1UCRA

Three-dimensional crystal structure of dissimilatory sulfite reductase d (dsrd)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
74
structure length
74
Chain Sequence
MEEAKQKVVDFLNSKSGSKSKFYFNDFTDLFPDMKQREVKKILTALVNDEVLEYWSSGSTTMYGLKGAGKQAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein dsvD
publication title Crystal Structure of Dissimilatory Sulfite Reductase D (DsrD) Protein-Possible Interaction with B- and Z-DNA by Its Winged-Helix Motif
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Unknown function
total genus 23
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08679 DsrD Dissimilatory sulfite reductase D (DsrD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ucrA00
2MD5A 1KGSA 2V1DA 5TJJA 4YIFA 4ENNA 2YSRA 2DTRA 4M6YA 2ELHA 2HOEA 4LLLA 1J0RA 4HQMA 2DFIA 2HZTA 2VT2A 2FBIA 1PDNC 2K4BA 2COMA 1JHHA 3ABUA 3D0SA 2HEOA 2EFNA 4YIIA 2YU3A 3DXJF 2CQKA 2Q2EA 4L18B 4O6JA 2ZFWA 4IRGA 2PFBA 1GXQA 3M9AA 3R0JA 2Z33A 1MJ9A 3SZTA 3TDZC 5CVIA 2A6HF 2HFHA 5HS7A 3DKWA 2D1VA 2GXGA 4Y17A 3WTVC 1HSJA 4LK1F 3ML6A 3ZMVA 3M8FA 4L5IA 3LAJA 1UFMA 3CLOA 2QQ9A 5ICGA 2P5KA 1JGSA 2XVCA 4WWCA 1HKQA 1AWCA 4IJAA 3DPLC 3J81Z 4OU0A 5L3GA 5DCMA 5JR3A 1FNNA 5LLQA 3COAC 2YR2A 1BI0A 2ZCWA 1XMKA 2JPBA 4XLPF 4XLNF 4M6XA 5DCFA 4WF2A 1FWZA 2IA2A 1UB9A 3EYYA 2STTA 3KE2A 2LDUA 1LNWA 4IF4A 3E5QA 3H92A 4G8XA 2W25A 1K79A 2BGCA 2EFPA 2IJLA 4NB5A 5FB2A 1LB2A 1XCBA 4Q48A 2A07F 1EH7A 2L54A 5AIQA 3HTUA 4BYYA 3JTGA 1OYIA 3V7CA 2AS5F 3GYHX 3V7RA 5EEGA 2V1XA 3DV8A 1U5TB 2GA1A 3SFZA 4UV8A 1SFUA 2MH9A 3GLXA 4PGGA 2KIUA 5JVTA 2DK5A 1IRFA 5LHHA 3GO5A 1IF1A 2V79A 5A2QZ 4EGZA 2RVCA 3ECOA 4L5JA 4JQFA 3U9GA 2HYGD 2IA1A 1XDUA 4AD9A 1ZHFA 1EH8A 3ZMSA 3N4MA 3F8NA 2QBYB 3I64A 3E6CC 3K69A 3JAMZ 2WV0A 4ZZDA 3JSOA 1YTYA 2PMUA 3ZN1A 1MJBA 4KDPA 1WQ2A 1BI1A 4WXHA 2M45A 2Y75A 2EFWA 3PQKA 1BI2A 1ZH5A 2QYOA 1QO0D 2NAZA 2PEXA 1YFHA 3WTXC 3OOPA 4R8HA 3NRVA 1BJAA 3U2RA 2W24A 5LEJA 1EV7A 3ZN0A 2K7LA 2EFOA 5DUIA 2IA0A 4RGSA 3FMSA 4UVAA 2Z5UA 1SAXA 2GA2A 1OKRA 5FGMA 4WXDA 4AWXB 2LSOA 3BJOA 2HKOA 2L3DA 3CO7C 2XAQA 2NYXA 2FNPA 4KICA 3V8LA 4I0BA 1Y0UA 2FNAA 2VBXA 4PZJA 2BEOA 4DNCA 1I1GA 4GXOA 3KZYA 3O6BB 1R58A 1KU3A 3WGHA 2QQBA 4CYDA 1U5TA 2XAJA 3HSFA 4IHSA 4KN4X 1ZYRF 1W4MA 3GVAA 4N0BA 1FYMA 3M7GA 2GQQA 2R3SA 2K27A 1MDMB 4ETSA 3CJNA 1RIOH 1IUYA 4P55A 4OINF 5E1WA 2DPDA 2DAOA 4BQAA 1P4XA 3QP5A 2XGXA 2Y48A 1XGOA 4G7HF 3LA2A 1S7AA 2QBYA 4LG0B 1UHMA 4GCVA 1WRJA 1NHAA 5D5WB 4EJVA 3J81K 2H6BA 2ZNZA 4YG2F 1XD7A 4MEXF 2Z99A 2OZ6A 1ZG1A 4ZYGA 5FFXA 4B8XA 2F2EA 2RGVA 2L02A 3HYIA 1LQ1A 1JHFA 3KP5A 3F8FA 3FMQA 5ERIA 2EFQA 5D6FA 1Z91A 3QPHA 1FPQA 3KEQA 1FOKA 3E97A 2E7WA 4MHGA 3WTTC 1ULYA 1R23A 3IL2A 4RAYA 5JFRA 2EWNA 1QPMA 5ILVA 3KP3A 1DP7P 3BPVA 3CUQC 4EJTA 2ISYA 4WX9A 1I1SA 2IW5A 2RV8A 3ZMDA 2VBZA 1FZPB 5K5RA 4HF0A 3QU3A 3T1BA 2EV6A 5J6XA 4G94A 1ZN2A 5DD4A 3WGGA 4A2UA 5D5UB 2UXNA 2XUBA 2OU2A 2YX7A 3E5XA 1PUEE 3FWEA 5A2QK 1ZGJA 2V9VA 1RNLA 1ZRCA 1IN7A 3K9TA 1XGNA 1MDMA 1JXSA 1BN5A 2EA2A 3Q9SA 3HRSA 1FP2A 1K6OA 2H09A 1P4WA 4RAZA 2CSOA 1FYLA 2ESHA 3E6DA 4U7BA 3GF2A 5HS9A 1AOYA 4EJWA 1IN5A 2VONA 1G4DA 2MBFA 5CYVA 5E20A 4MEYF 1ONVA 2M30A 5F64A 4KIFA 4N9HA 4RS8A 4HLXA 4YFXF 4RGXA 5L3EA 2DI3A 2JTVA 2VOOA 4Y13A 2UZKA 4BAYA 1U78A 1YG2A 3B73A 2NNNA 4M9SA 2VBYA 1J5YA 3RJPA 2L01A 3HRMA 3ECHA 4KA4A 4UUVA 3B02A 3GXOA 4BHCA 1BIAA 1OYYA 1T6SA 1R22A 3HSEA 4KUMA 4EJUA 1G6NA 4E70A 3MCZA 1SD5A 1K7AA 1YQAA 1OMIA 4R1HA 4UV9A 1P92A 5E17F 2DW4A 5DV5A 1I27A 1HQCA 2VODA 2H94A 4PGHA 3FM5A 4XRFA 4H0EA 1YYVA 2CYYA 3CTAA 4CZZA 1G3TA 4A0ZA 2EB7A 2CWEA 1F9NA 2JRTA 2W84A 5BQTA 3IKVA 1DUXC 2HDCA 1BOAA 5LHIA 4P96A 2PBIA 1HBXG 5BS6A 3MAJA 1SMTA 1STZA 2XASA 5E1ZB 3I54A 1K78B 4NQWA 4HAMA 5HOOA 2FU4A 4IHTA 3MEXA 1REPC 3FX3A 3TDUC 4HDUA 3QOPA 3J80Z 1TNSA 3EYIA 1ZGAA 3WE3A 4G7OF 3MZYA 5D8LB 1XDSA 4QLCU 3BJAA 2XROA 3QP6A 2BBYA 2RDPA 4U7DA 3JSPA 3DPTA 4CICA 3HOTA 3WE2A 2BYVE 2R7FA 4HDVA 4MTDA 4KIBA 2OZUA 3KFWX 4WK8F 2HKXA 4RB3C 4IVNA 1W5SA 4PCQA 1U8RA 1I6XA 4G7ZF 1TTYA 3BOQA 4RB2C 1J9IA 3ROUA 1IN8A 4XSXF 2FE3A 4BXUA 3RYPA 4P9UA 4L0ZB 5E18F 1B9NA 3SXYA 4S04A 2OA4A 4U0VA 1LEAA 2FBKA 3WU0A 1Z7UA 3J7AO 3DEUA 1V3FA 2WC2A 2VE9A 3WTZA 1Z1DA 5H20A 1H0MA 2BV6A 2HGCA 2O0YA 3FXQA 2EK5A 3ZMTA 3GX4X 3ZPLA 5LGUA 2K4JA 1ZLKA 3L09A 4BHBA 1QZZA 2V1UA 3IWFA 2FSWA 3L00A 2G9WA 3WU1B 1R5GA 3ULQB 3LWFA 1IXSB 3I0TA 4EQQA 3SZPA 4KIGA 2A69F 4ENMA 3IRRA 1K78A 1DPUA 5JHUA 1E2XA 3ABTA 1L0OC 2VT3A 1R1VA 4A0YA 2MA3A 5HDNA 2P7CB 5IT3A 4OMZA 3FM3A 3GUDA 4IXAA 1YS7A 2KJBA 1B9MA 1HW1A 4EV0A 1BI3A 5KVRA 4DQ2A 1CF7B 1OYWA 3JTHA 2DQRA 2VC1A 5E8IA 3IRQA 3SQNA 2HTSA 1QBJA 3TOAA 1U2WA 1R00A 4HZFA 2QZ8A 3NEUA 1QGPA 3IWZA 1P2FA 3TO9A 4FX0A 3T5XA 1KQ9A 3ZQ7A 4F7ZA 1B4AA 1WI9A 3KP2A 1R1UA 3C18A 3C1DA 2O03A 2CW0F 5KK1A 1ZLJA 3V8JA 5K1YA 1U3EM 4MNUA 4LB5A 2UXXA 2HTJA 2E1CA 3VEPA 2DO7A 5E8GA 4K2EA 4TV7A 5H6RA 3LSTA 4ESFA 4G9YA 4GGGA 1MGTA 1HW2A 1IN6A 2ZNYA 5BPDA 3W6JB 5CVUA 4I01A 4KN7X 2XHKA 2UWMA 5L3BA 4CDGA 3IKTA 3LQRA 4ESJA 3I58A 3J80K 3F6VA 4R79A 5FFZA 2AXLA 1LDJA 3KEOA 4HX8A 4KYWA 5F6FA 3BY6A 3V8KA 2DLLA 1SFXA 4L9JA 2ZXJA 3WTUC 4UXNA 5BPIA 5BMZA 1RUOA 2J5OA 3H3UA 1IN4A 3C3WA 1S6LA 4LMYA 1CF7A 1F1ZA 2KIMA 3WTYC 2IPQX 1USSA 2KKOA 2FXAA 3O3KA 3WODF 4IRHA 1XB4A 5HLGA 1UHWA 2QUFA 3FZVA 2P8TA 2DK8A 4OOIA 3N97A 1J7KA 3GEZA 4BH9A 1FLIA 1WKMA 4CXFA 2G7UA 1XCVA 1S7OA 2XAHA 5ED4A 2ISZA 2VC0A 1O7FA 1EH6A 4EGYA 1TQPA 4A0XA 5HDGA 1J59A 2VXZA 5DYMA 3RKWA 2DQLA 5CVRA 3KETA 2PJPA 4EM2A 4ENJA 4XSZF 1RUNA 4Q5SF 1TQIA 3GWZA 2EV5A 2FQ3A 4P9FA 2RNJA 4BHPA 1U5TC 3IC7A 2FOKA 4LB6B 1ODDA 2M5WA 5EEHA 2PQ8A 1S8NA 3F6OA 3GFIA 2V6CA 4S05A 2OD5A 1QQIA 4MTEA 2GZWA 4HX4A 1R1TA 1XSVA 1IRGA 3F72A 2HQNA 2K02A 1XMAA 1GVJA 3QAHA 3K1MA 2CG4A 4LD5A 5F1RA 6PAXA 2XKPA 4KNYA 2YPRA 3BJ6A 1SD4A 1HXDA 3R60A 1L3LA 2VOPA 1O3TA 4FT8A 2JZYA 2JSCA 3EETA 5K5OA 3S2WA 2JPCA 4I02A 1ZRFA 3O2PE 4LFUA 4ZZLA 3KZZA 2W85A 4Z2YA 3BP8A 3W6KB 1YIOA 5H6QA 4GO1A 2E7XA 5DDGA 3C7JA 4HV6A 4Q47A 2X0LA 3E5UA 4BNCA 1ZAOA 1ZG5A 4HQEA 3F8BA 4AIHA 2O8XA 4PDKA 5FLXK 1KQ8A 2Z3YA 2NS0A 3MQ0A 1FY7A 5HDKA 4NHJA 2L4AA 1Z9CA 3WTSC 3P9KA 1R36A 1QZYA 3NQOA 1LJ9A 1D5VA 3TOBA 2G7HA 2FA5A 1KA8A 4XBFA 3LFKA 2PLYA 2CO5A 4EM1A 1YO5C 3HHGA 3R6SA 1MKMA 1U6GA 2RC4A 1YLFA 2F5FA 