3ZMS A;  2K02 A;  1UST A;  3LA2 A;  2M8E A;  2V79 A;  5JHU A;  1KU9 A;  3VOD A;  2QQB A;  4XLP F;  1G4D A;  5K5O A;  2W57 A;  2FNA A;  3WU0 A;  3MWM A;  3GFL A;  4DQ2 A;  2J5P A;  5LBQ A;  5HLG A;  4L9V A;  3VB2 A;  5IT3 A;  3QP5 A;  4LFU A;  1P4X A;  1R1T A;  3H92 A;  2JSC A;  2VT3 A;  3CUQ B;  5TJJ A;  3FMR A;  2HTS A;  2KRF A;  3NQO A;  2FXA A;  2IP2 A;  2GXG A;  5LGN A;  1H9T A;  4P55 A;  1I27 A;  3JTG A;  4LK0 F;  1PP7 U;  1K78 A;  3FX3 A;  4FHT A;  5FD5 A;  1XGN A;  3IWZ A;  4CYD A;  2DPD A;  3BJA A;  3WG9 A;  1Z7U A;  3P9K A;  1XMK A;  2BE5 F;  3T0Y A;  2DFI A;  4MGR A;  1I1S A;  4IPA A;  4M73 A;  3RPU A;  2DQL A;  2RNJ A;  1VTN C;  5FGM A;  5LRR A;  4H0E A;  2Z9O A;  1R5G A;  1ONV A;  3HRU A;  4MQ9 F;  1SAX A;  4KIB A;  2HDC A;  3ABU A;  2R3S A;  1ZH5 A;  1RNL A;  4RS8 A;  3E3V A;  3WGG A;  4XBF A;  1OYI A;  1YQA A;  1JXS A;  2DBB A;  1G3T A;  1LQ1 A;  2RV8 A;  1P4W A;  2HQR A;  4OIO F;  2M1B A;  4HBL A;  2IRF G;  3DEU A;  2NNN A;  3HUG A;  4OMY A;  3JTH A;  3T8R A;  3SZT A;  4M74 A;  4A2U A;  3D5L A;  2RVC A;  4A5N A;  4M9S A;  2BYV E;  3KP4 A;  4XSX F;  2E1N A;  5H6R A;  5LLQ A;  1IZ1 A;  2OQR A;  3WTW C;  1H0M A;  1U5T A;  2O03 A;  2RGV A;  1DP7 P;  1ULY A;  4KYW A;  4WK8 F;  4ZYE A;  4UUV A;  3V8J A;  1WSU A;  4IRG A;  3HTS B;  3OV8 A;  4BYY A;  1UHM A;  2QEN A;  4M6X A;  5BOX A;  4LLL A;  2FBI A;  1EH6 A;  1FT9 A;  5AON A;  3CLO A;  2V1D A;  3HIF A;  2K4J A;  3MZH A;  4RB3 C;  1CF7 A;  1QNT A;  5ICF A;  1D3Y A;  1JE8 A;  1U6G A;  2IW5 A;  5E8G A;  4KIF A;  2RDP A;  2OZU A;  2Z33 A;  2CWE A;  4BQA A;  2PI0 A;  3I5U A;  2PN6 A;  5LGU A;  4M71 A;  2HKX A;  4IHT A;  1E2X A;  3E5X A;  1TNT A;  2GXB A;  4G8X A;  3EET A;  1XDU A;  4NHJ A;  4HA8 A;  1Z6T A;  2XRN A;  4P9U A;  2AS5 F;  4CXF A;  2FBK A;  1O7F A;  4I09 A;  3J81 K;  3U9G A;  3RDI A;  1ZLJ A;  5DCF A;  3IL2 A;  5LHG A;  1J75 A;  2Q2E A;  3DKW A;  5L3D A;  4RB0 A;  1C0W A;  3RTR A;  1FZP B;  2EB7 A;  2JPB A;  1SMY F;  2FE3 A;  4UVC A;  1KA8 A;  1BBY A;  3DPL C;  1WWX A;  5A2Q K;  4HF0 A;  4RGU A;  2ADU A;  4B09 A;  3I71 A;  2ZCW A;  1BIA A;  1FY7 A;  3GFM A;  2MLK A;  4RAZ A;  2YR2 A;  4HAM A;  3GEZ A;  5DUK A;  3WOD F;  4A0X A;  1SD5 A;  5AIP A;  4AD9 A;  1FBU A;  3HRS A;  3BDD A;  5E1X A;  1FWZ A;  3GWZ A;  5JI6 A;  1IF1 A;  5A2Q Z;  2FEZ A;  3L2C A;  2LF8 A;  1DPU A;  5DD8 A;  3K2Z A;  3QPT A;  1SD6 A;  1WRJ A;  2LF7 A;  1W7P D;  1JHF A;  3F3X A;  3WGH A;  1HW5 A;  2FMY A;  2ESH A;  3FXQ A;  1F5T A;  1MKM A;  1XMA A;  1J2X A;  1ZRE A;  2RN7 A;  3WTT C;  3KP5 A;  3KCC A;  2KJB A;  2RKH A;  4CDG A;  1U5T B;  2EA2 A;  3Q9S A;  4LB5 A;  1SFU A;  2H27 A;  1W5S A;  1XSX A;  2L4A A;  3I59 A;  1R1U A;  2IJL A;  3GW2 A;  4GYG A;  2W85 A;  1SD7 A;  5HLI A;  1LEB A;  1EV7 A;  4A6E A;  2K86 A;  4Q47 A;  1IXC A;  2OU2 A;  1RZ4 A;  3FZV A;  3HSF A;  4HLY A;  3ISP A;  2X0L A;  5K1Y A;  3M1E A;  4IJA A;  3U2R A;  4BAY A;  5BS6 A;  4ENK A;  2IVM A;  2DW4 A;  2OBP A;  3T5X A;  2A07 F;  4YG2 F;  4RAY A;  1PDN C;  3EDP A;  3K1M A;  4ZYG A;  4LMY A;  5J8C A;  2BV6 A;  2OQG A;  2H94 A;  3V4G A;  4P5O A;  2XAS A;  5AIQ A;  1ZGA A;  2W84 A;  3R61 A;  1FNN A;  1HW1 A;  5JR3 A;  2ZNZ A;  1YO5 C;  1TTY A;  4M9X A;  3HSE A;  2HS5 A;  3ZN1 A;  1FPQ A;  4N0B A;  3G73 A;  1IUY A;  1R23 A;  3P9I A;  4I02 A;  2M45 A;  3HOS A;  3HRM A;  4R79 A;  4HF1 A;  2VBZ A;  3CUQ A;  2EFQ A;  3FF5 A;  3GLX A;  1Z91 A;  5D8K B;  3ROU A;  1REP C;  1B6A A;  3JSP A;  5D5V B;  4ASN A;  1FYK A;  2ISZ A;  2COM A;  4HDU A;  4HV5 A;  2XHK A;  2P6S A;  4HW0 A;  1U2W A;  3MFK A;  1ZG1 A;  3ZP5 A;  1W5T A;  2J5O A;  2FU4 A;  4GCV A;  3QAH A;  3QU6 A;  1RIO H;  2V1U A;  1LVA A;  3REO A;  1FC3 A;  3RKW A;  3T8T A;  4LGW A;  2E7X A;  3I53 A;  2L54 A;  1MJA A;  2QBY B;  2XGX A;  2UZK A;  1HST A;  5D6F A;  5EEH A;  4LK1 F;  4I2O A;  3ZMU A;  1R22 A;  1YS6 A;  3ZQ7 A;  3BP8 A;  1OYW A;  2DK5 A;  3ZMZ A;  4PDK A;  2YPR A;  2CFX A;  4EJT A;  2ELH A;  3QRF F;  2K4B A;  3HHH A;  2CO5 A;  3I59 B;  5F1R A;  1G3W A;  1G3Y A;  2LDU A;  3M8F A;  1S7O A;  2QQ9 A;  4M9Z A;  4O5V A;  3TO9 A;  1FSH A;  1YG2 A;  4AIJ A;  2HR3 A;  4O6J A;  4AIH A;  1T38 A;  1KYZ A;  3EYY A;  3TO6 A;  1MJ9 A;  3D0S A;  3ZMT A;  1TW3 A;  1O3Q A;  2G7U A;  1QQI A;  2ZXJ A;  2VC0 A;  3R6S A;  1OKR A;  1UFM A;  4WX9 A;  1DDN A;  4BHB A;  4IVN A;  3MCZ A;  1KQ8 A;  2FA5 A;  2HYG D;  2RQP A;  1PUE E;  5LGT A;  2GQQ A;  3GXO A;  4ZZD A;  4U0W A;  1U5T C;  4XSZ F;  3G3Z A;  2OAZ A;  1G3S A;  1BN5 A;  5LEJ A;  4L0Y B;  3F8B A;  1W7P B;  2CG4 A;  1WQ2 A;  1MD0 A;  5DD4 A;  4IXA A;  3BOQ A;  3DPT A;  4L0Z B;  4OIP F;  3LQR A;  4OOI A;  4UHT A;  4N9I A;  2H6C A;  1IN8 A;  3L7W A;  3ML6 A;  3EQL F;  2FNP A;  3QPH A;  3H3Z A;  1LEA A;  1BM9 A;  3K1P A;  2A3S A;  2X4H A;  4F7Z A;  3KZZ A;  2KJC A;  4RGS A;  1YFH A;  3RJP A;  5DEQ A;  1XN7 A;  2V6C A;  2UWM A;  1TBX A;  3RKY A;  5D5W B;  1UCR A;  2Z99 A;  4JBA A;  3CDH A;  1BI3 A;  2XUB A;  1I5Z A;  4UNO A;  2WWY A;  1FX7 A;  2O0Y A;  1IN5 A;  3KEQ A;  1D8J A;  2MC3 A;  3F23 A;  1B9N A;  2YU3 A;  1T6S A;  2QUF A;  3HTU A;  3HHG A;  1T39 A;  1Z05 A;  2XAF A;  2NS0 A;  3WTY C;  3M9A A;  1GHC A;  3CTA A;  4CZZ A;  4I0A A;  3FXU A;  2ZKZ A;  5E18 F;  5E1W A;  5H20 A;  1P4A A;  1P2F A;  3KP7 A;  4Y13 A;  1U3E M;  2H09 A;  1FBS A;  2A6E F;  2F5E A;  3JW4 A;  1B59 A;  3GX4 X;  3EYI A;  4MEX F;  3RPQ A;  3TOB A;  3TQN A;  2P5L C;  2K27 A;  3JSO A;  4ENN A;  3MEX A;  3WE3 A;  4LD5 A;  2NAZ A;  1S8N A;  3OOP A;  4A0Z A;  2OZ6 A;  3TGN A;  2YSR A;  3LAP A;  1IRG A;  4GXO A;  2P7V B;  2HYF A;  1QPM A;  3M7G A;  3E6C C;  4RGX A;  1T98 A;  4D0P A;  2KIF A;  1P6R A;  1B1B A;  4KIC A;  2HQN A;  3MQ0 A;  1XGS A;  3C3W A;  2MD5 A;  2QZ8 A;  3S2W A;  3GFJ A;  1STZ A;  2F5F A;  2ZBK A;  3O2P E;  4WXC A;  5CYV A;  5ICC A;  1YW9 A;  4FT8 A;  1SFE A;  1IN7 A;  4KDP A;  1BI1 A;  1SFX A;  3V8K A;  2A5Y B;  4O3M A;  3F8C A;  1R5H A;  1K7A A;  5D6E A;  3KLN A;  2L3D A;  4EV0 A;  4WXH A;  3R4K A;  3TDZ C;  4HOB A;  3NEU A;  1HQC A;  3HOT A;  3E6D A;  1EH7 A;  3FHZ A;  1E17 A;  5L3C A;  2A61 A;  4L5I A;  2RC4 A;  2EA4 A;  2Q0O A;  2M30 