1UCRA

Three-dimensional crystal structure of dissimilatory sulfite reductase d (dsrd)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
74
structure length
74
Chain Sequence
MEEAKQKVVDFLNSKSGSKSKFYFNDFTDLFPDMKQREVKKILTALVNDEVLEYWSSGSTTMYGLKGAGKQAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Dissimilatory Sulfite Reductase D (DsrD) Protein-Possible Interaction with B- and Z-DNA by Its Winged-Helix Motif
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Unknown function
molecule keywords Protein dsvD
total genus 23
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08679 DsrD Dissimilatory sulfite reductase D (DsrD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ucrA00
1TW2A 2XAGA 3FWEA 4LLNA 4HDUA 2HDCA 1WKMA 3V8KA 3NEUA 4LGWA 5KVRA 1G4DA 5J8FA 1J59A 1IF1A 2F2EA 5DD8A 4UXNA 5DEQA 5L3BA 2IPQX 2A3SA 5E1ZB 3Q9SA 2FBHA 1J75A 2MD5A 3WE2A 1J5YA 5F6FA 1JXSA 1I27A 2IJLA 4G94A 2KKOA 1WI9A 4NB5A 2DW4A 1T2KA 2J5PA 4ZYGA 1W5SA 2VBYA 2OQRA 3TO6A 2BE5F 4UVCA 4LMYA 3GVAA 4M9ZA 1IN8A 1MGTA 2J5OA 5JVTA 1FT9A 2P7VB 3DV8A 3ZMSA 1ZG1A 3FM5A 1ZARA 2FNPA 2QWWA 4L9TA 4ZZDA 3ISPA 5E18F 4U7BA 3ABUA 4HYEA 1E17A 1RI7A 2NS0A 4HQEA 5D6EA 3Q5FA 1ZAOA 4M6YA 3BOQA 3PQJA 2F5DA 2XRNA 3JTHA 1U6GA 1D5VA 3HUGA 1UB9A 4RGRA 4KMFA 4RB3C 4G7OF 2EJRA 4ON0A 5JR3A 5IT9Z 2XAHA 2NYXA 3F3XA 3GFMA 4OMZA 1V3FA 4G9YA 4CDGA 5E17F 1BM9A 1F5TA 3DF8A 2V9VA 3REOA 2D45A 2V1XA 4Q5SF 2RNJA 4KIBA 2FMLA 4KNYA 2EA2A 4EJOA 3C7JA 3ZMDA 1OKRA 1ZH5A 3J7AO 3IC7A 1P2FA 1IXRC 1R58A 2WWYA 3ZN1A 5L3DA 2PN6A 4WXCA 3JAMK 3WU1B 2COMA 3MQ0A 3JW4A 3OOPA 4ENNA 2VE8A 4GYIA 5HLIA 5FB2A 3K1NA 2NRAC 4IXAA 1RUOA 1XDSA 2DQRA 1OYIA 5CLSA 1RZ4A 4H0EA 4R79A 3ERED 3KLOA 1BI3A 1KU2A 4IHTA 1P4XA 5LLQA 2GQQA 2P6SA 3RYPA 1BJAA 4EJVA 4CHUA 2CSOA 2IA2A 2YX7A 4CZZA 3H3ZA 1L0OC 2V6CA 3GFIA 3P9IA 3ZMVA 1S7AA 2Z9OA 4BAYA 3RPQA 1IAWA 1MZBA 5LHHA 4QLCU 2JSCA 4RB0A 4Y17A 4L9NA 5CJ9A 2MLGA 3WTZA 1B6AA 3HRMA 4AVPA 2RKHA 3KETA 3L2CA 5DYMA 1SFEA 3G73A 1YTYA 5FLXZ 1G3SA 3J81Z 4U0YA 2O03A 3BWGA 1G3YA 3HSRA 2H09A 2VN2A 2OD5A 5H6QA 5HOOA 3R4KA 1IXSB 2ZXJA 1FLIA 1B9MA 2Q8KA 4OIPF 1ZGAA 1MJBA 3EUHA 1S6LA 4YFXF 5E20A 5D5XB 3RJPA 4ZH4F 3KZZA 1J7KA 4GCVA 1BIBA 1Z6TA 3HSFA 2EFNA 2PEXA 4ZYEA 1FC3A 3E97A 4P5OA 4A6DA 2UXXA 3LSTA 4L5IA 1MDMB 3RPUA 2KIFA 2QBYA 1EV7A 2HGCA 2VXZA 2EV0A 4D0PA 2CWEA 4IRGA 4KUMA 5H20A 2PJPA 4WF2A 1OMIA 1W5TA 1H0MA 3K69A 1R22A 5FFZA 3L7WA 2HYGD 4G6DA 1IRFA 1ZRDA 2HZTA 5HDGA 3NQOA 3WTSC 4BHCA 3K9TA 3LQRA 1LDKB 2YX4A 2HR3A 1HKQA 2DPUA 1W7PD 3FZVA 4CO8A 3I53A 2IRFG 4UUVA 2QVOA 4YIFA 2A6HF 1RUNA 1LJ9A 4P55A 1FZPB 3TOBA 2OA4A 3LA7A 3R61A 3OV8A 4CGZA 2QLZA 3WTUC 1R5GA 4Q48A 3GFLA 2HTJA 4A5NA 3E6MA 3RTRA 2O6GE 2KJBA 4ETSA 2M30A 5L3GA 1O3RA 4RB1A 2XAQA 4I7HA 5CVJA 3VB2A 4L5JA 4LFUA 4O3MA 5LGTA 2HOEA 1SFXA 1A04A 2QBYB 2BEOA 1O3SA 2P5KA 4HX8A 3BP8A 2JPBA 1FBSA 2ZMEA 2CFXA 3JSPA 4K2EA 3TO9A 4Z2YA 4GO1A 4ESBA 3ZMZA 4L9VA 1PP8F 1P4WA 1Q1HA 2EA4A 3K0LA 1TBXA 1KYZA 2MA3A 4A6EA 2QQAA 4L18B 3W6KB 1BI0A 3LA3A 2OAZA 3HHHA 5TRDA 4DNCA 4M9SA 1Z6RA 2Z3YA 2C6YA 4B8XA 3KEOA 3F8FA 3JTGA 1OPCA 2QZ8A 4JBAA 3HTSB 4A0YA 2FE3A 3QU6A 3CJNA 3LA2A 1HKTA 3FXQA 4GGGA 4EM1A 3GUDA 5BPDA 1FYKA 4YFNF 3SXYA 4YIIA 2M8EA 1U8RA 4KIGA 4A2UA 1RIOH 5AIPA 1TTYA 3HIFA 2XUBA 5HS7A 1KQ8A 4RAZA 1LB2A 3K1MA 4LK0F 3VODA 1NHAA 4HX7A 3KP2A 1H9GA 2GWRA 2BV6A 3E6CC 1Z05A 2PLYA 2HQNA 3FMRA 2BBYA 2IP2A 5L3EA 4Q47A 1AWCA 4ESFA 1GHCA 2FBKA 1B1BA 1YIOA 2HS5A 2P4WA 1B4AA 4UV8A 4MQVA 3V4GA 2VOOA 4KN7X 3K1PA 4G8XA 3MAJA 3FXUA 4WXHA 3GZ6A 4MNUA 5JHUA 1E2XA 3ML6A 1QBJA 2D1HA 2RVCA 5BOXA 4MQ9F 5HLGA 5CVVA 4BNCA 1PDNC 1BBYA 2ETHA 3WTTC 4HW0A 3V7SA 2ISZA 2V79A 2A61A 1ZLKA 2EV5A 1XSXA 5E8IA 4MGRA 5J8CA 4RS8A 2PMHA 2Y75A 5AONA 2PQ8A 5CYVA 2M5WA 4OMYA 2YU3A 2CYYA 4Y13A 4M9XA 3C3WA 4MTEA 4P96A 1PUEE 4OINF 1YS6A 2ZFWA 2EWNA 3T8RA 1SAXA 2CGPA 4WWCA 1W7PB 5FO5A 1JGSA 4MTDA 1OYYA 1TW3A 3B73A 2R3SA 2K02A 1R7JA 2CW0F 3DQVC 1R23A 3W6JB 3ZQ7A 3GLXA 3E6DA 1ON1A 4M73A 2EK5A 3H3UA 4F7ZA 2M45A 3TDZC 2XAFA 4FT8A 4BHPA 1X3UA 2WC2A 3I0TA 5A2QZ 1T98A 1XCBA 4G7ZF 3FXRA 1OYWA 4RGXA 4LB5A 2JRTA 3HHGA 2BGCA 2XKPA 4CXFA 3I71A 3BY6A 3F72A 1SD6A 2V1DA 1WSUA 4HOBA 1O57A 1HSTA 1KQ9A 4S04A 4ESJA 3MCZA 1BIAA 2VE9A 2FBIA 3ZPLA 4IRIA 2JTVA 2H6BA 3EQLF 3ZMTA 3WTYC 3KZYA 1DP7P 3P7NA 5CVUA 1QZZA 3CUOA 1O7LA 1ZGJA 1TQIA 4I0BA 2OQGA 2VOPA 2G9WA 3ECHA 4EJWA 2Q2EA 1I1SA 1P4AA 3TGNA 4N9IA 4XSZF 3T0YA 3CUQB 4AIHA 5BPIA 2HKXA 1C0WA 4ZYDA 2MBFA 3E3VA 3TDUC 1YQAA 2IA0A 1FX7A 1UFMA 3ZMUA 2DPDA 3SZTA 1WRJA 4EVIA 4HV6A 3T1BA 2VC0A 1YG2A 2E1NA 3CO7C 3R0AA 4OU0A 3NRVA 1KGSA 5HVQC 2KJCA 3HRTA 3T8TA 4I09A 2VODA 3JSOA 2QUFA 3SFZA 2PMUA 1RNLA 2K4BA 1IUYA 2F5FA 1U5TC 2HTSA 2ZBKA 2IA1A 1SD5A 1U78A 2Z99A 4LG0B 4Q4ZF 4HAMA 1FP2A 5D6FA 4QWQA 3IKVA 3TKYA 3WE3A 2NNYA 5K1YA 3V8JA 2ZKZA 3GF2A 4I02A 5D5WB 3Q9VA 5DCMB 2FMYA 3IWFA 5LRRA 1J9IA 2STWA 2GA2A 4B09A 3ELKA 4A5MA 4MEXF 2A6EF 4R1HA 2FRHA 5FD6A 3HOSA 3F6OA 3M8EA 3KP4A 1HSJA 2UXNA 2CG4A 4I2OA 5ICCA 1MD0A 2DFIA 4WX9A 3SHFA 5A2QK 5FLXK 3IRRA 4PCQA 2VT3A 2EFQA 4PDKA 5FD5A 2L4MA 2FEZA 2FXAA 4YFKF 1HBXG 2P5VA 2JT1A 2LNBA 3WU0A 4HF0A 1XGNA 2O0YA 3I64A 4PGHA 5E1WA 1D3YA 3QP5A 3RI4A 1BOAA 1I6XA 1UHWA 2FA5A 4A0XA 2EFWA 4G7HF 2OU2A 3F8NA 1IRGA 3ECOA 3V7CA 4FX4A 1F4KA 5HDKA 3V7RA 3RDIA 1V4RA 3GX4X 4N9HA 1CGPA 5CVRA 1K78B 2B0LA 3HRSA 1T38A 1ZN2A 3VEPA 3GW2A 1FOKA 1FP1D 2HEOA 4E70A 1USTA 3L00A 4R8HA 2E1CA 2VBZA 1S3JA 2LDUA 1U5TA 4GYGA 1FBQA 3J80Z 3JAMZ 2G7HA 2H27A 4UNOA 3WTXC 4KYWA 5JFRA 1XN7A 1EH6A 2STTA 2PBIA 4U0VA 5BQTA 4AIJA 1R36A 2L02A 3FF5A 3F23A 5LGUA 3QOPA 3COAC 2D1VA 2LKPA 2D2WA 2V1UA 5D8KB 4HLYA 4RAYA 3SZPA 4KIFA 1DPUA 3MFKA 3EYIA 2A68F 4IF4A 2A07F 1YW9A 3L09A 3TQNA 4CYDA 3WTWC 1Y0UA 2A69F 3F6VA 5LGNA 2EFPA 3PQKA 3R60A 2K4JA 3IWZA 5DCFA 5K5OA 1KQ0A 1SD4A 1ZG5A 5J6XA 1K79A 1O3TA 5HDNA 3I58A 2AXLA 3ULQB 3BZ6A 2H94A 5L3CA 4BXUA 1LVAA 3LFKA 3GFJA 1CF7A 5K5QA 4IRHA 3D0SA 2W84A 3G3ZA 3C18A 2LSOA 2Z33A 4PZJA 3DEUA 2GA1A 3E5QA 1ZLJA 4ASNA 2RV8A 1MJ9A 2HKOA 2M87A 1B59A 2O3FA 1MKMA 3V8LA 1IXCA 2FF4A 3WGIA 1MJAA 1XCVA 1BI1A 1XD7A 2Z5UA 2DO7A 3AAFA 2A5YB 2DK8A 4EGZA 3N4MA 1K7AA 3E6BA 1ZREA 2OZ6A 1TNSA 1B9NA 1TNTA 4HBLA 5L3FA 1IZ1A 4NHJA 2XHKA 1QGPA 4BHBA 1HQCA 2ZJ2A 2X0LA 3FMQA 3LQQA 5D5UB 2FSWA 2ZO4A 4UV9A 2KIMA 5DCMA 4OIRF 3CUQA 4BH9A 3KP6A 4EMSA 1YW7A 3QPTA 4LG0A 1ONVA 4M71A 1P92A 2AS5F 2DLLA 1F9NA 3CLOA 2IVMA 3WGGA 5LRSA 2XKOA 3I59A 1TQPA 1XGMA 4UHTA 4HLXA 5IT9K 3IKTA 2DK5A 2IT0A 3BJAA 1JHHA 1S8NA 4Y15A 5HS9A 4EM2A 1QPMA 5D4SA 1WWXA 4M74A 3KP5A 4BQAA 2XV4S 2WTEA 1O7FA 2ELHA 2DU9A 3I54A 1LEBA 2CQKA 4IHSA 1CF7B 2HYFA 2P8TA 3F8MA 2DAOA 1KYWA 3FHZA 4IVNA 1H9TA 2MH2A 3GEZA 2E7XA 2F5CA 2UZKA 3P9CA 1KU7A 2E7WA 2M1BA 2GXBA 3WGHA 5EEGA 3KFWX 2HWVA 3WG9A 4KMUX 1JHFA 2DT5A 2OBPA 2MC3A 4HA8A 2YR2A 1FYMA 4KA4A 1HKSA 1Z9CA 4BYYA 1I5ZA 3U9GA 3FX3A 4HV5A 3U1DA 1UHMA 4NQWA 5E1XA 1GVJA 2ESHA 2GAUA 3T5XA 4O6JA 4XLNF 4HZFA 3LAJA 1YYVA 1DDNA 4LJZF 5LHIA 1AOYA 1G6NA 3TOAA 2ESNA 4EQQA 4LD5A 1DUXC 3ZP5A 3ROUA 1LDJA 3HSEA 4FHTA 3QAHA 4I98B 3HTUA 1U5TB 2LF8A 4ENMA 3DPTA 3DP7A 2XIGA 2GZWA 4L0YB 4WK8F 1L3LA 1IN5A 2VC1A 5DD4A 3KP7A 2W24A 1R1UA 1BN5A 4XRFA 4LLLA 2QQBA 2W85A 2OZUA 3J81K 2O8XA 5H6RA 3B02A 1LDDA 1T39A 4MEYF 2VBWA 5EEHA 5FGMA 4UVBA 1MDMA 4OOIA 3IL2A 2FOKA 4P9UA 2RGVA 2YSRA 1LQ1A 1OR7A 5ILSA 3GXOA 1SMYF 4XSXF 3WODF 4GXOA 5D4RA 4I0AA 1EH8A 3GO5A 1BI2A 1ZRCA 2TDXA 1QQIA 3HOTA 2VT2A 3FMSA 2EV6A 4I01A 4KICA 2KRFA 2L4AA 3M9AA 2P5LC 1Z1DA 3RIRA 5JI6A 2MH9A 3EYYA 3U2RA 2LF7A 1IN4A 3D5LA 3M1EA 3QRFF 1QNTA 5ED4A 3F8BA 2RC4A 2FNAA 4JQFA 1HW5A 2DI3A 2Q0OA 3MZYA 1XGOA 1FNNA 3TO7A 3LWFA 3ZN0A 1U3EM 1FWZA 2L3DA 1FY7A 4JK1X 1GXQA 3P9KA 2EB7A 1BC8C 1LEAA 4N0BA 4S05A 4OIOF 2ISYA 2IW5A 2ZCWA 4KDPA 3E5XA 3MZHA 2W57A 2Y0MA 5CVIA 2XVCA 1EH7A 2GXGA 2H6CA 3QP6A 3RYRA 5LEKA 6PAXA 4UVAA 4EJTA 1XSDA 4ENKA 5E8GA 4RGSA 5KK1A 4HF1A 1R1VA 3CO6C 5K5RA 4EGYA 1S7OA 1G3WA 2RN7A 2KIUA 1YO5C 3DKWA 4RGUA 5IT3A 1UCRA 2QM3A 2XROA 4LB6B 2QYOA 2NAZA 3C1DA 4TV7A 4P9FA 2FU4A 2YPRA 1FBUA 4LK1F 2L54A 4IPAA 2X4HA 1WQ2A 4KFCA 3DPLC 1USSA 3R0JA 3BROA 1IW7F 3MEXA 4U0WA 1VTNC 4A0ZA 3IRQA 3RKYA 3GZ5A 1JE8A 2ADUA 4L0ZB 1D8KA 4WCGA 3KP3A 3PFIA 5ICEA 1ZG3A 2ZNYA 4IJAA 3VFZA 2UWMA 2W25A 4U7DA 4A12A 1P6RA 3FM3A 1R5HA 2ACJA 3RKXA 4EV0A 1QO0D 1O3QA 1HW2A 1FSHA 2DBBA 3WTVC 3EETA 3SQNA 3HYIA 5D5VB 3N97A 4HDVA 1HXDA 1QZYA 4L9JA 1XGSA 2VONA 3I4PA 3I59B 2RQPA 3BJ6A 1ULYA 1REPC 5ICGA 1GXPA 2ZNZA 2QENA 4PGGA 1ZHFA 5LBQA 2FQ3A 5AIQA 3F22A 2QQ9A 4XBFA 2GIVA 2JZYA 1LNWA 2NNNA 3KE2A 4CICA 2CO5A 3L9FA 1SMTA 3DXJF 1J2XA 2HFHA 3IHUA 4DQ2A 1G3TA 1YLFA 2DTRA 3H92A 3QPHA 5ERIA 2PI0A 1SD7A 1ZYRF 3S2WA 1TQMA 1XMAA 3CUQC 1YS7A 1XSVA 3HRUA 4MHGA 1KU9A 1W4MA 1YFHA 3K2ZA 5F64A 1D8JA 4LLGF 1SFUA 1FSEA 3VOEA 1IN7A 2JPCA 4EM0B 1F1ZA 2R7FA 2RDPA 3EDPA 5ILUA 4O5VA 1W7PA 3E5UA 4AD9A 4M72A 3BPVA 1XMKA 3BPXA 1DPRA 3QU3A 2L01A 2XASA 4RB2C 3DFGA 3M8FA 1T6SA 2P6TA 4HX4A 5BMZA 3RKWA 1ODDA 2BYVE 2PG4A 5HS8A 5DDGA 1K6OA 3F8CA 2MLKA 3F21A 1T0FA 2F5EA 4EJUA 5TJJA 1STZA 4KN4X 2VBXA 4M6XA 4AIKA 3CTAA 1FPQA 2WV0A 4AWXB 1TLHB 2P7CB 2DQLA 4HQMA 3O6BB 1ZRFA 5HLHA 3KCCA 1IN6A 5LHGA 3ABTA 1Z91A 3J80K 4U88A 5BS6A 3GWZA 2G7UA 2R7DA 3M7GA 1FYLA 3LAPA 3O2PE 4OIQF 2PFBA 1KU3A 1ON2A 3KEQA 2K7LA 1R00A 1XB4A 4G6QA 3I5UA 4ENJA 3KLNA 4HF2A 1PP7U 1K78A 2XGXA 5LEJA 1XDUA 1Z7UA 1KA8A 2HQRA 4YG2F 1YW8A 4FX0A 1S29A 5ICFA 2XAJA 2Y48A 1U2WA 2EFOA 3BDDA 3R6SA 4XLPF 5DUIA 1I1GA 5FFXA 1HW1A 3CDHA 3BJOA 2K86A 4ZYHA 2ZMEB 5DV5A 4ZZLA 5ILVA 2O61A 2K27A 1R1TA 3O3KA 1BC7C 5D8LB 5DUKA 5F1RA 4WXDA 3MWMA 1J0RA 4KT5C 3GYHX
chains in the Genus database with same CATH superfamily
4QPOA 1T0FC 1TW2A 2DMPA 2KZVA 4LITA 5EZGA 2XAGA 3FWEA 4LLNA 4HDUA 2HDCA 2DA3A 1RPWA 1WKMA 2V7FA 1PVEA 2KP6A 3V8KA 3NEUA 4RLFA 2O7OA 2IEKA 4LGWA 5KVRA 5J4VA 5M5XJ 3H5RA 3ZQIA 1G4DA 5J8FA 5CQGA 1J59A 1FMVA 1IF1A 2F2EA 1G2HA 3CJQB 3CC2I 5DD8A 3L2QA 4UXNA 3A0HC 3RSNA 2JUGA 5DEQA 3AKZA 5L3BA 3ZQHA 1OCPA 2IPQX 2A3SA 4PJNA 5E1ZB 5J47A 3K70C 2R7SA 3Q9SA 2HPMA 2TCTA 2FBHA 1J75A 1B72B 2MD5A 3WE2A 1J5YA 2VKHA 3GCMA 5F6FA 2XSJC 2X1EA 1JXSA 1I27A 2KISA 4XN0A 1NK2P 2IJLA 4G94A 2KKOA 1WI9A 2M4GA 4C30A 2Y0SN 4NB5A 2DW4A 2QCOA 4XOPA 1T2KA 3PO2J 3ZQFA 2J5PA 4ZYGA 5DS9A 1W5SA 2LK2A 2VBYA 2OQRA 2GXAA 3TO6A 4QTRA 2BE5F 3SZGA 4UVCA 2PJRB 4LMYA 3GVAA 3JRCA 1JT0A 2VI6A 1IN8A 4M9ZA 2QKMB 1MGTA 2J5OA 4PK4A 1FT9A 2P7VB 3DV8A 3HGYA 3ZMSA 5JVTA 1UZCA 4DJAA 3DTEA 4D5FA 1ZG1A 2EINH 3FM5A 1ZARA 3OYBA 3CJTB 3KYLA 2FNPA 2QWWA 4L9TA 3DLAA 4UUTA 4ZZDA 1Z0XA 3ISPA 5E18F 2E1MC 4U7BA 3ABUA 3M8JA 4XL9A 3OL4A 4HYEA 1E17A 1RI7A 2XF7A 1W36C 2NVTJ 2NS0A 4HQEA 5D6EA 1LFPA 1OFCX 3Q5FA 1ZAOA 2OUMA 5KAIC 1E3OC 2JA6J 4A3GJ 3IV5A 4M6YA 3BOQA 5IYBJ 1XC5A 1T56A 1Y8RB 3PQJA 2F5DA 2XRNA 3JTHA 4F55A 1U6GA 1HC8A 4XMYA 3BZCA 1LKXA 1D5VA 3BR2A 3HUGA 2WAEA 1UB9A 4RGRA 4KMFA 2E2JJ 4RB3C 4G7OF 3CMAI 2EJRA 3FHNA 3NWTA 4ON0A 1N75A 2DOAA 3HC7A 2KIQA 1DQUA 5JR3A 4OWRB 1I6HJ 5IT9Z 3HM5A 2XAHA 2NYXA 3LNQA 1JKQC 1XX5A 1GUUA 1MMNA 1ETKA 1WFXA 3F3XA 1AU7A 2E1OA 3GFMA 4OMZA 4LOCA 4CZCA 2LREA 1H89C 1V3FA 4G9YA 1SEUA 1Z7LA 4CDGA 2V9KA 5E17F 1BM9A 1G8XA 2LY2A 3AG2H 2JSPA 1MBJA 2DMQA 1F5TA 1TL8A 3DF8A 2V9VA 3REOA 4XRSA 2D45A 2V1XA 2Z1DA 4Q5SF 2RNJA 4XRSG 2K3FA 2PX9A 4HPQA 3HOXJ 4KIBA 2FMLA 4KNYA 2LH9A 2EA2A 3NARA 4EJOA 3DTIA 3IH2A 3C7JA 3I55I 1K83J 2CFOA 2WB1A 3ZMDA 4B43A 5EG0A 3S1MJ 1OKRA 2BVMA 1ZH5A 4IHVA 2K9NA 3RCOA 1D5YA 2R5YB 3J7AO 1ZR4A 3IC7A 3CF2A 4RM2A 1P2FA 3A02A 1IXRC 1VQMI 2W1OA 1R58A 3H0DA 3AFHA 3H5NA 2WWYA 2NS7A 3LFUA 5L3DA 3ZN1A 4XICA 4JOMA 2PN6A 4WXCA 3CDIA 3JAMK 3WU1B 2COMA 3MQ0A 3HEFA 4P1WA 3JW4A 