1ZG3A 4D0PA 1GHCA 5ILUA 4ZYDA 3REOA 2IVMA 2O61A 1Z6RA 2HYFA 3ERED 5TRDA 1FP1D 3U1DA 2RN7A 2VBWA 2A3SA 1XGMA 2Q0OA 4QWQA 3K1PA 5D4SA 4WCGA 2EV0A 2D45A 1SMYF 2NRAC 2GXBA 2Q8KA 3KLNA 1H9GA 3L7WA 2ZJ2A 1O3QA 3MWMA 3SHFA 4AIJA 2A5YB 1B59A 2MLGA 3RDIA 5CVVA 4CHUA 3LA7A 2IRFG 1KYWA 2PMHA 3BDDA 1T2KA 2CGPA 2O3FA 5HVQC 2M87A 5AONA 1XSDA 2GWRA 4I0AA 3F8CA 1MJAA 2TDXA 5ICEA 1FX7A 4M9XA 3DQVC 3E6MA 5CJ9A 2HR3A 5L3DA 3VOEA 4LJZF 4N9IA 1H9TA 3JW4A 1J75A 3RKYA 1DPRA 5ICFA 4GYIA 2F5CA 1V4RA 4LLGF 1G3SA 3F23A 2XAGA 2P6SA 2OBPA 3I53A 1UCRA 4KMUX 3FXUA 3LAPA 4HOBA 4UHTA 4GYGA 2ZKZA 3GW2A 3F3XA 1TW2A 2IT0A 1USTA 5ILSA 2PN6A 1E17A 2O6GE 2B0LA 4HF1A 4A5NA 5L3CA 3ELKA 2ACJA 4MQVA 3E3VA 1FT9A 4UVBA 1Z6TA 4I2OA 3R0AA 5LGTA 3CO6C 1QNTA 1BM9A 4RGRA 4M9ZA 5K5QA 1A04A 1PP7U 3RKXA 5LHGA 3T8TA 4MQ9F 2X4HA 1YS6A 1KQ0A 2J5PA 2VE8A 4LLNA 2HWVA 3V7SA 3TO7A 2P5VA 3VFZA 2VN2A 5D5VB 1FSEA 3TO6A 4OIQF 3KP4A 3VODA 3ZMZA 2KJCA 2RKHA 2ETHA 2XIGA 3T0YA 2GAUA 3DF8A 4HA8A 2DPUA 1YW7A 3FHZA 2H6CA 3HRTA 4OIPF 3K1NA 1W7PB 2ESNA 3GZ5A 2P6TA 4Y15A 3F21A 3PQJA 5D8KB 2H27A 2DBBA 2BE5F 1WWXA 1ZRDA 2A61A 3IHUA 1O3SA 2Z9OA 2FRHA 4M71A 1OR7A 3R61A 3VB2A 1O3RA 1RZ4A 2FMLA 1T39A 3LQQA 4JK1X 1Z05A 3CUOA 3TGNA 1XN7A 4ZYHA 3OV8A 1HKTA 4M74A 4EMSA 3HRUA 3HOSA 4KT5C 3FF5A 4ON0A 3RTRA 3H3ZA 3I5UA 1OPCA 4ESBA 4OIOF 2E1NA 5AIPA 3L2CA 2P4WA 1ON2A 5LBQA 5FLXZ 4M72A 5CVJA 1T38A 2XAFA 3TQNA 4ZYEA 4FX4A 1FC3A 4IPAA 1FSHA 1F5TA 1KU2A 3RI4A 2OQGA 3CUQB 3FXRA 5FO5A 1G3WA 1HKSA 4B09A 3BROA 2QENA 1RI7A 5DUKA 5BOXA 1BC7C 4RGUA 4O3MA 1XGSA 3KLOA 2M8EA 1BC8C 2EJRA 5ICCA 1W5TA 4G6DA 1KU9A 3I71A 4LK0F 1YW9A 5J8CA 3P9CA 1B1BA 4U0WA 4P5OA 1S3JA 2WWYA 1D8JA 1W7PA 1LDDA 3WG9A 3G73A 1BIBA 3F22A 1IZ1A 3LA3A 2FBHA 3HHHA 2R7DA 5DD8A 4ENKA 1FBQA 2CFXA 3KCCA 2KIFA 4A6EA 3RPUA 2M1BA 1Q1HA 2FEZA 4A6DA 4EVIA 3I59B 4I09A 1DDNA 1HW5A 1D3YA 1FBSA 2QM3A 2LF7A 1D8KA 3PFIA 5FD6A 3E6BA 2ZO4A 4EM0B 1O57A 3G3ZA 3Q5FA 1KYZA 4HW0A 4L0YB 3R4KA 5LEKA 4UNOA 1BBYA 2DT5A 3RYRA 4HF2A 3KP6A 3GFLA 2F5EA 1MZBA 2QLZA 4HBLA 5IT9Z 4YFNF 4G6QA 3RIRA 2PI0A 1FYKA 2ZMEB 3CUQA 3M1EA 1O7LA 4UVCA 1FBUA 4HYEA 2ZBKA 1G3YA 4L9TA 4RB1A 1VTNC 2QQAA 1TLHB 2PG4A 1R7JA 2LF8A 1ZREA 5JI6A 5HLIA 3GZ6A 1CGPA 1TW3A 1S29A 1WSUA 4L9VA 4HX7A 3L9FA 3EQLF 3T8RA 4CO8A 2OQRA 4U0YA 1P6RA 2JT1A 3DP7A 1KU7A 3ZP5A 2D1HA 1ON1A 1R5HA 2OAZA 5J8FA 3ZMUA 1MD0A 4HV5A 4YFKF 3I4PA 3P9IA 4O5VA 4KMFA 1T98A 5L3FA 1IXCA 1JE8A 2NNYA 3WTWC 4IRIA 3AAFA 2RQPA 3I59A 1IAWA 1I5ZA 4A12A 2XKOA 1TQMA 3HTSB 1LVAA 5LGNA 2WTEA 3BPXA 4JBAA 1LEBA 3EDPA 4LGWA 3BWGA 3DFGA 2MH2A 3HIFA 5LRRA 3CDHA 5CLSA 5HS8A 4I98B 3QPTA 2FF4A 4KFCA 3KP7A 3JAMK 4RB0A 4L9NA 2P7VB 3MZHA 2MC3A 3P7NA 1B6AA 4M73A 4CGZA 2C6YA 1ZARA 2ZMEA 4I7HA 4LG0A 4OMYA 4ASNA 4U88A 2STWA 2QWWA 3V4GA 2A68F 1IW7F 2LKPA 5LRSA 1T0FA 2FMYA 3TKYA 3EUHA 3HUGA 5FD5A 2ADUA 2LNBA 2A6EF 1P4AA 1HSTA 4AVPA 4WXCA 3Q9VA 5HLHA 1IXRC 2EA4A 4Q4ZF 1GXPA 2MLKA 3F8MA 3BZ6A 2HQRA 3FMRA 2IP2A 4HLYA 2KRFA 4OIRF 3HSRA 3GFMA 2XRNA 2GIVA 4EJOA 1YW8A 4A5MA 3WGIA 3GFJA 3M8EA 2DU9A 3QU6A 1LDKB 1TBXA 1SD6A 3K0LA 1W7PD 4MGRA 3D5LA 3K2ZA 3ISPA 1C0WA 5DEQA 2F5DA 2XV4S 2K86A 3RPQA 5DCMB 5D6EA 4FHTA 1SD7A 4AIKA 2D2WA 2W57A 1TNTA 5IT9K 1F4KA 3MFKA 1XSXA 3QRFF 2L4MA 5E1XA 1PP8F 2YX4A 2HS5A 1J2XA 4ZH4F 2P5LC 1X3UA 5D5XB 1SFEA 2Y0MA 5D4RA 2QVOA
chains in the Genus database with same CATH superfamily
2MD5A 1KGSA 2V1DA 2DN0A 5TJJA 4YIFA 4ENNA 2F5VA 3CCQI 2YSRA 2DTRA 3VDXA 3LMMA 3S1NJ 4M6YA 2ELHA 2EIMH 2HOEA 3BQYA 4LLLA 3A4CA 2HVSA 1J0RA 4HQMA 1W0TA 2DFIA 4B43A 4IHYA 2HZTA 2VT2A 2FBIA 4IX7A 1LPQA 3HXLA 1PDNC 1UG2A 2K9LA 2RREA 2LY1A 2Y30A 2Z16A 2K4BA 4QPOA 2COMA 1JHHA 3ABUA 1LVKA 2DA3A 3OYNA 2OJED 2KHMA 1AKHA 3D0SA 2F48A 5H2FC 1OQYA 4D7MA 1JUMA 2EFNA 4YIIA 2HEOA 2YU3A 3DXJF 2CQKA 1ZTRA 2Q2EA 4L18B 2BW3A 1WI3A 4O6JA 3L2VA 2EQRA 2ZFWA 2WA0A 4IRGA 2PFBA 2PMZN 4CH7A 4HPQA 2ME6A 1PYVA 1GXQA 3M9AA 3PJRA 4GDFA 2DCEA 3R0JA 2Z33A 1MJ9A 2KL4A 1WJBA 3SZTA 3TDZC 5CVIA 4ZDLA 2A6HF 2JA2A 3FXKA 2HFHA 2LD5A 3OR1C 1P9QC 4FASD 5HS7A 3FDYA 3DKWA 4X0GA 2D1VA 2GXGA 2YS9A 2ZC2A 2K85A 4J19A 4Y17A 3WTVC 1HSJA 4LK1F 3ML6A 3ZMVA 3M8FA 3OS1A 1VNDA 4L5IA 3LAJA 1R4NB 1UFMA 3FXLA 3S32A 1PVEA 3CLOA 2QQ9A 5ICGA 1WHUA 2P5KA 1GUUA 1VQ7I 1UAAA 3K6GA 1JGSA 2XVCA 4B44A 4WWCA 3H3VK 1HKQA 4H4KC 1AWCA 3PNVA 4V19K 4IJAA 3DPLC 5IY5H 3FBNB 3OIQA 3J81Z 4OU0A 1KONA 5E3MA 5L3GA 5DCMA 2VJ5A 1TWCJ 5J4VA 5JR3A 4DZJA 1FNNA 5LLQA 3COAC 2ELKA 1R71A 4FTHA 2YR2A 2M4KA 1BI0A 1RETA 2ZCWA 1XMKA 2VXDA 3C2BA 4BE1A 2LFBA 2JPBA 4XLPF 3BR6A 4XLNF 3K4BA 5IP7J 2LRDA 4M6XA 5DCFA 2AXTC 1VQKI 1JTXA 4WF2A 3A03A 1FWZA 2IA2A 1UB9A 2ZXIA 1MSFC 4KJZA 2A05A 1E3HA 3EYYA 2STTA 3KE2A 2LDUA 4CCMA 2EZIA 3GTKJ 1Y39A 1HLVA 4PK4A 2JQ7A 1LNWA 4IF4A 3D1NI 3E5QA 3H92A 2NOJB 4G8XA 2W25A 1K79A 1XC5A 4IHVA 2KMUA 1OLTA 5FROA 2BGCA 2LC2A 2EFPA 2E2IJ 2IJLA 5GAHJ 1SFKA 4NB5A 5FB2A 1LB2A 2NVYJ 2AHQA 1XCBA 4Q48A 2A07F 1EH7A 1DP3A 4HG2A 2L54A 3HKZN 2MW8A 5AIQA 2MD0A 2I8DA 3HTUA 4BYYA 4E7KA 3JTGA 1OYIA 3V7CA 3ZXSA 2AS5F 3GYHX 2X48A 4DZPA 3V7RA 5EEGA 2V1XA 3DV8A 1U5TB 1SEUA 2UV1A 1MMGA 2GA1A 3SFZA 4UV8A 1SFUA 2MH9A 5J4YA 2Y31A 3GLXA 4PGGA 1U8BA 2ID3A 2KIUA 5JVTA 1MH4A 2DK5A 4A3GJ 1IRFA 3CCRI 4RM2A 5LHHA 3GO5A 5EGOB 4BE2A 1IF1A 2OCCH 2IGNA 4XKWA 2V79A 5A2QZ 4EGZA 2Y9ZA 1G8XA 2RVCA 3ECOA 4L5JA 1ZR4A 4JQFA 1QVTA 2HPMA 3U9GA 2HYGD 2JVHA 1X1AA 4XIDA 2IA1A 4DYQA 4M3FA 2B7EA 1JT6A 2QKMB 2HQAA 4II3A 1OR7C 1XDUA 4AD9A 1ZHFA 1EH8A 3ZMSA 1UELB 4G12A 4PFOA 4Y3OA 4AVZA 3LFUA 5IOYA 2CUFA 2XPWA 3F8NA 3K4JA 4II2A 3I64A 3ZQQA 4C3HJ 1VQOI 2QBYB 1V54H 1NH3A 3OYDA 3E6CC 3HG9A 3K69A 3JAMZ 2WV0A 4ZZDA 5DM7F 3JSOA 1YTYA 2PMUA 4YEJA 3ZN1A 5FLMJ 1MJBA 3JRFA 4BJTA 4KDPA 2EZHA 2L9RA 1WQ2A 1BI1A 3H36A 3UKGA 4A3KJ 4GRIA 3CCEI 4WXHA 2M45A 1PJRA 2HPIA 3CCLI 2Y75A 1WJEA 2EILH 2CQXA 2EFWA 5B3SH 3PQKA 1BI2A 1ZH5A 3RSNA 2GOMA 1U9NA 2QYOA 3F9KA 1QO0D 5FKOA 2NAZA 2PEXA 3GTMJ 5TGTA 3MZ8A 1RKWA 1V5EA 1YFHA 4RAGA 3WTXC 4C3IJ 4NBQA 2W4SA 3OOPA 4R8HA 3NRVA 2KZGA 1BJAA 2H1KA 3U2RA 2W24A 5LEJA 4JP0A 2VL8A 1EV7A 3W2WA 3ZN0A 5GPAA 5IYBJ 2K7LA 2EFOA 5DUIA 2IA0A 4M6VA 4RGSA 3C2HA 2OTLI 3FMSA 5J3LA 4UVAA 3G4SI 2GXAA 2EH3A 2Z5UA 1SAXA 3QPLA 2GA2A 1OKRA 5FGMA 4WXDA 4AWXB 2WB1N 1ZK8A 2DYSH 1Y56A 2LSOA 3BJOA 3LSIA 2HKOA 2JA8J 4D7NA 2L3DA 3BG9A 