A;  3PQK A;  2ZME B;  1BOA A;  1MDM B;  1QBJ A;  3J81 Z;  1HKQ A;  3B02 A;  3KP6 A;  3F8M A;  2GAU A;  5CVR A;  1SD4 A;  2LNB A;  4NB5 A;  3LA3 A;  2QYO A;  4KN7 X;  1WI9 A;  4LLN A;  1EH8 A;  1QZZ A;  3CUQ C;  3CO7 C;  1OYY A;  4A5M A;  5D4S A;  4G9Y A;  1O57 A;  5CVV A;  2QBY A;  1KU2 A;  3KFW X;  3E5U A;  4AWX B;  3BJ6 A;  1HKS A;  1KU7 A;  4WCG A;  3K9T A;  2OA4 A;  3DV8 A;  4EGZ A;  3Q5F A;  3RKX A;  2V1X A;  5HS9 A;  4ESB A;  2JPC A;  5ILU A;  4EGY A;  3MAJ A;  2DLL A;  3K0L A;  4PCQ A;  3WE2 A;  2VT2 A;  6PAX A;  2VBX A;  4A6D A;  2WV0 A;  2P5V A;  5J6X A;  1Y0U A;  1HW2 A;  4BH9 A;  2NNY A;  1TQP A;  4CO8 A;  1KU3 A;  2XKO A;  2W24 A;  4QWQ A;  1R7J A;  2CSO A;  2PBI A;  1B4A A;  1KQ0 A;  3F8N A;  1IXR C;  5FFX A;  4JK1 X;  4CGZ A;  3IKT A;  1D8K A;  1ON1 A;  4KUM A;  1XSV A;  1FSE A;  4HV6 A;  2M5W A;  3BWG A;  5DCM B;  3KP3 A;  3BJO A;  5BPI A;  4EM1 A;  3E6M A;  3TO7 A;  3LFK A;  2IT0 A;  5DDG A;  4RGR A;  4M72 A;  3WTX C;  3TKY A;  2P8T A;  5HDK A;  2VBY A;  1Z9C A;  1F4K A;  3VEP A;  1XD7 A;  2FRH A;  1Z1D A;  2VC1 A;  4KMF A;  2D1V A;  2Z5U A;  4YIF A;  2FML A;  1W7P A;  3L00 A;  3SXY A;  4N9H A;  4OMZ A;  1LDJ A;  4BXU A;  1XCV A;  3VFZ A;  1I6X A;  1P92 A;  5E1Z B;  3N4M A;  3IRQ A;  3HYI A;  1FYM A;  5HOO A;  1CGP A;  2VOO A;  3RYR A;  2FF4 A;  1PP8 F;  1OR7 A;  2PG4 A;  1WKM A;  1YW8 A;  3E5Q A;  1XCB A;  3GF2 A;  1J7K A;  2QQA A;  2ZNY A;  3GFI A;  4L9J A;  4EVI A;  1QZY A;  3V7C A;  1TQM A;  2VOD A;  3GZ5 A;  3L09 A;  2HEO A;  4L18 B;  2JRT A;  1KGS A;  3BZ6 A;  2GZW A;  2MLG A;  4GO1 A;  2CYY A;  1XB4 A;  2A69 F;  5J8F A;  3O3K A;  5CVJ A;  4EMS A;  2F5D A;  5LEK A;  4FX0 A;  3ZMD A;  3WU1 B;  4BNC A;  1QO0 D;  1K79 A; 
#chains in the Genus database with same CATH topology
 4G6D A;  1R58 A;  1U9N A;  4OAY A;  5F1J A;  1SAU A;  4WWC A;  4KMU X;  4EJO A;  4J19 A;  3GTK J;  4XRF A;  2TDX A;  2JA5 J;  3GYH X;  4Q4Z F;  1OCP A;  5D5U B;  3E0J B;  1X1A A;  3PFI A;  1MGT A;  1OMI A;  1RET A;  2VON A;  4MQV A;  5HLH A;  2NVT J;  4U0V A;  1UHW A;  2GIV A;  3FXR A;  4XLC A;  2E71 A;  2HOA A;  3K4N A;  4DYQ A;  5BQT A;  3K6G A;  3COA C;  1UG0 A;  1BW5 A;  5HNF A;  2V9V A;  3P7N A;  2KL4 A;  4IHS A;  3CCU I;  2Q1Z B;  4TV7 A;  1BC8 C;  1FBQ A;  1KQ9 A;  2VXZ A;  3Q9V A;  4HX4 A;  5H6Q A;  4AIK A;  5F27 A;  3RPU D;  2HFH A;  2C6Y A;  4M3B A;  1NK3 P;  5GP9 A;  4EJV A;  2O3F A;  3DCF A;  4L5J A;  3AFH A;  1GVD A;  4ZYH A;  4DBQ A;  3F21 A;  1JT0 A;  2VJJ A;  5IY5 H;  2DN0 A;  2LMD A;  5CLS A;  5K5R A;  1IRX A;  3FMQ A;  1MBK A;  3A01 B;  5FFZ A;  5GTI C;  3ELK A;  2BBY A;  2LK2 A;  1IDZ A;  1Y8R B;  3DEE A;  3C7J A;  2L4M A;  1DUX C;  5CVI A;  3WGI A;  5D5X B;  1RPW A;  4CCK A;  1ZRF A;  2FSW A;  2CW0 F;  5HS8 A;  5J4V A;  2KT0 A;  2XC7 A;  1NHA A;  3OYI A;  4LG0 B;  3AG1 H;  2IA1 A;  1SVO A;  1H9G A;  1UZC A;  2ETH A;  2PJP A;  1YLF A;  5F64 A;  5LHH A;  3DQV C;  4RLF A;  3V8L A;  3H3U A;  5LRS A;  1ZG5 A;  1X1B A;  2QWW A;  1AWC A;  4II3 A;  1GLN A;  2DT5 A;  4XKC A;  5DUI A;  1IAW A;  3L1P A;  2FOK A;  3OL4 A;  3CCL I;  2UXN A;  2IAI A;  3GZ6 A;  2XGD A;  2BY3 A;  4XLA A;  2PMU A;  2LY9 A;  1ETO A;  3ABT A;  3C2G A;  1PYV A;  4OAZ A;  4M6Y A;  1JT6 A;  1D5Y A;  4BY1 J;  4MO7 A;  2CV2 A;  1M1E B;  1R36 A;  2AQE A;  1RUO A;  3S2H J;  1H89 C;  1T08 B;  4RBO A;  2OD5 A;  2V26 A;  1YI2 I;  2P5K A;  4EAT A;  1JTY A;  4QLC U;  1IW7 F;  3OYM A;  2W25 A;  4DOZ A;  4XIC A;  4ZDP A;  4ANJ A;  4KT6 A;  4C3H J;  4UV8 A;  1JTX A;  2BHZ A;  3BR3 A;  3J80 K;  4YFK F;  1RES A;  4MTE A;  5FLV A;  2EFO A;  2ISY A;  1X58 A;  4PJM A;  3ESW B;  4FX4 A;  1XTA A;  1G6N A;  4UB6 C;  1MIJ A;  1MH3 A;  4WXD A;  4UXN A;  2QGU A;  1SMT A;  1T2K A;  3T1B A;  1UB9 A;  2AO9 A;  4G94 A;  1OCO H;  4QPQ A;  3A03 A;  2DU9 A;  2IPQ X;  1F1Z A;  2LSO A;  3KLO A;  3MVP A;  4M3F A;  4U88 A;  2UXX A;  2M87 A;  1MJB A;  3ZMV A;  1R1V A;  1YIO A;  3BTL A;  2JA2 A;  2O8X A;  3CMY A;  2DA7 A;  2LBF A;  1F9N A;  2PLY A;  2B0L A;  2BXY A;  3SDB A;  3AL0 C;  3KP2 A;  3K1N A;  4E70 A;  3J80 Z;  2JUG A;  3BPV A;  3DP7 A;  2VQC A;  4XOT A;  3SHF A;  4EM0 B;  3DLA A;  3H0G J;  1KYW A;  1A6I A;  3ASN H;  2GA1 A;  2X9D A;  2ZME A;  4HX7 A;  1SC7 A;  2YX7 A;  1MDM A;  3IKV A;  4HF2 A;  2NYX A;  3J7A O;  1HKT A;  2JT1 A;  3QOP A;  3QU3 A;  1B8I A;  1MZB A;  5ICE A;  1LJ9 A;  1ZG3 A;  4X6A J;  3WHB A;  1YW7 A;  2R7X A;  2GOM A;  4A12 A;  1X3U A;  2L5Q A;  3TP0 A;  5ICG A;  4EM2 A;  1HLV A;  4CCM A;  1LKX A;  3CJR B;  3FM5 A;  4B8X A;  4MNU A;  2EWN A;  2NS8 A;  3HG9 A;  3VYT B;  2P0W A;  1RR8 C;  2D2W A;  2P7C B;  1QGP A;  3VYU B;  4XRM A;  1HC8 A;  4OIR F;  1SFK A;  2Y9Z A;  2LLK A;  3S17 J;  4UV9 A;  1A04 A;  5LFA A;  3GVA A;  2VAS A;  3QP6 A;  1GXQ A;  2HTJ A;  4KIG A;  4W1U A;  2BY1 A;  1VQ7 I;  2XF5 A;  3JRE A;  2VPL A;  4IO9 F;  2XRO A;  3PNY A;  4CHU A;  1ETK A;  3IRR A;  4E7H A;  4YFX F;  1P7J A;  1Y56 A;  2AXL A;  3VSK A;  4A0Y A;  4I0B A;  3NRV A;  3SQN A;  5F0H A;  2DI3 A;  2QM3 A;  3J7A Y;  4GDF A;  2I8D A;  1WHU A;  1FTZ A;  2HWV A;  5FLX K;  2OC6 A;  4L5E A;  4G7H F;  1T95 A;  3LSG A;  2CQK A;  1IN4 A;  2E7W A;  2QVO A;  3JAM K;  2ZO4 A;  1S6L A;  1UMQ A;  3CJN A;  4EEF G;  3QQA A;  2OPT A;  4PFO A;  4JOM A;  3SEZ A;  5GPA A;  4EJW A;  1U9O A;  3L2W A;  2EIL H;  4ZZL A;  3BG5 A;  1J5Y A;  3QWL A;  1XMX A;  1TLH B;  2R7R A;  4CIC A;  2CS3 A;  1A31 A;  4GRI A;  5TRD A;  2VB6 A;  1RI7 A;  4LLG F;  1JHH A;  4BDZ A;  3OS2 A;  1V54 H;  2Y30 A;  1SFO J;  5EGO B;  1DGW Y;  4IF4 A;  2R7O A;  2L02 A;  5FLX Z;  3F72 A;  2LKP A;  1WJA A;  2WAE A;  5BPD A;  4R8H A;  1ZN2 A;  2X6O A;  1YE9 A;  1QHG A;  2K7L A;  3JAM Z;  2ZFW A;  1YX5 A;  3WTS C;  2VUM J;  3KPH A;  3NWT A;  2GBY A;  4D5F A;  3BZK A;  2BEO A;  4U7B A;  4CCO A;  1QVT A;  2W82 A;  3LAJ A;  2FOW A;  1R00 A;  1ZAR A;  4FAS D;  3FK6 A;  3RIR A;  3ERM A;  2O6G E;  4A3B J;  4BJT A;  1YS7 A;  1K4T A;  3HSR A;  1WPK A;  5EF6 A;  4EJU A;  5KK1 A;  4U7D A;  3R0A A;  4DNC A;  5J1R A;  2NRA C;  5HDG A;  4MLO A;  5JFR A;  3U1D A;  2ZJ2 A;  3GO5 A;  2ZJQ F;  4PZJ A;  2R5Y B;  5EZG A;  4C30 A;  1Z77 A;  1S72 I;  3FDY