3OOPA 4ENNA 2VE8A 2XGEA 4GYIA 5HLIA 5FB2A 3PSFA 3K1NA 1AKHA 2NRAC 4IXAA 1A6QA 1XDSA 2DQRA 1RUOA 1OYIA 5CLSA 1RZ4A 4H0EA 3LMMA 3O8HA 4R79A 2A5WA 3NAUA 3B6CA 3D1NI 3ERED 1V54H 1ZK8A 1WJBA 3BG5A 3KLOA 3HOVJ 1BI3A 3MN2A 1KU2A 4IHTA 2COBA 1P4XA 5LLQA 2M0CA 2JUCA 2R7VA 2GQQA 2P6SA 1XS9A 2HI3A 2EILH 2DMNA 3HBLA 3RYPA 1IO2A 1BJAA 4EJVA 4CHUA 4CA0A 2W82A 2VQHA 2CSOA 2IA2A 2YX7A 4CZZA 5EJCA 3H3ZA 2L0KA 3CQZJ 1L0OC 2CH0A 2V6CA 3P9IA 3GFIA 3TW6A 3ZMVA 1S7AA 2Z9OA 3PJRA 4BAYA 4X6AJ 3RPQA 2XGCA 1IAWA 1MZBA 2BZTA 2RAEA 4UB6C 5LHHA 4QLCU 2JSCA 3EPZA 4F3QA 2IBDA 4RB0A 3CCUI 2VKVA 4Y17A 4L9NA 5CJ9A 2MLGA 1GV5A 3WTZA 3CCRI 1FMWA 1B6AA 5EG0B 3HRMA 3QOEA 1MSFC 4AVPA 2RKHA 3KETA 3L2CA 3W2AA 1MBFA 1V5FA 5DYMA 4RMNA 3L2VA 2IS1A 1SFEA 3G73A 5CKTA 1YTYA 5FLXZ 5FKLA 1G3SA 2XPWA 2DN0A 4MFDA 2CQXA 2LY1A 5IY5H 3J81Z 2O03A 4U0YA 5GADJ 2NVUB 1VQLI 3BWGA 3ZQCA 1G3YA 3HSRA 2H09A 3OMYA 2VN2A 1R5ID 2OD5A 5H6QA 1AKHB 2JVGA 5HOOA 3R4KA 4XLEA 4NDLA 3ZXSA 1WH5A 1IXSB 2ZXJA 3HKZA 4AIDA 3MKYB 4J00A 1MSEC 4XKWA 4ABZA 5EGOA 1FLIA 1MBHA 4LIVA 1FIPA 1B9MA 1PYVA 2Q8KA 1VQKI 4XOTA 4OIPF 2PMZA 1ZGAA 1MJBA 4HNVA 1SAUA 1S6LA 2NS8A 3EUHA 3SDGA 2ECCA 4IX7A 2IS2A 4YFXF 5E20A 5D5XB 3BR1A 2FOWA 3RJPA 5B1BH 3AL0B 4BQNA 4DW6A 1WJAA 3ZCOA 2MG4A 1XTAA 4ZH4F 1LFUP 2GBYA 2V9PA 2DA4A 2X85A 3KZZA 4D7NA 1J7KA 4GCVA 1BIBA 1Z6TA 3HSFA 2R7XA 2EFNA 2CS3A 2PEXA 1ZTRA 1FC3A 4ZYEA 3E97A 1QA6A 3AG1H 4P5OA 4N4NB 4A6DA 2UXXA 3LSTA 5IOYA 4L5IA 5K7FA 1QU3A 5GPAA 1MDMB 5FROA 1DU6A 2E35A 3RPUA 1Y56A 4HNUA 4N4OB 5EEAA 2KIFA 2QBYA 1TWFJ 3FXKA 1EV7A 2HGCA 2V1NA 4YIRX 2VXZA 2EV0A 4D0PA 2KPMA 2CWEA 4IRGA 4DBQA 4KUMA 3M1CA 5H20A 3Q3SA 2PJPA 4WF2A 5F08A 1JJ8C 1OMIA 2CW8A 1W5TA 2ID6A 4XIDA 4ZTFA 4D7MA 1H0MA 3OYMA 3K69A 1R22A 4DGWB 2XSDC 5FFZA 3L7WA 4C2UA 2HYGD 3OYKA 4G6DA 1IRFA 4XONA 1ZRDA 2HZTA 5HDGA 2CV1A 3NQOA 3WTSC 3ABKH 3K9TA 3LQRA 2HQAA 2BHZA 2YX4A 1LDKB 4BHCA 1N78A 1WGXA 2HR3A 1HKQA 2DPUA 2GM4A 3SEQA 2JK3A 2XB0X 1W7PD 3FZVA 4CO8A 3IP4B 3I53A 2IRFG 4UUVA 4FTHA 3PUBA 4NBQA 1GDTA 5GAGJ 2QVOA 4YIFA 2A6HF 3W2VA 4ANJA 1RUNA 2ZXIA 4YEJA 4A3FJ 1LJ9A 3DBRB 4P55A 1FZPB 3TOBA 1WPKA 5KCMA 2OA4A 4ZC3A 3LA7A 3R61A 3OV8A 4CGZA 2QLZA 3WTUC 1Q1VA 2W48A 1R5GA 4Q48A 4Y7NJ 2WY7Q 3GFLA 3VPRA 4B44A 2HTJA 4A5NA 3E6MA 3RTRA 1MW7A 1MNMC 2O6GE 2KJBA 1TC3C 4ETSA 1R4MB 2IS6A 2M30A 2CRGA 5L3GA 2IGKA 4RB1A 1O3RA 2XAQA 4I7HA 5CVJA 3VB2A 4L5JA 4LFUA 3CC7I 4O3MA 3ZRGA 5LGTA 2HOEA 3K70D 3LSIA 1SFXA 1A04A 1BW6A 2QBYB 2BEOA 2VPLA 2WAQN 1Z3YA 1O3SA 2H1KA 2P5KA 4HX8A 3BP8A 4MLOA 1NTCA 2JPBA 1FBSA 2ZMEA 2CFXA 2LG4A 3MMYB 4K2EA 3JSPA 3TO9A 5HODA 2BW3B 4Z2YA 5F1JA 2CUEA 3DEEA 1WJEA 1OLTA 4GO1A 2ZJPF 3HPGA 4ESBA 3ZMZA 4L9VA 2L7MP 1PP8F 1P4WA 2QQ8A 4H4KC 1Q1HA 2E5NA 2EA4A 2O8KA 3K0LA 2VASA 1TBXA 1KYZA 2MA3A 4BY7J 1IDYA 2L9VA 4A6EA 3BC8A 2QQAA 3BG6A 4L18B 3W6KB 1BI0A 3LA3A 2OAZA 2KZGA 3FKJA 3HHHA 5J1RA 2LKXA 4BBSJ 5TRDA 2A6TA 3ASNH 4M9SA 4DNCA 1Z6RA 2Z3YA 2C6YA 4B8XA 3KEOA 3F8FA 3JTGA 1OPCA 2H8RA 2ZB9A 2QZ8A 4JBAA 3LSRA 3HTSB 4A0YA 1XG1A 2FE3A 1ACIA 2O9LA 1W1WE 2RREA 3QU6A 3CJNA 3LA2A 3KX2A 1HKTA 3FXQA 4B1RA 4GGGA 2I8DA 1X1PA 3GBGA 1IGNA 4EM1A 2EZIA 2YU9J 3G1LA 3GUDA 5BPDA 1FYKA 4YFNF 1X4OA 1Y0NA 3SXYA 1JTXA 2ZFUA 4YIIA 3DU6A 2M8EA 2IS4A 1U8RA 1D1CA 5IP6A 2M4KA 1ZKGA 3LSKA 1JT6A 4KIGA 4M3DA 4A2UA 3QYFA 4XLFA 3CCLI 4BQOA 1RIOH 5AIPA 1H8AC 1TTYA 4HEA2 3HIFA 5F0CA 4CCOA 2UV1A 4E7LA 2HXOA 3KYCB 2F6CA 2XUBA 3H9JA 3D5SC 5HS7A 1KQ8A 2R7QA 2XDVA 4RAZA 1SVMA 1LB2A 3I56I 3OS1A 1B8IB 2DXIA 3K1MA 4A3EJ 1X4PA 4LK0F 1N77A 3VODA 1NHAA 4HX7A 4AUXA 2M7BA 3HL2A 3KP2A 1H9GA 2GWRA 2BV6A 2F4MB 3LOCA 3E6CC 1Z05A 2A05A 2PLYA 3DU5A 2HQNA 1U8BA 3FMRA 2CUZA 1Y1VJ 1R4NB 2BBYA 2IP2A 3H1CA 5L3EA 4Q47A 3FXLA 4RAFA 1AWCA 1VQ8I 4E7IA 4ESFA 1GHCA 2FBKA 1JUMA 2ZJQF 4JX6A 4PFPA 1B1BA 3JRDA 1YIOA 2HS5A 2P4WA 1B4AA 4UV8A 4DYQA 4MQVA 3U21A 3V4GA 2VOOA 3GTPJ 4KN7X 2L7FP 4B3AA 1NK3P 3K1PA 2ZMEC 1S7EA 1GV2A 1FJLA 4J19A 4G8XA 5FLVA 1VQOI 3MAJA 2HDWA 3FXUA 4FETA 4WXHA 3GZ6A 3HPHA 4MNUA 5JHUA 1E2XA 1WHUA 1X58A 3ML6A 2L9SA 1QBJA 1BW5A 1MNDA 2D1HA 1R9TJ 2RVCA 5BOXA 3PM1A 4MQ9F 5HLGA 3CESA 5CVVA 4BNCA 1PDNC 4ITVA 5IP7J 1ETXA 2QSGX 1BBYA 2ETHA 3KZIC 3WTTC 4HW0A 3V7SA 3VSKA 2ISZA 2M2EA 2V79A 3A1YA 2A61A 4BEHA 1ZLKA 2EV5A 1XSXA 5E8IA 2KRHA 4MGRA 3FXOA 5J8CA 4RS8A 1A6IA 2PMHA 2Y75A 5AONA 2PQ8A 5CYVA 3QPSA 2M5WA 4OMYA 2DOEA 1E3HA 2YU3A 1XPXA 3M3YJ 1X1BA 2CYYA 4Y13A 3S2DJ 3VYUB 2DOFA 3V42A 4M9XA 4BEHB 3NWSA 3C3WA 4MTEA 4E7ZA 1SFKA 4P96A 2X6XA 1PUEE 1WZ2A 1FOXA 4W97A 4OINF 3G2BA 1SC7A 1YS6A 1WH7A 2ZFWA 1OISA 2EWNA 2DODA 3T8RA 2KLOA 1SAXA 3H3VK 2CGPA 4WWCA 3Q0VA 5K7ZA 1W7PB 5FO5A 1JGSA 4MTDA 1OYYA 1TW3A 3B73A 4ZDPA 2R3SA 3MKLA 2BY1A 4Y52J 2K02A 1P9QC 1R7JA 3L2RA 4YRVA 2OCEA 2CW0F 3DQVC 1R23A 3W6JB 1Y1WJ 3ZQ7A 2BXZA 1ZGWA 2MD0A 3CCQI 3GLXA 1WJCA 2IGOA 3E6DA 1IC8A 1ON1A 1MNEA 4M73A 2EK5A 3K2AA 1OCCH 3H9QA 3H3UA 4F7ZA 3ESWB 2M45A 1VI0A 3TDZC 2XAFA 4FT8A 4BHPA 2D5VA 1ETVA 5JLXA 1LPQA 4BL0B 1X3UA 2WC2A 4DZJA 3I0TA 5A2QZ 1T98A 1XCBA 4G7ZF 3IUOA 3FXRA 3W3CA 1QHGA 3C2GA 1OYWA 1YX3A 1SANA 3DEWA 4I76A 4RGXA 4LB5A 2JRTA 2NOJB 2R7UA 1X2MA 3HHGA 2CV0A 3JRHA 2BGCA 2XKPA 3A4CA 1YOVB 3I71A 2EZHA 3BY6A 4CXFA 5C4JJ 3HOWJ 3F72A 2R92J 1SD6A 2G0EA 1Z67A 2F5VA 2K9SA 5GAEJ 2V1DA 2F4IA 3OL3A 4DOZA 2LR8A 1WCMJ 1WSUA 4HOBA 1O57A 1HSTA 2KDOA 4BU2A 1KQ9A 4S04A 4ESJA 3MCZA 1BIAA 2VE9A 2FBIA 3ZPLA 4IRIA 2WB1N 2R5YA 1W36D 3H36A 3DKYA 1LUJB 2JTVA 1QVTA 2K85A 2H6BA 3EQLF 3HUGB 3ZMTA 3WTYC 2LD5A 3WHBA 5E3NA 2V6EA 2ZSHB 3KZYA 1XMXA 1DP7P 4ZDOA 3P7NA 2Y9YA 3GTJJ 5CVUA 1QZZA 3BR5A 3BCBA 2BVLA 3CUOA 1O7LA 2EBIA 4BJTA 2R7WA 3FDYA 1ZGJA 2KMUA 1TQIA 3C2HA 4I0BA 1G59A 5J1YA 1A31A 2OQGA 1YHQI 1YRNB 2VOPA 3BTJA 2LOOA 1K6YA 3A0BC 2G9WA 3ECHA 2ICWG 2NVYJ 4EJWA 2Q2EA 1I1SA 1P4AA 3TGNA 3K7AJ 4N9IA 4XSZF 3T0YA 2XC7A 5GPCA 3OIOA 3Q0UA 3CUQB 2HNHA 3LSGA 2HOSA 2CQ7A 4AIHA 5BPIA 3I3LA 9ANTA 3DPUA 2HKXA 3ERMA 4E7KA 1AHDP 1C0WA 4XLCA 4ZYDA 4BS9A 2MBFA 3E3VA 3TDUC 3SJMA 1YQAA 4YELA 2IA0A 4F91B 1FX7A 4AVZA 1UFMA 3ZMUA 3MKWB 1K4SA 1H88C 1VQ7I 2CQNA 2DPDA 3VYSB 3SZTA 1WRJA 3ZQLA 4EVIA 4HV6A 3T1BA 3OIPA 2VC0A 1YG2A 1YJWI 4C9YA 4BE0A 2E1NA 3EUHC 3CO7C 4QPQA 3R0AA 3OYJA 2HDDA 2R5ZA 1IRZA 2BY3A 4OU0A 3NRVA 1X1AA 3OR1C 1KGSA 4CH7A 3GMEA 3FBIB 3K4KA 1WI3A 5HVQC 5J40A 4FE7A 2L7KA 2KJCA 2W7NA 3HRTA 3T8TA 4C3HJ 4I09A 5J1UA 3L1PA 2VODA 2VPRA 3CZ6A 2HPIA 3JSOA 2QUFA 1ETWA 3SFZA 2PMUA 1RNLA 2K4BA 3TP3A 4BXFA 1IUYA 2F5FA 2LC2A 1U5TC 2HTSA 2ZBKA 3IH3A 2IA1A 1SD5A 1U78A 2MGQA 4XKVA 2Z99A 2X6YA 3PNVA 4Q4ZF 4LG0B 2ZC2A 4HAMA 2JA2A 1FP2A 5D6FA 4QWQA 4BACA 1QPIA 3CC4I 3IKVA 1U9OA 3TKYA 3WE3A 2NNYA 5K1YA 5HLTA 5TGTA 3V8JA 2ZKZA 3GF2A 5EF6A 4I02A 3M07A 2HVRA 5D5WB 2M3AA 1GVDA 4V2FA 3Q9VA 5DCMB 2FMYA 3IWFA 2L9NA 1V5GA 5LRRA 1JTYA 1ORKA 2VB6A 1J9IA 2STWA 3LL7A 1ERDA 2GA2A 4B09A 3ELKA 4A5MA 2MYSA 4MEXF 3UKGA 1T8IA 2A6EF 3JCUC 2W4SA 2XB5A 4R1HA 2FRHA 5FD6A 3HOSA 2DJNA 3F6OA 3M8EA 1MMGA 4V2GA 4FCYA 3KP4A 3MZ8A 1IRXA 1TZLA 1HSJA 2UXNA 3CCVI 2CG4A 4I2OA 5ICCA 1MD0A 2DFIA 4WX9A 3CMMA 3SHFA 5A2QK 4IKFA 2ELJA 5FLXK 3G1OA 3IRRA 1Y39A 1VNDA 5B3SH 1IJWC 4V19K 5GAHJ 4PCQA 2VT3A 2EFQA 4PDKA 3ASOH 5M3MJ 5FD5A 2L4MA 4CSWA 3S32A 4XORA 2FEZA 3ZOBA 2L5QA 2L7ZA 2FXAA 4YFKF 2LY9A 1HBXG 2P5VA 5K7HA 1X19A 2JT1A 2VJJA 2BHYA 4KISA 2LNBA 3WU0A 4HF0A 5E3LA 3AG3H 1XGNA 2O0YA 2X1DA 1JUPA 3I64A 4PGHA 5E1WA 3OWTA 1LE8B 1BL0A 4A93J 1D3YA 1SVLA 2OCCH 3QP5A 3A01A 1DP3A 3RI4A 1BOAA 2JRMA 4DZPA 2EZLA 1I6XA 1UHWA 2FA5A 3CLQA 4A0XA 3G71I 5M5WJ 2EFWA 4G7HF 3KYDB 3S15J 2OU2A 1OCRH 2R7OA 2OPTA 3F8NA 1IRGA 3ECOA 3WHCA 4FISA 2K9QA 3V7CA 4FX4A 1F4KA 2DFEA 4PFOA 3FXJA 4B48A 5HDKA 3V7RA 3RDIA 1V4RA 3GX4X 4N9HA 1FIAA 2AHQA 1CGPA 1D1AA 2CW7A 5CVRA 1K78B 2B0LA 3HRSA 3HOZJ 4MO7A 3S93A 5EGOB 1T38A 5IYCJ 1ZN2A 1O4XA 2QSFX 3K4CA 3VEPA 2E34A 4A3JJ 3JRIA 1Y8QB 2XPVA 3BG9A 4AM3A 2AQEA 1POGA 3FISA 3GW2A 4XQFA 1FOKA 2VKEA 1FP1D 2HEOA 4E70A 1USTA 5DTDA 2LBFA 3L00A 4R8HA 2E1CA 2GIZA 2VBZA 1X1DA 2FUG2 2WY8Q 1S3JA 2LDUA 3J7YJ 1ETQA 1U5TA 1FBQA 4GYGA 4PSWA 3L2UA 3J80Z 3JAMZ 2G7HA 4AU7A 4A3DJ 2H27A 4UNOA 4RA2A 1JKPC 5F0FA 4CCJA 2YS9A 5JFRA 3WTXC 1XN7A 4Z6YA 1S72I 3K6GA 4C2TA 4KYWA 3KIOA 2MFZA 2E2IJ 1OCTC 2CU7A 1EH6A 1HCRA 3FKIJ 2STTA 4IOAF 2HVQA 2PBIA 4FQGA 1FOWA 1ETOA 4U0VA 2R7TA 5BQTA 4AIJA 1R36A 2L02A 3S8PA 2NXNB 3FF5A 3F23A 5LGUA 1PUFB 3QOPA 3COAC 1RKTA 2D1VA 1X3WB 2O5RA 2LKPA 2D2WA 3GZNB 4AYBN 3OYGA 2V1UA 5D8KB 2HXIA 4HLYA 4RAYA 3SZPA 5HNFA 4KIFA 2AQFA 3PSIA 4CCMA 2R4GA 1DPUA 5KAFC 3MFKA 3EYIA 2A68F 2CV2A 4IF4A 2A07F 1YW9A 3L09A 3TQNA 4CYDA 3S1QJ 1B8IA 2JQ7A 3P5JA 3WTWC 1Y0UA 2A69F 3GTQJ 3F6VA 5LGNA 2EFPA 2OF7A 3PQKA 3R60A 2K4JA 3CD6I 3IWZA 4IEJA 5DCFA 5K5OA 3OYIA 5BNGA 3LSJA 1KQ0A 1SD4A 1ZG5A 1Z21A 1MBKA 5J6XA 1O3TA 5HDNA 1K79A 3I58A 2HYJA 3HDDA 2AXLA 2VIXA 3ULQB 3BZ6A 2H94A 2VJIA 4RLQA 4BXUA 5L3CA 1LVAA 4BKXA 3LFKA 3GFJA 3AG4H 3OYLA 4X1EA 1CF7A 5CQEA 5K5QA 4IRHA 4C3JJ 3D0SA 2W84A 1J09A 3G3ZA 4A3BJ 1TT5B 3C18A 2E5ZA 2XF6A 2LSOA 2HOAA 2Z33A 2DA5A 4PZJA 3DEUA 3CF5F 5HNHA 3ONQA 1IV8A 2GA1A 3E5QA 1ZLJA 4ASNA 2RV8A 3D5RC 4D5CA 1MJ9A 4M3GA 2K40A 2HKOA 2M87A 1R71A 1B59A 1JGGA 2O3FA 1MKMA 3V8LA 1IXCA 2ZJRF 2FF4A 3WGIA 4CUGA 1MJAA 3TEDA 1NG6A 4AC0A 2VLAA 4JYKA 1XCVA 2N8GA 5DM7F 1BI1A 1XD7A 2Z5UA 3QYBA 5IYDJ 2DO7A 2ID3A 3AAFA 2A5YB 5JHFA 2DK8A 4E4HA 4EGZA 3FK6A 3N4MA 3JREA 2QKLB 2E19A 1K7AA 3E6BA 1YJNI 1ZREA 2OZ6A 3PIOF 1BA5A 1TNSA 1B9NA 3PNYA 1TNTA 4HBLA 5L3FA 3WU2C 1IZ1A 2XHKA 5KNLA 4IQJA 4NHJA 1LVKA 1QGPA 5TISC 3W6VA 4BHBA 4RM3A 2Y30A 1HQCA 2ZJ2A 3DBHB 2JJ7A 3QPLA 1EA3A 2X0LA 3FMQA 1OJLA 3LQQA 2WAQA 3HOUJ 5D5UB 2FSWA 2VQCA 1UG2A 2ZO4A 3K4MA 4IHWA 3I4NJ 2X6OA 4UV9A 2KIMA 2JA8J 2QGUA 5DCMA 4XKBA 4OIRF 3CUQA 2X6WA 4BH9A 3CDLA 3KP6A 4X0GA 3FBNB 4XM3A 2ELKA 3LSHA 1EJ9A 4EMSA 3CCYA 1BR4A 1YW7A 2KQRA 1RR8C 2M7AA 5C4XJ 3QPTA 4BY1J 1I3AA 1D0XA 1T08B 2ZXHA 1ONVA 2MC4A 4LG0A 4M71A 3QYEA 4NC8A 1P92A 1UMQA 2AS5F 3CLOA 2DLLA 1F9NA 2LKSA 1BOBA 4I99C 2IVMA 2M9HA 3WGGA 3CCEI 5LRSA 1N25A 2HOTA 2XKOA 4PSXA 2JWTA 4J01A 5FKNA 2H8WA 4A3MJ 3OSFA 3I59A 1WJ5A 1TQPA 3K4NA 4I6ZA 1B72A 1I50J 1NG7A 1JI8A 3BQYA 1XGMA 1TT0A 3VDXA 4UHTA 4HLXA 5IT9K 3BQZA 3IKTA 2DK5A 3JRAA 5LFAA 2IT0A 3BJAA 2K9LA 2W00A 3FIWA 5EDNA 2HVSA 2L9RA 2GLOA 1QRYA 2XF5A 1JHHA 2LFBA 2PJRA 3BCAA 1S8NA 1X3ZB 2KFDA 4PJMA 2DYSH 4Y15A 5HS9A 1DGRM 4EM2A 1RESA 5LD2C 2B63J 1QPMA 2V4JC 4G6TB 5D4SA 4F93B 4IHXA 3KEYA 1WWXA 4IZZA 4M74A 3KP5A 4BQAA 1X1CA 2XV4S 2WTEA 1O7FA 4MFEA 2JVHA 2ELHA 2DU9A 2TRTA 3I54A 1LEBA 5F04A 2CQKA 4IHSA 2Z16A 4JP0A 3PIPF 1CF7B 2HYFA 2P8TA 3F8MA 2DAOA 3HXLA 3J7ZI 1KYWA 3FHZA 4HNTA 4IVNA 1H9TA 1T95A 2DFHA 3ABLH 4BE2A 4E7HA 1A5JA 3S1NJ 2MH2A 2MABA 3GEZA 2E7XA 4CCNA 1K4TA 1TWAJ 2F5CA 2UZKA 3WG7H 2QA4I 3I9V2 3P9CA 1KU7A 3H5AA 2E7WA 4E6KG 2M1BA 2GXBA 3WGHA 5EEGA 3KFWX 3QODA 4FASD 2HWVA 3MD2A 3WG9A 4KMUX 1JHFA 2DT5A 2OBPA 1P7JA 1VQ9I 1ENHA 2MC3A 1U9NA 4DYRA 4HA8A 4A69C 1IUFA 2YR2A 1FYMA 4KA4A 1HKSA 1Z9CA 1W5CC 2HQ5A 4BYYA 4FE4A 1WJDA 1I5ZA 4F92B 2Y9ZA 2HU9A 2LYCA 2LLKA 3FX3A 4HV5A 1UHMA 3U1DA 2EZKA 4NQWA 1GVJA 5E1XA 3U9GA 4UUSB 2ZXWH 3MKZA 3PO3J 2ESHA 2GAUA 2K3PA 3T5XA 3L2WA 4O6JA 4XLNF 3HG9A 4HZFA 3LAJA 1WVRA 1YYVA 4Y33A 1DDNA 4LJZF 5LHIA 3E0JB 4Y3OA 3E1SA 5FJ8J 1AOYA 1G6NA 2Q1ZB 1U0JA 2ESNA 3TOAA 4EQQA 3OOUA 4LD5A 1DUXC 5FRMA 3ZP5A 2WV1A 1UHSA 3ROUA 2VUMJ 2BOLA 1LDJA 1TWHJ 3HSEA 3DBLB 4FHTA 3VYTB 3QAHA 1DGWY 3HTUA 4I98B 4BGDA 5C3EJ 3S14J 1I3QJ 1U5TB 3N05A 2LF8A 1D0YA 3CCJI 1ETYA 4ENMA 3GTOJ 3DPTA 2FJ1A 3DP7A 2XIGA 4RAGA 2GZWA 4L0YB 4WK8F 1L3LA 1IN5A 2VC1A 5DD4A 4AYBA 3KP7A 3BTCA 2W24A 3S16J 1R1UA 1BN5A 4XRFA 4LLLA 4BDYA 5M3FJ 3OYDA 4PJLA 2QF7A 1JKOC 2QQBA 2W85A 2WAFA 