3CO7C 2XAQA 4A3CJ 4B3AA 2NYXA 2DOEA 2FNPA 4KICA 4BQQA 3V8LA 4GFBA 4I0BA 1Y0UA 1QRYA 2FNAA 2V1NA 2VBXA 3PO3J 4BUPA 2M2EA 5K7ZA 2YUSA 4PZJA 5GTIC 2BEOA 2R7UA 4DNCA 1I1GA 4GXOA 3KZYA 3SJMA 4BJ5C 2BVMA 3O6BB 1Y1WJ 4Y52J 2RAEA 1R58A 1KU3A 3WGHA 2QQBA 3E7LA 4BJ6C 2DDAA 4W97A 4CYDA 1U5TA 2XAJA 3HSFA 4IHSA 3A02A 3BCAA 4KN4X 2K9NA 2LREA 1ZYRF 1W4MA 1QZEA 3BTLA 3TL4X 3GVAA 4N0BA 4DYRA 4PSWA 1FYMA 3M7GA 2GQQA 5B1BH 1NG7A 2R3SA 1NTCA 2K27A 2BY3A 1MDMB 4HNVA 1N78A 4ETSA 1FTTA 2L7FP 3OYBA 5M5YJ 3CJNA 1LFBA 2KDOA 5EGOA 1RIOH 1UMQA 1IUYA 4P55A 4OINF 4ZDPA 1HA8A 2O5RA 5E1WA 5IOZA 2DPDA 3SZGA 4CCNA 2F4IA 1JT0A 2DAOA 3Q0WA 4BQAA 1P4XA 3QP5A 2XGXA 4QSHA 5J47A 3F0CA 1A36A 2N8GA 2Y48A 1XGOA 2VIXA 4G7HF 2NS8A 3LA2A 4AU7A 4DIQA 1MBGA 1S7AA 2PMZA 3FK6A 2QBYA 2DMQA 2VKVA 4LG0B 2DA1A 1UHMA 3WHBA 4GCVA 1Y0NA 2LYCA 1NHAA 1WRJA 3H5AA 1Q1VA 3ABKH 3NWTA 5KCMA 5D5WB 4EJVA 3J81K 2H6BA 2ZNZA 4YG2F 2BZTA 2IXSA 3OYIA 1XD7A 2I5UA 1X2MA 4MEXF 2Z99A 2OZ6A 1HDPA 1ZG1A 5EZGA 4ZYGA 1OFCX 5FFXA 4B8XA 2F2EA 2RGVA 2KISA 1ERDA 2L02A 4NUBA 2VPLA 3HYIA 1LQ1A 1JHFA 4PJNA 3ZQCA 4OWRB 3KP5A 3F8FA 3FMQA 5ERIA 1ZQ3P 1K61A 5CKTA 1MNDA 2EFQA 5D6FA 3HPGA 4XNFA 5EG0A 4ZTFA 5IPAA 2KT0A 1Z91A 2W82A 2E5ZA 3QPHA 3CC2I 1FPQA 1POGA 4B3XA 2X9DA 5K7FA 3X2QH 3OSGA 3KEQA 1FOKA 3E97A 2E1MB 5HNFA 2E7WA 4MHGA 3G71I 3QOEA 3WTTC 3H0DA 3CCUI 1ULYA 3DPUA 1R23A 2WV1A 1JUSA 3IL2A 4RAYA 4A3MJ 5JFRA 2VKEA 2EWNA 2MFZA 1QPMA 3FHNA 3KP3A 5ILVA 3MKZA 1TWGJ 1DP7P 3BPVA 3CUQC 4EJTA 2R7WA 3ABMH 3S3NA 2ISYA 2JA6J 4WX9A 1I1SA 2IW5A 2RV8A 3OYLA 3ZMDA 2IGMA 1MNMC 2VBZA 2L9SA 4XMYA 1FZPB 2DA5A 4HF0A 3QU3A 5K5RA 2TCTA 3T1BA 1R6RA 1OCPA 2EV6A 3DEEA 5J6XA 3ZRGA 4ZDOA 3IH4A 4IHXA 4G94A 3S15J 3DTEA 1ZN2A 3ZR8X 5DD4A 4QIWN 2QKLB 3WGGA 4BQNA 4A2UA 5D5UB 4M3BA 1NK2P 1Z21A 2UXNA 2ZXWH 2XUBA 2DJIA 2OU2A 2YX7A 3E5XA 1PUEE 2E71A 3FWEA 2EIKH 3OMYA 5A2QK 1F43A 1ZGJA 2V9VA 3CZ6A 3HC7A 1RNLA 3JRCA 1ZRCA 4XORA 2QGUA 3KYCB 1IN7A 3K9TA 3AG1H 1X19A 1XGNA 1MDMA 2IS2A 2COBA 1JXSA 1FMWA 1BN5A 1T08B 2EA2A 3Q9SA 3HRSA 4NQWB 2W7NA 1FP2A 1K6OA 2H09A 4XLHA 3EUAA 1P4WA 2CSOA 4RAZA 1FYLA 2JMWA 3QQAA 2ESHA 3E6DA 2CV2A 4U7BA 3GF2A 5HS9A 1YRNB 1AOYA 1MMNA 4EJWA 1IN5A 2VONA 3H5RA 1G4DA 2MG4A 1JKOC 3KPHA 2MBFA 5CYVA 2CQQA 5E20A 1GVDA 4MEYF 3TP3A 1ONVA 2M30A 1SVMA 5F64A 2EPFA 1NK3P 4KIFA 4N9HA 1QPIA 4RS8A 4HLXA 2V7FA 3PSFA 2R5YB 3ZCOA 3QYBA 4YFXF 4RGXA 5L3EA 2DI3A 2Y9YA 2JTVA 2VOOA 1MMDA 3OYKA 1XS9A 1V5GA 4Y13A 2UZKA 2VQGA 3LSHA 1SC7A 4BAYA 5FRMA 4RLQA 1U78A 1YG2A 3B73A 2NNNA 4M9SA 2YU9J 2VBYA 1J5YA 2JWTA 3RJPA 2L01A 3HB9A 2OPTA 3AKZA 2GM4A 2AQFA 3CJQB 2DJNA 3M07A 4UUSB 4MIMA 3OL3A 2X85A 1WPKA 3JRHA 2KDZA 3ASNH 3HRMA 3ECHA 3JRBA 4KA4A 3LNQA 4UUVA 4LIUA 2DMTA 5J1YA 3B02A 3V42A 3TEDA 1IDYA 4MFEA 4N4OB 3GXOA 4BHCA 1G2HA 1BIAA 3HDDA 1ZKGA 1GDTA 1OYYA 1T6SA 1R22A 3HSEA 3O8GA 4KUMA 3BQZA 4NNJA 1JTYA 4EJUA 4E7LA 3LSGA 1AU7A 1G6NA 4XLFA 4E70A 2HVRA 3MCZA 2ZMEC 1SD5A 1K7AA 1YQAA 1OMIA 2JA5J 4R1HA 3H0GJ 1JKPC 4UV9A 3ZQLA 1P92A 5E17F 2DW4A 2E19A 5DV5A 2M0MA 1I27A 1HQCA 1FJLA 2VODA 2H94A 4PGHA 3FM5A 4XRFA 4H0EA 1W36D 2EZLA 1YYVA 2CYYA 4A69C 1SAUA 3PIOF 1YE9A 4XKBA 3CTAA 4CZZA 1T0FC 5F1JA 4MFDA 2KFDA 2AQEA 1G3TA 4A0ZA 3EUHC 2EB7A 1IG7A 2CWEA 2L9NA 1A5JA 1F9NA 2JRTA 2W84A 5BQTA 3VSKA 1R4MB 2VI6A 2XGDA 1RPWA 1BJZA 5DM6F 3IKVA 3TBIA 4IQJA 4D1QA 1DUXC 2HDCA 1X1PA 1BOAA 2XB5A 5LHIA 4A93J 4P96A 2PBIA 1HBXG 1MBJA 5LFAA 5BS6A 2M7BA 3PIPF 3W2AA 1FTZA 3MAJA 1HC8A 1SMTA 1STZA 2XASA 5IP6A 5E1ZB 3I54A 1K78B 3CCJI 4NQWA 4F91B 4HAMA 5HOOA 3HEFA 2M34A 5M5XJ 2FU4A 4A3DJ 2M3AA 4W1UA 4IHTA 1R49A 3MEXA 1V5FA 1REPC 3FX3A 3TDUC 3PM1A 1RRJA 4ABZA 3DBRB 4HDUA 3QOPA 3J80Z 4AC0A 1YRNA 2LY2A 1TNSA 3EYIA 2EINH 1ZGAA 3KX2A 2ZJQF 4JX6A 4RDUA 4I99C 3WE3A 4E7SA 4G7OF 3GCMA 3MZYA 4XR6A 5KAIC 5D8LB 4J01A 1XDSA 3BTJA 4QLCU 2H8RA 3BJAA 2XROA 3QP6A 2Y2ZA 2BBYA 2RDPA 3NWSA 4BEHB 4U7DA 3JSPA 3DPTA 4CICA 3O8HA 3FKIJ 3HOTA 3CDIA 3I9V2 1R9TJ 2R5YA 3WE2A 2DT7B 2BYVE 1B8IB 2R7FA 4QPQA 4HDVA 4XQFA 5FKKA 5JLWA 4XICA 2QCOA 3AL0B 2V4JC 3WG7H 4MTDA 1D1AA 2L2OA 2HQ5A 2CMPA 1AHDP 1P7IA 4KIBA 2OZUA 3KFWX 5C3EJ 2HKXA 4WK8F 4XN3A 5TISC 4RB3C 4UUSA 4IVNA 4ANJA 1W5SA 2X6WA 4PCQA 3AG4H 3VSLA 1WH7A 1I6XA 4E7IA 1U8RA 4G7ZF 3FISA 1TTYA 1IV6A 2W1OA 1YHQI 3BOQA 4E4HA 4RB2C 3OS2A 1J9IA 3ROUA 2R7TA 1IN8A 4XSXF 2FE3A 4BXUA 4XN0A 2DYRH 3RYPA 4P9UA 4L0ZB 2X51A 5E18F 2M0CA 1T56A 1B9NA 3SXYA 4AUXA 3CP2A 2ZJPF 4S04A 2OA4A 2ZJRF 4U0VA 1APLC 1W5CC 1LEAA 3I4NJ 2FBKA 2IS6A 3WU0A 1Z7UA 4LITA 3J7AO 2DTZA 3DEUA 2NS7A 2E36A 3KZIC 1V3FA 2QQ8A 2WC2A 1RR8C 1OISA 2VE9A 3WTZA 4XM3A 1K4TA 1Z1DA 5H20A 1WFXA 1H0MA 2BV6A 2HGCA 2O0YA 3ABLH 3FXQA 4FQGA 2EK5A 3ZMTA 1WJAA 2H1LA 3GX4X 3ZPLA 5LGUA 2K4JA 3CCSI 3L09A 4BHBA 4ZC3A 1ZLKA 1QZZA 2LOOA 3IWFA 1GT0C 2FSWA 3DLLF 2V1UA 1F36A 3L00A 2G9WA 3M1CA 3G6EI 1R5GA 3WU1B 3ULQB 3JR9A 3LWFA 1JKRC 2F4MB 3HOUJ 1R5ID 3Q0UA 1IXSB 3I0TA 4IOCF 2OTJI 4EQQA 3IV5A 1TWAJ 3SZPA 4KIGA 2A69F 2HXIA 4DYCA 4HNUA 4ENMA 3K2AA 3A0HC 3K4MA 1WH5A 1T8IA 3IRRA 1K78A 1DPUA 1I3AA 5JHUA 1E2XA 3BG5A 2MABA 2VKHA 3ABTA 5CQEA 3CLQA 4RM3A 3ZGKA 1L0OC 2FOWA 2VT3A 3L2UA 3GLLA 4FETA 1R1VA 3EUKL 4A0YA 3OYMA 3DTKA 2MA3A 3P5JA 5HDNA 2P7CB 2O7OA 2X6XA 5IT3A 4OMZA 2K3PA 3SEQA 1OCRH 3FM3A 3GUDA 4IXAA 1YS7A 2KJBA 2CQ7A 1OCZH 3HGGA 1D5YA 1B9MA 1E0EA 4BGDA 1HW1A 4EV0A 1BI3A 4ITVA 1IRXA 2M9HA 5KVRA 3MVPA 4BEHA 4DQ2A 1MSEC 1N77A 2PJRB 1CF7B 1OYWA 3JTHA 2DQRA 4BL0B 2VC1A 5E8IA 2QSGX 3IRQA 1B8IA 3SQNA 2HTSA 5HODA 1QBJA 3BR2A 1U2WA 3TOAA 1R00A 4HZFA 2QZ8A 3FXOA 2DA4A 3NEUA 5J1RA 1QGPA 3IWZA 1QHHD 1FOWA 1I3QJ 1P2FA 3PL8A 4UUTA 3TO9A 1K6YA 1FOYA 4FX0A 3T5XA 4BS9A 2BHYA 1KQ9A 5F0CA 3W6VA 3ZQ7A 2HYJA 1B4AA 4F7ZA 1WI9A 3KP2A 4C2UA 3PNTA 1R1UA 3BR3A 3C18A 4XLCA 3C1DA 2VQHA 2L0KA 1TWFJ 2O03A 2CW0F 4PFPA 3HOZJ 5KK1A 2R92J 4IZZA 1ZLJA 3V8JA 4F93B 5K1YA 1U3EM 4BY1J 2PX9A 2VQLA 1MH3A 4MNUA 4F52A 4LB5A 3GTJJ 2UXXA 2HTJA 2E60A 4FE4A 2VUMJ 2E1CA 2DA7A 3VEPA 2DO7A 5E8GA 3S16J 3W3CA 2HDDA 4K2EA 4TV7A 2MGQA 2QA4I 2Y0SN 3MKLA 5H6RA 2CRGA 3LSTA 3CC7I 1J09A 3OYGA 4YIRX 4ESFA 3B6AA 3OR2C 4G9YA 4GGGA 2R5ZA 3IAS2 1MGTA 1HW2A 1TC3C 2V26A 4PUSA 1IN6A 2ZNYA 5BPDA 2HOSA 3BTIA 3W6JB 5CVUA 2R7ZJ 3M3YJ 4I01A 4KN7X 2XHKA 2UWMA 5EG0B 1H89C 5L3BA 3SEZA 4CDGA 3IKTA 4IHWA 3I4MJ 1TWHJ 3LQRA 4XL9A 1DU0A 2CFOA 