A;  1YJ9 I;  3IC7 A;  3CCE I;  4QSH A;  1HDP A;  4IQJ A;  2MH2 A;  3CC4 I;  2DK8 A;  2YS9 A;  2Y48 A;  2GXA A;  1FP1 D;  1XSD A;  4IRH A;  4I01 A;  1QHH D;  3FMS A;  4RM3 A;  1V4R A;  3SZP A;  1QA6 A;  2VKH A;  1LDK B;  2IA2 A;  2VBW A;  3QOD A;  1AKH B;  1OCC H;  1S9H A;  3MZY A;  1IRZ A;  3BTI A;  1YYV A;  5DCM A;  3G2B A;  1USS A;  4XKB A;  3BG9 A;  4V2G A;  1BIB A;  4WF2 A;  2DQR A;  1ZEL A;  2D45 A;  1BI0 A;  5B3S H;  3LST A;  2MH9 A;  1Z67 A;  4HNT A;  1MBH A;  3S8P A;  5IYD J;  2K9N A;  4BXX J;  2DOD A;  1UAA A;  3DPU A;  3ZQG A;  4AC0 A;  4RB2 C;  1VQ4 I;  1XGM A;  3ZN0 A;  2MC4 A;  3LSJ A;  1FLI A;  1ZYR F;  1OPC A;  4FCY A;  3FKJ A;  2Y2Z A;  2E1M C;  2R7D A;  4G7Z F;  1FOW A;  5ILS A;  4AVP A;  1YTY A;  4PGH A;  4IRI A;  1K78 B;  1Z0X A;  3FHN A;  2KZV A;  2XIG A;  5DM6 F;  3Q0U A;  2EV0 A;  3W2A A;  3PQJ A;  1OCZ H;  2GIZ A;  2XAJ A;  4Y17 A;  1V3F A;  4IOC F;  3ABM H;  3SEQ A;  2MG4 A;  3F8F A;  2M8G X;  3SJM A;  1L0O C;  2W4S A;  2NVU B;  2Y0M A;  1OCR H;  2CUE A;  3E97 A;  3E6B A;  2JTV A;  1Z6R A;  3Q0V A;  2XPW A;  3G1O A;  4K2E A;  2Q8K A;  3FBI B;  4LIT A;  3TDU C;  3NAU A;  2PMH A;  2M4K A;  3LOC A;  5DV5 A;  5L3G A;  1AOY A;  2KIQ A;  2GWR A;  3W2W A;  2EZL A;  5IOY A;  3KET A;  2Y69 H;  4S05 A;  4NQW A;  4XK4 A;  2G7H A;  3KE2 A;  2RNG A;  3BPX A;  4MHG A;  5D4R A;  1MBE A;  2Y0S A;  3M1C A;  2HZD A;  3BZC A;  4ENJ A;  3W6K B;  1ZRC A;  2XV4 S;  2CQX A;  3ZPL A;  5LHI A;  1PUF B;  3DU6 A;  3BT9 A;  1ITY A;  5HDN A;  3DKY A;  3ONQ A;  2ACJ A;  3OR1 C;  4UVA A;  3RYP A;  3BLY A;  1OLT A;  5L3B A;  1MMS A;  3HDD A;  2HDW A;  3S32 A;  1O3S A;  4I7H A;  2L9S A;  1LNW A;  2BZT A;  4XN3 A;  1OCT C;  5IT9 K;  1FEX A;  3OYB A;  1XDS A;  1IN6 A;  3EUH A;  1BC7 C;  3CO6 C;  3LSI A;  4ZDO A;  2CFO A;  1N78 A;  2R7V A;  1ZHF A;  4LB6 B;  2M0M A;  4HST A;  2HOS A;  4RLQ A;  3HOW J;  3I0T A;  1FOX A;  4HEA 2;  1E0E A;  2JSP A;  5ILV A;  5CPR B;  4N4O B;  2DPU A;  3ECH A;  5M3F J;  5GPC A;  5B1B H;  2QF7 A;  5ED4 A;  2JJ7 A;  1VQ8 I;  2KIU A;  4RDU A;  4PUS A;  3G1L A;  5E20 A;  2XSJ C;  3HUG B;  3GTO J;  4UVB A;  4CH7 A;  5IT9 Z;  3I4N J;  1IXS B;  1ON2 A;  3LQQ A;  1IV8 A;  2EJR A;  1OR7 C;  1BR1 A;  5HVQ C;  3IAS 2;  2CUJ A;  4A3I J;  2KIM A;  4OIQ F;  1MMD A;  5F6F A;  4HQE A;  3KEO A;  3LWF A;  2ECB A;  4XM3 A;  5DYM A;  5FO5 A;  3FM3 A;  2LKS A;  1LUJ B;  3R0J A;  1ZAO A;  2HGC A;  3C2H A;  5HOD A;  4HDV A;  1L3L A;  3B6A A;  2R7Q A;  1IRF A;  2HU9 A;  2LRD A;  2HKO A;  2AXT C;  3P5J A;  1W0U A;  2RQQ A;  2EFP A;  2OF7 A;  3KZI C;  4NUB A;  3G71 I;  1OQY A;  4XL9 A;  2FD5 A;  4GYI A;  5BMZ A;  4U0Y A;  2XRL A;  4Y15 A;  1DPR A;  2EK5 A;  5E3N A;  1HBX G;  1FIP A;  2L7K A;  4MFE A;  2FBH A;  1Y8Q B;  3U21 A;  2D1H A;  3TOA A;  5CKT A;  1S29 A;  3G6E I;  1KZH A;  3LL7 A;  2DA4 A;  3CES A;  3C1D A;  2LP0 A;  2M7B A;  4KT5 C;  3CUO A;  3GME A;  4HG2 A;  2E1C A;  3OYJ A;  3BCB A;  3A01 A;  1X19 A;  3WG7 H;  2XKP A;  2H6B A;  2V7F A;  4L9N A;  4Z2Y A;  3I4P A;  1LE8 B;  5DS9 A;  1BA5 A;  1GVJ A;  3H5R A;  1CF7 B;  3VSL A;  1R4M B;  5JVT A;  1W36 C;  5KAI C;  1Q1H A;  2F5C A;  3ULQ B;  4YII A;  4DYR A;  4RB1 A;  1VI0 A;  1RKW A;  2EV5 A;  1MMN A;  4LG0 A;  5FRO A;  3AG2 H;  2A68 F;  5CJ9 A;  1BW6 A;  4G6Q A;  4BHP A;  2YX4 A;  5J3L A;  3DXJ F;  3I54 A;  5E3L A;  4CZC A;  3JRA A;  2KDZ A;  4IHX A;  5D8L B;  1BR2 A;  2DOE A;  3HRT A;  2STW A;  1J0R A;  4GGG A;  4XLN F;  2QLZ A;  2Y0S N;  4NNJ A;  3RZD J;  1EJ9 A;  3DF8 A;  2O61 A;  2QSF X;  2VPR A;  5EEA A;  1HDD C;  1VF9 A;  2XVC A;  4P9F A;  3VOE A;  1S7A A;  4M3D A;  1VQL I;  3IHU A;  3CME I;  4KNY A;  3KX2 A;  2E5Z A;  4ETS A;  3OSG A;  2Z16 A;  3HJE A;  2IA0 A;  1B9M A;  1I1G A;  1TZL A;  5ERI A;  3H5N A;  3N97 A;  1O3R A;  4QIW N;  2X48 A;  1V5G A;  3K4K A;  4ESJ A;  3PO3 J;  2WC2 A;  1J9I A;  4QTR A;  3F6V A;  3OS0 A;  1S3J A;  3A0B C;  2JZY A;  4Q48 A;  3ECO A;  4I98 B;  3X2Q H;  1GV5 A;  4FQG A;  5K5Q A;  3PJR A;  1W4M A;  3OS1 A;  1ZGJ A;  3A4C A;  3CQZ J;  4HQM A;  2Q2E B;  2Z3Y A;  4DBR A;  2VJ5 A;  2VLA A;  4JQF A;  4DGW B;  4ZYA A;  2QEX I;  2F2E A;  5M5W J;  3BRO A;  4R1H A;  2UV1 A;  2VQG A;  1XGO A;  1YX3 A;  3F22 A;  3H9Q A;  3HOU J;  3ERE D;  5J1U A;  3FWE A;  4ZTF A;  2FJ1 A;  2HYJ A;  4ZYD A;  1ETY A;  3C18 A;  3ZQL A;  4MEY F;  3M8E A;  2KKO A;  4XRS A;  4XID A;  4FIS A;  1X4O A;  4PGG A;  1O7L A;  1IUF A;  4LJZ F;  2DTR A;  2CQ7 A;  1W0T A;  1K6O A;  5KHD A;  4DW6 A;  2DMQ A;  4OU0 A;  2EV6 A;  5CVU A;  1K6Y A;  2BGC A;  2NOG A;  1J59 A;  4P96 A;  3MKY B;  1JGS A;  4G7O F;  2IBD A;  2OCE A;  2CUZ A;  2DO7 A;  1POG A;  3L9F A;  4HYE A;  2MA3 A;  2GA2 A;  1R49 A;  1ACI A;  1FP2 A;  3GUD A;  2PFB A;  5FB2 A;  3GTJ J;  2KPM A;  2XAH A;  2EFN A;  4HLX A;  3W6V A;  1FTT A;  1WGX A;  1VQ5 I;  5L3F A;  2WV1 A;  1GXP A;  4HX8 A;  4B43 A;  3ABL H;  1TQI A;  4BJ6 C;  5C44 J;  3GTQ J;  2R7U A;  4W97 A;  5E17 F;  2K3P A;  4PJL A;  2DT7 B;  1ZLK A;  2CJJ A;  3I64 A;  1FYL A;  4B3X A;  3M4O J;  3V7R A;  3O6B B;  3BG3 A;  2P4W A;  4NC7 A;  4AID A;  1LDD A;  1GDT A;  3HOZ J;  2VQH A;  3B6C A;  3K70 D;  4EQQ A;  1RUN A;  3GBG A;  1A6Q A;  2R7F A;  2RAE A;  3CP8 A;  2NVX J;  2ZME C;  5KVR A;  3K4C A;  4NC8 A;  2VL8 A;  3WTZ A;  1ETW A;  3AAF A;  2DAO A;  2HZT A;  4F55 A;  4OIN F;  2A6H F;  3I58 A;  4YRV A;  4YFN F;  3K2A A;  3F6O A;  4A3L J;  4KN4 X;  2VN2 A;  2ELK A;  3CZ6 A;  3V7S A;  3O8G A;  4HZF A;  5HS7 A;  2FUG 2;  3SYT A;  5FD6 A;  1BI2 A;  4CCL A;  4BHC A;  2L2O A;  5EG0 B;  1W1W E;  3WTU C;  2XAG A;  5CQG A;  3JRD A;  2M7A A;  3IWF A;  2VE9 A;  1U78 A;  2DOA A;  3LA7 A;  1ODD A;  2G9W A;  2VE8 A;  2Z2S B;  1I39 A;  4ESF A;  5E8I A;  4Q5S F;  4XON A;  3B73 A;  1BL0 A;  3RI4 A;  2Y75 A;  4S04 A;  4L9T A;  2HPI A;  2TCT A;  2CGP A;  2LG4 A;  2XAQ A;  1T0F A;  5EGO A;  1U0J A;  1BJA A;  3JRG A;  2STT A;  3R60 A;  5F0C A;  2DFF A;  4MTD A;  3EUK L;  1TNS A;  3CCQ I;  3KZY A;  3DFG A;  3BY6 A;  2F6C A;  2WTE A;  3W6J B;  1IJW C;  1ZRD A;  2VOP A;  2PQ8 A;  1LB2 A;  3SFZ A;  4ENM A;  5FKM A;  3S16 J;  3U1K A;  1HSJ A;  2X1E A;  3WTV C;  3MKZ A;  4PSX A;  