3VWBA 2OZUA 3J81K 2E1MB 2O8XA 1PUFA 5H6RA 2WA0A 3B02A 4DYCA 1LDDA 1T39A 4EEFG 4PJJA 3CJRB 3OY9A 5F27A 4MEYF 4ZJZA 2VBWA 5EEHA 5FGMA 4UVBA 1P7IA 3SFIA 2KDZA 1MDMA 2LP0A 2QEXI 3GTMJ 4OOIA 1R49A 3IL2A 3OYCA 2FOKA 4P9UA 2DFFA 2RGVA 4BBRJ 2YSRA 1OR7C 2WADA 5C44J 1LQ1A 1OR7A 2EIMH 4M6VA 3GXOA 5ILSA 2MSYA 1GLNA 1SMYF 4XSXF 3WODF 1D0ZA 4GXOA 5D4RA 4I0AA 2R7ZJ 2X51A 2RQQA 1F36A 5FRNA 3BR6A 5E3MA 1EH8A 1YIJI 1UAAA 3BT9A 3GO5A 1BI2A 4XRMA 2DDBA 1SFOJ 1I39A 1ZRCA 1YI2I 2LMDA 3HKZN 3M4OJ 2TDXA 4HG2A 1TP4A 1UJ8A 3OS0A 1QQIA 2B9SA 1YITI 3HOTA 4CCKA 1UG0A 2VT2A 1JUSA 3FMSA 2CJJA 4E7JA 2EV6A 4S0HB 4I01A 4KICA 4KJZA 2KRFA 3C2BA 2L4AA 3M9AA 2P5LC 2IGMA 4OAYA 3H9GA 3ZGKA 1Z1DA 3S1RJ 3RIRA 1HDDC 5JI6A 2ME6A 2MH9A 3EYYA 4NQWB 3U2RA 2LF7A 3G4SI 1KZHA 1IN4A 3SEZA 3D5LA 3M1EA 4ZDLA 3QRFF 2DA1A 4M3BA 5H2FC 1QNTA 1RR7A 2EH3A 3DLLF 5ED4A 3HZJA 3F8BA 2RC4A 2XRLA 2FNAA 3GTLJ 2IAIA 2OC6A 1LFBA 3U1KA 2OTLI 2X1CA 4JQFA 3LSPA 1HW5A 2DI3A 2Q0OA 3BR0A 3UNGC 4A3CJ 4MIMA 3MZYA 4NC6A 1MBEA 2VQLA 5B1AH 1XGOA 1FNNA 3TO7A 4C2MJ 2OJED 3LWFA 2NVXJ 3OR2C 3ZN0A 2IXSA 2VKDA 1U3EM 4B47A 4M3EA 2R93J 1FWZA 1YJ9I 2UUZA 2L3DA 4NC7A 1FY7A 4JK1X 1GXQA 2ZSIB 3P9KA 2EB7A 2KRCA 1BC8C 4D1QA 1LEAA 4N0BA 3S2HJ 3HGGA 4S05A 4OIOF 1RETA 2ISYA 1NH3A 2IW5A 2ZCWA 4KDPA 1OCOH 2KT0A 3E5XA 3SYTA 3MZHA 2W57A 2Y0MA 5CVIA 4IO9F 2XVCA 1EH7A 2GXGA 2H6CA 3QP6A 4GFBA 2LVSA 3RYRA 5GTHC 2R7RA 4II2A 1R6RA 5LEKA 6PAXA 1Z77A 5B5EC 4PJ0C 4UVAA 4EJTA 2LRDA 1XSDA 1W0TA 2VQGA 1V5EA 1WJFA 4ENKA 1T33A 4LIUA 3VYRB 3PUFA 5E8GA 2X9DA 4RGSA 5KK1A 1VQPI 2I10A 1IDZA 4HF1A 1R1VA 1Z3XA 1S9HA 3H0GJ 3CO6C 5K5RA 4EGYA 1S7OA 1G3WA 2Z2SB 2RN7A 2OTJI 2FD5A 4BDZA 2KIUA 1YO5C 1IG7A 1RC9A 3DKWA 4RGUA 4JX5A 1LE8A 5IT3A 2H1LA 1UCRA 2QM3A 2JN6A 2XROA 4LB6B 2QYOA 5GP9A 2NAZA 3C1DA 1ZQ3P 4UY8I 2QSHX 4TV7A 4P9FA 5FKOA 2FU4A 2YPRA 2CMPA 1FBUA 3JRFA 4LK1F 4LG3A 1JJ6C 1JKRC 1MBGA 2EQRA 5CPRB 2L54A 2WBMA 2EIJH 4IPAA 5EYRA 2X4HA 4II3A 3JRGA 1K61A 1WQ2A 4KFCA 3DPLC 4EATA 2Y2ZA 4XLAA 3ZQQA 5IOZA 1USSA 3R0JA 4HSRA 1BJZA 4XN3A 3BROA 4RDUA 1IW7F 1HOMA 3MEXA 3OYEA 4U0WA 1BR2A 1VTNC 4A0ZA 3Q0WA 3K4BA 3KPHA 3IRQA 1HA8A 2MW8A 3RKYA 5FLMJ 3GZ5A 3TL4X 2DT7B 4IOCF 2DDAA 1MIJA 2NVQJ 1JE8A 2ADUA 3PFYA 4L0ZB 1D8KA 2JA5J 4WCGA 2DMTA 1E0EA 3KP3A 4XNFA 4NUBA 3PFIA 5ICEA 1ZG3A 1TWCJ 2ZNYA 1X2NA 4U87A 4IJAA 3VFZA 2UWMA 2W25A 3EUAA 3VSLA 4U7DA 4A12A 1P6RA 1QVUA 3FM3A 1R5HA 2ACJA 1FTTA 2DA7A 1EF4A 3RKXA 5DM6F 4EV0A 1QO0D 2IGNA 3MVPA 1YX5A 1V55H 1O3QA 3S3NA 1HW2A 3RZOJ 2DYRH 1FSHA 2DBBA 3WTVC 2Q2EB 3EETA 1D1BA 1VF9A 2JMWA 3SQNA 3CMYA 3HYIA 3GLLA 5D5VB 3N97A 1IV6A 4HDVA 1HXDA 3JR9A 2E2HJ 1QZYA 2I5UA 4L9JA 1XGSA 2VONA 3I4PA 2L2OA 2RQPA 3I59B 3BJ6A 1ULYA 1REPC 5ICGA 1VZ0A 1GXPA 2ZNZA 3TMOA 2GOMA 2QENA 3HB9A 1A36A 4A3KJ 1YE9A 3G6EI 4PGGA 3H35A 3DCFA 3UR3C 1ZHFA 5LBQA 3BZKA 2VJ5A 2FQ3A 4A3IJ 1BR1A 5KHDA 5AIQA 3F22A 2F4OB 2QQ9A 4XBFA 2GIVA 2JZYA 1ITYA 1LNWA 1QHHD 3O8GA 4GRIA 3EUKL 2M0MA 3RZDJ 2NNNA 4DBRA 3KE2A 4BXXJ 4BJ6C 4CICA 2CO5A 4XK4A 3L9FA 3I4MJ 3OYNA 1SMTA 2DJIA 4KT6A 4HSTA 3DXJF 1J2XA 2HFHA 3E7LA 3IHUA 4DQ2A 1G3TA 1YLFA 2CUFA 1UELB 2DTRA 4OAZA 4XLHA 3RQIA 3H92A 2JA7J 4A3LJ 3QPHA 2HZDA 5ERIA 4PUSA 2PI0A 1SD7A 3DWLE 3G1MA 3W2WA 3ZR8X 2E60A 1ZYRF 3RPUD 3S2WA 2M34A 4B4CA 2M8GX 3DTKA 5F0HA 1TQMA 4G12A 4BUPA 4B3XA 3X2QH 1RRJA 3OYHA 2X48A 1XMAA 3CUQC 4KITB 1YS7A 1XSVA 3HRUA 3IAM2 4MHGA 4ZTJA 2FX0A 1KU9A 3PNTA 1W4MA 1VQ5I 1YFHA 3K2ZA 3HJEA 5F64A 1D8JA 2LTPA 4LLGF 2EIKH 3PL8A 1SFUA 3AL0C 1PJRA 1FSEA 3VOEA 1IN7A 2JPCA 3FK7A 2DA2A 4EM0B 1F1ZA 2R7FA 4HRIA 1Y6IA 1VQ6I 1OQYA 1AA7A 2RDPA 2Y0SA 4BE1A 1YRNA 3EDPA 3BG7A 5ILUA 5B66C 4O5VA 4IHYA 1W7PA 3IH4A 5E3OA 3E5UA 4AD9A 2OV7A 1OCZH 5IP9J 1A35A 1MH4A 4M72A 3BPVA 1XMKA 1FOYA 2BXYA 3BPXA 2AXTC 4BQQA 1DPRA 2PMZN 3K4LA 2DA6A 2VL8A 2P81A 3QU3A 2L01A 3BLYA 1ZELA 3BG3A 2XASA 1QZEA 3IAS2 3DFGA 3M8FA 4E7SA 5FKKA 4RB2C 1MMSA 2RNGA 1T6SA 2ME0A 2P6TA 4HX4A 5BMZA 3RKWA 1ODDA 2Y69H 2BYVE 2DCEA 2PG4A 3OS2A 5HS8A 2BY0A 3RKQA 2VXDA 2KL4A 3F0CA 2P0WA 3S17J 3OYFA 5DDGA 1VQNI 4CYCB 1ZR2A 1K6OA 3F8CA 2MLKA 3F9KA 3F21A 3QQAA 1T0FA 2F5EA 4D9JA 3J7AY 4M3FA 4EJUA 5TJJA 1STZA 3DKXA 1KONA 3TP0A 3BTIA 4KN4X 2LBFB 4DIQA 2VBXA 3OIQA 4M6XA 5JLWA 3S3MA 3OYAA 4UB8C 4AIKA 4IQ4A 3CTAA 1FPQA 4CCLA 2ECBA 1FEXA 5J3LA 1TWGJ 2WV0A 2XPUA 2XAUA 5M5YJ 4AWXB 1TLHB 1MMAA 2FQ4A 2VJ4A 3RQ4A 2P7CB 2DQLA 4HQMA 1EKEA 3SDBA 3O6BB 4ZYAA 1ZRFA 5HLHA 3KCCA 1F43A 3GTKJ 1IN6A 5EZHA 3A2KA 3CP8A 1FTZA 5LHGA 2CQQA 1VFCA 2NOGA 3ABTA 3A03A 5GTIC 3OSGA 1Z91A 3J80K 4U88A 5BS6A 3GWZA 3ZQGA 1APLC 5JVGF 4GDFA 2G7UA 3K10A 1HF0A 2R7DA 3CCMI 3M7GA 4W1UA 1HDPA 2K5CA 4L5EA 1FYLA 3LAPA 3O2PE 4OIQF 2PFBA 3ABMH 4QIWN 1VQ4I 1KU3A 1ON2A 3KEQA 1GT0C 1W0UA 2K7LA 3GTGJ 1R00A 1XB4A 4G6QA 5E79C 2E71A 2V26A 1MH3A 3I5UA 2E36A 3B6AA 1S5LC 1DU0A 5FKMA 4ENJA 2DTZA 3KLNA 3CMEI 4HF2A 5IPAA 1PP7U 1K78A 1MMDA 2XGXA 5LEJA 2B7EA 1XDUA 1HLVA 3LSMA 3S3OA 1Z7UA 1SVOA 1KA8A 2HQRA 1M1EB 3CCSI 4YG2F 1YW8A 4FX0A 1S29A 2DMUA 2AO9A 5ICFA 2R0QC 2XGDA 2DT6A 4UUSA 2CUJA 1CQTA 2XAJA 3A01B 2Y48A 4Y4RA 1U2WA 2BY2A 2EFOA 3HOYJ 4JX4A 3BDDA 3FXMA 3R6SA 4XLPF 5DUIA 3BR3A 1I1GA 3TBIA 5FFXA 3BTLA 3QWLA 1HW1A 3CDHA 2BW3A 3K4JA 3BJOA 2K86A 2K9MA 4NNJA 4ZYHA 4XKCA 2ZMEB 5DV5A 3CP2A 2Y31A 2YUSA 5J4YA 4CYCA 4C3IJ 4ZZLA 2R5ZB 4F52A 5ILVA 2O61A 2K27A 1R1TA 3O3KA 1BC7C 2KHMA 5D8LB 1RKWA 2F48A 4XR6A 5DUKA 5F1RA 4WXDA 1E3PA 3TW7A 4BJ5C 3MWMA 4RBOA 4IL6C 3JRBA 1J0RA 4KT5C 2EPFA 3GYHX 2GOXB 4QSHA
chains in the Genus database with same CATH topology
1TW2A 2XAGA 3FWEA 4LLNA 4HDUA 2HDCA 1WKMA 3V8KA 3NEUA 4LGWA 5KVRA 1G4DA 5J8FA 1J59A 1IF1A 2F2EA 5DD8A 4UXNA 5DEQA 5L3BA 2IPQX 2A3SA 5E1ZB 3Q9SA 2FBHA 1J75A 2MD5A 3WE2A 1J5YA 5F6FA 1JXSA 1I27A 2IJLA 4G94A 2KKOA 1WI9A 4NB5A 2DW4A 1T2KA 2J5PA 4ZYGA 1W5SA 2VBYA 2OQRA 3TO6A 2BE5F 4UVCA 4LMYA 3GVAA 4M9ZA 1IN8A 1MGTA 2J5OA 5JVTA 1FT9A 2P7VB 3DV8A 3ZMSA 1ZG1A 3FM5A 1ZARA 2FNPA 2QWWA 4L9TA 4ZZDA 3ISPA 5E18F 4U7BA 3ABUA 4HYEA 1E17A 1RI7A 2NS0A 4HQEA 5D6EA 3Q5FA 1ZAOA 4M6YA 3BOQA 3PQJA 2F5DA 2XRNA 3JTHA 1U6GA 1D5VA 3HUGA 1UB9A 4RGRA 4KMFA 4RB3C 4G7OF 2EJRA 4ON0A 5JR3A 5IT9Z 2XAHA 2NYXA 3F3XA 3GFMA 4OMZA 1V3FA 4G9YA 4CDGA 5E17F 1BM9A 1F5TA 3DF8A 2V9VA 3REOA 2D45A 2V1XA 4Q5SF 2RNJA 4KIBA 2FMLA 4KNYA 2EA2A 4EJOA 3C7JA 3ZMDA 1OKRA 1ZH5A 3J7AO 3IC7A 1P2FA 1IXRC 1R58A 2WWYA 3ZN1A 5L3DA 2PN6A 4WXCA 3JAMK 3WU1B 2COMA 3MQ0A 3JW4A 3OOPA 4ENNA 2VE8A 4GYIA 5HLIA 5FB2A 3K1NA 2NRAC 4IXAA 1RUOA 1XDSA 2DQRA 1OYIA 5CLSA 1RZ4A 4H0EA 4R79A 3ERED 3KLOA 1BI3A 1KU2A 4IHTA 1P4XA 5LLQA 2GQQA 2P6SA 3RYPA 1BJAA 4EJVA 4CHUA 2CSOA 2IA2A 2YX7A 4CZZA 3H3ZA 1L0OC 2V6CA 3GFIA 3P9IA 3ZMVA 1S7AA 2Z9OA 4BAYA 3RPQA 1IAWA 1MZBA 5LHHA 4QLCU 2JSCA 4RB0A 4Y17A 4L9NA 5CJ9A 2MLGA 3WTZA 1B6AA 3HRMA 4AVPA 2RKHA 3KETA 3L2CA 5DYMA 1SFEA 3G73A 1YTYA 5FLXZ 1G3SA 3J81Z 4U0YA 2O03A 3BWGA 1G3YA 3HSRA 2H09A 2VN2A 2OD5A 5H6QA 5HOOA 3R4KA 1IXSB 2ZXJA 1FLIA 1B9MA 2Q8KA 4OIPF 1ZGAA 1MJBA 3EUHA 1S6LA 4YFXF 5E20A 5D5XB 3RJPA 4ZH4F 3KZZA 1J7KA 4GCVA 1BIBA 1Z6TA 3HSFA 2EFNA 2PEXA 4ZYEA 1FC3A 3E97A 4P5OA 4A6DA 2UXXA 3LSTA 4L5IA 1MDMB 3RPUA 2KIFA 2QBYA 1EV7A 2HGCA 2VXZA 2EV0A 4D0PA 2CWEA 4IRGA 4KUMA 5H20A 2PJPA 4WF2A 1OMIA 1W5TA 1H0MA 3K69A 1R22A 5FFZA 3L7WA 2HYGD 4G6DA 1IRFA 1ZRDA 2HZTA 5HDGA 3NQOA 3WTSC 4BHCA 3K9TA 3LQRA 1LDKB 2YX4A 2HR3A 1HKQA 2DPUA 1W7PD 3FZVA 4CO8A 3I53A 2IRFG 4UUVA 2QVOA 4YIFA 2A6HF 1RUNA 1LJ9A 4P55A 1FZPB 3TOBA 2OA4A 3LA7A 3R61A 3OV8A 4CGZA 2QLZA 3WTUC 1R5GA 4Q48A 3GFLA 2HTJA 4A5NA 3E6MA 3RTRA 2O6GE 2KJBA 4ETSA 2M30A 5L3GA 1O3RA 4RB1A 2XAQA 4I7HA 5CVJA 3VB2A 4L5JA 4LFUA 4O3MA 5LGTA 2HOEA 1SFXA 1A04A 2QBYB 2BEOA 1O3SA 2P5KA 4HX8A 3BP8A 2JPBA 1FBSA 2ZMEA 2CFXA 3JSPA 4K2EA 3TO9A 4Z2YA 4GO1A 4ESBA 3ZMZA 4L9VA 1PP8F 1P4WA 1Q1HA 2EA4A 3K0LA 1TBXA 1KYZA 2MA3A 4A6EA 2QQAA 4L18B 3W6KB 1BI0A 3LA3A 2OAZA 3HHHA 5TRDA 4DNCA 4M9SA 1Z6RA 2Z3YA 2C6YA 4B8XA 3KEOA 3F8FA 3JTGA 1OPCA 2QZ8A 4JBAA 3HTSB 4A0YA 2FE3A 3QU6A 3CJNA 3LA2A 1HKTA 3FXQA 4GGGA 4EM1A 3GUDA 5BPDA 1FYKA 4YFNF 3SXYA 4YIIA 2M8EA 1U8RA 4KIGA 4A2UA 1RIOH 5AIPA 1TTYA 3HIFA 2XUBA 5HS7A 1KQ8A 4RAZA 1LB2A 3K1MA 4LK0F 3VODA 1NHAA 4HX7A 3KP2A 1H9GA 2GWRA 2BV6A 3E6CC 1Z05A 2PLYA 2HQNA 3FMRA 2BBYA 2IP2A 5L3EA 4Q47A 1AWCA 4ESFA 1GHCA 2FBKA 1B1BA 1YIOA 2HS5A 2P4WA 1B4AA 4UV8A 4MQVA 3V4GA 2VOOA 4KN7X 3K1PA 4G8XA 3MAJA 3FXUA 4WXHA 3GZ6A 4MNUA 5JHUA 1E2XA 3ML6A 1QBJA 2D1HA 2RVCA 5BOXA 4MQ9F 5HLGA 5CVVA 4BNCA 1PDNC 1BBYA 2ETHA 3WTTC 4HW0A 3V7SA 2ISZA 2V79A 2A61A 1ZLKA 2EV5A 1XSXA 5E8IA 4MGRA 5J8CA 4RS8A 2PMHA 2Y75A 5AONA 2PQ8A 5CYVA 2M5WA 4OMYA 2YU3A 2CYYA 4Y13A 4M9XA 3C3WA 4MTEA 4P96A 1PUEE 4OINF 1YS6A 2ZFWA 2EWNA 3T8RA 1SAXA 2CGPA 4WWCA 1W7PB 5FO5A 1JGSA 4MTDA 1OYYA 1TW3A 3B73A 2R3SA 2K02A 1R7JA 2CW0F 3DQVC 1R23A 3W6JB 3ZQ7A 3GLXA 3E6DA 1ON1A 4M73A 2EK5A 3H3UA 4F7ZA 2M45A 3TDZC 2XAFA 4FT8A 4BHPA 1X3UA 2WC2A 3I0TA 5A2QZ 1T98A 1XCBA 4G7ZF 3FXRA 1OYWA 4RGXA 4LB5A 2JRTA 3HHGA 2BGCA 2XKPA 4CXFA 3I71A 3BY6A 3F72A 1SD6A 2V1DA 1WSUA 4HOBA 1O57A 1HSTA 1KQ9A 4S04A 4ESJA 3MCZA 1BIAA 2VE9A 2FBIA 3ZPLA 4IRIA 2JTVA 2H6BA 3EQLF 3ZMTA 3WTYC 3KZYA 1DP7P 3P7NA 5CVUA 1QZZA 3CUOA 1O7LA 1ZGJA 1TQIA 4I0BA 2OQGA 2VOPA 2G9WA 3ECHA 4EJWA 2Q2EA 1I1SA 1P4AA 3TGNA 4N9IA 4XSZF 3T0YA 3CUQB 4AIHA 5BPIA 2HKXA 1C0WA 4ZYDA 2MBFA 3E3VA 3TDUC 1YQAA 2IA0A 1FX7A 1UFMA 3ZMUA 2DPDA 3SZTA 1WRJA 4EVIA 4HV6A 3T1BA 2VC0A 1YG2A 2E1NA 3CO7C 3R0AA 4OU0A 3NRVA 1KGSA 5HVQC 2KJCA 3HRTA 3T8TA 4I09A 2VODA 3JSOA 2QUFA 3SFZA 2PMUA 1RNLA 2K4BA 1IUYA 2F5FA 1U5TC 2HTSA 2ZBKA 2IA1A 1SD5A 1U78A 2Z99A 4LG0B 4Q4ZF 4HAMA 1FP2A 5D6FA 4QWQA 3IKVA 3TKYA 3WE3A 2NNYA 5K1YA 3V8JA 2ZKZA 3GF2A 4I02A 5D5WB 3Q9VA 5DCMB 2FMYA 3IWFA 5LRRA 1J9IA 2STWA 2GA2A 4B09A 3ELKA 4A5MA 4MEXF 2A6EF 4R1HA 2FRHA 5FD6A 3HOSA 3F6OA 3M8EA 3KP4A 1HSJA 2UXNA 2CG4A 4I2OA 5ICCA 1MD0A 2DFIA 4WX9A 3SHFA 5A2QK 5FLXK 3IRRA 4PCQA 2VT3A 2EFQA 4PDKA 5FD5A 2L4MA 2FEZA 2FXAA 4YFKF 1HBXG 2P5VA 2JT1A 2LNBA 3WU0A 4HF0A 1XGNA 2O0YA 3I64A 4PGHA 5E1WA 1D3YA 3QP5A 3RI4A 1BOAA 1I6XA 1UHWA 2FA5A 4A0XA 2EFWA 4G7HF 2OU2A 3F8NA 1IRGA 3ECOA 3V7CA 4FX4A 1F4KA 5HDKA 3V7RA 3RDIA 1V4RA 3GX4X 4N9HA 1CGPA 5CVRA 1K78B 2B0LA 3HRSA 1T38A 1ZN2A 3VEPA 3GW2A 1FOKA 1FP1D 2HEOA 4E70A 1USTA 3L00A 4R8HA 2E1CA 2VBZA 1S3JA 2LDUA 1U5TA 4GYGA 1FBQA 3J80Z 3JAMZ 2G7HA 2H27A 4UNOA 3WTXC 4KYWA 5JFRA 1XN7A 1EH6A 2STTA 2PBIA 4U0VA 5BQTA 4AIJA 1R36A 2L02A 3FF5A 3F23A 5LGUA 3QOPA 3COAC 2D1VA 2LKPA 2D2WA 2V1UA 5D8KB 4HLYA 4RAYA 3SZPA 4KIFA 1DPUA 3MFKA 3EYIA 2A68F 4IF4A 2A07F 1YW9A 3L09A 3TQNA 4CYDA 3WTWC 1Y0UA 2A69F 3F6VA 5LGNA 2EFPA 3PQKA 3R60A 2K4JA 3IWZA 5DCFA 5K5OA 1KQ0A 1SD4A 1ZG5A 5J6XA 1K79A 1O3TA 5HDNA 3I58A 2AXLA 3ULQB 3BZ6A 2H94A 5L3CA 4BXUA 1LVAA 3LFKA 3GFJA 1CF7A 5K5QA 4IRHA 3D0SA 2W84A 3G3ZA 3C18A 2LSOA 2Z33A 4PZJA 3DEUA 2GA1A 3E5QA 1ZLJA 4ASNA 2RV8A 1MJ9A 2HKOA 2M87A 1B59A 2O3FA 1MKMA 3V8LA 1IXCA 2FF4A 3WGIA 1MJAA 1XCVA 1BI1A 1XD7A 2Z5UA 2DO7A 3AAFA 2A5YB 2DK8A 4EGZA 3N4MA 1K7AA 3E6BA 1ZREA 2OZ6A 1TNSA 1B9NA 1TNTA 4HBLA 5L3FA 1IZ1A 4NHJA 2XHKA 1QGPA 4BHBA 1HQCA 2ZJ2A 2X0LA 3FMQA 3LQQA 5D5UB 2FSWA 2ZO4A 4UV9A 2KIMA 5DCMA 4OIRF 3CUQA 4BH9A 3KP6A 4EMSA 1YW7A 3QPTA 4LG0A 1ONVA 4M71A 1P92A 2AS5F 2DLLA 1F9NA 3CLOA 2IVMA 3WGGA 5LRSA 2XKOA 3I59A 1TQPA 1XGMA 4UHTA 4HLXA 5IT9K 3IKTA 2DK5A 2IT0A 3BJAA 1JHHA 1S8NA 4Y15A 5HS9A 4EM2A 1QPMA 5D4SA 1WWXA 4M74A 3KP5A 4BQAA 2XV4S 2WTEA 1O7FA 2ELHA 2DU9A 3I54A 1LEBA 2CQKA 4IHSA 1CF7B 2HYFA 2P8TA 3F8MA 2DAOA 1KYWA 3FHZA 4IVNA 1H9TA 2MH2A 3GEZA 2E7XA 2F5CA 2UZKA 3P9CA 1KU7A 2E7WA 2M1BA 2GXBA 3WGHA 5EEGA 3KFWX 2HWVA 3WG9A 4KMUX 1JHFA 2DT5A 2OBPA 2MC3A 4HA8A 2YR2A 1FYMA 4KA4A 1HKSA 1Z9CA 4BYYA 1I5ZA 3U9GA 