3CCYA 3I58A 3J80K 3OS0A 4ESJA 4YELA 2HOTA 2XPUA 3S14J 1WZ2A 4CCJA 3F6VA 4R79A 5FFZA 4PJLA 2CU7A 4A3EJ 3J7AY 2AXLA 1LDJA 3KEOA 2LP0A 4HX8A 4KYWA 4BE0A 5F6FA 4B47A 1MNEA 3BY6A 2E35A 3L1PA 1JJ6C 4OAYA 5J40A 3V8KA 2DLLA 1SFXA 2OC6A 4XONA 4L9JA 5EJCA 3CF2A 1EA3A 5B5EC 2HVQA 2ZXJA 4F92B 2JUGA 3WTUC 4AIDA 4UXNA 4IOAF 3N05A 5BPIA 1JKQC 5BMZA 1DGWY 3CMMA 1Z7LA 3IH3A 1RUOA 2FUG2 2J5OA 2CUZA 3H3UA 2DMUA 3ZQHA 1TT5B 2W48A 2DXIA 1IN4A 1I50J 2PJRA 3C3WA 1S6LA 4LMYA 1CF7A 3SDBA 2LVSA 1F1ZA 1X4PA 2KIMA 2IPQX 1USSA 3WTYC 4ZJZA 2KKOA 3KEYA 2F6CA 2FXAA 3O3KA 5F04A 3WODF 4IRHA 5C4XJ 1XB4A 5HLGA 1GV2A 1UHWA 2QUFA 3K4NA 3FZVA 2P8TA 2DK8A 1J7KA 3PNYA 4OOIA 3N97A 3GEZA 4BH9A 1W36C 2CV0A 1FLIA 1WKMA 3JRDA 4CXFA 2M7AA 3HOVJ 2G7UA 4C2TA 4XRSG 1XCVA 3TW6A 3TP0A 1EKEA 3D5SC 4B48A 1P7JA 1I6HJ 2JVGA 1S7OA 3WU2C 3QPSA 3DCFA 2R7SA 2XAHA 5ED4A 1WGXA 2F4OB 2LR8A 1H8AC 2ISZA 3NAUA 2WAEA 2VC0A 1EJ9A 1O7FA 3K4CA 1EH6A 3DTIA 2L7KA 1VQ5I 4EGYA 1TQPA 4A0XA 5HDGA 2E2HJ 2XF5A 2FQ4A 2X6OA 3S3OA 2DMNA 3BR1A 1J59A 2VXZA 5HLTA 1X2NA 5DYMA 2ZFUA 3RQ4A 1Z3XA 1VQ4I 3RKWA 5DTDA 2DQLA 5CVRA 2XC7A 1VQNI 3KETA 3AG3H 1V55H 2PJPA 3CDLA 4EM2A 4ENJA 4XSZF 1TZLA 1RUNA 4Q5SF 1OCOH 1TQIA 3HL2A 3GWZA 4PJJA 2EV5A 2FQ3A 4P9FA 2RNJA 4Y4RA 4BHPA 1U5TC 4BBRJ 2JN6A 2E2JJ 3IC7A 2FOKA 2VASA 2EIJH 4LB6B 3RQIA 2DOFA 2HI3A 1ODDA 2M5WA 4PJMA 5EEHA 2PQ8A 4XKVA 3QODA 3M8JA 1S8NA 2NVXJ 3F6OA 2JK3A 2XDVA 3GFIA 4NC8A 2BVLA 5J1UA 1VFCA 2BXYA 2V6CA 1LUJB 4S05A 2OD5A 1QQIA 5E79C 4MTEA 2GZWA 4HX4A 1R1TA 1XSVA 1IRGA 3F72A 2HQNA 2K02A 1XMAA 4C9YA 1GVJA 3ONQA 1XG1A 3QAHA 3K1MA 2FJ1A 4MLOA 2IEKA 4MO7A 2CUEA 3NARA 2CG4A 4F55A 1SVOA 4LD5A 4M3DA 4S0HB 5F1RA 1S5LC 2XKPA 6PAXA 3QYEA 4KNYA 2YPRA 3BJ6A 1SD4A 2V9KA 1HXDA 4UY8I 1CQTA 4KT6A 3R60A 1L3LA 5EZHA 1WVRA 2VOPA 3K4LA 1O3TA 4HRIA 1IUFA 4FT8A 2JZYA 2JSCA 3EETA 2R93J 5K5OA 3S2WA 2JPCA 4I02A 1ZRFA 2E1OA 3O2PE 4LFUA 4ZZLA 3ESWB 4L5EA 3KZZA 2W85A 1ACIA 5E3OA 4Z2YA 2XF6A 1X1DA 3VPRA 1X3ZB 2ZB9A 3BP8A 2TRTA 1OCCH 1YIOA 2WBMA 3W6KB 4IQ4A 1JI8A 1RKTA 5H6QA 5CQGA 4GO1A 1B72B 2E7XA 1D0ZA 4DBQA 5DDGA 3MD2A 3C7JA 3VYUB 5FJ8J 4HV6A 4Q47A 2X0LA 3E5UA 3OYAA 1ETQA 2GLOA 3ZOBA 4BNCA 1ZAOA 1ZG5A 3MMYB 4HQEA 3MKYB 2GBYA 3F8BA 2Q1ZB 4AIHA 2O8XA 4HSTA 4PDKA 5F0FA 4RLFA 5FLXK 3A01B 3BG7A 2VJJA 3MKWB 1KQ8A 2G0EA 4C2MJ 2Z3YA 4XLAA 4Y7NJ 2NS0A 2OUMA 2HU9A 1QHGA 3MQ0A 4D9JA 4KITB 3TMOA 1FY7A 5HDKA 1FMVA 2O9LA 2IGKA 4NHJA 2ZXHA 1Y8RB 1ETYA 2L4AA 1Z9CA 1ETOA 2OCEA 3WTSC 3P9KA 1W1WE 1R36A 1QZYA 3NQOA 1LJ9A 1D5VA 4BY7J 2DMPA 3TOBA 2G7HA 1VQ9I 2FA5A 1KA8A 4IKFA 3A2KA 2UUZA 4XBFA 3S1QJ 3LFKA 2PLYA 2CO5A 2M8GX 4EM1A 3OY9A 1YO5C 5C4JJ 4B4CA 2Y0SA 3HHGA 3K4KA 2BY1A 2BY2A 3R6SA 1MKMA 1U6GA 3HJEA 2RC4A 1YLFA 2F5FA 1ZG3A 2WADA 4D0PA 3MN2A 1GHCA 5ILUA 2LBFB 1SANA 4ZYDA 3REOA 1VQLI 2IVMA 2O61A 1Z6RA 2HYFA 3ERED 2JA7J 5TRDA 1FP1D 3U1DA 4XOPA 4CA0A 4LIVA 4BBSJ 3JCUC 3CCMI 4A3JJ 1MBHA 2RN7A 2ELJA 2VBWA 4FE7A 2A3SA 1XGMA 3OIOA 2Q0OA 2LKXA 1LE8B 1QVUA 4QWQA 2EZKA 3K1PA 5D4SA 1K4SA 4WCGA 1I39A 1MIJA 2O8KA 2EV0A 4JOMA 2D45A 1IGNA 1SMYF 2XSDC 2NRAC 2GXBA 3GTOJ 2Q8KA 2FD5A 4KISA 3KLNA 1RR7A 1H9GA 4NDLA 3L7WA 1X3WB 2ZJ2A 1YI2I 5FKNA 2CUJA 1O3QA 1B72A 3J7ZI 3MWMA 3SHFA 3K70D 4AIJA 2A5YB 5B1AH 1B59A 2MLGA 1BW5A 2FX0A 3RDIA 5GAGJ 5CVVA 3I56I 4CHUA 3LA7A 2IRFG 1QA6A 1KYWA 4UB6C 1ORKA 2PMHA 3BDDA 1D0XA 3BZCA 4CYCB 1T2KA 2CGPA 2E1MC 5F08A 2HZDA 2O3FA 5HVQC 1YJNI 5GADJ 3CMYA 2M87A 4F3QA 5AONA 2RQQA 4FCYA 1XSDA 3A01A 2GWRA 5M3MJ 3KYLA 4I0AA 3F8CA 1MJAA 2TDXA 5ICEA 3LSMA 1FX7A 4M9XA 3DQVC 3E6MA 1HDDC 1W0UA 2B63J 1TL8A 5CJ9A 2HR3A 5L3DA 3SFIA 3VOEA 2D5VA 1YJWI 3RZOJ 3FBIB 4LJZF 4N9IA 1H9TA 3DU5A 3JW4A 3ZQFA 1J75A 2WY7Q 3RKYA 1DPRA 2E5NA 2AO9A 2ECBA 5ICFA 4GYIA 2F5CA 1H88C 1V4RA 4LLGF 1G3SA 3CD6I 3CJTB 4HSRA 3F23A 2XAGA 1BOBA 3GTQJ 1UHSA 2P6SA 1S7EA 2LMDA 2OBPA 1WJDA 4X1EA 2XAUA 1G59A 3I53A 1UCRA 4B1RA 3GTGJ 2KP6A 1BL0A 4KMUX 4ZTJA 3GMEA 3FXUA 3LAPA 4HOBA 4UHTA 2BHZA 4GYGA 1WJ5A 3ZQGA 2ZKZA 1YIJI 2CW8A 3GW2A 3F3XA 1Y6IA 1MBEA 1TW2A 2IT0A 4X6AJ 1XMXA 1USTA 2ICWG 4A3IJ 1MW7A 2LBFA 4BKXA 5ILSA 2PN6A 2WY8Q 3OOUA 1E17A 4XRMA 2K5CA 2O6GE 2B0LA 1X1BA 5E3LA 4HF1A 4A5NA 5L3CA 1ZELA 3K7AJ 3ELKA 1UJ8A 3PUFA 2ACJA 4MQVA 3E3VA 1PUFA 2M4GA 1FT9A 4BU2A 4UVBA 1VQ8I 1Z6TA 4IEJA 2Z1DA 4JX4A 4I2OA 2KLOA 3R0AA 4I76A 3HGYA 5EYRA 5LGTA 1VQMI 1ZR2A 4XKCA 2Y69H 3CO6C 1QNTA 1BM9A 1LE8A 2K9QA 1T33A 4RA2A 4RGRA 4M9ZA 5K5QA 3N4MA 4CUGA 1A04A 3C2GA 2KZVA 1PP7U 3RKXA 5LHGA 3T8TA 4MQ9F 2CS3A 3FK7A 2LG4A 2X4HA 1YS6A 1LFUP 1DQUA 1KQ0A 2J5PA 2R5ZB 2VE8A 4LLNA 2HWVA 4EATA 4A3FJ 3V7SA 3TO7A 3IUOA 1U9OA 1ZGWA 2R7VA 3VWBA 2P5VA 3VFZA 2VN2A 1XPXA 5D5VB 1FSEA 3UR3C 4JYKA 1GV5A 3TO6A 4OIQF 3KP4A 1Z0XA 3VODA 4CYCA 3ZMZA 2KJCA 2RKHA 5E3NA 2ETHA 2R4GA 3AG2H 2XIGA 3T0YA 2GAUA 4M3EA 2LLKA 3KIOA 3DF8A 3H9QA 4HA8A 3ZQIA 2DPUA 2L9VA 4E7ZA 1YW7A 3FHZA 2L7MP 3G1LA 4DJAA 2H6CA 4BDYA 3HRTA 3BLYA 4OIPF 3K1NA 1W7PB 2ESNA 3GZ5A 2DA2A 2HNHA 2P6TA 1S72I 4Y15A 1T95A 3F21A 3PQJA 5D8KB 2H27A 1ETVA 2DBBA 3BCBA 2BE5F 1WWXA 1ZRDA 3IP4B 1VF9A 4A3BJ 2A61A 3W2VA 4PJ0C 2P0WA 3IHUA 1O3SA 2Z9OA 2FRHA 4M71A 1OR7A 3LSKA 3R61A 3KYDB 3VB2A 2QEXI 1O3RA 1E3OC 4A3LJ 4PSXA 4Z6YA 3DBHB 3CESA 1RZ4A 4DBRA 2FMLA 1T39A 3LQQA 2CQNA 3ASOH 5M3FJ 1KZHA 2K40A 4JK1X 5EEAA 1YX3A 4NC7A 1MBKA 1X58A 3PUBA 2RNGA 2ECCA 3H9JA 2DA6A 1Z05A 2DT6A 3CUOA 3TGNA 1XN7A 2K3FA 4ZYHA 4XLEA 1DU6A 3OV8A 1HKTA 1NG6A 1YX5A 4XOTA 2VJ4A 4M74A 4Y33A 4EMSA 3HRUA 4C30A 3HOSA 4KT5C 3FF5A 1Y8QB 3LSJA 2X6YA 3OIPA 4ON0A 3RTRA 3H3ZA 3I5UA 3OL4A 1FIAA 1MBFA 1OPCA 2XPVA 3HM5A 4OAZA 1TT0A 3BT9A 4ESBA 5KAFC 4OIOF 4N4NB 2E1NA 4QTRA 3ERMA 1BR2A 5AIPA 3L2CA 2P4WA 1U0JA 3WHCA 1ON2A 4V2GA 5LBQA 5FLXZ 3L2RA 4M72A 5CVJA 2DFEA 2HOAA 1T38A 2B9SA 5IYDJ 2Z2SB 2XAFA 3TQNA 3VYTB 4ZYEA 3OYJA 2LK2A 2R7RA 4FX4A 1FC3A 4IPAA 1FSHA 3DWLE 2VJIA 3G2BA 1F5TA 1KU2A 3LSRA 4RMNA 3CC4I 3RI4A 2OQGA 3CUQB 3FXRA 1O4XA 1VQ6I 5FO5A 3S1RJ 5M5WJ 1G3WA 1HKSA 3H35A 1LKXA 4B09A 4AYBA 4DOZA 3AL0C 1Y1VJ 1HF0A 3BROA 2A5WA 2QENA 3DKXA 1RI7A 1IV8A 5DUKA 5BOXA 2DFFA 3OWTA 2WAQA 3FKJA 2CV1A 2R7OA 3S8PA 1BC7C 4RGUA 1A31A 4O3MA 1XGSA 3KLOA 2M8EA 2LH9A 2LKSA 5HNHA 4LG3A 3JRAA 3L2QA 5LD2C 1BC8C 1JUPA 2EJRA 5ICCA 1W5TA 1A6QA 1Z77A 4G6DA 1KU9A 3I71A 4LK0F 2KIQA 3CCVI 1SVLA 4U87A 5F0HA 3EPZA 1YW9A 5J8CA 4J00A 3P9CA 