3FBN B;  1WJE A;  3P9C A;  4ZH4 F;  2EFW A;  2FQ3 A;  2MBF A;  1JJ8 C;  2DA6 A;  3BR6 A;  4ITV A;  2H8R A;  5L3E A;  2L01 A;  5F04 A;  2P6T A;  2L7M P;  3BTJ A;  4BGD A;  1TW2 A;  3OL3 A;  1O3T A;  1TC3 C;  2KRC A;  1HXD A;  1FOK A;  2H8W A;  2HOE A;  4KA4 A;  4KFC A;  2E5N A;  4ON0 A;  2K9L A;  3HEF A;  3K69 A;  5EEG A;  3F0C A;  1E3P A;  2R5Y A;  2ESN A;  4JX5 A;  2PEX A;  2A6T A;  2XF6 A;  4J00 A;  2R93 J;  2DYR H;  1U8R A;  1P9Q C;  1D5V A;  2KIS A;  3ZMS A;  4FTH A;  2K02 A;  4KJZ A;  1UST A;  3LA2 A;  2M8E A;  2V79 A;  5JHU A;  1KU9 A;  3VOD A;  2QQB A;  4XLP F;  5M3M J;  1G4D A;  2R7T A;  5K5O A;  2W57 A;  1VND A;  2FNA A;  3WU0 A;  3DLL F;  1R4N B;  3MWM A;  3GFL A;  4RMN A;  4DQ2 A;  2J5P A;  1AKH A;  5LBQ A;  5HLG A;  4E7K A;  4L9V A;  3Q0W A;  2W00 A;  3VB2 A;  3TW6 A;  5IT3 A;  2JA6 J;  3QP5 A;  4B48 A;  4LFU A;  1P4X A;  1R1T A;  5JHF A;  3ZQC A;  3H92 A;  2JSC A;  1NG6 A;  2VT3 A;  3ZQF A;  3CUQ B;  4V2F A;  4ZTJ A;  5TJJ A;  3FMR A;  2HTS A;  2KRF A;  1X2N A;  3CJQ B;  4CCN A;  2DXI A;  3OYG A;  3NQO A;  2FXA A;  4DZP A;  2CU7 A;  2IP2 A;  2GXG A;  3GCM A;  5LGN A;  1QRY A;  1H9T A;  1JI8 A;  4UUS B;  4P55 A;  4IX7 A;  3DTI A;  2QSH X;  1I27 A;  2DMP A;  3JTG A;  4JX6 A;  5JVG F;  4JYK A;  4LK0 F;  1PP7 U;  1K78 A;  2HNH A;  5CQE A;  3RQ4 A;  3FX3 A;  1WH7 A;  2XPV A;  4FHT A;  5FD5 A;  1XGN A;  3IWZ A;  4CYD A;  4I76 A;  1HOM A;  2DPD A;  3UR3 C;  3BJA A;  3LSK A;  3WG9 A;  1JUP A;  1Z7U A;  3P9K A;  1FMW A;  1XMK A;  2BE5 F;  2DFI A;  3T0Y A;  5M5Y J;  4FE7 A;  4MGR A;  1IDY A;  1DQU A;  1I1S A;  1ETX A;  3V42 A;  3ZGK A;  2B7E A;  4IPA A;  4M73 A;  3RPU A;  2R0Q C;  1G2H A;  1JUS A;  3DBH B;  2DQL A;  2RNJ A;  3OYE A;  1VTN C;  1YRN B;  3M3Y J;  2M0C A;  5FGM A;  5LRR A;  4H0E A;  4RM2 A;  2Z9O A;  1R5G A;  1ONV A;  3HRU A;  4MQ9 F;  1WJD A;  3CCJ I;  1I6H J;  1SAX A;  4BJ5 C;  4KIB A;  4BKX A;  1Y1W J;  2HDC A;  1MH4 A;  2R3S A;  3ABU A;  1PUF A;  1ZH5 A;  1RNL A;  5K7H A;  5JLW A;  4RS8 A;  3ZCO A;  2DA1 A;  3EUA A;  1P7I A;  4BE1 A;  3E3V A;  3WGG A;  1IGN A;  3S1N J;  3PO2 J;  3ZQH A;  2IGN A;  1SAN A;  4XBF A;  1OYI A;  1YQA A;  2LY2 A;  1JXS A;  2DBB A;  1G3T A;  1LQ1 A;  2RV8 A;  3PFY A;  3HXL A;  2BY0 A;  1P4W A;  2HQR A;  2UUZ A;  3I4M J;  1A36 A;  4A69 C;  4OIO F;  2M1B A;  2Y9Y A;  5B66 C;  4HBL A;  2IRF G;  3DEU A;  4PK4 A;  2NNN A;  1ZTR A;  1HF0 A;  2R5Z B;  3HUG A;  4OMY A;  4E7L A;  3OIP A;  2DCE A;  1LFU P;  2E2H J;  3JTH A;  3T8R A;  3ZQI A;  3SZT A;  2IS2 A;  4XN0 A;  4M74 A;  4JX4 A;  2H1L A;  4II2 A;  1MSE C;  4A2U A;  1RKT A;  3D5L A;  2AHQ A;  3VYS B;  1Z21 A;  1R71 A;  3LSR A;  3H36 A;  2RVC A;  1TWH J;  4A5N A;  3EUH C;  3K4J A;  5LD2 C;  1HA8 A;  2EQR A;  4M9S A;  4A3J J;  4C2M J;  2BYV E;  3KP4 A;  4XSX F;  3TED A;  2E1N A;  3MKL A;  5H6R A;  5LLQ A;  1IZ1 A;  3DTE A;  1T56 A;  2OQR A;  3WTW C;  3CP2 A;  1U5T A;  1H0M A;  2O03 A;  2RGV A;  4FET A;  1DP7 P;  1ULY A;  2IS1 A;  3PUB A;  4PJN A;  4KYW A;  4BAC A;  4WK8 F;  4ZYE A;  4UUV A;  4BE0 A;  2ME6 A;  5IP6 A;  4HPQ A;  3V8J A;  1WSU A;  4PJ0 C;  2ZJP F;  1UG2 A;  2ECC A;  4XKW A;  4IRG A;  3BQZ A;  2WAF A;  3HTS B;  3CCV I;  3DBR B;  3QYF A;  4XKV A;  1PVE A;  3OV8 A;  4J01 A;  4CSW A;  4BYY A;  1UHM A;  2QEN A;  4M6X A;  5BOX A;  4LLL A;  2FBI A;  1EH6 A;  1FT9 A;  1X3Z B;  5AON A;  3CLO A;  2V1D A;  3HIF A;  2K4J A;  3MZH A;  1LE8 A;  4HRI A;  1RRJ A;  2BXZ A;  4RB3 C;  1CF7 A;  1QNT A;  5C4X J;  5ICF A;  2X85 A;  5GAH J;  1D3Y A;  3LNQ A;  3H3V K;  5FKL A;  2HXO A;  3HPH A;  1JE8 A;  2BY2 A;  1U6G A;  2IW5 A;  5E8G A;  1O4X A;  4KIF A;  2RDP A;  3MKW B;  2OZU A;  2Z33 A;  2IGM A;  2CWE A;  5FRM A;  4BQA A;  2PI0 A;  3PSI A;  3I5U A;  2VIX A;  4F3Q A;  2PN6 A;  5LGU A;  3OWT A;  2JVG A;  3MN2 A;  4M71 A;  2HKX A;  4IHT A;  1E2X A;  2LOO A;  5GAD J;  3E5X A;  1TNT A;  2GXB A;  4G8X A;  3EET A;  1XDU A;  2EIK H;  4S0H B;  4NHJ A;  3BR0 A;  5FRN A;  2L7Z A;  4HA8 A;  1TL8 A;  1Z6T A;  2XRN A;  4P9U A;  2AS5 F;  4CXF A;  3BQY A;  2HQ5 A;  1NG7 A;  2FBK A;  2HVS A;  1O7F A;  4I09 A;  2QCO A;  2K5C A;  3J81 K;  1X3W B;  3U9G A;  3RDI A;  1ZLJ A;  5DCF A;  3IL2 A;  4NDL A;  5LHG A;  1ZR2 A;  2WAQ A;  1J75 A;  2Q2E A;  3ABK H;  3DKW A;  4BQO A;  5L3D A;  2QKM B;  3FXL A;  4RB0 A;  1C0W A;  3GTG J;  1D0X A;  2JK3 A;  3RTR A;  1YJW I;  2ZXI A;  3DEW A;  1FZP B;  1XPX A;  1YOV B;  2EB7 A;  2JPB A;  4DIQ A;  1SMY F;  2FE3 A;  4UVC A;  5FKO A;  1KA8 A;  3RCO A;  1BBY A;  3DPL C;  4A3E J;  1WWX A;  5A2Q K;  4AUX A;  4HF0 A;  2O5R A;  2K9S A;  4RGU A;  1JGG A;  2ADU A;  4B09 A;  2W1O A;  2DA2 A;  3I71 A;  2ZCW A;  1BIA A;  2V6E A;  2R7S A;  1FY7 A;  1JJ6 C;  3GFM A;  2MLK A;  1YHQ I;  4RAZ A;  2LVS A;  2YR2 A;  4HAM A;  3GEZ A;  1X1P A;  5DUK A;  3WOD F;  4D7M A;  2IS4 A;  2IGO A;  4A0X A;  1SD5 A;  5AIP A;  1JKP C;  1ENH A;  4AD9 A;  1FBU A;  3HRS A;  3BDD A;  5E1X A;  3NWS A;  4BS9 A;  1AHD P;  1FWZ A;  1WJB A;  4GFB A;  4AYB A;  3GWZ A;  5JI6 A;  2F48 A;  1IF1 A;  2X6X A;  5A2Q Z;  2FEZ A;  3L2C A;  1ZGW A;  1SEU A;  2W7N A;  1MBJ A;  1Z7L A;  2LF8 A;  1DPU A;  4IOA F;  3BR2 A;  4B3A A;  4IZZ A;  5DD8 A;  2V4J C;  3K2Z A;  2VQL A;  3QPT A;  5DM7 F;  2XSD C;  3KEY A;  4A3M J;  5IPA A;  1SD6 A;  1WRJ A;  1XG1 A;  2LF7 A;  1W7P D;  1JHF A;  3F3X A;  3VWB A;  4BBR J;  3WGH A;  1HW5 A;  2FMY A;  4IEJ A;  2O7O A;  3HZJ A;  3AG3 H;  4BQQ A;  3NAR A;  1TWA J;  2JVH A;  5C4J J;  2ESH A;  3FXQ A;  1F5T A;  1D1B A;  1MKM A;  1XMA A;  1J2X A;  4XOR A;  4C9Y A;  2OV7 A;  2BW3 B;  3SZG A;  2CQN A;  1ZRE A;  3GTL J;  2RN7 A;  3WTT C;  3KP5 A;  2FQ4 A;  3KCC A;  1A5J A;  2KJB A;  2RKH A;  1WH5 A;  4CDG A;  2EIN H;  2DYS H;  1U5T B;  1WJF A;  2EA2 A;  3TMO A;  2QA4 I;  1EF4 A;  3Q9S A;  2K85 A;  5EG0 A;  1VQ6 I;  2ZXH A;  4LB5 A;  1SFU A;  4MIM A;  1N75 A;  2NOJ B;  2H27 A;  1W5S A;  1XSX A;  2L4A A;  1XX5 A;  1R1U A;  3I59 A;  2IJL A;  3GW2 A;  5FLM J;  5KCM A;  1NK2 P;  1QU3 A;  2MGQ A;  4GYG A;  2W85 A;  2MFZ A;  1SD7 A;  3PIO F;  1BOB A;  2EIM H;  4CYC B;  3K4L A;  5HLI A;  1LEB A;  3HGY A;  1A35 A;  3PNV A;  1ETV A;  3HKZ A;  1EV7 A;  2LR8 A;  