3FX3A 4HV5A 3U1DA 1UHMA 4NQWA 5E1XA 1GVJA 2ESHA 2GAUA 3T5XA 4O6JA 4XLNF 4HZFA 3LAJA 1YYVA 1DDNA 4LJZF 5LHIA 1AOYA 1G6NA 3TOAA 2ESNA 4EQQA 4LD5A 1DUXC 3ZP5A 3ROUA 1LDJA 3HSEA 4FHTA 3QAHA 4I98B 3HTUA 1U5TB 2LF8A 4ENMA 3DPTA 3DP7A 2XIGA 2GZWA 4L0YB 4WK8F 1L3LA 1IN5A 2VC1A 5DD4A 3KP7A 2W24A 1R1UA 1BN5A 4XRFA 4LLLA 2QQBA 2W85A 2OZUA 3J81K 2O8XA 5H6RA 3B02A 1LDDA 1T39A 4MEYF 2VBWA 5EEHA 5FGMA 4UVBA 1MDMA 4OOIA 3IL2A 2FOKA 4P9UA 2RGVA 2YSRA 1LQ1A 1OR7A 5ILSA 3GXOA 1SMYF 4XSXF 3WODF 4GXOA 5D4RA 4I0AA 1EH8A 3GO5A 1BI2A 1ZRCA 2TDXA 1QQIA 3HOTA 2VT2A 3FMSA 2EV6A 4I01A 4KICA 2KRFA 2L4AA 3M9AA 2P5LC 1Z1DA 3RIRA 5JI6A 2MH9A 3EYYA 3U2RA 2LF7A 1IN4A 3D5LA 3M1EA 3QRFF 1QNTA 5ED4A 3F8BA 2RC4A 2FNAA 4JQFA 1HW5A 2DI3A 2Q0OA 3MZYA 1XGOA 1FNNA 3TO7A 3LWFA 3ZN0A 1U3EM 1FWZA 2L3DA 1FY7A 4JK1X 1GXQA 3P9KA 2EB7A 1BC8C 1LEAA 4N0BA 4S05A 4OIOF 2ISYA 2IW5A 2ZCWA 4KDPA 3E5XA 3MZHA 2W57A 2Y0MA 5CVIA 2XVCA 1EH7A 2GXGA 2H6CA 3QP6A 3RYRA 5LEKA 6PAXA 4UVAA 4EJTA 1XSDA 4ENKA 5E8GA 4RGSA 5KK1A 4HF1A 1R1VA 3CO6C 5K5RA 4EGYA 1S7OA 1G3WA 2RN7A 2KIUA 1YO5C 3DKWA 4RGUA 5IT3A 1UCRA 2QM3A 2XROA 4LB6B 2QYOA 2NAZA 3C1DA 4TV7A 4P9FA 2FU4A 2YPRA 1FBUA 4LK1F 2L54A 4IPAA 2X4HA 1WQ2A 4KFCA 3DPLC 1USSA 3R0JA 3BROA 1IW7F 3MEXA 4U0WA 1VTNC 4A0ZA 3IRQA 3RKYA 3GZ5A 1JE8A 2ADUA 4L0ZB 1D8KA 4WCGA 3KP3A 3PFIA 5ICEA 1ZG3A 2ZNYA 4IJAA 3VFZA 2UWMA 2W25A 4U7DA 4A12A 1P6RA 3FM3A 1R5HA 2ACJA 3RKXA 4EV0A 1QO0D 1O3QA 1HW2A 1FSHA 2DBBA 3WTVC 3EETA 3SQNA 3HYIA 5D5VB 3N97A 4HDVA 1HXDA 1QZYA 4L9JA 1XGSA 2VONA 3I4PA 3I59B 2RQPA 3BJ6A 1ULYA 1REPC 5ICGA 1GXPA 2ZNZA 2QENA 4PGGA 1ZHFA 5LBQA 2FQ3A 5AIQA 3F22A 2QQ9A 4XBFA 2GIVA 2JZYA 1LNWA 2NNNA 3KE2A 4CICA 2CO5A 3L9FA 1SMTA 3DXJF 1J2XA 2HFHA 3IHUA 4DQ2A 1G3TA 1YLFA 2DTRA 3H92A 3QPHA 5ERIA 2PI0A 1SD7A 1ZYRF 3S2WA 1TQMA 1XMAA 3CUQC 1YS7A 1XSVA 3HRUA 4MHGA 1KU9A 1W4MA 1YFHA 3K2ZA 5F64A 1D8JA 4LLGF 1SFUA 1FSEA 3VOEA 1IN7A 2JPCA 4EM0B 1F1ZA 2R7FA 2RDPA 3EDPA 5ILUA 4O5VA 1W7PA 3E5UA 4AD9A 4M72A 3BPVA 1XMKA 3BPXA 1DPRA 3QU3A 2L01A 2XASA 4RB2C 3DFGA 3M8FA 1T6SA 2P6TA 4HX4A 5BMZA 3RKWA 1ODDA 2BYVE 2PG4A 5HS8A 5DDGA 1K6OA 3F8CA 2MLKA 3F21A 1T0FA 2F5EA 4EJUA 5TJJA 1STZA 4KN4X 2VBXA 4M6XA 4AIKA 3CTAA 1FPQA 2WV0A 4AWXB 1TLHB 2P7CB 2DQLA 4HQMA 3O6BB 1ZRFA 5HLHA 3KCCA 1IN6A 5LHGA 3ABTA 1Z91A 3J80K 4U88A 5BS6A 3GWZA 2G7UA 2R7DA 3M7GA 1FYLA 3LAPA 3O2PE 4OIQF 2PFBA 1KU3A 1ON2A 3KEQA 2K7LA 1R00A 1XB4A 4G6QA 3I5UA 4ENJA 3KLNA 4HF2A 1PP7U 1K78A 2XGXA 5LEJA 1XDUA 1Z7UA 1KA8A 2HQRA 4YG2F 1YW8A 4FX0A 1S29A 5ICFA 2XAJA 2Y48A 1U2WA 2EFOA 3BDDA 3R6SA 4XLPF 5DUIA 1I1GA 5FFXA 1HW1A 3CDHA 3BJOA 2K86A 4ZYHA 2ZMEB 5DV5A 4ZZLA 5ILVA 2O61A 2K27A 1R1TA 3O3KA 1BC7C 5D8LB 5DUKA 5F1RA 4WXDA 3MWMA 1J0RA 4KT5C 3GYHX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TW2 A;  2XAG A;  3FWE A;  4LLN A;  4HDU A;  2HDC A;  1WKM A;  3V8K A;  3NEU A;  4LGW A;  5KVR A;  1G4D A;  5J8F A;  1J59 A;  1IF1 A;  2F2E A;  5DD8 A;  4UXN A;  5DEQ A;  5L3B A;  2IPQ X;  2A3S A;  5E1Z B;  3Q9S A;  2FBH A;  1J75 A;  2MD5 A;  3WE2 A;  1J5Y A;  5F6F A;  1JXS A;  1I27 A;  2IJL A;  4G94 A;  2KKO A;  1WI9 A;  4NB5 A;  2DW4 A;  1T2K A;  2J5P A;  4ZYG A;  1W5S A;  2VBY A;  2OQR A;  3TO6 A;  2BE5 F;  4UVC A;  4LMY A;  3GVA A;  4M9Z A;  1IN8 A;  1MGT A;  2J5O A;  5JVT A;  1FT9 A;  2P7V B;  3DV8 A;  3ZMS A;  1ZG1 A;  3FM5 A;  1ZAR A;  2FNP A;  2QWW A;  4L9T A;  4ZZD A;  3ISP A;  5E18 F;  4U7B A;  3ABU A;  4HYE A;  1E17 A;  1RI7 A;  2NS0 A;  4HQE A;  5D6E A;  3Q5F A;  1ZAO A;  4M6Y A;  3BOQ A;  3PQJ A;  2F5D A;  2XRN A;  3JTH A;  1U6G A;  1D5V A;  3HUG A;  1UB9 A;  4RGR A;  4KMF A;  4RB3 C;  4G7O F;  2EJR A;  4ON0 A;  5JR3 A;  5IT9 Z;  2XAH A;  2NYX A;  3F3X A;  3GFM A;  4OMZ A;  1V3F A;  4G9Y A;  4CDG A;  5E17 F;  1BM9 A;  1F5T A;  3DF8 A;  2V9V A;  3REO A;  2D45 A;  2V1X A;  4Q5S F;  2RNJ A;  4KIB A;  2FML A;  4KNY A;  2EA2 A;  4EJO A;  3C7J A;  3ZMD A;  1OKR A;  1ZH5 A;  3J7A O;  3IC7 A;  1P2F A;  1IXR C;  1R58 A;  2WWY A;  3ZN1 A;  5L3D A;  2PN6 A;  4WXC A;  3JAM K;  3WU1 B;  2COM A;  3MQ0 A;  3JW4 A;  3OOP A;  4ENN A;  2VE8 A;  4GYI A;  5HLI A;  5FB2 A;  3K1N A;  2NRA C;  4IXA A;  1RUO A;  1XDS A;  2DQR A;  1OYI A;  5CLS A;  1RZ4 A;  4H0E A;  4R79 A;  3ERE D;  3KLO A;  1BI3 A;  1KU2 A;  4IHT A;  1P4X A;  5LLQ A;  2GQQ A;  2P6S A;  3RYP A;  1BJA A;  4EJV A;  4CHU A;  2CSO A;  2IA2 A;  2YX7 A;  4CZZ A;  3H3Z A;  1L0O C;  2V6C A;  3GFI A;  3P9I A;  3ZMV A;  1S7A A;  2Z9O A;  4BAY A;  3RPQ A;  1IAW A;  1MZB A;  5LHH A;  4QLC U;  2JSC A;  4RB0 A;  4Y17 A;  4L9N A;  5CJ9 A;  2MLG A;  3WTZ A;  1B6A A;  3HRM A;  4AVP A;  2RKH A;  3KET A;  3L2C A;  5DYM A;  1SFE A;  3G73 A;  1YTY A;  5FLX Z;  1G3S A;  3J81 Z;  4U0Y A;  2O03 A;  3BWG A;  1G3Y A;  3HSR A;  2H09 A;  2VN2 A;  2OD5 A;  5H6Q A;  5HOO A;  3R4K A;  1IXS B;  2ZXJ A;  1FLI A;  1B9M A;  2Q8K A;  4OIP F;  1ZGA A;  1MJB A;  3EUH A;  1S6L A;  4YFX F;  5E20 A;  5D5X B;  3RJP A;  4ZH4 F;  3KZZ A;  1J7K A;  4GCV A;  1BIB A;  1Z6T A;  3HSF A;  2EFN A;  2PEX A;  4ZYE A;  1FC3 A;  3E97 A;  4P5O A;  4A6D A;  2UXX A;  3LST A;  4L5I A;  1MDM B;  3RPU A;  2KIF A;  2QBY A;  1EV7 A;  2HGC A;  2VXZ A;  2EV0 A;  4D0P A;  2CWE A;  4IRG A;  4KUM A;  5H20 A;  2PJP A;  4WF2 A;  1OMI A;  1W5T A;  1H0M A;  3K69 A;  1R22 A;  5FFZ A;  3L7W A;  2HYG D;  4G6D A;  1IRF A;  1ZRD A;  2HZT A;  5HDG A;  3NQO A;  3WTS C;  4BHC A;  3K9T A;  3LQR A;  1LDK B;  2YX4 A;  2HR3 A;  1HKQ A;  2DPU A;  1W7P D;  3FZV A;  4CO8 A;  3I53 A;  2IRF G;  4UUV A;  2QVO A;  4YIF A;  2A6H F;  1RUN A;  1LJ9 A;  4P55 A;  1FZP B;  3TOB A;  2OA4 A;  3LA7 A;  3R61 A;  3OV8 A;  4CGZ A;  2QLZ A;  3WTU C;  1R5G A;  4Q48 A;  3GFL A;  2HTJ A;  4A5N A;  3E6M A;  3RTR A;  2O6G E;  2KJB A;  4ETS A;  2M30 A;  5L3G A;  1O3R A;  4RB1 A;  2XAQ A;  4I7H A;  5CVJ A;  3VB2 A;  4L5J A;  4LFU A;  4O3M A;  5LGT A;  2HOE A;  1SFX A;  1A04 A;  2QBY B;  2BEO A;  1O3S A;  2P5K A;  4HX8 A;  3BP8 A;  2JPB A;  1FBS A;  2ZME A;  2CFX A;  3JSP A;  4K2E A;  3TO9 A;  4Z2Y A;  4GO1 A;  4ESB A;  3ZMZ A;  4L9V A;  1PP8 F;  1P4W A;  1Q1H A;  2EA4 A;  3K0L A;  1TBX A;  1KYZ A;  2MA3 A;  4A6E A;  2QQA A;  4L18 B;  3W6K B;  1BI0 A;  3LA3 A;  2OAZ A;  3HHH A;  5TRD A;  4DNC A;  4M9S A;  1Z6R A;  2Z3Y A;  2C6Y A;  4B8X A;  3KEO A;  3F8F A;  3JTG A;  1OPC A;  2QZ8 A;  4JBA A;  3HTS B;  4A0Y A;  2FE3 A;  3QU6 A;  3CJN A;  3LA2 A;  1HKT A;  3FXQ A;  4GGG A;  4EM1 A;  3GUD A;  5BPD A;  1FYK A;  4YFN F;  3SXY A;  4YII A;  2M8E A;  1U8R A;  4KIG A;  4A2U A;  1RIO H;  5AIP A;  1TTY A;  3HIF A;  2XUB A;  5HS7 A;  1KQ8 A;  4RAZ A;  1LB2 A;  3K1M A;  4LK0 F;  3VOD A;  1NHA A;  4HX7 A;  3KP2 A;  1H9G A;  2GWR A;  2BV6 A;  3E6C C;  1Z05 A;  2PLY A;  2HQN A;  3FMR A;  2BBY A;  2IP2 A;  5L3E A;  4Q47 A;  1AWC A;  4ESF A;  1GHC A;  2FBK A;  1B1B A;  1YIO A;  2HS5 A;  2P4W A;  1B4A A;  4UV8 A;  4MQV A;  3V4G A;  2VOO A;  4KN7 X;  3K1P A;  4G8X A;  3MAJ A;  3FXU A;  4WXH A;  3GZ6 A;  4MNU A;  5JHU A;  1E2X A;  3ML6 A;  1QBJ A;  2D1H A;  2RVC A;  5BOX A;  4MQ9 F;  5HLG A;  5CVV A;  4BNC A;  1PDN C;  1BBY A;  2ETH A;  3WTT C;  4HW0 A;  3V7S A;  2ISZ A;  2V79 A;  2A61 A;  1ZLK A;  2EV5 A;  1XSX A;  5E8I A;  4MGR A;  5J8C A;  4RS8 A;  2PMH A;  2Y75 A;  5AON A;  2PQ8 A;  5CYV A;  2M5W A;  4OMY A;  2YU3 A;  2CYY A;  4Y13 A;  4M9X A;  3C3W A;  4MTE A;  4P96 A;  1PUE E;  4OIN F;  1YS6 A;  2ZFW A;  2EWN A;  3T8R A;  1SAX A;  2CGP A;  4WWC A;  1W7P B;  5FO5 A;  1JGS A;  4MTD A;  1OYY A;  1TW3 A;  3B73 A;  2R3S A;  2K02 A;  1R7J A;  2CW0 F;  3DQV C;  1R23 A;  3W6J B;  3ZQ7 A;  3GLX A;  3E6D A;  1ON1 A;  4M73 A;  2EK5 A;  3H3U A;  4F7Z A;  2M45 A;  3TDZ C;  2XAF A;  4FT8 A;  4BHP A;  1X3U A;  2WC2 A;  3I0T A;  5A2Q Z;  1T98 A;  1XCB A;  4G7Z F;  3FXR A;  1OYW A;  4RGX A;  4LB5 A;  2JRT A;  3HHG A;  2BGC A;  2XKP A;  4CXF A;  3I71 A;  3BY6 A;  3F72 A;  1SD6 A;  2V1D A;  1WSU A;  4HOB A;  1O57 A;  1HST A;  1KQ9 A;  4S04 A;  4ESJ A;  3MCZ A;  1BIA A;  2VE9 A;  2FBI A;  3ZPL A;  4IRI A;  2JTV A;  2H6B A;  3EQL F;  3ZMT A;  3WTY C;  3KZY A;  1DP7 P;  3P7N A;  5CVU A;  1QZZ A;  3CUO A;  1O7L A;  1ZGJ A;  1TQI A;  4I0B A;  2OQG A;  2VOP A;  2G9W A;  3ECH A;  4EJW A;  2Q2E A;  1I1S A;  1P4A A;  3TGN A;  4N9I A;  4XSZ F;  3T0Y A;  3CUQ B;  4AIH A;  5BPI A;  2HKX A;  1C0W A;  4ZYD A;  2MBF A;  3E3V A;  3TDU C;  1YQA A;  2IA0 A;  1FX7 A;  1UFM A;  3ZMU A;  2DPD A;  3SZT A;  1WRJ A;  4EVI A;  4HV6 A;  3T1B A;  2VC0 A;  1YG2 A;  2E1N A;  3CO7 C;  3R0A A;  4OU0 A;  3NRV A;  1KGS A;  5HVQ C;  2KJC A;  3HRT A;  3T8T A;  4I09 A;  2VOD A;  3JSO A;  2QUF A;  3SFZ A;  2PMU A;  1RNL A;  2K4B A;  1IUY A;  2F5F A;  1U5T C;  2HTS A;  2ZBK A;  2IA1 A;  1SD5 A;  1U78 A;  2Z99 A;  4LG0 B;  4Q4Z F;  4HAM A;  1FP2 A;  5D6F A;  4QWQ A;  3IKV A;  3TKY A;  3WE3 A;  2NNY A;  5K1Y A;  3V8J A;  2ZKZ A;  3GF2 A;  4I02 A;  5D5W B;  3Q9V A;  5DCM B;  2FMY A;  3IWF A;  5LRR A;  1J9I A;  2STW A;  2GA2 A;  4B09 A;  3ELK A;  4A5M A;  4MEX F;  2A6E F;  4R1H A;  2FRH A;  5FD6 A;  3HOS A;  3F6O A;  3M8E A;  3KP4 A;  1HSJ A;  2UXN A;  2CG4 A;  4I2O A;  5ICC A;  1MD0 A;  2DFI A;  4WX9 A;  3SHF A;  5A2Q K;  5FLX K;  3IRR A;  4PCQ A;  2VT3 A;  2EFQ A;  4PDK A;  5FD5 A;  2L4M A;  2FEZ A;  2FXA A;  4YFK F;  1HBX G;  2P5V A;  2JT1 A;  2LNB A;  3WU0 A;  4HF0 A;  1XGN A;  2O0Y A;  3I64 A;  4PGH A;  5E1W A;  1D3Y A;  3QP5 A;  3RI4 A;  1BOA A;  1I6X A;  1UHW A;  2FA5 A;  4A0X A;  2EFW A;  4G7H F;  2OU2 A;  3F8N A;  1IRG A;  3ECO A;  3V7C A;  4FX4 A;  1F4K A;  5HDK A;  3V7R A;  3RDI A;  1V4R A;  3GX4 X;  4N9H A;  1CGP A;  5CVR A;  1K78 B;  2B0L A;  3HRS A;  1T38 A;  1ZN2 A;  3VEP A;  3GW2 A;  1FOK A;  1FP1 D;  2HEO A;  4E70 A;  1UST A;  3L00 A;  4R8H A;  2E1C A;  2VBZ A;  1S3J A;  2LDU A;  1U5T A;  4GYG A;  1FBQ A;  3J80 Z;  3JAM Z;  2G7H A;  2H27 A;  4UNO A;  3WTX C;  4KYW A;  5JFR A;  1XN7 A;  1EH6 A;  2STT A;  2PBI A;  4U0V A;  5BQT A;  4AIJ A;  1R36 A;  2L02 A;  3FF5 A;  3F23 A;  5LGU A;  3QOP A;  3COA C;  2D1V A;  2LKP A;  2D2W A;  2V1U A;  5D8K B;  4HLY A;  4RAY A;  3SZP A;  4KIF A;  1DPU A;  3MFK A;  3EYI A;  2A68 F;  4IF4 A;  2A07 F;  1YW9 A;  3L09 A;  3TQN A;  4CYD A;  3WTW C;  1Y0U A;  2A69 F;  3F6V A;  5LGN A;  2EFP A;  3PQK A;  3R60 A;  2K4J A;  3IWZ A;  5DCF A;  5K5O A;  1KQ0 A;  1SD4 A;  1ZG5 A;  5J6X A;  1K79 A;  1O3T A;  5HDN A;  3I58 A;  2AXL A;  3ULQ B;  3BZ6 A;  2H94 A;  5L3C A;  4BXU A;  1LVA A;  3LFK A;  3GFJ A;  1CF7 A;  5K5Q A;  4IRH A;  3D0S A;  2W84 A;  3G3Z A;  3C18 A;  2LSO A;  2Z33 A;  4PZJ A;  3DEU A;  2GA1 A;  3E5Q A;  1ZLJ A;  4ASN A;  2RV8 A;  1MJ9 A;  2HKO A;  2M87 A;  1B59 A;  2O3F A;  1MKM A;  3V8L A;  1IXC A;  2FF4 A;  3WGI A;  1MJA A;  1XCV A;  1BI1 A;  1XD7 A;  2Z5U A;  2DO7 A;  3AAF A;  2A5Y B;  2DK8 A;  4EGZ A;  3N4M A;  1K7A A;  3E6B A;  1ZRE A;  2OZ6 A;  1TNS A;  1B9N A;  1TNT A;  4HBL A;  5L3F A;  1IZ1 A;  4NHJ A;  2XHK A;  1QGP A;  4BHB A;  1HQC A;  2ZJ2 A;  2X0L A;  3FMQ A;  3LQQ A;  5D5U B;  2FSW A;  2ZO4 A;  4UV9 A;  2KIM A;  5DCM A;  4OIR F;  3CUQ A;  4BH9 A;  3KP6 A;  4EMS A;  1YW7 A;  3QPT A;  4LG0 A;  1ONV A;  4M71 A;  1P92 A;  2AS5 F;  2DLL A;  1F9N A;  3CLO A;  2IVM A;  3WGG A;  5LRS A;  2XKO A;  3I59 A;  1TQP A;  1XGM A;  4UHT A;  4HLX A;  5IT9 K;  3IKT A;  2DK5 A;  2IT0 A;  3BJA A;  1JHH A;  1S8N A;  4Y15 A;  5HS9 A;  4EM2 A;  1QPM A;  5D4S A;  1WWX A;  4M74 A;  3KP5 A;  4BQA A;  2XV4 S;  2WTE A;  1O7F A;  2ELH A;  2DU9 A;  3I54 A;  1LEB A;  2CQK A;  4IHS A;  1CF7 B;  2HYF