1ETWA 1B1BA 4U0WA 3D5RC 4P5OA 1RC9A 1S3JA 3RCOA 2WWYA 1D8JA 1W7PA 1LDDA 3WG9A 3DKYA 3OYHA 3G73A 1BIBA 4P1WA 3F22A 3VYRB 1IZ1A 3LA3A 2NVQJ 2FBHA 3HHHA 2R7DA 5DD8A 2BY0A 4ENKA 1FBQA 2CFXA 2XF7A 1FIPA 3KCCA 2KIFA 4A6EA 3RPUA 2X1DA 2IGOA 3A0BC 3FXJA 5EDNA 4NC6A 2M1BA 1Q1HA 3DEWA 1ETKA 2FEZA 4A6DA 2DFHA 4EVIA 2KPMA 3I59B 4CCLA 5GTHC 1Z3YA 4I09A 3GTLJ 3JREA 2HDWA 4DGWB 1DDNA 1HW5A 1D3YA 1FBSA 1IC8A 3BR5A 2IS1A 1ITYA 1AA7A 3GZNB 4BDZA 2QM3A 4E7HA 1D0YA 1VZ0A 3E0JB 1WJFA 1IJWC 4CCOA 2LF7A 1D8KA 3CQZJ 3PFIA 5IYCJ 5FD6A 3E6BA 1UZCA 2R0QC 2ZO4A 4EM0B 5BNGA 1O57A 3G3ZA 4V2FA 1DGRM 3K70C 3H1CA 3Q5FA 2NVTJ 1KYZA 1X4OA 1EF4A 4HW0A 4L0YB 3R4KA 5LEKA 5EF6A 1LFPA 3BZKA 4UNOA 2DOAA 2JSPA 3CMEI 1BBYA 3LL7A 2DT5A 3RYRA 2MSYA 2R7QA 4HF2A 1N75A 3KP6A 3GFLA 1XTAA 1OJLA 2F5EA 2CW7A 2XGCA 3HOXJ 1MZBA 1YOVB 2QLZA 4HBLA 5IT9Z 2BOLA 4YFNF 4G6QA 3S1MJ 3RIRA 2PI0A 1VQPI 1FYKA 4XK4A 2ZMEB 1FOXA 3CUQA 3G1OA 4BXFA 3S3MA 3M1EA 1O7LA 4UVCA 1FBUA 4HYEA 3S2HJ 2ZBKA 1G3YA 3BG3A 3GBGA 2X1EA 4L9TA 2V9PA 5FKLA 4RB1A 1VTNC 2GIZA 2QQAA 1TLHB 3DU6A 3LSPA 5FLVA 4BQOA 2PG4A 1R7JA 2LF8A 2XGEA 1ZREA 1IDZA 5JI6A 3JRIA 5HLIA 3GZ6A 1CGPA 1TW3A 4EEFG 3S2DJ 1WCMJ 1S29A 1WSUA 5FRNA 3HUGB 4L9VA 2BXZA 4HNTA 2L5QA 4HX7A 3L9FA 2IBDA 2HXOA 3EQLF 3CP8A 3PFYA 3FXMA 3T8RA 5K7HA 2WAFA 4CO8A 2OQRA 4E6KG 3E1SA 4U0YA 1P6RA 2JT1A 2ZSIB 2CJJA 1VI0A 3DP7A 1KU7A 2D1HA 3ZP5A 1ON1A 1R5HA 5JLXA 2OAZA 3H5NA 1A6IA 1ENHA 5J8FA 2W00A 3ZMUA 1MD0A 2JJ7A 4HV5A 5KNLA 5GAEJ 4YFKF 1YJ9I 3I4PA 2K9MA 3P9IA 4O5VA 4KMFA 1T98A 4JX5A 5L3FA 1IXCA 2MC4A 3FIWA 3LOCA 3QYFA 2NXNB 1JE8A 2IS4A 3H9GA 2NNYA 3WTWC 2JRMA 3RZDJ 2VQCA 3Q3SA 4IRIA 4ZYAA 1JGGA 3AAFA 2RQPA 3I59A 1IO2A 1IAWA 1I5ZA 4A12A 2XKOA 1TQMA 3Q0VA 2I10A 3HTSB 1LVAA 5LGNA 1E3PA 1N25A 2WTEA 1TP4A 3BPXA 2VPRA 3IAM2 1IRZA 2DDBA 4RBOA 4AM3A 1XX5A 4JBAA 4I6ZA 4FISA 3TW7A 2E34A 3EDPA 1LEBA 1FEXA 4LGWA 2ZSHB 3BWGA 3DFGA 3HZJA 2MH2A 2VLAA 3SYTA 3HIFA 3HKZA 5LRRA 1S9HA 3CDHA 5CLSA 3U21A 2V6EA 5HS8A 4I98B 3CJRB 3CF5F 4RAFA 3QPTA 2FF4A 3L2WA 4D5FA 4KFCA 1Z67A 3KP7A 3JAMK 5GPCA 3QWLA 4RB0A 4L9NA 2P7VB 3B6CA 3MZHA 5CPRB 3BC8A 2MC3A 3P7NA 2P81A 1B6AA 4M73A 4CGZA 5GP9A 2C6YA 3HOWJ 1OCTC 3M4OJ 1ZARA 3BR0A 3U1KA 5JVGF 2ZMEA 4I7HA 3JRGA 4LG0A 3CMAI 4G6TB 2VB6A 4OMYA 4ASNA 4U88A 2LY9A 2STWA 4UB8C 2QWWA 3IH2A 3V4GA 2KRCA 2A68F 2ID6A 1IW7F 2NOGA 2LKPA 4IO9F 2H8WA 1ETXA 5LRSA 1T0FA 2FMYA 1QU3A 3TKYA 5F27A 3OYCA 3EUHA 3HUGA 5FD5A 1YITI 1AKHB 1WJCA 2ADUA 2LNBA 4HEA2 2A6EF 2NVUB 3HBLA 1P4AA 1HSTA 2DODA 4CZCA 4XRSA 1PUFB 4AVPA 2Q2EB 4WXCA 2BW3B 9ANTA 2QF7A 1BW6A 3AFHA 3Q9VA 5HLHA 1IXRC 3OYEA 2EA4A 2KRHA 4Q4ZF 4BXXJ 4IL6C 4DW6A 5JHFA 2IAIA 1GXPA 2A6TA 2MLKA 4E7JA 4AYBN 5B66C 3F8MA 1BA5A 3BZ6A 1BR4A 2CH0A 2EBIA 2HQRA 1D1BA 2OF7A 2XSJC 3OYFA 2MYSA 1RESA 3FMRA 2IP2A 3DBLB 3J7YJ 1MMAA 4HLYA 2KRFA 2WAQN 2XB0X 3S17J 4OIRF 2GOXB 3HSRA 3GFMA 2XRLA 2XRNA 2GIVA 2L7ZA 4LOCA 4EJOA 2X1CA 2QSHX 1X1CA 1YW8A 4A5MA 3WGIA 3GFJA 2OV7A 3M8EA 5IP9J 2DU9A 4M3GA 2WB1A 1HCRA 3UNGC 1JJ8C 3OSFA 4C3JJ 3QU6A 1LDKB 3S93A 3SDGA 3I55I 1MMSA 3A1YA 1TBXA 1SFOJ 3PO2J 3I3LA 1SD6A 3K0LA 1W7PD 4MGRA 3GTPJ 3D5LA 3K2ZA 3ISPA 5DS9A 1C0WA 5DEQA 2F5DA 2KQRA 2XV4S 1UG0A 4BACA 2K86A 3RPQA 5C44J 1K83J 3DLAA 5DCMB 2VKDA 5D6EA 2JUCA 4FHTA 1SD7A 4AIKA 2D2WA 3RPUD 1M1EB 2W57A 3PSIA 3HOYJ 1TNTA 5IT9K 1F4KA 3BTCA 3MFKA 1GLNA 4YRVA 1XSXA 3QRFF 2L4MA 5E1XA 3RKQA 2ME0A 4CCKA 1A35A 1PP8F 3BG6A 2R7XA 2YX4A 3K10A 1BR1A 1HOMA 2HS5A 2LTPA 2K9SA 3G1MA 1J2XA 4ZH4F 2P5LC 2QSFX 3HPHA 1X3UA 5D5XB 1SFEA 1D1CA 5KHDA 5FKMA 2Y0MA 4CSWA 4D5CA 5D4RA 2QVOA 3VYSB
chains in the Genus database with same CATH topology
2MD5A 1KGSA 2V1DA 5TJJA 4YIFA 4ENNA 2YSRA 2DTRA 4M6YA 2ELHA 2HOEA 4LLLA 1J0RA 4HQMA 2DFIA 2HZTA 2VT2A 2FBIA 1PDNC 2K4BA 2COMA 1JHHA 3ABUA 3D0SA 2HEOA 2EFNA 4YIIA 2YU3A 3DXJF 2CQKA 2Q2EA 4L18B 4O6JA 2ZFWA 4IRGA 2PFBA 1GXQA 3M9AA 3R0JA 2Z33A 1MJ9A 3SZTA 3TDZC 5CVIA 2A6HF 2HFHA 5HS7A 3DKWA 2D1VA 2GXGA 4Y17A 3WTVC 1HSJA 4LK1F 3ML6A 3ZMVA 3M8FA 4L5IA 3LAJA 1UFMA 3CLOA 2QQ9A 5ICGA 2P5KA 1JGSA 2XVCA 4WWCA 1HKQA 1AWCA 4IJAA 3DPLC 3J81Z 4OU0A 5L3GA 5DCMA 5JR3A 1FNNA 5LLQA 3COAC 2YR2A 1BI0A 2ZCWA 1XMKA 2JPBA 4XLPF 4XLNF 4M6XA 5DCFA 4WF2A 1FWZA 2IA2A 1UB9A 3EYYA 2STTA 3KE2A 2LDUA 1LNWA 4IF4A 3E5QA 3H92A 4G8XA 2W25A 1K79A 2BGCA 2EFPA 2IJLA 4NB5A 5FB2A 1LB2A 1XCBA 4Q48A 2A07F 1EH7A 2L54A 5AIQA 3HTUA 4BYYA 3JTGA 1OYIA 3V7CA 2AS5F 3GYHX 3V7RA 5EEGA 2V1XA 3DV8A 1U5TB 2GA1A 3SFZA 4UV8A 1SFUA 2MH9A 3GLXA 4PGGA 2KIUA 5JVTA 2DK5A 1IRFA 5LHHA 3GO5A 1IF1A 2V79A 5A2QZ 4EGZA 2RVCA 3ECOA 4L5JA 4JQFA 3U9GA 2HYGD 2IA1A 1XDUA 4AD9A 1ZHFA 1EH8A 3ZMSA 3N4MA 3F8NA 2QBYB 3I64A 3E6CC 3K69A 3JAMZ 2WV0A 4ZZDA 3JSOA 1YTYA 2PMUA 3ZN1A 1MJBA 4KDPA 1WQ2A 1BI1A 4WXHA 2M45A 2Y75A 2EFWA 3PQKA 1BI2A 1ZH5A 2QYOA 1QO0D 2NAZA 2PEXA 1YFHA 3WTXC 3OOPA 4R8HA 3NRVA 1BJAA 3U2RA 2W24A 5LEJA 1EV7A 3ZN0A 2K7LA 2EFOA 5DUIA 2IA0A 4RGSA 3FMSA 4UVAA 2Z5UA 1SAXA 2GA2A 1OKRA 5FGMA 4WXDA 4AWXB 2LSOA 3BJOA 2HKOA 2L3DA 3CO7C 2XAQA 2NYXA 2FNPA 4KICA 3V8LA 4I0BA 1Y0UA 2FNAA 2VBXA 4PZJA 2BEOA 4DNCA 1I1GA 4GXOA 3KZYA 3O6BB 1R58A 1KU3A 3WGHA 2QQBA 4CYDA 1U5TA 2XAJA 3HSFA 4IHSA 4KN4X 1ZYRF 1W4MA 3GVAA 4N0BA 1FYMA 3M7GA 2GQQA 2R3SA 2K27A 1MDMB 4ETSA 3CJNA 1RIOH 1IUYA 4P55A 4OINF 5E1WA 2DPDA 2DAOA 4BQAA 1P4XA 3QP5A 2XGXA 2Y48A 1XGOA 4G7HF 3LA2A 1S7AA 2QBYA 4LG0B 1UHMA 4GCVA 1WRJA 1NHAA 5D5WB 4EJVA 3J81K 2H6BA 2ZNZA 4YG2F 1XD7A 4MEXF 2Z99A 2OZ6A 1ZG1A 4ZYGA 5FFXA 4B8XA 2F2EA 2RGVA 2L02A 3HYIA 1LQ1A 1JHFA 3KP5A 3F8FA 3FMQA 5ERIA 2EFQA 5D6FA 1Z91A 3QPHA 1FPQA 3KEQA 1FOKA 3E97A 2E7WA 4MHGA 3WTTC 1ULYA 1R23A 3IL2A 4RAYA 5JFRA 2EWNA 1QPMA 5ILVA 3KP3A 1DP7P 3BPVA 3CUQC 4EJTA 2ISYA 4WX9A 1I1SA 2IW5A 2RV8A 3ZMDA 2VBZA 1FZPB 5K5RA 4HF0A 3QU3A 3T1BA 2EV6A 5J6XA 4G94A 1ZN2A 5DD4A 3WGGA 4A2UA 5D5UB 2UXNA 2XUBA 2OU2A 2YX7A 3E5XA 1PUEE 3FWEA 5A2QK 1ZGJA 2V9VA 1RNLA 1ZRCA 1IN7A 3K9TA 1XGNA 1MDMA 1JXSA 1BN5A 2EA2A 3Q9SA 3HRSA 1FP2A 1K6OA 2H09A 1P4WA 4RAZA 2CSOA 1FYLA 2ESHA 3E6DA 4U7BA 3GF2A 5HS9A 1AOYA 4EJWA 1IN5A 2VONA 1G4DA 2MBFA 5CYVA 5E20A 4MEYF 1ONVA 2M30A 5F64A 4KIFA 4N9HA 4RS8A 4HLXA 4YFXF 4RGXA 5L3EA 2DI3A 2JTVA 2VOOA 4Y13A 2UZKA 4BAYA 1U78A 1YG2A 3B73A 2NNNA 4M9SA 2VBYA 1J5YA 3RJPA 2L01A 3HRMA 3ECHA 4KA4A 4UUVA 3B02A 3GXOA 4BHCA 1BIAA 