4A6E A;  2K86 A;  3KYC B;  4Q47 A;  1IXC A;  2OU2 A;  1RZ4 A;  2CQQ A;  1MND A;  3FZV A;  3HSF A;  3QOE A;  3RZO J;  1EA3 A;  4HLY A;  3CDI A;  3ISP A;  3CCR I;  5K7F A;  3D5S C;  2X0L A;  3VYR B;  5K1Y A;  4YIR X;  3M1E A;  1JKR C;  2MD0 A;  4H4K C;  4IJA A;  1SVM A;  4PFP A;  3U2R A;  2IVM A;  2ZXW H;  3ZOB A;  4BAY A;  5BS6 A;  4ENK A;  2DW4 A;  4YEJ A;  2OBP A;  1G59 A;  2WAQ N;  3T5X A;  2A07 F;  4YG2 F;  1TWC J;  4RAY A;  3E1S A;  3EDP A;  3KYD B;  3K1M A;  1PDN C;  4ZYG A;  3OR2 C;  4LMY A;  3PUF A;  4C2T A;  5J8C A;  2BV6 A;  3OIQ A;  3CMA I;  2OQG A;  2H94 A;  3V4G A;  3AL0 B;  5EYR A;  3BR5 A;  4P5O A;  2XAS A;  5AIQ A;  2ZSI B;  3CC7 I;  1ZGA A;  2W84 A;  2G0E A;  3R61 A;  1FNN A;  5J47 A;  3J7Z I;  2W48 A;  4I99 C;  2XPU A;  1T0F C;  1HW1 A;  3MZ8 A;  5JR3 A;  2ZNZ A;  4C2U A;  1YO5 C;  1KON A;  1TTY A;  4M9X A;  2LH9 A;  3HSE A;  4XLF A;  2HS5 A;  3ZN1 A;  1FPQ A;  4N0B A;  1W36 D;  3G73 A;  1IUY A;  4RAG A;  1SVL A;  1H88 C;  1R23 A;  3RKQ A;  3P9I A;  4I02 A;  2M45 A;  3HOS A;  1S7E A;  2V9K A;  3OYN A;  4JP0 A;  3HRM A;  1DGR M;  1WJC A;  4R79 A;  4AYB N;  4HF1 A;  2ZB9 A;  2ELJ A;  2VBZ A;  3CUQ A;  4P1W A;  1Y39 A;  5KNL A;  4RAF A;  2E2I J;  2EFQ A;  5IOZ A;  3FF5 A;  4FE4 A;  3GLX A;  1Z91 A;  1FMV A;  3OYL A;  3JR9 A;  2OCC H;  1TWG J;  3WU2 C;  5D8K B;  3ROU A;  1REP C;  2NXN B;  3ZR8 X;  1B6A A;  3JSP A;  4Y7N J;  2DDB A;  2I10 A;  5D5V B;  4ASN A;  4UUS A;  1FYK A;  2L9N A;  1PJR A;  2ISZ A;  2COM A;  2CW8 A;  4HDU A;  4HV5 A;  2XHK A;  2P6S A;  4HW0 A;  3HPG A;  5K7Z A;  5H2F C;  2OTL I;  2COB A;  4F52 A;  1U2W A;  3MFK A;  1ZG1 A;  1D0Y A;  4D9J A;  1W5T A;  3ZP5 A;  3K4B A;  1B72 B;  2J5O A;  1IV6 A;  2FU4 A;  4GCV A;  1F43 A;  2KFD A;  3QAH A;  2M3A A;  3QU6 A;  1RIO H;  2V1U A;  1Y6I A;  1LVA A;  3REO A;  2DFH A;  3CJT B;  5F0F A;  1FC3 A;  4G12 A;  3RKW A;  4IHV A;  3T8T A;  2X6Y A;  2ZSH B;  1WVR A;  1AU7 A;  1YRN A;  4LGW A;  5GAG J;  2E7X A;  3I53 A;  4X1E A;  4E7S A;  2L54 A;  1MJA A;  2KZG A;  4BU2 A;  4F92 B;  4AU7 A;  2QBY B;  2EPF A;  2CH0 A;  5E79 C;  3PNT A;  2L7F P;  3HKZ N;  2K9Q A;  2XGX A;  1VQM I;  2UZK A;  1HST A;  1Y1V J;  3S1M J;  3QYE A;  2LFB A;  5D6F A;  5EEH A;  2A05 A;  4LK1 F;  2LY1 A;  3JCU C;  4I2O A;  2L9V A;  3ZMU A;  1R22 A;  1VFC A;  1YS6 A;  4IQ4 A;  3GTP J;  3ZQ7 A;  4HNU A;  3BP8 A;  3O8H A;  3M8J A;  1OYW A;  2DK5 A;  1DU6 A;  3ZMZ A;  2AQF A;  2KRH A;  4PDK A;  2YPR A;  4U87 A;  4Y33 A;  2CFX A;  4EJT A;  2ELH A;  3QRF F;  3BC8 A;  2K4B A;  4NBQ A;  3HHH A;  2CO5 A;  1X1C A;  3I59 B;  3CLQ A;  5F1R A;  2R5Z A;  1K4S A;  5FJ8 J;  3CCM I;  1G3W A;  1G3Y A;  4D7N A;  1MMA A;  4B1R A;  3H5A A;  4F93 B;  2LDU A;  3CMM A;  1OIS A;  3LSH A;  4RA2 A;  2WY8 Q;  2VI6 A;  3M8F A;  3BCA A;  1S7O A;  2QQ9 A;  5KAF C;  3HOX J;  4M9Z A;  4O5V A;  2IGK A;  3TO9 A;  3GLL A;  3GZN B;  5C3E J;  1MBG A;  1MNE A;  2D5V A;  1FSH A;  2JWT A;  1YG2 A;  2DFE A;  4CUG A;  4AIJ A;  2JA8 J;  3ZQQ A;  2E35 A;  2HR3 A;  4O6J A;  4AIH A;  5IYC J;  1T38 A;  3HB9 A;  3H9J A;  3PSF A;  4BL0 B;  1K61 A;  1KYZ A;  1TT0 A;  2BOL A;  3A1Y A;  3EYY A;  3TO6 A;  2M4G A;  1MJ9 A;  1UJ8 A;  3D0S A;  3ZMT A;  3I55 I;  1TW3 A;  3H35 A;  2E1M B;  3FKI J;  1O3Q A;  3LSM A;  4BEH A;  2G7U A;  2CRG A;  1QPI A;  3HOY J;  3CC2 I;  1QQI A;  2ZXJ A;  2VC0 A;  2BVM A;  2KMU A;  2X1C A;  1G8X A;  5TIS C;  3R6S A;  1OKR A;  1UFM A;  4WX9 A;  4ZJZ A;  1DDN A;  2DDA A;  4XRS G;  2CW7 A;  4BHB A;  3CCY A;  4IVN A;  3MCZ A;  3JRB A;  2PX9 A;  1KQ8 A;  2PJR B;  2R7W A;  3FIW A;  2FA5 A;  2HYG D;  2XAU A;  2RQP A;  1OFC X;  1PUE E;  5LGT A;  2GQQ A;  3GXO A;  4ZZD A;  2M9H A;  1R5I D;  3HBL A;  4U0W A;  2EH3 A;  3ASO H;  1U5T C;  1V5F A;  3S3N A;  3CD6 I;  3BG6 A;  1Q1V A;  3CF2 A;  4XSZ F;  3G1M A;  3G3Z A;  1FOY A;  2OAZ A;  2KP6 A;  2QQ8 A;  1G3S A;  3K10 A;  5FKK A;  1BN5 A;  5LEJ A;  1W5C C;  4L0Y B;  3HGG A;  3F8B A;  1W7P B;  2CG4 A;  3DKX A;  1WQ2 A;  3IH3 A;  1MD0 A;  1IC8 A;  5BNG A;  5DD4 A;  4IXA A;  1T33 A;  3BOQ A;  3DPT A;  2O8K A;  4L0Z B;  4OIP F;  2L0K A;  4IL6 C;  5IP9 J;  3D5R C;  3LQR A;  4OOI A;  4UHT A;  4N9I A;  2H6C A;  5E3O A;  1IN8 A;  3L7W A;  3ML6 A;  3HL2 A;  4BBS J;  1D1C A;  3EQL F;  5IP7 J;  2FNP A;  3QPH A;  3H3Z A;  1LEA A;  2OJE D;  3OSF A;  1LFB A;  3MMY B;  1DU0 A;  1BM9 A;  4XNF A;  3K1P A;  3H0D A;  2A3S A;  2XF7 A;  2X4H A;  4F7Z A;  1LFP A;  3KZZ A;  2KJC A;  4RGS A;  3RSN A;  2M2E A;  1YFH A;  2EIJ H;  3OIO A;  5DEQ A;  3RJP A;  3TL4 X;  1XN7 A;  2V6C A;  2V1N A;  2UWM A;  1X4P A;  1TBX A;  1CQT A;  3RKY A;  4LIV A;  5D5W B;  1UCR A;  2Z99 A;  4JBA A;  1NTC A;  3CDH A;  1FIA A;  2DJI A;  1BI3 A;  2JRM A;  2XB5 A;  1VQK I;  1MNM C;  2XUB A;  1I5Z A;  4UNO A;  3BG7 A;  4XLE A;  2WWY A;  4A3C J;  1FX7 A;  2O0Y A;  1IN5 A;  3KEQ A;  2E19 A;  1D8J A;  2MC3 A;  3F23 A;  1B9N A;  2YU3 A;  3IV5 A;  1T6S A;  2QUF A;  1ERD A;  1JUM A;  2IXS A;  3HTU A;  2XGE A;  3HHG A;  1T39 A;  3C2B A;  1Z05 A;  2XAF A;  2ME0 A;  5J1Y A;  4A3K J;  2NS0 A;  3WTY C;  1X1D A;  3M9A A;  4B44 A;  4E7J A;  2PMZ A;  1WFX A;  3JRI A;  3N05 A;  2DTZ A;  1GHC A;  3CTA A;  2K40 A;  4CZZ A;  4I0A A;  3FXU A;  4UY8 I;  2JMW A;  2ZKZ A;  5E18 F;  9ANT A;  5B5E C;  5E1W A;  3F9K A;  5H20 A;  1ZK8 A;  1H8A C;  1Z3Y A;  3KIO A;  1T8I A;  1P4A A;  2HPM A;  2TRT A;  1P2F A;  3KP7 A;  3AG4 H;  3W3C A;  4PJJ A;  4Y13 A;  4PSW A;  1U3E M;  2H09 A;  2E34 A;  1FBS A;  2A6E F;  3A2K A;  2WY7 Q;  2F5E A;  3JW4 A;  1B59 A;  3HM5 A;  3GX4 X;  3EYI A;  5EJC A;  3RPQ A;  3TOB A;  3TQN A;  4MEX F;  2P5L C;  4XLH A;  1X2M A;  2E60 A;  2K27 A;  4C3I J;  2F4M B;  3JSO A;  4ENN A;  1S5L C;  3MEX A;  4LOC A;  3WE3 A;  4LD5 A;  2NAZ A;  1N25 A;  1S8N A;  2K9M A;  2BW3 A;  4AVZ A;  3OOP A;  4A0Z A;  1OJL A;  2OZ6 A;  3TGN A;  4XQF A;  5B1A H;  2YSR A;  1U8B A;  4D5C A;  3LAP A;  1LPQ A;  4KIT B;  2MAB A;  1IRG A;  4GXO A;  2P7V B;  2HYF A;  1QPM A;  3HC7 A;  3M7G A;  3E6C C;  1TT5 B;  4RGX A;  1BR4 A;  1ZQ3 P;  4BEH B;  3S3O A;  1D1A A;  2WB1 A;  1T98 A;  4D0P A;  4CYC A;  3LSP A;  1VZ0 A;  4A3F J;  2KIF A;  1P6R A;  1Y0N A;  1B1B