A;  2P8T A;  3F8M A;  2DAO A;  1KYW A;  3FHZ A;  4IVN A;  1H9T A;  2MH2 A;  3GEZ A;  2E7X A;  2F5C A;  2UZK A;  3P9C A;  1KU7 A;  2E7W A;  2M1B A;  2GXB A;  3WGH A;  5EEG A;  3KFW X;  2HWV A;  3WG9 A;  4KMU X;  1JHF A;  2DT5 A;  2OBP A;  2MC3 A;  4HA8 A;  2YR2 A;  1FYM A;  4KA4 A;  1HKS A;  1Z9C A;  4BYY A;  1I5Z A;  3U9G A;  3FX3 A;  4HV5 A;  3U1D A;  1UHM A;  4NQW A;  5E1X A;  1GVJ A;  2ESH A;  2GAU A;  3T5X A;  4O6J A;  4XLN F;  4HZF A;  3LAJ A;  1YYV A;  1DDN A;  4LJZ F;  5LHI A;  1AOY A;  1G6N A;  3TOA A;  2ESN A;  4EQQ A;  4LD5 A;  1DUX C;  3ZP5 A;  3ROU A;  1LDJ A;  3HSE A;  4FHT A;  3QAH A;  4I98 B;  3HTU A;  1U5T B;  2LF8 A;  4ENM A;  3DPT A;  3DP7 A;  2XIG A;  2GZW A;  4L0Y B;  4WK8 F;  1L3L A;  1IN5 A;  2VC1 A;  5DD4 A;  3KP7 A;  2W24 A;  1R1U A;  1BN5 A;  4XRF A;  4LLL A;  2QQB A;  2W85 A;  2OZU A;  3J81 K;  2O8X A;  5H6R A;  3B02 A;  1LDD A;  1T39 A;  4MEY F;  2VBW A;  5EEH A;  5FGM A;  4UVB A;  1MDM A;  4OOI A;  3IL2 A;  2FOK A;  4P9U A;  2RGV A;  2YSR A;  1LQ1 A;  1OR7 A;  5ILS A;  3GXO A;  1SMY F;  4XSX F;  3WOD F;  4GXO A;  5D4R A;  4I0A A;  1EH8 A;  3GO5 A;  1BI2 A;  1ZRC A;  2TDX A;  1QQI A;  3HOT A;  2VT2 A;  3FMS A;  2EV6 A;  4I01 A;  4KIC A;  2KRF A;  2L4A A;  3M9A A;  2P5L C;  1Z1D A;  3RIR A;  5JI6 A;  2MH9 A;  3EYY A;  3U2R A;  2LF7 A;  1IN4 A;  3D5L A;  3M1E A;  3QRF F;  1QNT A;  5ED4 A;  3F8B A;  2RC4 A;  2FNA A;  4JQF A;  1HW5 A;  2DI3 A;  2Q0O A;  3MZY A;  1XGO A;  1FNN A;  3TO7 A;  3LWF A;  3ZN0 A;  1U3E M;  1FWZ A;  2L3D A;  1FY7 A;  4JK1 X;  1GXQ A;  3P9K A;  2EB7 A;  1BC8 C;  1LEA A;  4N0B A;  4S05 A;  4OIO F;  2ISY A;  2IW5 A;  2ZCW A;  4KDP A;  3E5X A;  3MZH A;  2W57 A;  2Y0M A;  5CVI A;  2XVC A;  1EH7 A;  2GXG A;  2H6C A;  3QP6 A;  3RYR A;  5LEK A;  6PAX A;  4UVA A;  4EJT A;  1XSD A;  4ENK A;  5E8G A;  4RGS A;  5KK1 A;  4HF1 A;  1R1V A;  3CO6 C;  5K5R A;  4EGY A;  1S7O A;  1G3W A;  2RN7 A;  2KIU A;  1YO5 C;  3DKW A;  4RGU A;  5IT3 A;  1UCR A;  2QM3 A;  2XRO A;  4LB6 B;  2QYO A;  2NAZ A;  3C1D A;  4TV7 A;  4P9F A;  2FU4 A;  2YPR A;  1FBU A;  4LK1 F;  2L54 A;  4IPA A;  2X4H A;  1WQ2 A;  4KFC A;  3DPL C;  1USS A;  3R0J A;  3BRO A;  1IW7 F;  3MEX A;  4U0W A;  1VTN C;  4A0Z A;  3IRQ A;  3RKY A;  3GZ5 A;  1JE8 A;  2ADU A;  4L0Z B;  1D8K A;  4WCG A;  3KP3 A;  3PFI A;  5ICE A;  1ZG3 A;  2ZNY A;  4IJA A;  3VFZ A;  2UWM A;  2W25 A;  4U7D A;  4A12 A;  1P6R A;  3FM3 A;  1R5H A;  2ACJ A;  3RKX A;  4EV0 A;  1QO0 D;  1O3Q A;  1HW2 A;  1FSH A;  2DBB A;  3WTV C;  3EET A;  3SQN A;  3HYI A;  5D5V B;  3N97 A;  4HDV A;  1HXD A;  1QZY A;  4L9J A;  1XGS A;  2VON A;  3I4P A;  3I59 B;  2RQP A;  3BJ6 A;  1ULY A;  1REP C;  5ICG A;  1GXP A;  2ZNZ A;  2QEN A;  4PGG A;  1ZHF A;  5LBQ A;  2FQ3 A;  5AIQ A;  3F22 A;  2QQ9 A;  4XBF A;  2GIV A;  2JZY A;  1LNW A;  2NNN A;  3KE2 A;  4CIC A;  2CO5 A;  3L9F A;  1SMT A;  3DXJ F;  1J2X A;  2HFH A;  3IHU A;  4DQ2 A;  1G3T A;  1YLF A;  2DTR A;  3H92 A;  3QPH A;  5ERI A;  2PI0 A;  1SD7 A;  1ZYR F;  3S2W A;  1TQM A;  1XMA A;  3CUQ C;  1YS7 A;  1XSV A;  3HRU A;  4MHG A;  1KU9 A;  1W4M A;  1YFH A;  3K2Z A;  5F64 A;  1D8J A;  4LLG F;  1SFU A;  1FSE A;  3VOE A;  1IN7 A;  2JPC A;  4EM0 B;  1F1Z A;  2R7F A;  2RDP A;  3EDP A;  5ILU A;  4O5V A;  1W7P A;  3E5U A;  4AD9 A;  4M72 A;  3BPV A;  1XMK A;  3BPX A;  1DPR A;  3QU3 A;  2L01 A;  2XAS A;  4RB2 C;  3DFG A;  3M8F A;  1T6S A;  2P6T A;  4HX4 A;  5BMZ A;  3RKW A;  1ODD A;  2BYV E;  2PG4 A;  5HS8 A;  5DDG A;  1K6O A;  3F8C A;  2MLK A;  3F21 A;  1T0F A;  2F5E A;  4EJU A;  5TJJ A;  1STZ A;  4KN4 X;  2VBX A;  4M6X A;  4AIK A;  3CTA A;  1FPQ A;  2WV0 A;  4AWX B;  1TLH B;  2P7C B;  2DQL A;  4HQM A;  3O6B B;  1ZRF A;  5HLH A;  3KCC A;  1IN6 A;  5LHG A;  3ABT A;  1Z91 A;  3J80 K;  4U88 A;  5BS6 A;  3GWZ A;  2G7U A;  2R7D A;  3M7G A;  1FYL A;  3LAP A;  3O2P E;  4OIQ F;  2PFB A;  1KU3 A;  1ON2 A;  3KEQ A;  2K7L A;  1R00 A;  1XB4 A;  4G6Q A;  3I5U A;  4ENJ A;  3KLN A;  4HF2 A;  1PP7 U;  1K78 A;  2XGX A;  5LEJ A;  1XDU A;  1Z7U A;  1KA8 A;  2HQR A;  4YG2 F;  1YW8 A;  4FX0 A;  1S29 A;  5ICF A;  2XAJ A;  2Y48 A;  1U2W A;  2EFO A;  3BDD A;  3R6S A;  4XLP F;  5DUI A;  1I1G A;  5FFX A;  1HW1 A;  3CDH A;  3BJO A;  2K86 A;  4ZYH A;  2ZME B;  5DV5 A;  4ZZL A;  5ILV A;  2O61 A;  2K27 A;  1R1T A;  3O3K A;  1BC7 C;  5D8L B;  5DUK A;  5F1R A;  4WXD A;  3MWM A;  1J0R A;  4KT5 C;  3GYH X; 
#chains in the Genus database with same CATH topology
 4QPO A;  1T0F C;  1TW2 A;  2DMP A;  2KZV A;  4LIT A;  5EZG A;  2XAG A;  3FWE A;  4LLN A;  4HDU A;  2HDC A;  2DA3 A;  1RPW A;  1WKM A;  2V7F A;  1PVE A;  2KP6 A;  3V8K A;  3NEU A;  4RLF A;  2O7O A;  2IEK A;  4LGW A;  5KVR A;  5J4V A;  5M5X J;  3H5R A;  3ZQI A;  1G4D A;  5J8F A;  5CQG A;  1J59 A;  1FMV A;  1IF1 A;  2F2E A;  1G2H A;  3CJQ B;  3CC2 I;  5DD8 A;  3L2Q A;  4UXN A;  3A0H C;  3RSN A;  2JUG A;  5DEQ A;  3AKZ A;  5L3B A;  3ZQH A;  1OCP A;  2IPQ X;  2A3S A;  4PJN A;  5E1Z B;  5J47 A;  3K70 C;  2R7S A;  3Q9S A;  2HPM A;  2TCT A;  2FBH A;  1J75 A;  1B72 B;  2MD5 A;  3WE2 A;  1J5Y A;  2VKH A;  3GCM A;  5F6F A;  2XSJ C;  2X1E A;  1JXS A;  1I27 A;  2KIS A;  4XN0 A;  1NK2 P;  2IJL A;  4G94 A;  2KKO A;  1WI9 A;  2M4G A;  4C30 A;  2Y0S N;  4NB5 A;  2DW4 A;  2QCO A;  4XOP A;  1T2K A;  3PO2 J;  3ZQF A;  2J5P A;  4ZYG A;  5DS9 A;  1W5S A;  2LK2 A;  2VBY A;  2OQR A;  2GXA A;  3TO6 A;  4QTR A;  2BE5 F;  3SZG A;  4UVC A;  2PJR B;  4LMY A;  3GVA A;  3JRC A;  1JT0 A;  2VI6 A;  1IN8 A;  4M9Z A;  2QKM B;  1MGT A;  2J5O A;  4PK4 A;  1FT9 A;  2P7V B;  3DV8 A;  3HGY A;  3ZMS A;  5JVT A;  1UZC A;  4DJA A;  3DTE A;  4D5F A;  1ZG1 A;  2EIN H;  3FM5 A;  1ZAR A;  3OYB A;  3CJT B;  3KYL A;  2FNP A;  2QWW A;  4L9T A;  3DLA A;  4UUT A;  4ZZD A;  1Z0X A;  3ISP A;  5E18 F;  2E1M C;  4U7B A;  3ABU A;  3M8J A;  4XL9 A;  3OL4 A;  4HYE A;  1E17 A;  1RI7 A;  2XF7 A;  1W36 C;  2NVT J;  2NS0 A;  4HQE A;  5D6E A;  1LFP A;  1OFC X;  3Q5F A;  1ZAO A;  2OUM A;  5KAI C;  1E3O C;  2JA6 J;  4A3G J;  3IV5 A;  4M6Y A;  3BOQ A;  5IYB J;  1XC5 A;  1T56 A;  1Y8R B;  3PQJ A;  2F5D A;  2XRN A;  3JTH A;  4F55 A;  1U6G A;  1HC8 A;  4XMY A;  3BZC A;  1LKX A;  1D5V A;  3BR2 A;  3HUG A;  2WAE A;  1UB9 A;  4RGR A;  4KMF A;  2E2J J;  4RB3 C;  4G7O F;  3CMA I;  2EJR A;  3FHN A;  3NWT A;  4ON0 A;  1N75 A;  2DOA A;  3HC7 A;  2KIQ A;  1DQU A;  5JR3 A;  4OWR B;  1I6H J;  5IT9 Z;  3HM5 A;  2XAH A;  2NYX A;  3LNQ A;  1JKQ C;  1XX5 A;  1GUU A;  1MMN A;  1ETK A;  1WFX A;  3F3X A;  1AU7 A;  2E1O A;  3GFM A;  4OMZ A;  4LOC A;  4CZC A;  2LRE A;  1H89 C;  1V3F A;  4G9Y A;  1SEU A;  1Z7L A;  4CDG A;  2V9K A;  5E17 F;  1BM9 A;  1G8X A;  2LY2 A;  3AG2 H;  2JSP A;  1MBJ A;  2DMQ A;  1F5T A;  1TL8 A;  3DF8 A;  2V9V A;  3REO A;  4XRS A;  2D45 A;  2V1X A;  2Z1D A;  4Q5S F;  2RNJ A;  4XRS G;  2K3F A;  2PX9 A;  4HPQ A;  3HOX J;  4KIB A;  2FML A;  4KNY A;  2LH9 A;  2EA2 A;  3NAR A;  4EJO A;  3DTI A;  3IH2 A;  3C7J A;  3I55 I;  1K83 J;  2CFO A;  2WB1 A;  3ZMD A;  4B43 A;  5EG0 A;  3S1M J;  1OKR A;  2BVM A;  1ZH5 A;  4IHV A;  2K9N A;  3RCO A;  1D5Y A;  2R5Y B;  3J7A O;  1ZR4 A;  3IC7 A;  3CF2 A;  4RM2 A;  1P2F A;  3A02 A;  1IXR C;  1VQM I;  2W1O A;  1R58 A;  3H0D A;  3AFH A;  3H5N A;  2WWY A;  2NS7 A;  3LFU A;  5L3D A;  3ZN1 A;  4XIC A;  4JOM A;  2PN6 A;  4WXC A;  3CDI A;  3JAM K;  3WU1 B;  2COM A;  3MQ0 A;  3HEF A;  4P1W A;  3JW4 A;  3OOP A;  4ENN A;  2VE8 A;  2XGE A;  4GYI A;  5HLI A;  5FB2 A;  3PSF A;  3K1N A;  1AKH A;  2NRA C;  4IXA A;  1A6Q A;  1XDS A;  2DQR A;  1RUO A;  1OYI A;  5CLS A;  1RZ4 A;  4H0E A;  3LMM A;  3O8H A;  4R79 A;  2A5W A;  3NAU A;  3B6C A;  3D1N I;  3ERE D;  1V54 H;  1ZK8 A;  1WJB A;  3BG5 A;  3KLO A;  3HOV J;  1BI3 A;  3MN2 A;  1KU2 A;  4IHT A;  2COB A;  1P4X A;  5LLQ A;  2M0C A;  2JUC A;  2R7V A;  2GQQ A;  2P6S A;  1XS9 A;  2HI3 A;  2EIL H;  2DMN A;  3HBL A;  3RYP A;  1IO2 A;  1BJA A;  4EJV A;  4CHU A;  4CA0 A;  2W82 A;  2VQH A;  2CSO A;  2IA2 A;  2YX7 A;  4CZZ A;  5EJC A;  3H3Z A;  2L0K A;  3CQZ J;  1L0O C;  2CH0 A;  2V6C A;  3P9I A;  3GFI A;  3TW6 A;  3ZMV A;  1S7A A;  2Z9O A;  3PJR A;  4BAY A;  4X6A J;  3RPQ A;  2XGC A;  1IAW A;  1MZB A;  2BZT A;  2RAE A;  4UB6 C;  5LHH A;  4QLC U;  2JSC A;  3EPZ A;  4F3Q A;  2IBD A;  4RB0 A;  3CCU I;  2VKV A;  4Y17 A;  4L9N A;  5CJ9 A;  2MLG A;  1GV5 A;  3WTZ A;  3CCR I;  1FMW A;  1B6A A;  5EG0 B;  3HRM A;  3QOE A;  1MSF C;  4AVP A;  2RKH A;  3KET A;  3L2C A;  3W2A A;  1MBF A;  1V5F A;  5DYM A;  4RMN A;  3L2V A;  2IS1 A;  1SFE A;  3G73 A;  5CKT A;  1YTY A;  5FLX Z;  5FKL A;  1G3S A;  2XPW A;  2DN0 A;  4MFD A;  2CQX A;  2LY1 A;  5IY5 H;  3J81 Z;  2O03 A;  4U0Y A;  5GAD J;  2NVU B;  1VQL I;  3BWG A;  3ZQC A;  1G3Y A;  3HSR A;  2H09 A;  3OMY A;  2VN2 A;  1R5I D;  2OD5 A;  5H6Q A;  1AKH B;  2JVG A;  5HOO A;  3R4K A;  4XLE A;  4NDL A;  3ZXS A;  1WH5 A;  1IXS B;  2ZXJ A;  3HKZ A;  4AID A;  3MKY B;  4J00 A;  1MSE C;  4XKW A;  4ABZ A;  5EGO A;  1FLI A;  1MBH A;  4LIV A;  1FIP A;  1B9M A;  1PYV A;  2Q8K A;  1VQK I;  4XOT A;  4OIP F;  2PMZ A;  1ZGA A;  1MJB A;  4HNV A;  1SAU A;  1S6L A;  2NS8 A;  3EUH A;  3SDG A;  2ECC A;  4IX7 A;  2IS2 A;  4YFX F;  5E20 A;  5D5X B;  3BR1 A;  2FOW A;  3RJP A;  5B1B H;  3AL0 B;  4BQN A;  4DW6 A;  1WJA A;  3ZCO A;  2MG4 A;  1XTA A;  4ZH4 F;  1LFU P;  2GBY A;  2V9P A;  2DA4 A;  2X85 A;  3KZZ A;  4D7N A;  1J7K A;  4GCV A;  1BIB A;  1Z6T A;  3HSF A;  2R7X A;  2EFN A;  2CS3 A;  2PEX A;  1ZTR A;  1FC3 A;  4ZYE A;  3E97 A;  1QA6 A;  3AG1 H;  4P5O A;  4N4N B;  4A6D A;  2UXX A;  3LST A;  5IOY A;  4L5I A;  5K7F A;  1QU3 A;  5GPA A;  1MDM B;  5FRO A;  1DU6 A;  2E35 A;  3RPU A;  1Y56 A;  4HNU A;  4N4O B;  5EEA A;  2KIF A;  2QBY A;  1TWF J;  3FXK A;  1EV7 A;  2HGC A;  2V1N A;  4YIR X;  2VXZ A;  2EV0 A;  4D0P A;  2KPM A;  2CWE A;  4IRG A;  4DBQ A;  4KUM A;  3M1C A;  5H20 A;  3Q3S A;  2PJP A;  4WF2 A;  5F08 A;  1JJ8 C;  1OMI A;  2CW8 A;  1W5T A;  2ID6 A;  4XID A;  4ZTF A;  4D7M A;  1H0M A;  3OYM A;  3K69 A;  1R22 A;  4DGW B;  2XSD C;  5FFZ A;  3L7W A;  4C2U A;  2HYG D;  3OYK A;  4G6D A;  1IRF A;  4XON A;  1ZRD A;  2HZT A;  5HDG A;  2CV1 A;  3NQO A;  3WTS C;  3ABK H;  3K9T A;  3LQR A;  2HQA A;  2BHZ A;  2YX4 A;  1LDK B;  4BHC A;  1N78 A;  1WGX A;  2HR3 A;  1HKQ A;  2DPU A;  2GM4 A;  3SEQ A;  2JK3 A;  2XB0 X;  1W7P D;  3FZV A;  4CO8 A;  3IP4 B;  3I53 A;  2IRF G;  4UUV A;  4FTH A;  3PUB A;  4NBQ A;  1GDT A;  5GAG J;  2QVO A;  4YIF A;  2A6H F;  3W2V A;  4ANJ A;  1RUN A;  2ZXI A;  4YEJ A;  4A3F J;  1LJ9 A;  3DBR B;  4P55 A;  1FZP B;  3TOB A;  1WPK A;  5KCM A;  2OA4 A;  4ZC3 A;  3LA7 A;  3R61 A;  3OV8 A;  4CGZ A;  2QLZ A;  3WTU C;  1Q1V A;  2W48 A;  1R5G A;  4Q48 A;  4Y7N J;  2WY7 Q;  3GFL A;  3VPR A;  4B44 A;  2HTJ A;  4A5N A;  3E6M A;  3RTR A;  1MW7 A;  1MNM C;  2O6G E;  2KJB A;  1TC3 C;  4ETS A;  1R4M B;  2IS6 A;  2M30 A;  2CRG A;  5L3G A;  2IGK A;  4RB1 A;  1O3R A;  2XAQ A;  4I7H A;  5CVJ A;  3VB2 A;  4L5J A;  4LFU A;  3CC7 I;  4O3M A;  3ZRG A;  5LGT A;  2HOE A;  3K70 D;  3LSI A;  1SFX A;  1A04 A;  1BW6 A;  2QBY B;  2BEO A;  2VPL A;  2WAQ N;  1Z3Y A;  1O3S A;  2H1K A;  2P5K A;  4HX8 A;  3BP8 A;  4MLO A;  1NTC A;  2JPB A;  1FBS A;  2ZME A;  2CFX A;  2LG4 A;  3MMY B;  4K2E A;  3JSP A;  3TO9 A;  5HOD A;  2BW3 B;  4Z2Y A;  5F1J A;  2CUE A;  3DEE A;  1WJE A;  1OLT A;  4GO1 A;  2ZJP F;  3HPG A;  4ESB A;  3ZMZ A;  4L9V A;  2L7M P;  1PP8 F;  1P4W A;  2QQ8 A;  4H4K C;  1Q1H A;  2E5N A;  2EA4 A;  2O8K A;  3K0L A;  2VAS A;  