1OYYA 1T6SA 1R22A 3HSEA 4KUMA 4EJUA 1G6NA 4E70A 3MCZA 1SD5A 1K7AA 1YQAA 1OMIA 4R1HA 4UV9A 1P92A 5E17F 2DW4A 5DV5A 1I27A 1HQCA 2VODA 2H94A 4PGHA 3FM5A 4XRFA 4H0EA 1YYVA 2CYYA 3CTAA 4CZZA 1G3TA 4A0ZA 2EB7A 2CWEA 1F9NA 2JRTA 2W84A 5BQTA 3IKVA 1DUXC 2HDCA 1BOAA 5LHIA 4P96A 2PBIA 1HBXG 5BS6A 3MAJA 1SMTA 1STZA 2XASA 5E1ZB 3I54A 1K78B 4NQWA 4HAMA 5HOOA 2FU4A 4IHTA 3MEXA 1REPC 3FX3A 3TDUC 4HDUA 3QOPA 3J80Z 1TNSA 3EYIA 1ZGAA 3WE3A 4G7OF 3MZYA 5D8LB 1XDSA 4QLCU 3BJAA 2XROA 3QP6A 2BBYA 2RDPA 4U7DA 3JSPA 3DPTA 4CICA 3HOTA 3WE2A 2BYVE 2R7FA 4HDVA 4MTDA 4KIBA 2OZUA 3KFWX 4WK8F 2HKXA 4RB3C 4IVNA 1W5SA 4PCQA 1U8RA 1I6XA 4G7ZF 1TTYA 3BOQA 4RB2C 1J9IA 3ROUA 1IN8A 4XSXF 2FE3A 4BXUA 3RYPA 4P9UA 4L0ZB 5E18F 1B9NA 3SXYA 4S04A 2OA4A 4U0VA 1LEAA 2FBKA 3WU0A 1Z7UA 3J7AO 3DEUA 1V3FA 2WC2A 2VE9A 3WTZA 1Z1DA 5H20A 1H0MA 2BV6A 2HGCA 2O0YA 3FXQA 2EK5A 3ZMTA 3GX4X 3ZPLA 5LGUA 2K4JA 1ZLKA 3L09A 4BHBA 1QZZA 2V1UA 3IWFA 2FSWA 3L00A 2G9WA 3WU1B 1R5GA 3ULQB 3LWFA 1IXSB 3I0TA 4EQQA 3SZPA 4KIGA 2A69F 4ENMA 3IRRA 1K78A 1DPUA 5JHUA 1E2XA 3ABTA 1L0OC 2VT3A 1R1VA 4A0YA 2MA3A 5HDNA 2P7CB 5IT3A 4OMZA 3FM3A 3GUDA 4IXAA 1YS7A 2KJBA 1B9MA 1HW1A 4EV0A 1BI3A 5KVRA 4DQ2A 1CF7B 1OYWA 3JTHA 2DQRA 2VC1A 5E8IA 3IRQA 3SQNA 2HTSA 1QBJA 3TOAA 1U2WA 1R00A 4HZFA 2QZ8A 3NEUA 1QGPA 3IWZA 1P2FA 3TO9A 4FX0A 3T5XA 1KQ9A 3ZQ7A 4F7ZA 1B4AA 1WI9A 3KP2A 1R1UA 3C18A 3C1DA 2O03A 2CW0F 5KK1A 1ZLJA 3V8JA 5K1YA 1U3EM 4MNUA 4LB5A 2UXXA 2HTJA 2E1CA 3VEPA 2DO7A 5E8GA 4K2EA 4TV7A 5H6RA 3LSTA 4ESFA 4G9YA 4GGGA 1MGTA 1HW2A 1IN6A 2ZNYA 5BPDA 3W6JB 5CVUA 4I01A 4KN7X 2XHKA 2UWMA 5L3BA 4CDGA 3IKTA 3LQRA 4ESJA 3I58A 3J80K 3F6VA 4R79A 5FFZA 2AXLA 1LDJA 3KEOA 4HX8A 4KYWA 5F6FA 3BY6A 3V8KA 2DLLA 1SFXA 4L9JA 2ZXJA 3WTUC 4UXNA 5BPIA 5BMZA 1RUOA 2J5OA 3H3UA 1IN4A 3C3WA 1S6LA 4LMYA 1CF7A 1F1ZA 2KIMA 3WTYC 2IPQX 1USSA 2KKOA 2FXAA 3O3KA 3WODF 4IRHA 1XB4A 5HLGA 1UHWA 2QUFA 3FZVA 2P8TA 2DK8A 4OOIA 3N97A 1J7KA 3GEZA 4BH9A 1FLIA 1WKMA 4CXFA 2G7UA 1XCVA 1S7OA 2XAHA 5ED4A 2ISZA 2VC0A 1O7FA 1EH6A 4EGYA 1TQPA 4A0XA 5HDGA 1J59A 2VXZA 5DYMA 3RKWA 2DQLA 5CVRA 3KETA 2PJPA 4EM2A 4ENJA 4XSZF 1RUNA 4Q5SF 1TQIA 3GWZA 2EV5A 2FQ3A 4P9FA 2RNJA 4BHPA 1U5TC 3IC7A 2FOKA 4LB6B 1ODDA 2M5WA 5EEHA 2PQ8A 1S8NA 3F6OA 3GFIA 2V6CA 4S05A 2OD5A 1QQIA 4MTEA 2GZWA 4HX4A 1R1TA 1XSVA 1IRGA 3F72A 2HQNA 2K02A 1XMAA 1GVJA 3QAHA 3K1MA 2CG4A 4LD5A 5F1RA 6PAXA 2XKPA 4KNYA 2YPRA 3BJ6A 1SD4A 1HXDA 3R60A 1L3LA 2VOPA 1O3TA 4FT8A 2JZYA 2JSCA 3EETA 5K5OA 3S2WA 2JPCA 4I02A 1ZRFA 3O2PE 4LFUA 4ZZLA 3KZZA 2W85A 4Z2YA 3BP8A 3W6KB 1YIOA 5H6QA 4GO1A 2E7XA 5DDGA 3C7JA 4HV6A 4Q47A 2X0LA 3E5UA 4BNCA 1ZAOA 1ZG5A 4HQEA 3F8BA 4AIHA 2O8XA 4PDKA 5FLXK 1KQ8A 2Z3YA 2NS0A 3MQ0A 1FY7A 5HDKA 4NHJA 2L4AA 1Z9CA 3WTSC 3P9KA 1R36A 1QZYA 3NQOA 1LJ9A 1D5VA 3TOBA 2G7HA 2FA5A 1KA8A 4XBFA 3LFKA 2PLYA 2CO5A 4EM1A 1YO5C 3HHGA 3R6SA 1MKMA 1U6GA 2RC4A 1YLFA 2F5FA 1ZG3A 4D0PA 1GHCA 5ILUA 4ZYDA 3REOA 2IVMA 2O61A 1Z6RA 2HYFA 3ERED 5TRDA 1FP1D 3U1DA 2RN7A 2VBWA 2A3SA 1XGMA 2Q0OA 4QWQA 3K1PA 5D4SA 4WCGA 2EV0A 2D45A 1SMYF 2NRAC 2GXBA 2Q8KA 3KLNA 1H9GA 3L7WA 2ZJ2A 1O3QA 3MWMA 3SHFA 4AIJA 2A5YB 1B59A 2MLGA 3RDIA 5CVVA 4CHUA 3LA7A 2IRFG 1KYWA 2PMHA 3BDDA 1T2KA 2CGPA 2O3FA 5HVQC 2M87A 5AONA 1XSDA 2GWRA 4I0AA 3F8CA 1MJAA 2TDXA 5ICEA 1FX7A 4M9XA 3DQVC 3E6MA 5CJ9A 2HR3A 5L3DA 3VOEA 4LJZF 4N9IA 1H9TA 3JW4A 1J75A 3RKYA 1DPRA 5ICFA 4GYIA 2F5CA 1V4RA 4LLGF 1G3SA 3F23A 2XAGA 2P6SA 2OBPA 3I53A 1UCRA 4KMUX 3FXUA 3LAPA 4HOBA 4UHTA 4GYGA 2ZKZA 3GW2A 3F3XA 1TW2A 2IT0A 1USTA 5ILSA 2PN6A 1E17A 2O6GE 2B0LA 4HF1A 4A5NA 5L3CA 3ELKA 2ACJA 4MQVA 3E3VA 1FT9A 4UVBA 1Z6TA 4I2OA 3R0AA 5LGTA 3CO6C 1QNTA 1BM9A 4RGRA 4M9ZA 5K5QA 1A04A 1PP7U 3RKXA 5LHGA 3T8TA 4MQ9F 2X4HA 1YS6A 1KQ0A 2J5PA 2VE8A 4LLNA 2HWVA 3V7SA 3TO7A 2P5VA 3VFZA 2VN2A 5D5VB 1FSEA 3TO6A 4OIQF 3KP4A 3VODA 3ZMZA 2KJCA 2RKHA 2ETHA 2XIGA 3T0YA 2GAUA 3DF8A 4HA8A 2DPUA 1YW7A 3FHZA 2H6CA 3HRTA 4OIPF 3K1NA 1W7PB 2ESNA 3GZ5A 2P6TA 4Y15A 3F21A 3PQJA 5D8KB 2H27A 2DBBA 2BE5F 1WWXA 1ZRDA 2A61A 3IHUA 1O3SA 2Z9OA 2FRHA 4M71A 1OR7A 3R61A 3VB2A 1O3RA 1RZ4A 2FMLA 1T39A 3LQQA 4JK1X 1Z05A 3CUOA 3TGNA 1XN7A 4ZYHA 3OV8A 1HKTA 4M74A 4EMSA 3HRUA 3HOSA 4KT5C 3FF5A 4ON0A 3RTRA 3H3ZA 3I5UA 1OPCA 4ESBA 4OIOF 2E1NA 5AIPA 3L2CA 2P4WA 1ON2A 5LBQA 5FLXZ 4M72A 5CVJA 1T38A 2XAFA 3TQNA 4ZYEA 4FX4A 1FC3A 4IPAA 1FSHA 1F5TA 1KU2A 3RI4A 2OQGA 3CUQB 3FXRA 5FO5A 1G3WA 1HKSA 4B09A 3BROA 2QENA 1RI7A 5DUKA 5BOXA 1BC7C 4RGUA 4O3MA 1XGSA 3KLOA 2M8EA 1BC8C 2EJRA 5ICCA 1W5TA 4G6DA 1KU9A 3I71A 4LK0F 1YW9A 5J8CA 3P9CA 1B1BA 4U0WA 4P5OA 1S3JA 2WWYA 1D8JA 1W7PA 1LDDA 3WG9A 3G73A 1BIBA 3F22A 1IZ1A 3LA3A 2FBHA 3HHHA 2R7DA 5DD8A 4ENKA 1FBQA 2CFXA 3KCCA 2KIFA 4A6EA 3RPUA 2M1BA 1Q1HA 2FEZA 4A6DA 4EVIA 3I59B 4I09A 1DDNA 1HW5A 1D3YA 1FBSA 2QM3A 2LF7A 1D8KA 3PFIA 5FD6A 3E6BA 2ZO4A 4EM0B 1O57A 3G3ZA 3Q5FA 1KYZA 4HW0A 4L0YB 3R4KA 5LEKA 4UNOA 1BBYA 2DT5A 3RYRA 4HF2A 3KP6A 3GFLA 2F5EA 1MZBA 2QLZA 4HBLA 5IT9Z 4YFNF 4G6QA 3RIRA 2PI0A 1FYKA 2ZMEB 3CUQA 3M1EA 1O7LA 4UVCA 1FBUA 4HYEA 2ZBKA 1G3YA 4L9TA 4RB1A 1VTNC 2QQAA 1TLHB 2PG4A 1R7JA 2LF8A 1ZREA 5JI6A 5HLIA 3GZ6A 1CGPA 1TW3A 1S29A 1WSUA 4L9VA 4HX7A 3L9FA 3EQLF 3T8RA 4CO8A 2OQRA 4U0YA 1P6RA 2JT1A 3DP7A 1KU7A 3ZP5A 2D1HA 1ON1A 1R5HA 2OAZA 5J8FA 3ZMUA 1MD0A 4HV5A 4YFKF 3I4PA 3P9IA 4O5VA 4KMFA 1T98A 5L3FA 1IXCA 1JE8A 2NNYA 3WTWC 4IRIA 3AAFA 2RQPA 3I59A 1IAWA 1I5ZA 4A12A 2XKOA 1TQMA 3HTSB 1LVAA 5LGNA 2WTEA 3BPXA 4JBAA 1LEBA 3EDPA 4LGWA 3BWGA 3DFGA 2MH2A 3HIFA 5LRRA 3CDHA 5CLSA 5HS8A 4I98B 3QPTA 2FF4A 4KFCA 3KP7A 3JAMK 4RB0A 4L9NA 2P7VB 3MZHA 2MC3A 3P7NA 1B6AA 4M73A 4CGZA 2C6YA 1ZARA 2ZMEA 4I7HA 4LG0A 4OMYA 4ASNA 4U88A 2STWA 2QWWA 3V4GA 2A68F 1IW7F 2LKPA 5LRSA 1T0FA 2FMYA 3TKYA 3EUHA 3HUGA 5FD5A 2ADUA 2LNBA 2A6EF 1P4AA 1HSTA 4AVPA 4WXCA 3Q9VA 5HLHA 1IXRC 2EA4A 4Q4ZF 1GXPA 2MLKA 3F8MA 3BZ6A 2HQRA 3FMRA 2IP2A 4HLYA 2KRFA 4OIRF 3HSRA 3GFMA 2XRNA 2GIVA 4EJOA 1YW8A 4A5MA 3WGIA 3GFJA 3M8EA 2DU9A 3QU6A 1LDKB 1TBXA 1SD6A 3K0LA 1W7PD 4MGRA 3D5LA 3K2ZA 3ISPA 1C0WA 5DEQA 2F5DA 2XV4S 2K86A 3RPQA 5DCMB 5D6EA 4FHTA 1SD7A 4AIKA 2D2WA 2W57A 1TNTA 5IT9K 1F4KA 3MFKA 1XSXA 3QRFF 2L4MA 5E1XA 1PP8F 2YX4A 2HS5A 1J2XA 4ZH4F 2P5LC 1X3UA 5D5XB 1SFEA 2Y0MA 5D4RA 2QVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MD5 A;  1KGS