A;  4KIC A;  2HQN A;  3MQ0 A;  5E3M A;  3UKG A;  2VJ4 A;  1XGS A;  3C3W A;  4E7Z A;  1F36 A;  4E6K G;  2MD5 A;  2QZ8 A;  3S2W A;  2A5W A;  3GFJ A;  1STZ A;  5TGT A;  3K4M A;  2JUC A;  2F5F A;  2XB0 X;  3CF5 F;  2ZBK A;  1JKQ C;  1VQ9 I;  2HVQ A;  3O2P E;  4WXC A;  3S14 J;  4M3E A;  3OY9 A;  3IAM 2;  3A0H C;  5CYV A;  5ICC A;  3S1R J;  1YW9 A;  4FT8 A;  3HOV J;  1SFE A;  1IN7 A;  4KDP A;  1BI1 A;  1V5E A;  2V9P A;  2WBM A;  3L2Q A;  1SFX A;  3V8K A;  2A5Y B;  2DA5 A;  3F8C A;  4O3M A;  1R5H A;  2GM4 A;  1K7A A;  5D6E A;  3IH4 A;  3LFU A;  3CDL A;  2MYS A;  3OMY A;  2LC2 A;  2R4G A;  2HQA A;  1WCM J;  3KLN A;  2HVR A;  3AKZ A;  2ZJR F;  2L3D A;  4EV0 A;  2EZH A;  1APL C;  4M3G A;  1MW7 A;  3OOU A;  4WXH A;  2RRE A;  2XGC A;  2HDD A;  3S15 J;  3R4K A;  2ZC2 A;  2PMZ N;  3TDZ C;  4HOB A;  3NEU A;  1XC5 A;  4NC6 A;  4ZDL A;  2IS6 A;  3OYK A;  1ORK A;  1LVK A;  1HQC A;  1JKO C;  2O9L A;  3TP3 A;  2NVQ J;  3HOT A;  3E6D A;  4UB8 C;  1EH7 A;  2LBF B;  2NS7 A;  3FHZ A;  1UEL B;  4C3J J;  3PL8 A;  1E17 A;  5L3C A;  2HOT A;  4Y52 J;  1Z3X A;  5IYB J;  2A61 A;  4L5I A;  2RC4 A;  2F4O B;  2EA4 A;  2Q0O A;  4XMY A;  2M30 A;  3PQK A;  2B63 J;  2ZME B;  1BOA A;  1MDM B;  1QBJ A;  3EPZ A;  5EDN A;  3J81 Z;  1B8I B;  2VKD A;  1HKQ A;  2R92 J;  3B02 A;  4A3D J;  1I50 J;  3FXJ A;  3KP6 A;  3F8M A;  3OYF A;  2H1K A;  5J40 A;  2GAU A;  5CVR A;  3VDX A;  3L2R A;  1SD4 A;  2LNB A;  2GOX B;  4NB5 A;  4BQN A;  2X1D A;  1B72 A;  2CV0 A;  3LA3 A;  3PM1 A;  3IH2 A;  4DYC A;  2QYO A;  4KN7 X;  4G6T B;  1WI9 A;  3S1Q J;  4LLN A;  3Q3S A;  2YUS A;  3JRF A;  1EH8 A;  1QZZ A;  3CUQ C;  1WI3 A;  3CCS I;  3CO7 C;  1OYY A;  4A5M A;  4N4N B;  4Y4R A;  3L2U A;  2JA7 J;  5D4S A;  3FXM A;  4G9Y A;  3GTM J;  1O57 A;  5CVV A;  4ABZ A;  3OYC A;  3FXK A;  4LIU A;  3S93 A;  5F08 A;  2WB1 N;  3M07 A;  2QBY A;  1KU2 A;  1E3H A;  4M6V A;  1WZ2 A;  4DJA A;  3KFW X;  2XDV A;  3E5U A;  3SFI A;  1ETQ A;  3UNG C;  4AWX B;  3BJ6 A;  1HKS A;  1KU7 A;  1TWF J;  2X51 A;  3TBI A;  4WCG A;  3BTC A;  3K9T A;  1YIT I;  1GUU A;  4QPO A;  2OA4 A;  3DV8 A;  4YEL A;  4B4C A;  3J7Y J;  1HCR A;  3I3L A;  4IKF A;  4XOP A;  1MBF A;  4EGZ A;  3Q5F A;  5GTH C;  3JRH A;  3RKX A;  2V1X A;  5HS9 A;  3D1N I;  3A02 A;  4ESB A;  2JPC A;  5ILU A;  4EGY A;  2LD5 A;  3QYB A;  3WHC A;  1R9T J;  3LMM A;  1NH3 A;  3MAJ A;  2DLL A;  4F91 B;  3OYH A;  3K0L A;  2NVY J;  4PCQ A;  3WE2 A;  2FX0 A;  2VT2 A;  3S3M A;  4A93 J;  6PAX A;  2F4I A;  2VBX A;  3H9G A;  1MMG A;  1MSF C;  3DWL E;  4B47 A;  4DZJ A;  2LTP A;  2MSY A;  4OWR B;  1XS9 A;  4A6D A;  4MFD A;  2WV0 A;  2BHY A;  1IO2 A;  2P5V A;  5J6X A;  1Y0U A;  5EZH A;  2B9S A;  1HW2 A;  4V19 K;  5J4Y A;  1GT0 C;  4Z6Y A;  5M5X J;  4BH9 A;  2NNY A;  1TQP A;  1VQO I;  4CO8 A;  2WAD A;  2HI3 A;  4BE2 A;  1KU3 A;  2BVL A;  2XKO A;  2EZI A;  3G4S I;  1E3O C;  3E7L A;  4UUT A;  1D0Z A;  2LRE A;  2VKE A;  3QPL A;  2E1O A;  3VPR A;  2W24 A;  4QWQ A;  1R7J A;  2CSO A;  5HNH A;  1WJ5 A;  4AM3 A;  2PBI A;  1B4A A;  1KQ0 A;  1BJZ A;  1K83 J;  3F8N A;  2IEK A;  1J09 A;  3W2V A;  2X6W A;  1ZKG A;  1IXR C;  3DBL B;  3SDG A;  5FFX A;  3S2D J;  4JK1 X;  1TP4 A;  4CGZ A;  2EZK A;  4XR6 A;  2I5U A;  5JLX A;  2E36 A;  2CUF A;  2DMN A;  4HSR A;  2VXD A;  3MD2 A;  3IP4 B;  4A3G J;  3IKT A;  1D8K A;  3ZXS A;  1ON1 A;  4KUM A;  2P81 A;  1XSV A;  2DA3 A;  2DJN A;  1FSE A;  1QO0 D;  4HV6 A;  2M5W A;  3BWG A;  5DCM B;  3KP3 A;  3BJO A;  2QKL B;  5BPI A;  3FK7 A;  3DU5 A;  4EM1 A;  3E6M A;  3TO7 A;  2KLO A;  3LFK A;  2PJR A;  2IT0 A;  3FXO A;  5DDG A;  4RGR A;  4M72 A;  3WTX C;  3TKY A;  1R6R A;  1YJN I;  4IHY A;  2P8T A;  5HDK A;  2JN6 A;  2VBY A;  1Z9C A;  1F4K A;  2ID6 A;  2DT6 A;  2QSG X;  3QPS A;  1VQP I;  4Y3O A;  2JQ7 A;  5DTD A;  3VEP A;  1AA7 A;  1XD7 A;  1Z1D A;  2FRH A;  3H1C A;  1YIJ I;  2VC1 A;  4BY7 J;  3FIS A;  4KMF A;  2D1V A;  2Z5U A;  4YIF A;  3JRC A;  4I6Z A;  2FML A;  4KIS A;  2WA0 A;  1W7P A;  2L9R A;  3TW7 A;  2LYC A;  1RC9 A;  2E2J J;  2M34 A;  3L00 A;  3SXY A;  1I3A A;  4N9H A;  4HNV A;  4E7I A;  1UHS A;  4OMZ A;  1LDJ A;  4BXU A;  2HXI A;  1XCV A;  3VFZ A;  1I6X A;  1P92 A;  5E1Z B;  3N4M A;  1EKE A;  3IRQ A;  2ICW G;  4ZC3 A;  1VQN I;  2DMU A;  3DTK A;  3HYI A;  1FYM A;  2CV1 A;  4BXF A;  4NQW B;  5HOO A;  1CGP A;  2VOO A;  1I3Q J;  3KYL A;  3I56 I;  2DOF A;  3RYR A;  4IHW A;  1DP3 A;  3K7A J;  2FF4 A;  1PP8 F;  4BUP A;  3OYD A;  1QVU A;  2OTJ I;  1ZR4 A;  2EBI A;  2K3F A;  1OR7 A;  2PG4 A;  2VJI A;  1WKM A;  3I9V 2;  1QZE A;  1YW8 A;  3E5Q A;  4LG3 A;  3K70 C;  1XCB A;  3GF2 A;  1J7K A;  2QQA A;  2ZNY A;  3GFI A;  1N77 A;  4L9J A;  4D1Q A;  1QZY A;  2KHM A;  3RQI A;  3V7C A;  4EVI A;  1TQM A;  3PIP F;  5HLT A;  2MW8 A;  1RR7 A;  4CCJ A;  4BDY A;  3L2V A;  2F5V A;  2VOD A;  2Y31 A;  3GZ5 A;  3L09 A;  2DMT A;  4X0G A;  2HEO A;  4L18 B;  2R7Z J;  2VKV A;  3IUO A;  2JRT A;  2KDO A;  1KGS A;  1IG7 A;  2LKX A;  3BZ6 A;  2GZW A;  2MLG A;  2Z1D A;  4GO1 A;  2CYY A;  3BR1 A;  1XB4 A;  2A69 F;  2CMP A;  5J8F A;  3O3K A;  5CVJ A;  2GLO A;  2ZFU A;  2YU9 J;  1GV2 A;  5GAE J;  4CA0 A;  4EMS A;  1FJL A;  2KQR A;  2F5D A;  2N8G A;  3OYA A;  2OUM A;  4E4H A;  4FX0 A;  3ZMD A;  5LEK A;  3WU1 B;  4BNC A;  1V55 H;  5FKN A;  2ID3 A;  3ZRG A;  1K79 A; 
#chains in the Genus database with same CATH homology