1TBX A;  1KYZ A;  2MA3 A;  4BY7 J;  1IDY A;  2L9V A;  4A6E A;  3BC8 A;  2QQA A;  3BG6 A;  4L18 B;  3W6K B;  1BI0 A;  3LA3 A;  2OAZ A;  2KZG A;  3FKJ A;  3HHH A;  5J1R A;  2LKX A;  4BBS J;  5TRD A;  2A6T A;  3ASN H;  4M9S A;  4DNC A;  1Z6R A;  2Z3Y A;  2C6Y A;  4B8X A;  3KEO A;  3F8F A;  3JTG A;  1OPC A;  2H8R A;  2ZB9 A;  2QZ8 A;  4JBA A;  3LSR A;  3HTS B;  4A0Y A;  1XG1 A;  2FE3 A;  1ACI A;  2O9L A;  1W1W E;  2RRE A;  3QU6 A;  3CJN A;  3LA2 A;  3KX2 A;  1HKT A;  3FXQ A;  4B1R A;  4GGG A;  2I8D A;  1X1P A;  3GBG A;  1IGN A;  4EM1 A;  2EZI A;  2YU9 J;  3G1L A;  3GUD A;  5BPD A;  1FYK A;  4YFN F;  1X4O A;  1Y0N A;  3SXY A;  1JTX A;  2ZFU A;  4YII A;  3DU6 A;  2M8E A;  2IS4 A;  1U8R A;  1D1C A;  5IP6 A;  2M4K A;  1ZKG A;  3LSK A;  1JT6 A;  4KIG A;  4M3D A;  4A2U A;  3QYF A;  4XLF A;  3CCL I;  4BQO A;  1RIO H;  5AIP A;  1H8A C;  1TTY A;  4HEA 2;  3HIF A;  5F0C A;  4CCO A;  2UV1 A;  4E7L A;  2HXO A;  3KYC B;  2F6C A;  2XUB A;  3H9J A;  3D5S C;  5HS7 A;  1KQ8 A;  2R7Q A;  2XDV A;  4RAZ A;  1SVM A;  1LB2 A;  3I56 I;  3OS1 A;  1B8I B;  2DXI A;  3K1M A;  4A3E J;  1X4P A;  4LK0 F;  1N77 A;  3VOD A;  1NHA A;  4HX7 A;  4AUX A;  2M7B A;  3HL2 A;  3KP2 A;  1H9G A;  2GWR A;  2BV6 A;  2F4M B;  3LOC A;  3E6C C;  1Z05 A;  2A05 A;  2PLY A;  3DU5 A;  2HQN A;  1U8B A;  3FMR A;  2CUZ A;  1Y1V J;  1R4N B;  2BBY A;  2IP2 A;  3H1C A;  5L3E A;  4Q47 A;  3FXL A;  4RAF A;  1AWC A;  1VQ8 I;  4E7I A;  4ESF A;  1GHC A;  2FBK A;  1JUM A;  2ZJQ F;  4JX6 A;  4PFP A;  1B1B A;  3JRD A;  1YIO A;  2HS5 A;  2P4W A;  1B4A A;  4UV8 A;  4DYQ A;  4MQV A;  3U21 A;  3V4G A;  2VOO A;  3GTP J;  4KN7 X;  2L7F P;  4B3A A;  1NK3 P;  3K1P A;  2ZME C;  1S7E A;  1GV2 A;  1FJL A;  4J19 A;  4G8X A;  5FLV A;  1VQO I;  3MAJ A;  2HDW A;  3FXU A;  4FET A;  4WXH A;  3GZ6 A;  3HPH A;  4MNU A;  5JHU A;  1E2X A;  1WHU A;  1X58 A;  3ML6 A;  2L9S A;  1QBJ A;  1BW5 A;  1MND A;  2D1H A;  1R9T J;  2RVC A;  5BOX A;  3PM1 A;  4MQ9 F;  5HLG A;  3CES A;  5CVV A;  4BNC A;  1PDN C;  4ITV A;  5IP7 J;  1ETX A;  2QSG X;  1BBY A;  2ETH A;  3KZI C;  3WTT C;  4HW0 A;  3V7S A;  3VSK A;  2ISZ A;  2M2E A;  2V79 A;  3A1Y A;  2A61 A;  4BEH A;  1ZLK A;  2EV5 A;  1XSX A;  5E8I A;  2KRH A;  4MGR A;  3FXO A;  5J8C A;  4RS8 A;  1A6I A;  2PMH A;  2Y75 A;  5AON A;  2PQ8 A;  5CYV A;  3QPS A;  2M5W A;  4OMY A;  2DOE A;  1E3H A;  2YU3 A;  1XPX A;  3M3Y J;  1X1B A;  2CYY A;  4Y13 A;  3S2D J;  3VYU B;  2DOF A;  3V42 A;  4M9X A;  4BEH B;  3NWS A;  3C3W A;  4MTE A;  4E7Z A;  1SFK A;  4P96 A;  2X6X A;  1PUE E;  1WZ2 A;  1FOX A;  4W97 A;  4OIN F;  3G2B A;  1SC7 A;  1YS6 A;  1WH7 A;  2ZFW A;  1OIS A;  2EWN A;  2DOD A;  3T8R A;  2KLO A;  1SAX A;  3H3V K;  2CGP A;  4WWC A;  3Q0V A;  5K7Z A;  1W7P B;  5FO5 A;  1JGS A;  4MTD A;  1OYY A;  1TW3 A;  3B73 A;  4ZDP A;  2R3S A;  3MKL A;  2BY1 A;  4Y52 J;  2K02 A;  1P9Q C;  1R7J A;  3L2R A;  4YRV A;  2OCE A;  2CW0 F;  3DQV C;  1R23 A;  3W6J B;  1Y1W J;  3ZQ7 A;  2BXZ A;  1ZGW A;  2MD0 A;  3CCQ I;  3GLX A;  1WJC A;  2IGO A;  3E6D A;  1IC8 A;  1ON1 A;  1MNE A;  4M73 A;  2EK5 A;  3K2A A;  1OCC H;  3H9Q A;  3H3U A;  4F7Z A;  3ESW B;  2M45 A;  1VI0 A;  3TDZ C;  2XAF A;  4FT8 A;  4BHP A;  2D5V A;  1ETV A;  5JLX A;  1LPQ A;  4BL0 B;  1X3U A;  2WC2 A;  4DZJ A;  3I0T A;  5A2Q Z;  1T98 A;  1XCB A;  4G7Z F;  3IUO A;  3FXR A;  3W3C A;  1QHG A;  3C2G A;  1OYW A;  1YX3 A;  1SAN A;  3DEW A;  4I76 A;  4RGX A;  4LB5 A;  2JRT A;  2NOJ B;  2R7U A;  1X2M A;  3HHG A;  2CV0 A;  3JRH A;  2BGC A;  2XKP A;  3A4C A;  1YOV B;  3I71 A;  2EZH A;  3BY6 A;  4CXF A;  5C4J J;  3HOW J;  3F72 A;  2R92 J;  1SD6 A;  2G0E A;  1Z67 A;  2F5V A;  2K9S A;  5GAE J;  2V1D A;  2F4I A;  3OL3 A;  4DOZ A;  2LR8 A;  1WCM J;  1WSU A;  4HOB A;  1O57 A;  1HST A;  2KDO A;  4BU2 A;  1KQ9 A;  4S04 A;  4ESJ A;  3MCZ A;  1BIA A;  2VE9 A;  2FBI A;  3ZPL A;  4IRI A;  2WB1 N;  2R5Y A;  1W36 D;  3H36 A;  3DKY A;  1LUJ B;  2JTV A;  1QVT A;  2K85 A;  2H6B A;  3EQL F;  3HUG B;  3ZMT A;  3WTY C;  2LD5 A;  3WHB A;  5E3N A;  2V6E A;  2ZSH B;  3KZY A;  1XMX A;  1DP7 P;  4ZDO A;  3P7N A;  2Y9Y A;  3GTJ J;  5CVU A;  1QZZ A;  3BR5 A;  3BCB A;  2BVL A;  3CUO A;  1O7L A;  2EBI A;  4BJT A;  2R7W A;  3FDY A;  1ZGJ A;  2KMU A;  1TQI A;  3C2H A;  4I0B A;  1G59 A;  5J1Y A;  1A31 A;  2OQG A;  1YHQ I;  1YRN B;  2VOP A;  3BTJ A;  2LOO A;  1K6Y A;  3A0B C;  2G9W A;  3ECH A;  2ICW G;  2NVY J;  4EJW A;  2Q2E A;  1I1S A;  1P4A A;  3TGN A;  3K7A J;  4N9I A;  4XSZ F;  3T0Y A;  2XC7 A;  5GPC A;  3OIO A;  3Q0U A;  3CUQ B;  2HNH A;  3LSG A;  2HOS A;  2CQ7 A;  4AIH A;  5BPI A;  3I3L A;  9ANT A;  3DPU A;  2HKX A;  3ERM A;  4E7K A;  1AHD P;  1C0W A;  4XLC A;  4ZYD A;  4BS9 A;  2MBF A;  3E3V A;  3TDU C;  3SJM A;  1YQA A;  4YEL A;  2IA0 A;  4F91 B;  1FX7 A;  4AVZ A;  1UFM A;  3ZMU A;  3MKW B;  1K4S A;  1H88 C;  1VQ7 I;  2CQN A;  2DPD A;  3VYS B;  3SZT A;  1WRJ A;  3ZQL A;  4EVI A;  4HV6 A;  3T1B A;  3OIP A;  2VC0 A;  1YG2 A;  1YJW I;  4C9Y A;  4BE0 A;  2E1N A;  3EUH C;  3CO7 C;  4QPQ A;  3R0A A;  3OYJ A;  2HDD A;  2R5Z A;  1IRZ A;  2BY3 A;  4OU0 A;  3NRV A;  1X1A A;  3OR1 C;  1KGS A;  4CH7 A;  3GME A;  3FBI B;  3K4K A;  1WI3 A;  5HVQ C;  5J40 A;  4FE7 A;  2L7K A;  2KJC A;  2W7N A;  3HRT A;  3T8T A;  4C3H J;  4I09 A;  5J1U A;  3L1P A;  2VOD A;  2VPR A;  3CZ6 A;  2HPI A;  3JSO A;  2QUF A;  1ETW A;  3SFZ A;  2PMU A;  1RNL A;  2K4B A;  3TP3 A;  4BXF A;  1IUY A;  2F5F A;  2LC2 A;  1U5T C;  2HTS A;  2ZBK A;  3IH3 A;  2IA1 A;  1SD5 A;  1U78 A;  2MGQ A;  4XKV A;  2Z99 A;  2X6Y A;  3PNV A;  4Q4Z F;  4LG0 B;  2ZC2 A;  4HAM A;  2JA2 A;  1FP2 A;  5D6F A;  4QWQ A;  4BAC A;  1QPI A;  3CC4 I;  3IKV A;  1U9O A;  3TKY A;  3WE3 A;  2NNY A;  5K1Y A;  5HLT A;  5TGT A;  3V8J A;  2ZKZ A;  3GF2 A;  5EF6 A;  4I02 A;  3M07 A;  2HVR A;  5D5W B;  2M3A A;  1GVD A;  4V2F A;  3Q9V A;  5DCM B;  2FMY A;  3IWF A;  2L9N A;  1V5G A;  5LRR A;  1JTY A;  1ORK A;  2VB6 A;  1J9I A;  2STW A;  3LL7 A;  1ERD A;  2GA2 A;  4B09 A;  3ELK A;  4A5M A;  2MYS A;  4MEX F;  3UKG A;  1T8I A;  2A6E F;  3JCU C;  2W4S A;  2XB5 A;  4R1H A;  2FRH A;  5FD6 A;  3HOS A;  2DJN A;  3F6O A;  3M8E A;  1MMG A;  4V2G A;  4FCY A;  3KP4 A;  3MZ8 A;  1IRX A;  1TZL A;  1HSJ A;  2UXN A;  3CCV I;  2CG4 A;  4I2O A;  5ICC A;  1MD0 A;  2DFI A;  4WX9 A;  3CMM A;  3SHF A;  5A2Q K;  4IKF A;  2ELJ A;  5FLX K;  3G1O A;  3IRR A;  1Y39 A;  1VND A;  5B3S H;  1IJW C;  4V19 K;  5GAH J;  4PCQ A;  2VT3 A;  2EFQ A;  4PDK A;  3ASO H;  5M3M J;  5FD5 A;  2L4M A;  4CSW A;  3S32 A;  4XOR A;  2FEZ A;  3ZOB A;  2L5Q A;  2L7Z A;  2FXA A;  4YFK F;  2LY9 A;  1HBX G;  2P5V A;  5K7H A;  1X19 A;  2JT1 A;  2VJJ A;  2BHY A;  4KIS A;  2LNB A;  3WU0 A;  4HF0 A;  5E3L A;  3AG3 H;  1XGN A;  2O0Y A;  2X1D A;  1JUP A;  3I64 A;  4PGH A;  5E1W A;  3OWT A;  1LE8 B;  1BL0 A;  4A93 J;  1D3Y A;  1SVL A;  2OCC H;  3QP5 A;  3A01 A;  1DP3 A;  3RI4 A;  1BOA A;  2JRM A;  4DZP A;  2EZL A;  1I6X A;  1UHW A;  2FA5 A;  3CLQ A;  4A0X A;  3G71 I;  5M5W J;  2EFW A;  4G7H F;  3KYD B;  3S15 J;  2OU2 A;  1OCR H;  2R7O A;  2OPT A;  3F8N A;  1IRG A;  3ECO A;  3WHC A;  4FIS A;  2K9Q A;  3V7C A;  4FX4 A;  1F4K A;  2DFE A;  4PFO A;  3FXJ A;  4B48 A;  5HDK A;  3V7R A;  3RDI A;  1V4R A;  3GX4 X;  4N9H A;  1FIA A;  2AHQ A;  1CGP A;  1D1A A;  2CW7 A;  5CVR A;  1K78 B;  2B0L A;  3HRS A;  3HOZ J;  4MO7 A;  3S93 A;  5EGO B;  1T38 A;  5IYC J;  1ZN2 A;  1O4X A;  2QSF X;  3K4C A;  3VEP A;  2E34 A;  4A3J J;  3JRI A;  1Y8Q B;  2XPV A;  3BG9 A;  4AM3 A;  2AQE A;  1POG A;  3FIS A;  3GW2 A;  4XQF A;  1FOK A;  2VKE A;  1FP1 D;  2HEO A;  4E70 A;  1UST A;  5DTD A;  2LBF A;  3L00 A;  4R8H A;  2E1C A;  2GIZ A;  2VBZ A;  1X1D A;  2FUG 2;  2WY8 Q;  1S3J A;  2LDU A;  3J7Y J;  1ETQ A;  1U5T A;  1FBQ A;  4GYG A;  4PSW A;  3L2U A;  3J80 Z;  3JAM Z;  2G7H A;  4AU7 A;  4A3D J;  2H27 A;  4UNO A;  4RA2 A;  1JKP C;  5F0F A;  4CCJ A;  2YS9 A;  5JFR A;  3WTX C;  1XN7 A;  4Z6Y A;  1S72 I;  3K6G A;  4C2T A;  4KYW A;  3KIO A;  2MFZ A;  2E2I J;  1OCT C;  2CU7 A;  1EH6 A;  1HCR A;  3FKI J;  2STT A;  4IOA F;  2HVQ A;  2PBI A;  4FQG A;  1FOW A;  1ETO A;  4U0V A;  2R7T A;  5BQT A;  4AIJ A;  1R36 A;  2L02 A;  3S8P A;  2NXN B;  3FF5 A;  3F23 A;  5LGU A;  1PUF B;  3QOP A;  3COA C;  1RKT A;  2D1V A;  1X3W B;  2O5R A;  2LKP A;  2D2W A;  3GZN B;  4AYB N;  3OYG A;  2V1U A;  5D8K B;  2HXI A;  4HLY A;  4RAY A;  3SZP A;  5HNF A;  4KIF A;  2AQF A;  3PSI A;  4CCM A;  2R4G A;  1DPU A;  5KAF C;  3MFK A;  3EYI A;  2A68 F;  2CV2 A;  4IF4 A;  2A07 F;  1YW9 A;  3L09 A;  3TQN A;  4CYD A;  3S1Q J;  1B8I A;  2JQ7 A;  3P5J A;  3WTW C;  1Y0U A;  2A69 F;  3GTQ J;  3F6V A;  5LGN A;  2EFP A;  2OF7 A;  3PQK A;  3R60 A;  2K4J A;  3CD6 I;  3IWZ A;  4IEJ A;  5DCF A;  5K5O A;  3OYI A;  5BNG A;  3LSJ A;  1KQ0 A;  1SD4 A;  1ZG5 A;  1Z21 A;  1MBK A;  5J6X A;  1O3T A;  5HDN A;  1K79 A;  3I58 A;  2HYJ A;  3HDD A;  2AXL A;  2VIX A;  3ULQ B;  3BZ6 A;  2H94 A;  2VJI A;  4RLQ A;  4BXU A;  5L3C A;  1LVA A;  4BKX A;  3LFK A;  3GFJ A;  3AG4 H;  3OYL A;  4X1E A;  1CF7 A;  5CQE A;  5K5Q A;  4IRH A;  4C3J J;  3D0S A;  2W84 A;  1J09 A;  3G3Z A;  4A3B J;  1TT5 B;  3C18 A;  2E5Z A;  2XF6 A;  2LSO A;  2HOA A;  2Z33 A;  2DA5 A;  4PZJ A;  3DEU A;  3CF5 F;  5HNH A;  3ONQ A;  1IV8 A;  2GA1 A;  3E5Q A;  1ZLJ A;  4ASN A;  2RV8 A;  3D5R C;  4D5C A;  1MJ9 A;  4M3G A;  2K40 A;  2HKO A;  2M87 A;  1R71 A;  1B59 A;  1JGG A;  2O3F A;  1MKM A;  3V8L A;  1IXC A;  2ZJR F;  2FF4 A;  3WGI A;  4CUG A;  1MJA A;  3TED A;  1NG6 A;  4AC0 A;  2VLA A;  4JYK A;  1XCV A;  2N8G A;  5DM7 F;  1BI1 A;  1XD7 A;  2Z5U A;  3QYB A;  5IYD J;  2DO7 A;  2ID3 A;  3AAF A;  2A5Y B;  5JHF A;  2DK8 A;  4E4H A;  4EGZ A;  3FK6 A;  3N4M A;  3JRE A;  2QKL B;  2E19 A;  1K7A A;  3E6B A;  1YJN I;  1ZRE A;  2OZ6 A;  3PIO F;  1BA5 A;  1TNS A;  1B9N A;  3PNY A;  1TNT A;  4HBL A;  5L3F A;  3WU2 C;  1IZ1 A;  2XHK A;  5KNL A;  4IQJ A;  4NHJ A;  1LVK A;  1QGP A;  5TIS C;  3W6V A;  4BHB A;  4RM3 A;  2Y30 A;  1HQC A;  2ZJ2 A;  3DBH B;  2JJ7 A;  3QPL A;  1EA3 A;  2X0L A;  3FMQ A;  1OJL A;  3LQQ A;  2WAQ A;  3HOU J;  5D5U B;  2FSW A;  2VQC A;  1UG2 A;  2ZO4 A;  3K4M A;  4IHW A;  3I4N J;  2X6O A;  4UV9 A;  2KIM A;  2JA8 J;  2QGU A;  5DCM A;  4XKB A;  4OIR F;  3CUQ A;  2X6W A;  4BH9 A;  3CDL A;  3KP6 A;  4X0G A;  3FBN B;  4XM3 A;  2ELK A;  3LSH A;  1EJ9 A;  4EMS A;  3CCY A;  1BR4 A;  1YW7 A;  2KQR A;  1RR8 C;  2M7A A;  5C4X J;  3QPT A;  4BY1 J;  1I3A A;  1D0X A;  1T08 B;  2ZXH A;  1ONV A;  2MC4 A;  4LG0 A;  4M71 A;  3QYE A;  4NC8 A;  1P92 A;  1UMQ A;  2AS5 F;  3CLO A;  2DLL A;  1F9N A;  2LKS A;  1BOB A;  4I99 C;  2IVM A;  2M9H A;  3WGG A;  3CCE I;  5LRS A;  1N25 A;  2HOT A;  2XKO A;  4PSX A;  2JWT A;  4J01 A;  5FKN A;  2H8W A;  4A3M J;  3OSF A;  3I59 A;  1WJ5 A;  1TQP A;  3K4N A;  4I6Z A;  1B72 A;  1I50 J;  1NG7 A;  1JI8 A;  3BQY A;  1XGM A;  1TT0 A;  3VDX A;  4UHT A;  4HLX A;  5IT9 K;  3BQZ A;  3IKT A;  2DK5 A;  3JRA A;  5LFA A;  2IT0 A;  3BJA A;  2K9L A;  2W00 A;  3FIW A;  5EDN A;  2HVS A;  2L9R A;  2GLO A;  1QRY A;  2XF5 A;  1JHH A;  2LFB A;  2PJR A;  3BCA A;  1S8N A;  1X3Z B;  2KFD A;  4PJM A;  2DYS H;  4Y15 A;  5HS9 A;  1DGR M;  4EM2 A;  1RES A;  5LD2 C;  2B63 J;  1QPM A;  2V4J C;  4G6T B;  5D4S A;  4F93 B;  4IHX A;  3KEY A;  1WWX A;  4IZZ A;  4M74 A;  3KP5 A;  4BQA A;  1X1C A;  2XV4 S;  2WTE A;  1O7F A;  4MFE A;  2JVH A;  2ELH A;  2DU9 A;  2TRT A;  3I54 A;  1LEB A;  5F04 A;  2CQK A;  4IHS A;  2Z16 A;  4JP0 A;  3PIP F;  1CF7 B;  2HYF A;  