A;  2V1D A;  5TJJ A;  4YIF A;  4ENN A;  2YSR A;  2DTR A;  4M6Y A;  2ELH A;  2HOE A;  4LLL A;  1J0R A;  4HQM A;  2DFI A;  2HZT A;  2VT2 A;  2FBI A;  1PDN C;  2K4B A;  2COM A;  1JHH A;  3ABU A;  3D0S A;  2HEO A;  2EFN A;  4YII A;  2YU3 A;  3DXJ F;  2CQK A;  2Q2E A;  4L18 B;  4O6J A;  2ZFW A;  4IRG A;  2PFB A;  1GXQ A;  3M9A A;  3R0J A;  2Z33 A;  1MJ9 A;  3SZT A;  3TDZ C;  5CVI A;  2A6H F;  2HFH A;  5HS7 A;  3DKW A;  2D1V A;  2GXG A;  4Y17 A;  3WTV C;  1HSJ A;  4LK1 F;  3ML6 A;  3ZMV A;  3M8F A;  4L5I A;  3LAJ A;  1UFM A;  3CLO A;  2QQ9 A;  5ICG A;  2P5K A;  1JGS A;  2XVC A;  4WWC A;  1HKQ A;  1AWC A;  4IJA A;  3DPL C;  3J81 Z;  4OU0 A;  5L3G A;  5DCM A;  5JR3 A;  1FNN A;  5LLQ A;  3COA C;  2YR2 A;  1BI0 A;  2ZCW A;  1XMK A;  2JPB A;  4XLP F;  4XLN F;  4M6X A;  5DCF A;  4WF2 A;  1FWZ A;  2IA2 A;  1UB9 A;  3EYY A;  2STT A;  3KE2 A;  2LDU A;  1LNW A;  4IF4 A;  3E5Q A;  3H92 A;  4G8X A;  2W25 A;  1K79 A;  2BGC A;  2EFP A;  2IJL A;  4NB5 A;  5FB2 A;  1LB2 A;  1XCB A;  4Q48 A;  2A07 F;  1EH7 A;  2L54 A;  5AIQ A;  3HTU A;  4BYY A;  3JTG A;  1OYI A;  3V7C A;  2AS5 F;  3GYH X;  3V7R A;  5EEG A;  2V1X A;  3DV8 A;  1U5T B;  2GA1 A;  3SFZ A;  4UV8 A;  1SFU A;  2MH9 A;  3GLX A;  4PGG A;  2KIU A;  5JVT A;  2DK5 A;  1IRF A;  5LHH A;  3GO5 A;  1IF1 A;  2V79 A;  5A2Q Z;  4EGZ A;  2RVC A;  3ECO A;  4L5J A;  4JQF A;  3U9G A;  2HYG D;  2IA1 A;  1XDU A;  4AD9 A;  1ZHF A;  1EH8 A;  3ZMS A;  3N4M A;  3F8N A;  2QBY B;  3I64 A;  3E6C C;  3K69 A;  3JAM Z;  2WV0 A;  4ZZD A;  3JSO A;  1YTY A;  2PMU A;  3ZN1 A;  1MJB A;  4KDP A;  1WQ2 A;  1BI1 A;  4WXH A;  2M45 A;  2Y75 A;  2EFW A;  3PQK A;  1BI2 A;  1ZH5 A;  2QYO A;  1QO0 D;  2NAZ A;  2PEX A;  1YFH A;  3WTX C;  3OOP A;  4R8H A;  3NRV A;  1BJA A;  3U2R A;  2W24 A;  5LEJ A;  1EV7 A;  3ZN0 A;  2K7L A;  2EFO A;  5DUI A;  2IA0 A;  4RGS A;  3FMS A;  4UVA A;  2Z5U A;  1SAX A;  2GA2 A;  1OKR A;  5FGM A;  4WXD A;  4AWX B;  2LSO A;  3BJO A;  2HKO A;  2L3D A;  3CO7 C;  2XAQ A;  2NYX A;  2FNP A;  4KIC A;  3V8L A;  4I0B A;  1Y0U A;  2FNA A;  2VBX A;  4PZJ A;  2BEO A;  4DNC A;  1I1G A;  4GXO A;  3KZY A;  3O6B B;  1R58 A;  1KU3 A;  3WGH A;  2QQB A;  4CYD A;  1U5T A;  2XAJ A;  3HSF A;  4IHS A;  4KN4 X;  1ZYR F;  1W4M A;  3GVA A;  4N0B A;  1FYM A;  3M7G A;  2GQQ A;  2R3S A;  2K27 A;  1MDM B;  4ETS A;  3CJN A;  1RIO H;  1IUY A;  4P55 A;  4OIN F;  5E1W A;  2DPD A;  2DAO A;  4BQA A;  1P4X A;  3QP5 A;  2XGX A;  2Y48 A;  1XGO A;  4G7H F;  3LA2 A;  1S7A A;  2QBY A;  4LG0 B;  1UHM A;  4GCV A;  1WRJ A;  1NHA A;  5D5W B;  4EJV A;  3J81 K;  2H6B A;  2ZNZ A;  4YG2 F;  1XD7 A;  4MEX F;  2Z99 A;  2OZ6 A;  1ZG1 A;  4ZYG A;  5FFX A;  4B8X A;  2F2E A;  2RGV A;  2L02 A;  3HYI A;  1LQ1 A;  1JHF A;  3KP5 A;  3F8F A;  3FMQ A;  5ERI A;  2EFQ A;  5D6F A;  1Z91 A;  3QPH A;  1FPQ A;  3KEQ A;  1FOK A;  3E97 A;  2E7W A;  4MHG A;  3WTT C;  1ULY A;  1R23 A;  3IL2 A;  4RAY A;  5JFR A;  2EWN A;  1QPM A;  5ILV A;  3KP3 A;  1DP7 P;  3BPV A;  3CUQ C;  4EJT A;  2ISY A;  4WX9 A;  1I1S A;  2IW5 A;  2RV8 A;  3ZMD A;  2VBZ A;  1FZP B;  5K5R A;  4HF0 A;  3QU3 A;  3T1B A;  2EV6 A;  5J6X A;  4G94 A;  1ZN2 A;  5DD4 A;  3WGG A;  4A2U A;  5D5U B;  2UXN A;  2XUB A;  2OU2 A;  2YX7 A;  3E5X A;  1PUE E;  3FWE A;  5A2Q K;  1ZGJ A;  2V9V A;  1RNL A;  1ZRC A;  1IN7 A;  3K9T A;  1XGN A;  1MDM A;  1JXS A;  1BN5 A;  2EA2 A;  3Q9S A;  3HRS A;  1FP2 A;  1K6O A;  2H09 A;  1P4W A;  4RAZ A;  2CSO A;  1FYL A;  2ESH A;  3E6D A;  4U7B A;  3GF2 A;  5HS9 A;  1AOY A;  4EJW A;  1IN5 A;  2VON A;  1G4D A;  2MBF A;  5CYV A;  5E20 A;  4MEY F;  1ONV A;  2M30 A;  5F64 A;  4KIF A;  4N9H A;  4RS8 A;  4HLX A;  4YFX F;  4RGX A;  5L3E A;  2DI3 A;  2JTV A;  2VOO A;  4Y13 A;  2UZK A;  4BAY A;  1U78 A;  1YG2 A;  3B73 A;  2NNN A;  4M9S A;  2VBY A;  1J5Y A;  3RJP A;  2L01 A;  3HRM A;  3ECH A;  4KA4 A;  4UUV A;  3B02 A;  3GXO A;  4BHC A;  1BIA A;  1OYY A;  1T6S A;  1R22 A;  3HSE A;  4KUM A;  4EJU A;  1G6N A;  4E70 A;  3MCZ A;  1SD5 A;  1K7A A;  1YQA A;  1OMI A;  4R1H A;  4UV9 A;  1P92 A;  5E17 F;  2DW4 A;  5DV5 A;  1I27 A;  1HQC A;  2VOD A;  2H94 A;  4PGH A;  3FM5 A;  4XRF A;  4H0E A;  1YYV A;  2CYY A;  3CTA A;  4CZZ A;  1G3T A;  4A0Z A;  2EB7 A;  2CWE A;  1F9N A;  2JRT A;  2W84 A;  5BQT A;  3IKV A;  1DUX C;  2HDC A;  1BOA A;  5LHI A;  4P96 A;  2PBI A;  1HBX G;  5BS6 A;  3MAJ A;  1SMT A;  1STZ A;  2XAS A;  5E1Z B;  3I54 A;  1K78 B;  4NQW A;  4HAM A;  5HOO A;  2FU4 A;  4IHT A;  3MEX A;  1REP C;  3FX3 A;  3TDU C;  4HDU A;  3QOP A;  3J80 Z;  1TNS A;  3EYI A;  1ZGA A;  3WE3 A;  4G7O F;  3MZY A;  5D8L B;  1XDS A;  4QLC U;  3BJA A;  2XRO A;  3QP6 A;  2BBY A;  2RDP A;  4U7D A;  3JSP A;  3DPT A;  4CIC A;  3HOT A;  3WE2 A;  2BYV E;  2R7F A;  4HDV A;  4MTD A;  4KIB A;  2OZU A;  3KFW X;  4WK8 F;  2HKX A;  4RB3 C;  4IVN A;  1W5S A;  4PCQ A;  1U8R A;  1I6X A;  4G7Z F;  1TTY A;  3BOQ A;  4RB2 C;  1J9I A;  3ROU A;  1IN8 A;  4XSX F;  2FE3 A;  4BXU A;  3RYP A;  4P9U A;  4L0Z B;  5E18 F;  1B9N A;  3SXY A;  4S04 A;  2OA4 A;  4U0V A;  1LEA A;  2FBK A;  3WU0 A;  1Z7U A;  3J7A O;  3DEU A;  1V3F A;  2WC2 A;  2VE9 A;  3WTZ A;  1Z1D A;  5H20 A;  1H0M A;  2BV6 A;  2HGC A;  2O0Y A;  3FXQ A;  2EK5 A;  3ZMT A;  3GX4 X;  3ZPL A;  5LGU A;  2K4J A;  1ZLK A;  3L09 A;  4BHB A;  1QZZ A;  2V1U A;  3IWF A;  2FSW A;  3L00 A;  2G9W A;  3WU1 B;  1R5G A;  3ULQ B;  3LWF A;  1IXS B;  3I0T A;  4EQQ A;  3SZP A;  4KIG A;  2A69 F;  4ENM A;  3IRR A;  1K78 A;  1DPU A;  5JHU A;  1E2X A;  3ABT A;  1L0O C;  2VT3 A;  1R1V A;  4A0Y A;  2MA3 A;  5HDN A;  2P7C B;  5IT3 A;  4OMZ A;  3FM3 A;  3GUD A;  4IXA A;  1YS7 A;  2KJB A;  1B9M A;  1HW1 A;  4EV0 A;  1BI3 A;  5KVR A;  4DQ2 A;  1CF7 B;  1OYW A;  3JTH A;  2DQR A;  2VC1 A;  5E8I A;  3IRQ A;  3SQN A;  2HTS A;  1QBJ A;  3TOA A;  1U2W A;  1R00 A;  4HZF A;  2QZ8 A;  3NEU A;  1QGP A;  3IWZ A;  1P2F A;  3TO9 A;  4FX0 A;  3T5X A;  1KQ9 A;  3ZQ7 A;  4F7Z A;  1B4A A;  1WI9 A;  3KP2 A;  1R1U A;  3C18 A;  3C1D A;  2O03 A;  2CW0 F;  5KK1 A;  1ZLJ A;  3V8J A;  5K1Y A;  1U3E M;  4MNU A;  4LB5 A;  2UXX A;  2HTJ A;  2E1C A;  3VEP A;  2DO7 A;  5E8G A;  4K2E A;  4TV7 A;  5H6R A;  3LST A;  4ESF A;  4G9Y A;  4GGG A;  1MGT A;  1HW2 A;  1IN6 A;  2ZNY