 4G6D A;  1R58 A;  4WWC A;  4KMU X;  4EJO A;  4XRF A;  2TDX A;  3GYH X;  4Q4Z F;  5D5U B;  3PFI A;  1MGT A;  1OMI A;  2VON A;  4MQV A;  5HLH A;  4U0V A;  1UHW A;  2GIV A;  3FXR A;  5BQT A;  3COA C;  2V9V A;  3P7N A;  4IHS A;  4TV7 A;  1BC8 C;  1FBQ A;  1KQ9 A;  2VXZ A;  3Q9V A;  4HX4 A;  5H6Q A;  4AIK A;  2HFH A;  2C6Y A;  4EJV A;  2O3F A;  4L5J A;  4ZYH A;  3F21 A;  5CLS A;  5K5R A;  3FMQ A;  5FFZ A;  3ELK A;  2BBY A;  3C7J A;  2L4M A;  1DUX C;  5CVI A;  3WGI A;  5D5X B;  1ZRF A;  2FSW A;  2CW0 F;  5HS8 A;  1NHA A;  4LG0 B;  2IA1 A;  1H9G A;  2ETH A;  2PJP A;  1YLF A;  5F64 A;  5LHH A;  3DQV C;  3V8L A;  3H3U A;  5LRS A;  1ZG5 A;  2QWW A;  1AWC A;  2DT5 A;  5DUI A;  1IAW A;  2FOK A;  2UXN A;  3GZ6 A;  2PMU A;  3ABT A;  4M6Y A;  1R36 A;  1RUO A;  2OD5 A;  2P5K A;  4QLC U;  1IW7 F;  2W25 A;  4UV8 A;  3J80 K;  4YFK F;  4MTE A;  2EFO A;  2ISY A;  4FX4 A;  1G6N A;  4WXD A;  4UXN A;  1SMT A;  1T2K A;  3T1B A;  1UB9 A;  4G94 A;  2DU9 A;  2IPQ X;  1F1Z A;  2LSO A;  3KLO A;  4U88 A;  2UXX A;  1MJB A;  2M87 A;  3ZMV A;  1R1V A;  1YIO A;  2O8X A;  1F9N A;  2PLY A;  2B0L A;  3KP2 A;  3K1N A;  4E70 A;  3J80 Z;  3BPV A;  3DP7 A;  3SHF A;  4EM0 B;  1KYW A;  2ZME A;  2GA1 A;  4HX7 A;  1MDM A;  4HF2 A;  1HKT A;  2YX7 A;  3IKV A;  3J7A O;  2NYX A;  2JT1 A;  3QOP A;  3QU3 A;  1MZB A;  5ICE A;  1LJ9 A;  1ZG3 A;  1YW7 A;  4A12 A;  1X3U A;  5ICG A;  4EM2 A;  3FM5 A;  4B8X A;  4MNU A;  2EWN A;  2D2W A;  2P7C B;  1QGP A;  4OIR F;  4UV9 A;  1A04 A;  3GVA A;  3QP6 A;  1GXQ A;  2HTJ A;  4KIG A;  2XRO A;  4CHU A;  3IRR A;  4YFX F;  2AXL A;  4A0Y A;  4I0B A;  3NRV A;  3SQN A;  2DI3 A;  2QM3 A;  2HWV A;  5FLX K;  4G7H F;  2CQK A;  1IN4 A;  2E7W A;  2QVO A;  3JAM K;  2ZO4 A;  1S6L A;  3CJN A;  4EJW A;  4ZZL A;  1J5Y A;  1TLH B;  4CIC A;  5TRD A;  1RI7 A;  4LLG F;  1JHH A;  4IF4 A;  2L02 A;  5FLX Z;  3F72 A;  2LKP A;  5BPD A;  4R8H A;  1ZN2 A;  2K7L A;  3JAM Z;  3WTS C;  2ZFW A;  2BEO A;  4U7B A;  3LAJ A;  1R00 A;  1ZAR A;  3RIR A;  2O6G E;  1YS7 A;  3HSR A;  4EJU A;  5KK1 A;  4U7D A;  3R0A A;  4DNC A;  2NRA C;  5HDG A;  5JFR A;  3U1D A;  2ZJ2 A;  3GO5 A;  4PZJ A;  3IC7 A;  2MH2 A;  2DK8 A;  2Y48 A;  1FP1 D;  1XSD A;  4IRH A;  4I01 A;  3FMS A;  1V4R A;  3SZP A;  1LDK B;  2IA2 A;  2VBW A;  3MZY A;  1YYV A;  5DCM A;  1USS A;  1BIB A;  4WF2 A;  2DQR A;  2D45 A;  1BI0 A;  3LST A;  2MH9 A;  4RB2 C;  1XGM A;  3ZN0 A;  1FLI A;  1ZYR F;  1OPC A;  2R7D A;  4G7Z F;  5ILS A;  4AVP A;  1YTY A;  4PGH A;  4IRI A;  1K78 B;  2XIG A;  2EV0 A;  3PQJ A;  2XAJ A;  4Y17 A;  1V3F A;  3F8F A;  1L0O C;  2Y0M A;  3E97 A;  3E6B A;  2JTV A;  1Z6R A;  4K2E A;  2Q8K A;  3TDU C;  2PMH A;  5DV5 A;  5L3G A;  1AOY A;  2GWR A;  3KET A;  4S05 A;  4NQW A;  2G7H A;  3KE2 A;  3BPX A;  4MHG A;  5D4R A;  4ENJ A;  3W6K B;  1ZRC A;  2XV4 S;  3ZPL A;  5LHI A;  5HDN A;  2ACJ A;  4UVA A;  3RYP A;  5L3B A;  1O3S A;  4I7H A;  1LNW A;  5IT9 K;  1XDS A;  1IN6 A;  3EUH A;  1BC7 C;  3CO6 C;  1ZHF A;  4LB6 B;  3I0T A;  5ILV A;  2DPU A;  3ECH A;  5ED4 A;  2KIU A;  5E20 A;  4UVB A;  5IT9 Z;  1IXS B;  1ON2 A;  3LQQ A;  2EJR A;  5HVQ C;  2KIM A;  4OIQ F;  5F6F A;  4HQE A;  3KEO A;  3LWF A;  5DYM A;  5FO5 A;  3FM3 A;  3R0J A;  1ZAO A;  2HGC A;  4HDV A;  1L3L A;  1IRF A;  2HKO A;  2EFP A;  4GYI A;  5BMZ A;  4U0Y A;  4Y15 A;  1DPR A;  2EK5 A;  1HBX G;  2FBH A;  2D1H A;  3TOA A;  1S29 A;  3C1D A;  4KT5 C;  3CUO A;  2E1C A;  2XKP A;  2H6B A;  4L9N A;  4Z2Y A;  3I4P A;  1GVJ A;  1CF7 B;  5JVT A;  1Q1H A;  2F5C A;  3ULQ B;  4YII A;  4RB1 A;  2EV5 A;  4LG0 A;  5CJ9 A;  2A68 F;  4G6Q A;  4BHP A;  2YX4 A;  3DXJ F;  3I54 A;  5D8L B;  3HRT A;  2STW A;  1J0R A;  4GGG A;  4XLN F;  2QLZ A;  3DF8 A;  2O61 A;  2XVC A;  4P9F A;  3VOE A;  1S7A A;  4KNY A;  3IHU A;  4ETS A;  2IA0 A;  1B9M A;  1I1G A;  5ERI A;  3N97 A;  1O3R A;  4ESJ A;  1J9I A;  2WC2 A;  3F6V A;  1S3J A;  2JZY A;  4Q48 A;  3ECO A;  4I98 B;  5K5Q A;  1W4M A;  1ZGJ A;  4HQM A;  2Z3Y A;  4JQF A;  2F2E A;  3BRO A;  4R1H A;  1XGO A;  3F22 A;  3ERE D;  3FWE A;  4ZYD A;  3C18 A;  4MEY F;  3M8E A;  2KKO A;  4PGG A;  1O7L A;  4LJZ F;  2DTR A;  1K6O A;  4OU0 A;  2EV6 A;  5CVU A;  2BGC A;  1J59 A;  4P96 A;  1JGS A;  4G7O F;  2DO7 A;  3L9F A;  4HYE A;  2MA3 A;  2GA2 A;  1FP2 A;  3GUD A;  2PFB A;  5FB2 A;  2XAH A;  2EFN A;  4HLX A;  5L3F A;  1GXP A;  4HX8 A;  1TQI A;  5E17 F;  1ZLK A;  3I64 A;  1FYL A;  3V7R A;  3O6B B;  2P4W A;  1LDD A;  1RUN A;  4EQQ A;  2R7F A;  5KVR A;  3WTZ A;  3AAF A;  2DAO A;  2HZT A;  4OIN F;  2A6H F;  3I58 A;  4YFN F;  3F6O A;  4KN4 X;  2VN2 A;  3V7S A;  4HZF A;  5HS7 A;  5FD6 A;  1BI2 A;  4BHC A;  3WTU C;  2XAG A;  3IWF A;  2VE9 A;  1U78 A;  3LA7 A;  1ODD A;  2G9W A;  2VE8 A;  4ESF A;  5E8I A;  4Q5S F;  3B73 A;  3RI4 A;  2Y75 A;  4S04 A;  4L9T A;  2CGP A;  2XAQ A;  1T0F A;  1BJA A;  2STT A;  3R60 A;  4MTD A;  1TNS A;  3KZY A;  3DFG A;  3BY6 A;  2WTE A;  1ZRD A;  3W6J B;  2VOP A;  2PQ8 A;  1LB2 A;  3SFZ A;  4ENM A;  1HSJ A;  3WTV C;  3P9C A;  4ZH4 F;  2EFW A;  2FQ3 A;  2MBF A;  5L3E A;  2L01 A;  2P6T A;  1TW2 A;  1O3T A;  1HXD A;  1FOK A;  2HOE A;  4KA4 A;  4KFC A;  4ON0 A;  3K69 A;  5EEG A;  2ESN A;  2PEX A;  1U8R A;  1D5V A;  3ZMS A;  2K02 A;  1UST A;  3LA2 A;  2M8E A;  2V79 A;  5JHU A;  1KU9 A;  3VOD A;  2QQB A;  4XLP F;  1G4D A;  5K5O A;  2W57 A;  2FNA A;  3WU0 A;  3MWM A;  3GFL A;  4DQ2 A;  2J5P A;  5LBQ A;  5HLG A;  4L9V A;  3VB2 A;  5IT3 A;  3QP5 A;  4LFU A;  1P4X A;  1R1T A;  3H92 A;  2JSC A;  2VT3 A;  3CUQ B;  5TJJ A;  3FMR A;  2HTS A;  2KRF A;  3NQO A;  2FXA A;  2IP2 A;  2GXG A;  5LGN A;  1H9T A;  4P55 A;  1I27 A;  3JTG A;  4LK0 F;  1PP7 U;  1K78 A;  3FX3 A;  4FHT A;  5FD5 A;  1XGN A;  3IWZ A;  4CYD A;  2DPD A;  3BJA A;  3WG9 A;  1Z7U A;  3P9K A;  1XMK A;  2BE5 F;  3T0Y A;  2DFI A;  4MGR A;  1I1S A;  4IPA A;  4M73 A;  3RPU A;  2DQL A;  2RNJ A;  1VTN C;  5FGM A;  5LRR A;  4H0E A;  2Z9O A;  1R5G A;  1ONV A;  3HRU A;  4MQ9 F;  1SAX A;  4KIB A;  2HDC A;  3ABU A;  2R3S A;  1ZH5 A;  1RNL A;  4RS8 A;  3E3V A;  3WGG A;  4XBF A;  1OYI A;  1YQA A;  1JXS A;  2DBB A;  1G3T A;  1LQ1 A;  2RV8 A;  1P4W A;  2HQR A;  4OIO F;  2M1B A;  4HBL A;  2IRF G;  3DEU A;  2NNN A;  3HUG A;  4OMY A;  3JTH A;  3T8R A;  3SZT A;  4M74 A;  4A2U A;  3D5L A;  2RVC A;  4A5N A;  4M9S A;  2BYV E;  3KP4 A;  4XSX F;  2E1N A;  5H6R A;  5LLQ A;  1IZ1 A;  2OQR A;  3WTW C;  1H0M A;  1U5T A;  2O03 A;  2RGV A;  1DP7 P;  1ULY A;  4KYW A;  4WK8 F;  4ZYE A;  4UUV A;  3V8J A;  1WSU A;  4IRG A;  3HTS B;  3OV8 A;  4BYY A;  1UHM A;  2QEN A;  4M6X A;  5BOX A;  4LLL A;  2FBI A;  1EH6 A;  1FT9 A;  5AON A;  3CLO A;  2V1D A;  3HIF A;  2K4J A;  3MZH A;  4RB3 C;  1CF7 A;  1QNT A;  5ICF A;  1D3Y A;  1JE8 A;  1U6G A;  2IW5 A;  5E8G A;  4KIF A;  2RDP A;  2OZU A;  2Z33 A;  2CWE A;  4BQA A;  2PI0 A;  3I5U A;  2PN6 A;  5LGU A;  4M71 A;  2HKX A;  4IHT A;  1E2X A;  3E5X A;  1TNT A;  2GXB A;  4G8X A;  3EET A;  1XDU A;  4NHJ A;  4HA8 A;  1Z6T A;  2XRN A;  4P9U A;  2AS5 F;  