2P8T A;  3F8M A;  2DAO A;  3HXL A;  3J7Z I;  1KYW A;  3FHZ A;  4HNT A;  4IVN A;  1H9T A;  1T95 A;  2DFH A;  3ABL H;  4BE2 A;  4E7H A;  1A5J A;  3S1N J;  2MH2 A;  2MAB A;  3GEZ A;  2E7X A;  4CCN A;  1K4T A;  1TWA J;  2F5C A;  2UZK A;  3WG7 H;  2QA4 I;  3I9V 2;  3P9C A;  1KU7 A;  3H5A A;  2E7W A;  4E6K G;  2M1B A;  2GXB A;  3WGH A;  5EEG A;  3KFW X;  3QOD A;  4FAS D;  2HWV A;  3MD2 A;  3WG9 A;  4KMU X;  1JHF A;  2DT5 A;  2OBP A;  1P7J A;  1VQ9 I;  1ENH A;  2MC3 A;  1U9N A;  4DYR A;  4HA8 A;  4A69 C;  1IUF A;  2YR2 A;  1FYM A;  4KA4 A;  1HKS A;  1Z9C A;  1W5C C;  2HQ5 A;  4BYY A;  4FE4 A;  1WJD A;  1I5Z A;  4F92 B;  2Y9Z A;  2HU9 A;  2LYC A;  2LLK A;  3FX3 A;  4HV5 A;  1UHM A;  3U1D A;  2EZK A;  4NQW A;  1GVJ A;  5E1X A;  3U9G A;  4UUS B;  2ZXW H;  3MKZ A;  3PO3 J;  2ESH A;  2GAU A;  2K3P A;  3T5X A;  3L2W A;  4O6J A;  4XLN F;  3HG9 A;  4HZF A;  3LAJ A;  1WVR A;  1YYV A;  4Y33 A;  1DDN A;  4LJZ F;  5LHI A;  3E0J B;  4Y3O A;  3E1S A;  5FJ8 J;  1AOY A;  1G6N A;  2Q1Z B;  1U0J A;  2ESN A;  3TOA A;  4EQQ A;  3OOU A;  4LD5 A;  1DUX C;  5FRM A;  3ZP5 A;  2WV1 A;  1UHS A;  3ROU A;  2VUM J;  2BOL A;  1LDJ A;  1TWH J;  3HSE A;  3DBL B;  4FHT A;  3VYT B;  3QAH A;  1DGW Y;  3HTU A;  4I98 B;  4BGD A;  5C3E J;  3S14 J;  1I3Q J;  1U5T B;  3N05 A;  2LF8 A;  1D0Y A;  3CCJ I;  1ETY A;  4ENM A;  3GTO J;  3DPT A;  2FJ1 A;  3DP7 A;  2XIG A;  4RAG A;  2GZW A;  4L0Y B;  4WK8 F;  1L3L A;  1IN5 A;  2VC1 A;  5DD4 A;  4AYB A;  3KP7 A;  3BTC A;  2W24 A;  3S16 J;  1R1U A;  1BN5 A;  4XRF A;  4LLL A;  4BDY A;  5M3F J;  3OYD A;  4PJL A;  2QF7 A;  1JKO C;  2QQB A;  2W85 A;  2WAF A;  3VWB A;  2OZU A;  3J81 K;  2E1M B;  2O8X A;  1PUF A;  5H6R A;  2WA0 A;  3B02 A;  4DYC A;  1LDD A;  1T39 A;  4EEF G;  4PJJ A;  3CJR B;  3OY9 A;  5F27 A;  4MEY F;  4ZJZ A;  2VBW A;  5EEH A;  5FGM A;  4UVB A;  1P7I A;  3SFI A;  2KDZ A;  1MDM A;  2LP0 A;  2QEX I;  3GTM J;  4OOI A;  1R49 A;  3IL2 A;  3OYC A;  2FOK A;  4P9U A;  2DFF A;  2RGV A;  4BBR J;  2YSR A;  1OR7 C;  2WAD A;  5C44 J;  1LQ1 A;  1OR7 A;  2EIM H;  4M6V A;  3GXO A;  5ILS A;  2MSY A;  1GLN A;  1SMY F;  4XSX F;  3WOD F;  1D0Z A;  4GXO A;  5D4R A;  4I0A A;  2R7Z J;  2X51 A;  2RQQ A;  1F36 A;  5FRN A;  3BR6 A;  5E3M A;  1EH8 A;  1YIJ I;  1UAA A;  3BT9 A;  3GO5 A;  1BI2 A;  4XRM A;  2DDB A;  1SFO J;  1I39 A;  1ZRC A;  1YI2 I;  2LMD A;  3HKZ N;  3M4O J;  2TDX A;  4HG2 A;  1TP4 A;  1UJ8 A;  3OS0 A;  1QQI A;  2B9S A;  1YIT I;  3HOT A;  4CCK A;  1UG0 A;  2VT2 A;  1JUS A;  3FMS A;  2CJJ A;  4E7J A;  2EV6 A;  4S0H B;  4I01 A;  4KIC A;  4KJZ A;  2KRF A;  3C2B A;  2L4A A;  3M9A A;  2P5L C;  2IGM A;  4OAY A;  3H9G A;  3ZGK A;  1Z1D A;  3S1R J;  3RIR A;  1HDD C;  5JI6 A;  2ME6 A;  2MH9 A;  3EYY A;  4NQW B;  3U2R A;  2LF7 A;  3G4S I;  1KZH A;  1IN4 A;  3SEZ A;  3D5L A;  3M1E A;  4ZDL A;  3QRF F;  2DA1 A;  4M3B A;  5H2F C;  1QNT A;  1RR7 A;  2EH3 A;  3DLL F;  5ED4 A;  3HZJ A;  3F8B A;  2RC4 A;  2XRL A;  2FNA A;  3GTL J;  2IAI A;  2OC6 A;  1LFB A;  3U1K A;  2OTL I;  2X1C A;  4JQF A;  3LSP A;  1HW5 A;  2DI3 A;  2Q0O A;  3BR0 A;  3UNG C;  4A3C J;  4MIM A;  3MZY A;  4NC6 A;  1MBE A;  2VQL A;  5B1A H;  1XGO A;  1FNN A;  3TO7 A;  4C2M J;  2OJE D;  3LWF A;  2NVX J;  3OR2 C;  3ZN0 A;  2IXS A;  2VKD A;  1U3E M;  4B47 A;  4M3E A;  2R93 J;  1FWZ A;  1YJ9 I;  2UUZ A;  2L3D A;  4NC7 A;  1FY7 A;  4JK1 X;  1GXQ A;  2ZSI B;  3P9K A;  2EB7 A;  2KRC A;  1BC8 C;  4D1Q A;  1LEA A;  4N0B A;  3S2H J;  3HGG A;  4S05 A;  4OIO F;  1RET A;  2ISY A;  1NH3 A;  2IW5 A;  2ZCW A;  4KDP A;  1OCO H;  2KT0 A;  3E5X A;  3SYT A;  3MZH A;  2W57 A;  2Y0M A;  5CVI A;  4IO9 F;  2XVC A;  1EH7 A;  2GXG A;  2H6C A;  3QP6 A;  4GFB A;  2LVS A;  3RYR A;  5GTH C;  2R7R A;  4II2 A;  1R6R A;  5LEK A;  6PAX A;  1Z77 A;  5B5E C;  4PJ0 C;  4UVA A;  4EJT A;  2LRD A;  1XSD A;  1W0T A;  2VQG A;  1V5E A;  1WJF A;  4ENK A;  1T33 A;  4LIU A;  3VYR B;  3PUF A;  5E8G A;  2X9D A;  4RGS A;  5KK1 A;  1VQP I;  2I10 A;  1IDZ A;  4HF1 A;  1R1V A;  1Z3X A;  1S9H A;  3H0G J;  3CO6 C;  5K5R A;  4EGY A;  1S7O A;  1G3W A;  2Z2S B;  2RN7 A;  2OTJ I;  2FD5 A;  4BDZ A;  2KIU A;  1YO5 C;  1IG7 A;  1RC9 A;  3DKW A;  4RGU A;  4JX5 A;  1LE8 A;  5IT3 A;  2H1L A;  1UCR A;  2QM3 A;  2JN6 A;  2XRO A;  4LB6 B;  2QYO A;  5GP9 A;  2NAZ A;  3C1D A;  1ZQ3 P;  4UY8 I;  2QSH X;  4TV7 A;  4P9F A;  5FKO A;  2FU4 A;  2YPR A;  2CMP A;  1FBU A;  3JRF A;  4LK1 F;  4LG3 A;  1JJ6 C;  1JKR C;  1MBG A;  2EQR A;  5CPR B;  2L54 A;  2WBM A;  2EIJ H;  4IPA A;  5EYR A;  2X4H A;  4II3 A;  3JRG A;  1K61 A;  1WQ2 A;  4KFC A;  3DPL C;  4EAT A;  2Y2Z A;  4XLA A;  3ZQQ A;  5IOZ A;  1USS A;  3R0J A;  4HSR A;  1BJZ A;  4XN3 A;  3BRO A;  4RDU A;  1IW7 F;  1HOM A;  3MEX A;  3OYE A;  4U0W A;  1BR2 A;  1VTN C;  4A0Z A;  3Q0W A;  3K4B A;  3KPH A;  3IRQ A;  1HA8 A;  2MW8 A;  3RKY A;  5FLM J;  3GZ5 A;  3TL4 X;  2DT7 B;  4IOC F;  2DDA A;  1MIJ A;  2NVQ J;  1JE8 A;  2ADU A;  3PFY A;  4L0Z B;  1D8K A;  2JA5 J;  4WCG A;  2DMT A;  1E0E A;  3KP3 A;  4XNF A;  4NUB A;  3PFI A;  5ICE A;  1ZG3 A;  1TWC J;  2ZNY A;  1X2N A;  4U87 A;  4IJA A;  3VFZ A;  2UWM A;  2W25 A;  3EUA A;  3VSL A;  4U7D A;  4A12 A;  1P6R A;  1QVU A;  3FM3 A;  1R5H A;  2ACJ A;  1FTT A;  2DA7 A;  1EF4 A;  3RKX A;  5DM6 F;  4EV0 A;  1QO0 D;  2IGN A;  3MVP A;  1YX5 A;  1V55 H;  1O3Q A;  3S3N A;  1HW2 A;  3RZO J;  2DYR H;  1FSH A;  2DBB A;  3WTV C;  2Q2E B;  3EET A;  1D1B A;  1VF9 A;  2JMW A;  3SQN A;  3CMY A;  3HYI A;  3GLL A;  5D5V B;  3N97 A;  1IV6 A;  4HDV A;  1HXD A;  3JR9 A;  2E2H J;  1QZY A;  2I5U A;  4L9J A;  1XGS A;  2VON A;  3I4P A;  2L2O A;  2RQP A;  3I59 B;  3BJ6 A;  1ULY A;  1REP C;  5ICG A;  1VZ0 A;  1GXP A;  2ZNZ A;  3TMO A;  2GOM A;  2QEN A;  3HB9 A;  1A36 A;  4A3K J;  1YE9 A;  3G6E I;  4PGG A;  3H35 A;  3DCF A;  3UR3 C;  1ZHF A;  5LBQ A;  3BZK A;  2VJ5 A;  2FQ3 A;  4A3I J;  1BR1 A;  5KHD A;  5AIQ A;  3F22 A;  2F4O B;  2QQ9 A;  4XBF A;  2GIV A;  2JZY A;  1ITY A;  1LNW A;  1QHH D;  3O8G A;  4GRI A;  3EUK L;  2M0M A;  3RZD J;  2NNN A;  4DBR A;  3KE2 A;  4BXX J;  4BJ6 C;  4CIC A;  2CO5 A;  4XK4 A;  3L9F A;  3I4M J;  3OYN A;  1SMT A;  2DJI A;  4KT6 A;  4HST A;  3DXJ F;  1J2X A;  2HFH A;  3E7L A;  3IHU A;  4DQ2 A;  1G3T A;  1YLF A;  2CUF A;  1UEL B;  2DTR A;  4OAZ A;  4XLH A;  3RQI A;  3H92 A;  2JA7 J;  4A3L J;  3QPH A;  2HZD A;  5ERI A;  4PUS A;  2PI0 A;  1SD7 A;  3DWL E;  3G1M A;  3W2W A;  3ZR8 X;  2E60 A;  1ZYR F;  3RPU D;  3S2W A;  2M34 A;  4B4C A;  2M8G X;  3DTK A;  5F0H A;  1TQM A;  4G12 A;  4BUP A;  4B3X A;  3X2Q H;  1RRJ A;  3OYH A;  2X48 A;  1XMA A;  3CUQ C;  4KIT B;  1YS7 A;  1XSV A;  3HRU A;  3IAM 2;  4MHG A;  4ZTJ A;  2FX0 A;  1KU9 A;  3PNT A;  1W4M A;  1VQ5 I;  1YFH A;  3K2Z A;  3HJE A;  5F64 A;  1D8J A;  2LTP A;  4LLG F;  2EIK H;  3PL8 A;  1SFU A;  3AL0 C;  1PJR A;  1FSE A;  3VOE A;  1IN7 A;  2JPC A;  3FK7 A;  2DA2 A;  4EM0 B;  1F1Z A;  2R7F A;  4HRI A;  1Y6I A;  1VQ6 I;  1OQY A;  1AA7 A;  2RDP A;  2Y0S A;  4BE1 A;  1YRN A;  3EDP A;  3BG7 A;  5ILU A;  5B66 C;  4O5V A;  4IHY A;  1W7P A;  3IH4 A;  5E3O A;  3E5U A;  4AD9 A;  2OV7 A;  1OCZ H;  5IP9 J;  1A35 A;  1MH4 A;  4M72 A;  3BPV A;  1XMK A;  1FOY A;  2BXY A;  3BPX A;  2AXT C;  4BQQ A;  1DPR A;  2PMZ N;  3K4L A;  2DA6 A;  2VL8 A;  2P81 A;  3QU3 A;  2L01 A;  3BLY A;  1ZEL A;  3BG3 A;  2XAS A;  1QZE A;  3IAS 2;  3DFG A;  3M8F A;  4E7S A;  5FKK A;  4RB2 C;  1MMS A;  2RNG A;  1T6S A;  2ME0 A;  2P6T A;  4HX4 A;  5BMZ A;  3RKW A;  1ODD A;  2Y69 H;  2BYV E;  2DCE A;  2PG4 A;  3OS2 A;  5HS8 A;  2BY0 A;  3RKQ A;  2VXD A;  2KL4 A;  3F0C A;  2P0W A;  3S17 J;  3OYF A;  5DDG A;  1VQN I;  4CYC B;  1ZR2 A;  1K6O A;  3F8C A;  2MLK A;  3F9K A;  3F21 A;  3QQA A;  1T0F A;  2F5E A;  4D9J A;  3J7A Y;  4M3F A;  4EJU A;  5TJJ A;  1STZ A;  3DKX A;  1KON A;  3TP0 A;  3BTI A;  4KN4 X;  2LBF B;  4DIQ A;  2VBX A;  3OIQ A;  4M6X A;  5JLW A;  3S3M A;  3OYA A;  4UB8 C;  4AIK A;  4IQ4 A;  3CTA A;  1FPQ A;  4CCL A;  2ECB A;  1FEX A;  5J3L A;  1TWG J;  2WV0 A;  2XPU A;  2XAU A;  5M5Y J;  4AWX B;  1TLH B;  1MMA A;  2FQ4 A;  2VJ4 A;  3RQ4 A;  2P7C B;  2DQL A;  4HQM A;  1EKE A;  3SDB A;  3O6B B;  4ZYA A;  1ZRF A;  5HLH A;  3KCC A;  1F43 A;  3GTK J;  1IN6 A;  5EZH A;  3A2K A;  3CP8 A;  1FTZ A;  5LHG A;  2CQQ A;  1VFC A;  2NOG A;  3ABT A;  3A03 A;  5GTI C;  3OSG A;  1Z91 A;  3J80 K;  4U88 A;  5BS6 A;  3GWZ A;  3ZQG A;  1APL C;  5JVG F;  4GDF A;  2G7U A;  3K10 A;  1HF0 A;  2R7D A;  3CCM I;  3M7G A;  4W1U A;  1HDP A;  2K5C A;  4L5E A;  1FYL A;  3LAP A;  3O2P E;  4OIQ F;  2PFB A;  3ABM H;  4QIW N;  1VQ4 I;  1KU3 A;  1ON2 A;  3KEQ A;  1GT0 C;  1W0U A;  2K7L A;  3GTG J;  1R00 A;  1XB4 A;  4G6Q A;  5E79 C;  2E71 A;  2V26 A;  1MH3 A;  3I5U A;  2E36 A;  3B6A A;  1S5L C;  1DU0 A;  5FKM A;  4ENJ A;  2DTZ A;  3KLN A;  3CME I;  4HF2 A;  5IPA A;  1PP7 U;  1K78 A;  1MMD A;  2XGX A;  5LEJ A;  2B7E A;  1XDU A;  1HLV A;  3LSM A;  3S3O A;  1Z7U A;  1SVO A;  1KA8 A;  2HQR A;  1M1E B;  3CCS I;  4YG2 F;  1YW8 A;  4FX0 A;  1S29 A;  2DMU A;  2AO9 A;  5ICF A;  2R0Q C;  2XGD A;  2DT6 A;  4UUS A;  2CUJ A;  1CQT A;  2XAJ A;  3A01 B;  2Y48 A;  4Y4R A;  1U2W A;  2BY2 A;  2EFO A;  3HOY J;  4JX4 A;  3BDD A;  3FXM A;  3R6S A;  4XLP F;  5DUI A;  3BR3 A;  1I1G A;  3TBI A;  5FFX A;  3BTL A;  3QWL A;  1HW1 A;  3CDH A;  2BW3 A;  3K4J A;  3BJO A;  2K86 A;  2K9M A;  4NNJ A;  4ZYH A;  4XKC A;  2ZME B;  5DV5 A;  3CP2 A;  2Y31 A;  2YUS A;  5J4Y A;  4CYC A;  4C3I J;  4ZZL A;  2R5Z B;  4F52 A;  5ILV A;  2O61 A;  2K27 A;  1R1T A;  3O3K A;  1BC7 C;  2KHM A;  5D8L B;  1RKW A;  2F48 A;  4XR6 A;  5DUK A;  5F1R A;  4WXD A;  1E3P A;  3TW7 A;  4BJ5 C;  3MWM A;  4RBO A;  4IL6 C;  3JRB A;  1J0R A;  4KT5 C;  2EPF A;  3GYH X;  2GOX B;  4QSH A; 
#chains in the Genus database with same CATH homology