4CXF A;  2FBK A;  1O7F A;  4I09 A;  3J81 K;  3U9G A;  3RDI A;  1ZLJ A;  5DCF A;  3IL2 A;  5LHG A;  1J75 A;  2Q2E A;  3DKW A;  5L3D A;  4RB0 A;  1C0W A;  3RTR A;  1FZP B;  2EB7 A;  2JPB A;  1SMY F;  2FE3 A;  4UVC A;  1KA8 A;  1BBY A;  3DPL C;  1WWX A;  5A2Q K;  4HF0 A;  4RGU A;  2ADU A;  4B09 A;  3I71 A;  2ZCW A;  1BIA A;  1FY7 A;  3GFM A;  2MLK A;  4RAZ A;  2YR2 A;  4HAM A;  3GEZ A;  5DUK A;  3WOD F;  4A0X A;  1SD5 A;  5AIP A;  4AD9 A;  1FBU A;  3HRS A;  3BDD A;  5E1X A;  1FWZ A;  3GWZ A;  5JI6 A;  1IF1 A;  5A2Q Z;  2FEZ A;  3L2C A;  2LF8 A;  1DPU A;  5DD8 A;  3K2Z A;  3QPT A;  1SD6 A;  1WRJ A;  2LF7 A;  1W7P D;  1JHF A;  3F3X A;  3WGH A;  1HW5 A;  2FMY A;  2ESH A;  3FXQ A;  1F5T A;  1MKM A;  1XMA A;  1J2X A;  1ZRE A;  2RN7 A;  3WTT C;  3KP5 A;  3KCC A;  2KJB A;  2RKH A;  4CDG A;  1U5T B;  2EA2 A;  3Q9S A;  4LB5 A;  1SFU A;  2H27 A;  1W5S A;  1XSX A;  2L4A A;  3I59 A;  1R1U A;  2IJL A;  3GW2 A;  4GYG A;  2W85 A;  1SD7 A;  5HLI A;  1LEB A;  1EV7 A;  4A6E A;  2K86 A;  4Q47 A;  1IXC A;  2OU2 A;  1RZ4 A;  3FZV A;  3HSF A;  4HLY A;  3ISP A;  2X0L A;  5K1Y A;  3M1E A;  4IJA A;  3U2R A;  4BAY A;  5BS6 A;  4ENK A;  2IVM A;  2DW4 A;  2OBP A;  3T5X A;  2A07 F;  4YG2 F;  4RAY A;  1PDN C;  3EDP A;  3K1M A;  4ZYG A;  4LMY A;  5J8C A;  2BV6 A;  2OQG A;  2H94 A;  3V4G A;  4P5O A;  2XAS A;  5AIQ A;  1ZGA A;  2W84 A;  3R61 A;  1FNN A;  1HW1 A;  5JR3 A;  2ZNZ A;  1YO5 C;  1TTY A;  4M9X A;  3HSE A;  2HS5 A;  3ZN1 A;  1FPQ A;  4N0B A;  3G73 A;  1IUY A;  1R23 A;  3P9I A;  4I02 A;  2M45 A;  3HOS A;  3HRM A;  4R79 A;  4HF1 A;  2VBZ A;  3CUQ A;  2EFQ A;  3FF5 A;  3GLX A;  1Z91 A;  5D8K B;  3ROU A;  1REP C;  1B6A A;  3JSP A;  5D5V B;  4ASN A;  1FYK A;  2ISZ A;  2COM A;  4HDU A;  4HV5 A;  2XHK A;  2P6S A;  4HW0 A;  1U2W A;  3MFK A;  1ZG1 A;  3ZP5 A;  1W5T A;  2J5O A;  2FU4 A;  4GCV A;  3QAH A;  3QU6 A;  1RIO H;  2V1U A;  1LVA A;  3REO A;  1FC3 A;  3RKW A;  3T8T A;  4LGW A;  2E7X A;  3I53 A;  2L54 A;  1MJA A;  2QBY B;  2XGX A;  2UZK A;  1HST A;  5D6F A;  5EEH A;  4LK1 F;  4I2O A;  3ZMU A;  1R22 A;  1YS6 A;  3ZQ7 A;  3BP8 A;  1OYW A;  2DK5 A;  3ZMZ A;  4PDK A;  2YPR A;  2CFX A;  4EJT A;  2ELH A;  3QRF F;  2K4B A;  3HHH A;  2CO5 A;  3I59 B;  5F1R A;  1G3W A;  1G3Y A;  2LDU A;  3M8F A;  1S7O A;  2QQ9 A;  4M9Z A;  4O5V A;  3TO9 A;  1FSH A;  1YG2 A;  4AIJ A;  2HR3 A;  4O6J A;  4AIH A;  1T38 A;  1KYZ A;  3EYY A;  3TO6 A;  1MJ9 A;  3D0S A;  3ZMT A;  1TW3 A;  1O3Q A;  2G7U A;  1QQI A;  2ZXJ A;  2VC0 A;  3R6S A;  1OKR A;  1UFM A;  4WX9 A;  1DDN A;  4BHB A;  4IVN A;  3MCZ A;  1KQ8 A;  2FA5 A;  2HYG D;  2RQP A;  1PUE E;  5LGT A;  2GQQ A;  3GXO A;  4ZZD A;  4U0W A;  1U5T C;  4XSZ F;  3G3Z A;  2OAZ A;  1G3S A;  1BN5 A;  5LEJ A;  4L0Y B;  3F8B A;  1W7P B;  2CG4 A;  1WQ2 A;  1MD0 A;  5DD4 A;  4IXA A;  3BOQ A;  3DPT A;  4L0Z B;  4OIP F;  3LQR A;  4OOI A;  4UHT A;  4N9I A;  2H6C A;  1IN8 A;  3L7W A;  3ML6 A;  3EQL F;  2FNP A;  3QPH A;  3H3Z A;  1LEA A;  1BM9 A;  3K1P A;  2A3S A;  2X4H A;  4F7Z A;  3KZZ A;  2KJC A;  4RGS A;  1YFH A;  3RJP A;  5DEQ A;  1XN7 A;  2V6C A;  2UWM A;  1TBX A;  3RKY A;  5D5W B;  1UCR A;  2Z99 A;  4JBA A;  3CDH A;  1BI3 A;  2XUB A;  1I5Z A;  4UNO A;  2WWY A;  1FX7 A;  2O0Y A;  1IN5 A;  3KEQ A;  1D8J A;  2MC3 A;  3F23 A;  1B9N A;  2YU3 A;  1T6S A;  2QUF A;  3HTU A;  3HHG A;  1T39 A;  1Z05 A;  2XAF A;  2NS0 A;  3WTY C;  3M9A A;  1GHC A;  3CTA A;  4CZZ A;  4I0A A;  3FXU A;  2ZKZ A;  5E18 F;  5E1W A;  5H20 A;  1P4A A;  1P2F A;  3KP7 A;  4Y13 A;  1U3E M;  2H09 A;  1FBS A;  2A6E F;  2F5E A;  3JW4 A;  1B59 A;  3GX4 X;  3EYI A;  4MEX F;  3RPQ A;  3TOB A;  3TQN A;  2P5L C;  2K27 A;  3JSO A;  4ENN A;  3MEX A;  3WE3 A;  4LD5 A;  2NAZ A;  1S8N A;  3OOP A;  4A0Z A;  2OZ6 A;  3TGN A;  2YSR A;  3LAP A;  1IRG A;  4GXO A;  2P7V B;  2HYF A;  1QPM A;  3M7G A;  3E6C C;  4RGX A;  1T98 A;  4D0P A;  2KIF A;  1P6R A;  1B1B A;  4KIC A;  2HQN A;  3MQ0 A;  1XGS A;  3C3W A;  2MD5 A;  2QZ8 A;  3S2W A;  3GFJ A;  1STZ A;  2F5F A;  2ZBK A;  3O2P E;  4WXC A;  5CYV A;  5ICC A;  1YW9 A;  4FT8 A;  1SFE A;  1IN7 A;  4KDP A;  1BI1 A;  1SFX A;  3V8K A;  2A5Y B;  4O3M A;  3F8C A;  1R5H A;  1K7A A;  5D6E A;  3KLN A;  2L3D A;  4EV0 A;  4WXH A;  3R4K A;  3TDZ C;  4HOB A;  3NEU A;  1HQC A;  3HOT A;  3E6D A;  1EH7 A;  3FHZ A;  1E17 A;  5L3C A;  2A61 A;  4L5I A;  2RC4 A;  2EA4 A;  2Q0O A;  2M30 A;  3PQK A;  2ZME B;  1BOA A;  1MDM B;  1QBJ A;  3J81 Z;  1HKQ A;  3B02 A;  3KP6 A;  3F8M A;  2GAU A;  5CVR A;  1SD4 A;  2LNB A;  4NB5 A;  3LA3 A;  2QYO A;  4KN7 X;  1WI9 A;  4LLN A;  1EH8 A;  1QZZ A;  3CUQ C;  3CO7 C;  1OYY A;  4A5M A;  5D4S A;  4G9Y A;  1O57 A;  5CVV A;  2QBY A;  1KU2 A;  3KFW X;  3E5U A;  4AWX B;  3BJ6 A;  1HKS A;  1KU7 A;  4WCG A;  3K9T A;  2OA4 A;  3DV8 A;  4EGZ A;  3Q5F A;  3RKX A;  2V1X A;  5HS9 A;  4ESB A;  2JPC A;  5ILU A;  4EGY A;  3MAJ A;  2DLL A;  3K0L A;  4PCQ A;  3WE2 A;  2VT2 A;  6PAX A;  2VBX A;  4A6D A;  2WV0 A;  2P5V A;  5J6X A;  1Y0U A;  1HW2 A;  4BH9 A;  2NNY A;  1TQP A;  4CO8 A;  1KU3 A;  2XKO A;  2W24 A;  4QWQ A;  1R7J A;  2CSO A;  2PBI A;  1B4A A;  1KQ0 A;  3F8N A;  1IXR C;  5FFX A;  4JK1 X;  4CGZ A;  3IKT A;  1D8K A;  1ON1 A;  4KUM A;  1XSV A;  1FSE A;  4HV6 A;  2M5W A;  3BWG A;  5DCM B;  3KP3 A;  3BJO A;  5BPI A;  4EM1 A;  3E6M A;  3TO7 A;  3LFK A;  2IT0 A;  5DDG A;  4RGR A;  4M72 A;  3WTX C;  3TKY A;  2P8T A;  5HDK A;  2VBY A;  1Z9C A;  1F4K A;  3VEP A;  1XD7 A;  2FRH A;  1Z1D A;  2VC1 A;  4KMF A;  2D1V A;  2Z5U A;  4YIF A;  2FML A;  1W7P A;  3L00 A;  3SXY A;  4N9H A;  4OMZ A;  1LDJ A;  4BXU A;  1XCV A;  3VFZ A;  1I6X A;  1P92 A;  5E1Z B;  3N4M A;  3IRQ A;  3HYI A;  1FYM A;  5HOO A;  1CGP A;  2VOO A;  3RYR A;  2FF4 A;  1PP8 F;  1OR7 A;  2PG4 A;  1WKM A;  1YW8 A;  3E5Q A;  1XCB A;  3GF2 A;  1J7K A;  2QQA A;  2ZNY A;  3GFI A;  4L9J A;  4EVI A;  1QZY A;  3V7C A;  1TQM A;  2VOD A;  3GZ5 A;  3L09 A;  2HEO A;  4L18 B;  2JRT A;  1KGS A;  3BZ6 A;  2GZW A;  2MLG A;  4GO1 A;  2CYY A;  1XB4 A;  2A69 F;  5J8F A;  3O3K A;  5CVJ A;  4EMS A;  2F5D A;  5LEK A;  4FX0 A;  3ZMD A;  3WU1 B;  4BNC A;  1QO0 D;  1K79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...