 1TW2 A;  2XAG A;  3FWE A;  4LLN A;  4HDU A;  2HDC A;  1WKM A;  3V8K A;  3NEU A;  4LGW A;  5KVR A;  1G4D A;  5J8F A;  1J59 A;  1IF1 A;  2F2E A;  5DD8 A;  4UXN A;  5DEQ A;  5L3B A;  2IPQ X;  2A3S A;  5E1Z B;  3Q9S A;  2FBH A;  1J75 A;  2MD5 A;  3WE2 A;  1J5Y A;  5F6F A;  1JXS A;  1I27 A;  2IJL A;  4G94 A;  2KKO A;  1WI9 A;  4NB5 A;  2DW4 A;  1T2K A;  2J5P A;  4ZYG A;  1W5S A;  2VBY A;  2OQR A;  3TO6 A;  2BE5 F;  4UVC A;  4LMY A;  3GVA A;  4M9Z A;  1IN8 A;  1MGT A;  2J5O A;  5JVT A;  1FT9 A;  2P7V B;  3DV8 A;  3ZMS A;  1ZG1 A;  3FM5 A;  1ZAR A;  2FNP A;  2QWW A;  4L9T A;  4ZZD A;  3ISP A;  5E18 F;  4U7B A;  3ABU A;  4HYE A;  1E17 A;  1RI7 A;  2NS0 A;  4HQE A;  5D6E A;  3Q5F A;  1ZAO A;  4M6Y A;  3BOQ A;  3PQJ A;  2F5D A;  2XRN A;  3JTH A;  1U6G A;  1D5V A;  3HUG A;  1UB9 A;  4RGR A;  4KMF A;  4RB3 C;  4G7O F;  2EJR A;  4ON0 A;  5JR3 A;  5IT9 Z;  2XAH A;  2NYX A;  3F3X A;  3GFM A;  4OMZ A;  1V3F A;  4G9Y A;  4CDG A;  5E17 F;  1BM9 A;  1F5T A;  3DF8 A;  2V9V A;  3REO A;  2D45 A;  2V1X A;  4Q5S F;  2RNJ A;  4KIB A;  2FML A;  4KNY A;  2EA2 A;  4EJO A;  3C7J A;  3ZMD A;  1OKR A;  1ZH5 A;  3J7A O;  3IC7 A;  1P2F A;  1IXR C;  1R58 A;  2WWY A;  3ZN1 A;  5L3D A;  2PN6 A;  4WXC A;  3JAM K;  3WU1 B;  2COM A;  3MQ0 A;  3JW4 A;  3OOP A;  4ENN A;  2VE8 A;  4GYI A;  5HLI A;  5FB2 A;  3K1N A;  2NRA C;  4IXA A;  1RUO A;  1XDS A;  2DQR A;  1OYI A;  5CLS A;  1RZ4 A;  4H0E A;  4R79 A;  3ERE D;  3KLO A;  1BI3 A;  1KU2 A;  4IHT A;  1P4X A;  5LLQ A;  2GQQ A;  2P6S A;  3RYP A;  1BJA A;  4EJV A;  4CHU A;  2CSO A;  2IA2 A;  2YX7 A;  4CZZ A;  3H3Z A;  1L0O C;  2V6C A;  3GFI A;  3P9I A;  3ZMV A;  1S7A A;  2Z9O A;  4BAY A;  3RPQ A;  1IAW A;  1MZB A;  5LHH A;  4QLC U;  2JSC A;  4RB0 A;  4Y17 A;  4L9N A;  5CJ9 A;  2MLG A;  3WTZ A;  1B6A A;  3HRM A;  4AVP A;  2RKH A;  3KET A;  3L2C A;  5DYM A;  1SFE A;  3G73 A;  1YTY A;  5FLX Z;  1G3S A;  3J81 Z;  4U0Y A;  2O03 A;  3BWG A;  1G3Y A;  3HSR A;  2H09 A;  2VN2 A;  2OD5 A;  5H6Q A;  5HOO A;  3R4K A;  1IXS B;  2ZXJ A;  1FLI A;  1B9M A;  2Q8K A;  4OIP F;  1ZGA A;  1MJB A;  3EUH A;  1S6L A;  4YFX F;  5E20 A;  5D5X B;  3RJP A;  4ZH4 F;  3KZZ A;  1J7K A;  4GCV A;  1BIB A;  1Z6T A;  3HSF A;  2EFN A;  2PEX A;  4ZYE A;  1FC3 A;  3E97 A;  4P5O A;  4A6D A;  2UXX A;  3LST A;  4L5I A;  1MDM B;  3RPU A;  2KIF A;  2QBY A;  1EV7 A;  2HGC A;  2VXZ A;  2EV0 A;  4D0P A;  2CWE A;  4IRG A;  4KUM A;  5H20 A;  2PJP A;  4WF2 A;  1OMI A;  1W5T A;  1H0M A;  3K69 A;  1R22 A;  5FFZ A;  3L7W A;  2HYG D;  4G6D A;  1IRF A;  1ZRD A;  2HZT A;  5HDG A;  3NQO A;  3WTS C;  4BHC A;  3K9T A;  3LQR A;  1LDK B;  2YX4 A;  2HR3 A;  1HKQ A;  2DPU A;  1W7P D;  3FZV A;  4CO8 A;  3I53 A;  2IRF G;  4UUV A;  2QVO A;  4YIF A;  2A6H F;  1RUN A;  1LJ9 A;  4P55 A;  1FZP B;  3TOB A;  2OA4 A;  3LA7 A;  3R61 A;  3OV8 A;  4CGZ A;  2QLZ A;  3WTU C;  1R5G A;  4Q48 A;  3GFL A;  2HTJ A;  4A5N A;  3E6M A;  3RTR A;  2O6G E;  2KJB A;  4ETS A;  2M30 A;  5L3G A;  1O3R A;  4RB1 A;  2XAQ A;  4I7H A;  5CVJ A;  3VB2 A;  4L5J A;  4LFU A;  4O3M A;  5LGT A;  2HOE A;  1SFX A;  1A04 A;  2QBY B;  2BEO A;  1O3S A;  2P5K A;  4HX8 A;  3BP8 A;  2JPB A;  1FBS A;  2ZME A;  2CFX A;  3JSP A;  4K2E A;  3TO9 A;  4Z2Y A;  4GO1 A;  4ESB A;  3ZMZ A;  4L9V A;  1PP8 F;  1P4W A;  1Q1H A;  2EA4 A;  3K0L A;  1TBX A;  1KYZ A;  2MA3 A;  4A6E A;  2QQA A;  4L18 B;  3W6K B;  1BI0 A;  3LA3 A;  2OAZ A;  3HHH A;  5TRD A;  4DNC A;  4M9S A;  1Z6R A;  2Z3Y A;  2C6Y A;  4B8X A;  3KEO A;  3F8F A;  3JTG A;  1OPC A;  2QZ8 A;  4JBA A;  3HTS B;  4A0Y A;  2FE3 A;  3QU6 A;  3CJN A;  3LA2 A;  1HKT A;  3FXQ A;  4GGG A;  4EM1 A;  3GUD A;  5BPD A;  1FYK A;  4YFN F;  3SXY A;  4YII A;  2M8E A;  1U8R A;  4KIG A;  4A2U A;  1RIO H;  5AIP A;  1TTY A;  3HIF A;  2XUB A;  5HS7 A;  1KQ8 A;  4RAZ A;  1LB2 A;  3K1M A;  4LK0 F;  3VOD A;  1NHA A;  4HX7 A;  3KP2 A;  1H9G A;  2GWR A;  2BV6 A;  3E6C C;  1Z05 A;  2PLY A;  2HQN A;  3FMR A;  2BBY A;  2IP2 A;  5L3E A;  4Q47 A;  1AWC A;  4ESF A;  1GHC A;  2FBK A;  1B1B A;  1YIO A;  2HS5 A;  2P4W A;  1B4A A;  4UV8 A;  4MQV A;  3V4G A;  2VOO A;  4KN7 X;  3K1P A;  4G8X A;  3MAJ A;  3FXU A;  4WXH A;  3GZ6 A;  4MNU A;  5JHU A;  1E2X A;  3ML6 A;  1QBJ A;  2D1H A;  2RVC A;  5BOX A;  4MQ9 F;  5HLG A;  5CVV A;  4BNC A;  1PDN C;  1BBY A;  2ETH A;  3WTT C;  4HW0 A;  3V7S A;  2ISZ A;  2V79 A;  2A61 A;  1ZLK A;  2EV5 A;  1XSX A;  5E8I A;  4MGR A;  5J8C A;  4RS8 A;  2PMH A;  2Y75 A;  5AON A;  2PQ8 A;  5CYV A;  2M5W A;  4OMY A;  2YU3 A;  2CYY A;  4Y13 A;  4M9X A;  3C3W A;  4MTE A;  4P96 A;  1PUE E;  4OIN F;  1YS6 A;  2ZFW A;  2EWN A;  3T8R A;  1SAX A;  2CGP A;  4WWC A;  1W7P B;  5FO5 A;  1JGS A;  4MTD A;  1OYY A;  1TW3 A;  3B73 A;  2R3S A;  2K02 A;  1R7J A;  2CW0 F;  3DQV C;  1R23 A;  3W6J B;  3ZQ7 A;  3GLX A;  3E6D A;  1ON1 A;  4M73 A;  2EK5 A;  3H3U A;  4F7Z A;  2M45 A;  3TDZ C;  2XAF A;  4FT8 A;  4BHP A;  1X3U A;  2WC2 A;  3I0T A;  5A2Q Z;  1T98 A;  1XCB A;  4G7Z F;  3FXR A;  1OYW A;  4RGX A;  4LB5 A;  2JRT A;  3HHG A;  2BGC A;  2XKP A;  4CXF A;  3I71 A;  3BY6 A;  3F72 A;  1SD6 A;  2V1D A;  1WSU A;  4HOB A;  1O57 A;  1HST A;  1KQ9 A;  4S04 A;  4ESJ A;  3MCZ A;  1BIA A;  2VE9 A;  2FBI A;  3ZPL A;  4IRI A;  2JTV A;  2H6B A;  3EQL F;  3ZMT A;  3WTY C;  3KZY A;  1DP7 P;  3P7N A;  5CVU A;  1QZZ A;  3CUO A;  1O7L A;  1ZGJ A;  1TQI A;  4I0B A;  2OQG A;  2VOP A;  2G9W A;  3ECH A;  4EJW A;  2Q2E A;  1I1S A;  1P4A A;  3TGN A;  4N9I A;  4XSZ F;  3T0Y A;  3CUQ B;  4AIH A;  5BPI A;  2HKX A;  1C0W A;  4ZYD A;  2MBF A;  3E3V A;  3TDU C;  1YQA A;  2IA0 A;  1FX7 A;  1UFM A;  3ZMU A;  2DPD A;  3SZT A;  1WRJ A;  4EVI A;  4HV6 A;  3T1B A;  2VC0 A;  1YG2 A;  2E1N A;  3CO7 C;  3R0A A;  4OU0 A;  3NRV A;  1KGS A;  5HVQ C;  2KJC A;  3HRT A;  3T8T A;  4I09 A;  2VOD A;  3JSO A;  2QUF A;  3SFZ A;  2PMU A;  1RNL A;  2K4B A;  1IUY A;  2F5F A;  1U5T C;  2HTS A;  2ZBK A;  2IA1 A;  1SD5 A;  1U78 A;  2Z99 A;  4LG0 B;  4Q4Z F;  4HAM A;  1FP2 A;  5D6F A;  4QWQ A;  3IKV A;  3TKY A;  3WE3 A;  2NNY A;  5K1Y A;  3V8J A;  2ZKZ A;  3GF2 A;  4I02 A;  5D5W B;  3Q9V A;  5DCM B;  2FMY A;  3IWF A;  5LRR A;  1J9I A;  2STW A;  2GA2 A;  4B09 A;  3ELK A;  4A5M A;  4MEX F;  2A6E F;  4R1H A;  2FRH A;  5FD6 A;  3HOS A;  3F6O A;  3M8E A;  3KP4 A;  1HSJ A;  2UXN A;  2CG4 A;  4I2O A;  5ICC A;  1MD0 A;  2DFI A;  4WX9 A;  3SHF A;  5A2Q K;  5FLX K;  3IRR A;  4PCQ A;  2VT3 A;  2EFQ A;  4PDK A;  5FD5 A;  2L4M A;  2FEZ A;  2FXA A;  4YFK F;  1HBX G;  2P5V A;  2JT1 A;  2LNB A;  3WU0 A;  4HF0 A;  1XGN A;  2O0Y A;  3I64 A;  4PGH A;  5E1W A;  1D3Y A;  3QP5 A;  3RI4 A;  1BOA A;  1I6X A;  1UHW A;  2FA5 A;  4A0X A;  2EFW A;  4G7H F;  2OU2 A;  3F8N A;  1IRG A;  3ECO A;  3V7C A;  4FX4 A;  1F4K A;  5HDK A;  3V7R A;  3RDI A;  1V4R A;  3GX4 X;  4N9H A;  1CGP A;  5CVR A;  1K78 B;  2B0L A;  3HRS A;  1T38 A;  1ZN2 A;  3VEP A;  3GW2 A;  1FOK A;  1FP1 D;  2HEO A;  4E70 A;  1UST A;  3L00 A;  4R8H A;  2E1C A;  2VBZ A;  1S3J A;  2LDU A;  1U5T A;  4GYG A;  1FBQ A;  3J80 Z;  3JAM Z;  2G7H A;  2H27 A;  4UNO A;  3WTX C;  4KYW A;  5JFR A;  1XN7 A;  1EH6 A;  2STT A;  2PBI A;  4U0V A;  5BQT A;  4AIJ A;  1R36 A;  2L02 A;  3FF5 A;  3F23 A;  5LGU A;  3QOP A;  3COA C;  2D1V A;  2LKP A;  2D2W A;  2V1U A;  5D8K B;  4HLY A;  4RAY A;  3SZP A;  4KIF A;  1DPU A;  3MFK A;  3EYI A;  2A68 F;  4IF4 A;  2A07 F;  1YW9 A;  3L09 A;  3TQN A;  4CYD A;  3WTW C;  1Y0U A;  2A69 F;  3F6V A;  5LGN A;  2EFP A;  3PQK A;  3R60 A;  2K4J A;  3IWZ A;  5DCF A;  5K5O A;  1KQ0 A;  1SD4 A;  1ZG5 A;  5J6X A;  1K79 A;  1O3T A;  5HDN A;  3I58 A;  2AXL A;  3ULQ B;  3BZ6 A;  2H94 A;  5L3C A;  4BXU A;  1LVA A;  3LFK A;  3GFJ A;  1CF7 A;  5K5Q A;  4IRH A;  3D0S A;  2W84 A;  3G3Z A;  3C18 A;  2LSO A;  2Z33 A;  4PZJ A;  3DEU A;  2GA1 A;  3E5Q A;  1ZLJ A;  4ASN A;  2RV8 A;  1MJ9 A;  2HKO A;  2M87 A;  1B59 A;  2O3F A;  1MKM A;  3V8L A;  1IXC A;  2FF4 A;  3WGI A;  1MJA A;  1XCV A;  1BI1 A;  1XD7 A;  2Z5U A;  2DO7 A;  3AAF A;  2A5Y B;  2DK8 A;  4EGZ A;  3N4M A;  1K7A A;  3E6B A;  1ZRE A;  2OZ6 A;  1TNS A;  1B9N A;  1TNT A;  4HBL A;  5L3F A;  1IZ1 A;  4NHJ A;  2XHK A;  1QGP A;  4BHB A;  1HQC A;  2ZJ2 A;  2X0L A;  3FMQ A;  3LQQ A;  5D5U B;  2FSW A;  2ZO4 A;  4UV9 A;  2KIM A;  5DCM A;  4OIR F;  3CUQ A;  4BH9 A;  3KP6 A;  4EMS A;  1YW7 A;  3QPT A;  4LG0 A;  1ONV A;  4M71 A;  1P92 A;  2AS5 F;  2DLL A;  1F9N A;  3CLO A;  2IVM A;  3WGG A;  5LRS A;  2XKO A;  3I59 A;  1TQP A;  1XGM A;  4UHT A;  4HLX A;  5IT9 K;  3IKT A;  2DK5 A;  2IT0 A;  3BJA A;  1JHH A;  1S8N A;  4Y15 A;  5HS9 A;  4EM2 A;  1QPM A;  5D4S A;  1WWX A;  4M74 A;  3KP5 A;  4BQA A;  2XV4 S;  2WTE A;  1O7F A;  2ELH A;  2DU9 A;  3I54 A;  1LEB A;  2CQK A;  4IHS A;  1CF7 B;  2HYF A;  2P8T A;  3F8M A;  2DAO A;  1KYW A;  3FHZ A;  4IVN A;  1H9T A;  2MH2 A;  3GEZ A;  2E7X A;  2F5C A;  2UZK A;  3P9C A;  1KU7 A;  2E7W A;  2M1B A;  2GXB A;  3WGH A;  5EEG A;  3KFW X;  2HWV A;  3WG9 A;  4KMU X;  1JHF A;  2DT5 A;  2OBP A;  2MC3 A;  4HA8 A;  2YR2 A;  1FYM A;  4KA4 A;  1HKS A;  1Z9C A;  4BYY A;  1I5Z A;  3U9G A;  3FX3 A;  4HV5 A;  3U1D A;  1UHM A;  4NQW A;  5E1X A;  1GVJ A;  2ESH A;  2GAU A;  3T5X A;  4O6J A;  4XLN F;  4HZF A;  3LAJ A;  1YYV A;  1DDN A;  4LJZ F;  5LHI A;  1AOY A;  1G6N A;  3TOA A;  2ESN A;  4EQQ A;  4LD5 A;  1DUX C;  3ZP5 A;  3ROU A;  1LDJ A;  3HSE A;  4FHT A;  3QAH A;  4I98 B;  3HTU A;  1U5T B;  2LF8 A;  4ENM A;  3DPT A;  3DP7 A;  2XIG A;  2GZW A;  4L0Y B;  4WK8 F;  1L3L A;  1IN5 A;  2VC1 A;  5DD4 A;  3KP7 A;  2W24 A;  1R1U A;  1BN5 A;  4XRF A;  4LLL A;  2QQB A;  2W85 A;  2OZU A;  3J81 K;  2O8X A;  5H6R A;  3B02 A;  1LDD A;  1T39 A;  4MEY F;  2VBW A;  5EEH A;  5FGM A;  4UVB A;  1MDM A;  4OOI A;  3IL2 A;  2FOK A;  4P9U A;  2RGV A;  2YSR A;  1LQ1 A;  1OR7 A;  5ILS A;  3GXO A;  1SMY F;  4XSX F;  3WOD F;  4GXO A;  5D4R A;  4I0A A;  1EH8 A;  3GO5 A;  1BI2 A;  1ZRC A;  2TDX A;  1QQI A;  3HOT A;  2VT2 A;  3FMS A;  2EV6 A;  4I01 A;  4KIC A;  2KRF A;  2L4A A;  3M9A A;  2P5L C;  1Z1D A;  3RIR A;  5JI6 A;  2MH9 A;  3EYY A;  3U2R A;  2LF7 A;  1IN4 A;  3D5L A;  3M1E A;  3QRF F;  1QNT A;  5ED4 A;  3F8B A;  2RC4 A;  2FNA A;  4JQF A;  1HW5 A;  2DI3 A;  2Q0O A;  3MZY A;  1XGO A;  1FNN A;  3TO7 A;  3LWF A;  3ZN0 A;  1U3E M;  1FWZ A;  2L3D A;  1FY7 A;  4JK1 X;  1GXQ A;  3P9K A;  2EB7 A;  1BC8 C;  1LEA A;  4N0B A;  4S05 A;  4OIO F;  2ISY A;  2IW5 A;  2ZCW A;  4KDP A;  3E5X A;  3MZH A;  2W57 A;  2Y0M A;  5CVI A;  2XVC A;  1EH7 A;  2GXG A;  2H6C A;  3QP6 A;  3RYR A;  5LEK A;  6PAX A;  4UVA A;  4EJT A;  1XSD A;  4ENK A;  5E8G A;  4RGS A;  5KK1 A;  4HF1 A;  1R1V A;  3CO6 C;  5K5R A;  4EGY A;  1S7O A;  1G3W A;  2RN7 A;  2KIU A;  1YO5 C;  3DKW A;  4RGU A;  5IT3 A;  1UCR A;  2QM3 A;  2XRO A;  4LB6 B;  2QYO A;  2NAZ A;  3C1D A;  4TV7 A;  4P9F A;  2FU4 A;  2YPR A;  1FBU A;  4LK1 F;  2L54 A;  4IPA A;  2X4H A;  1WQ2 A;  4KFC A;  3DPL C;  1USS A;  3R0J A;  3BRO A;  1IW7 F;  3MEX A;  4U0W A;  1VTN C;  4A0Z A;  3IRQ A;  3RKY A;  3GZ5 A;  1JE8 A;  2ADU A;  4L0Z B;  1D8K A;  4WCG A;  3KP3 A;  3PFI A;  5ICE A;  1ZG3 A;  2ZNY A;  4IJA A;  3VFZ A;  2UWM A;  2W25 A;  4U7D A;  4A12 A;  1P6R A;  3FM3 A;  1R5H A;  2ACJ A;  3RKX A;  4EV0 A;  1QO0 D;  1O3Q A;  1HW2 A;  1FSH A;  2DBB A;  3WTV C;  3EET A;  3SQN A;  3HYI A;  5D5V B;  3N97 A;  4HDV A;  1HXD A;  1QZY A;  4L9J A;  1XGS A;  2VON A;  3I4P A;  3I59 B;  2RQP A;  3BJ6 A;  1ULY A;  1REP C;  5ICG A;  1GXP A;  2ZNZ A;  2QEN A;  4PGG A;  1ZHF A;  5LBQ A;  2FQ3 A;  5AIQ A;  3F22 A;  2QQ9 A;  4XBF A;  2GIV A;  2JZY A;  1LNW A;  2NNN A;  3KE2 A;  4CIC A;  2CO5 A;  3L9F A;  1SMT A;  3DXJ F;  1J2X A;  2HFH A;  3IHU A;  4DQ2 A;  1G3T A;  1YLF A;  2DTR A;  3H92 A;  3QPH A;  5ERI A;  2PI0 A;  1SD7 A;  1ZYR F;  3S2W A;  1TQM A;  1XMA A;  3CUQ C;  1YS7 A;  1XSV A;  3HRU A;  4MHG A;  1KU9 A;  1W4M A;  1YFH A;  3K2Z A;  5F64 A;  1D8J A;  4LLG F;  1SFU A;  1FSE A;  3VOE A;  1IN7 A;  2JPC A;  4EM0 B;  1F1Z A;  2R7F A;  2RDP A;  3EDP A;  5ILU A;  4O5V A;  1W7P A;  3E5U A;  4AD9 A;  4M72 A;  3BPV A;  1XMK A;  3BPX A;  1DPR A;  3QU3 A;  2L01 A;  2XAS A;  4RB2 C;  3DFG A;  3M8F A;  1T6S A;  2P6T A;  4HX4 A;  5BMZ A;  3RKW A;  1ODD A;  2BYV E;  2PG4 A;  5HS8 A;  5DDG A;  1K6O A;  3F8C A;  2MLK A;  3F21 A;  1T0F A;  2F5E A;  4EJU A;  5TJJ A;  1STZ A;  4KN4 X;  2VBX A;  4M6X A;  4AIK A;  3CTA A;  1FPQ A;  2WV0 A;  4AWX B;  1TLH B;  2P7C B;  2DQL A;  4HQM A;  3O6B B;  1ZRF A;  5HLH A;  3KCC A;  1IN6 A;  5LHG A;  3ABT A;  1Z91 A;  3J80 K;  4U88 A;  5BS6 A;  3GWZ A;  2G7U A;  2R7D A;  3M7G A;  1FYL A;  3LAP A;  3O2P E;  4OIQ F;  2PFB A;  1KU3 A;  1ON2 A;  3KEQ A;  2K7L A;  1R00 A;  1XB4 A;  4G6Q A;  3I5U A;  4ENJ A;  3KLN A;  4HF2 A;  1PP7 U;  1K78 A;  2XGX A;  5LEJ A;  1XDU A;  1Z7U A;  1KA8 A;  2HQR A;  4YG2 F;  1YW8 A;  4FX0 A;  1S29 A;  5ICF A;  2XAJ A;  2Y48 A;  1U2W A;  2EFO A;  3BDD A;  3R6S A;  4XLP F;  5DUI A;  1I1G A;  5FFX A;  1HW1 A;  3CDH A;  3BJO A;  2K86 A;  4ZYH A;  2ZME B;  5DV5 A;  4ZZL A;  5ILV A;  2O61 A;  2K27 A;  1R1T A;  3O3K A;  1BC7 C;  5D8L B;  5DUK A;  5F1R A;  4WXD A;  3MWM A;  1J0R A;  4KT5 C;  3GYH X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...