A;  5BPD A;  3W6J B;  5CVU A;  4I01 A;  4KN7 X;  2XHK A;  2UWM A;  5L3B A;  4CDG A;  3IKT A;  3LQR A;  4ESJ A;  3I58 A;  3J80 K;  3F6V A;  4R79 A;  5FFZ A;  2AXL A;  1LDJ A;  3KEO A;  4HX8 A;  4KYW A;  5F6F A;  3BY6 A;  3V8K A;  2DLL A;  1SFX A;  4L9J A;  2ZXJ A;  3WTU C;  4UXN A;  5BPI A;  5BMZ A;  1RUO A;  2J5O A;  3H3U A;  1IN4 A;  3C3W A;  1S6L A;  4LMY A;  1CF7 A;  1F1Z A;  2KIM A;  3WTY C;  2IPQ X;  1USS A;  2KKO A;  2FXA A;  3O3K A;  3WOD F;  4IRH A;  1XB4 A;  5HLG A;  1UHW A;  2QUF A;  3FZV A;  2P8T A;  2DK8 A;  4OOI A;  3N97 A;  1J7K A;  3GEZ A;  4BH9 A;  1FLI A;  1WKM A;  4CXF A;  2G7U A;  1XCV A;  1S7O A;  2XAH A;  5ED4 A;  2ISZ A;  2VC0 A;  1O7F A;  1EH6 A;  4EGY A;  1TQP A;  4A0X A;  5HDG A;  1J59 A;  2VXZ A;  5DYM A;  3RKW A;  2DQL A;  5CVR A;  3KET A;  2PJP A;  4EM2 A;  4ENJ A;  4XSZ F;  1RUN A;  4Q5S F;  1TQI A;  3GWZ A;  2EV5 A;  2FQ3 A;  4P9F A;  2RNJ A;  4BHP A;  1U5T C;  3IC7 A;  2FOK A;  4LB6 B;  1ODD A;  2M5W A;  5EEH A;  2PQ8 A;  1S8N A;  3F6O A;  3GFI A;  2V6C A;  4S05 A;  2OD5 A;  1QQI A;  4MTE A;  2GZW A;  4HX4 A;  1R1T A;  1XSV A;  1IRG A;  3F72 A;  2HQN A;  2K02 A;  1XMA A;  1GVJ A;  3QAH A;  3K1M A;  2CG4 A;  4LD5 A;  5F1R A;  6PAX A;  2XKP A;  4KNY A;  2YPR A;  3BJ6 A;  1SD4 A;  1HXD A;  3R60 A;  1L3L A;  2VOP A;  1O3T A;  4FT8 A;  2JZY A;  2JSC A;  3EET A;  5K5O A;  3S2W A;  2JPC A;  4I02 A;  1ZRF A;  3O2P E;  4LFU A;  4ZZL A;  3KZZ A;  2W85 A;  4Z2Y A;  3BP8 A;  3W6K B;  1YIO A;  5H6Q A;  4GO1 A;  2E7X A;  5DDG A;  3C7J A;  4HV6 A;  4Q47 A;  2X0L A;  3E5U A;  4BNC A;  1ZAO A;  1ZG5 A;  4HQE A;  3F8B A;  4AIH A;  2O8X A;  4PDK A;  5FLX K;  1KQ8 A;  2Z3Y A;  2NS0 A;  3MQ0 A;  1FY7 A;  5HDK A;  4NHJ A;  2L4A A;  1Z9C A;  3WTS C;  3P9K A;  1R36 A;  1QZY A;  3NQO A;  1LJ9 A;  1D5V A;  3TOB A;  2G7H A;  2FA5 A;  1KA8 A;  4XBF A;  3LFK A;  2PLY A;  2CO5 A;  4EM1 A;  1YO5 C;  3HHG A;  3R6S A;  1MKM A;  1U6G A;  2RC4 A;  1YLF A;  2F5F A;  1ZG3 A;  4D0P A;  1GHC A;  5ILU A;  4ZYD A;  3REO A;  2IVM A;  2O61 A;  1Z6R A;  2HYF A;  3ERE D;  5TRD A;  1FP1 D;  3U1D A;  2RN7 A;  2VBW A;  2A3S A;  1XGM A;  2Q0O A;  4QWQ A;  3K1P A;  5D4S A;  4WCG A;  2EV0 A;  2D45 A;  1SMY F;  2NRA C;  2GXB A;  2Q8K A;  3KLN A;  1H9G A;  3L7W A;  2ZJ2 A;  1O3Q A;  3MWM A;  3SHF A;  4AIJ A;  2A5Y B;  1B59 A;  2MLG A;  3RDI A;  5CVV A;  4CHU A;  3LA7 A;  2IRF G;  1KYW A;  2PMH A;  3BDD A;  1T2K A;  2CGP A;  2O3F A;  5HVQ C;  2M87 A;  5AON A;  1XSD A;  2GWR A;  4I0A A;  3F8C A;  1MJA A;  2TDX A;  5ICE A;  1FX7 A;  4M9X A;  3DQV C;  3E6M A;  5CJ9 A;  2HR3 A;  5L3D A;  3VOE A;  4LJZ F;  4N9I A;  1H9T A;  3JW4 A;  1J75 A;  3RKY A;  1DPR A;  5ICF A;  4GYI A;  2F5C A;  1V4R A;  4LLG F;  1G3S A;  3F23 A;  2XAG A;  2P6S A;  2OBP A;  3I53 A;  1UCR A;  4KMU X;  3FXU A;  3LAP A;  4HOB A;  4UHT A;  4GYG A;  2ZKZ A;  3GW2 A;  3F3X A;  1TW2 A;  2IT0 A;  1UST A;  5ILS A;  2PN6 A;  1E17 A;  2O6G E;  2B0L A;  4HF1 A;  4A5N A;  5L3C A;  3ELK A;  2ACJ A;  4MQV A;  3E3V A;  1FT9 A;  4UVB A;  1Z6T A;  4I2O A;  3R0A A;  5LGT A;  3CO6 C;  1QNT A;  1BM9 A;  4RGR A;  4M9Z A;  5K5Q A;  1A04 A;  1PP7 U;  3RKX A;  5LHG A;  3T8T A;  4MQ9 F;  2X4H A;  1YS6 A;  1KQ0 A;  2J5P A;  2VE8 A;  4LLN A;  2HWV A;  3V7S A;  3TO7 A;  2P5V A;  3VFZ A;  2VN2 A;  5D5V B;  1FSE A;  3TO6 A;  4OIQ F;  3KP4 A;  3VOD A;  3ZMZ A;  2KJC A;  2RKH A;  2ETH A;  2XIG A;  3T0Y A;  2GAU A;  3DF8 A;  4HA8 A;  2DPU A;  1YW7 A;  3FHZ A;  2H6C A;  3HRT A;  4OIP F;  3K1N A;  1W7P B;  2ESN A;  3GZ5 A;  2P6T A;  4Y15 A;  3F21 A;  3PQJ A;  5D8K B;  2H27 A;  2DBB A;  2BE5 F;  1WWX A;  1ZRD A;  2A61 A;  3IHU A;  1O3S A;  2Z9O A;  2FRH A;  4M71 A;  1OR7 A;  3R61 A;  3VB2 A;  1O3R A;  1RZ4 A;  2FML A;  1T39 A;  3LQQ A;  4JK1 X;  1Z05 A;  3CUO A;  3TGN A;  1XN7 A;  4ZYH A;  3OV8 A;  1HKT A;  4M74 A;  4EMS A;  3HRU A;  3HOS A;  4KT5 C;  3FF5 A;  4ON0 A;  3RTR A;  3H3Z A;  3I5U A;  1OPC A;  4ESB A;  4OIO F;  2E1N A;  5AIP A;  3L2C A;  2P4W A;  1ON2 A;  5LBQ A;  5FLX Z;  4M72 A;  5CVJ A;  1T38 A;  2XAF A;  3TQN A;  4ZYE A;  4FX4 A;  1FC3 A;  4IPA A;  1FSH A;  1F5T A;  1KU2 A;  3RI4 A;  2OQG A;  3CUQ B;  3FXR A;  5FO5 A;  1G3W A;  1HKS A;  4B09 A;  3BRO A;  2QEN A;  1RI7 A;  5DUK A;  5BOX A;  1BC7 C;  4RGU A;  4O3M A;  1XGS A;  3KLO A;  2M8E A;  1BC8 C;  2EJR A;  5ICC A;  1W5T A;  4G6D A;  1KU9 A;  3I71 A;  4LK0 F;  1YW9 A;  5J8C A;  3P9C A;  1B1B A;  4U0W A;  4P5O A;  1S3J A;  2WWY A;  1D8J A;  1W7P A;  1LDD A;  3WG9 A;  3G73 A;  1BIB A;  3F22 A;  1IZ1 A;  3LA3 A;  2FBH A;  3HHH A;  2R7D A;  5DD8 A;  4ENK A;  1FBQ A;  2CFX A;  3KCC A;  2KIF A;  4A6E A;  3RPU A;  2M1B A;  1Q1H A;  2FEZ A;  4A6D A;  4EVI A;  3I59 B;  4I09 A;  1DDN A;  1HW5 A;  1D3Y A;  1FBS A;  2QM3 A;  2LF7 A;  1D8K A;  3PFI A;  5FD6 A;  3E6B A;  2ZO4 A;  4EM0 B;  1O57 A;  3G3Z A;  3Q5F A;  1KYZ A;  4HW0 A;  4L0Y B;  3R4K A;  5LEK A;  4UNO A;  1BBY A;  2DT5 A;  3RYR A;  4HF2 A;  3KP6 A;  3GFL A;  2F5E A;  1MZB A;  2QLZ A;  4HBL A;  5IT9 Z;  4YFN F;  4G6Q A;  3RIR A;  2PI0 A;  1FYK A;  2ZME B;  3CUQ A;  3M1E A;  1O7L A;  4UVC A;  1FBU A;  4HYE A;  2ZBK A;  1G3Y A;  4L9T A;  4RB1 A;  1VTN C;  2QQA A;  1TLH B;  2PG4 A;  1R7J A;  2LF8 A;  1ZRE A;  5JI6 A;  5HLI A;  3GZ6 A;  1CGP A;  1TW3 A;  1S29 A;  1WSU A;  4L9V A;  4HX7 A;  3L9F A;  3EQL F;  3T8R A;  4CO8 A;  2OQR A;  4U0Y A;  1P6R A;  2JT1 A;  3DP7 A;  1KU7 A;  3ZP5 A;  2D1H A;  1ON1 A;  1R5H A;  2OAZ A;  5J8F A;  3ZMU A;  1MD0 A;  4HV5 A;  4YFK F;  3I4P A;  3P9I A;  4O5V A;  4KMF A;  1T98 A;  5L3F A;  1IXC A;  1JE8 A;  2NNY A;  3WTW C;  4IRI A;  3AAF A;  2RQP A;  3I59 A;  1IAW A;  1I5Z A;  4A12 A;  2XKO A;  1TQM A;  3HTS B;  1LVA A;  5LGN A;  2WTE A;  3BPX A;  4JBA A;  1LEB A;  3EDP A;  4LGW A;  3BWG A;  3DFG A;  2MH2 A;  3HIF A;  5LRR A;  3CDH A;  5CLS A;  5HS8 A;  4I98 B;  3QPT A;  2FF4 A;  4KFC A;  3KP7 A;  3JAM K;  4RB0 A;  4L9N A;  2P7V B;  3MZH A;  2MC3 A;  3P7N A;  1B6A A;  4M73 A;  4CGZ A;  2C6Y A;  1ZAR A;  2ZME A;  4I7H A;  4LG0 A;  4OMY A;  4ASN A;  4U88 A;  2STW A;  2QWW A;  3V4G A;  2A68 F;  1IW7 F;  2LKP A;  5LRS A;  1T0F A;  2FMY A;  3TKY A;  3EUH A;  3HUG A;  5FD5 A;  2ADU A;  2LNB A;  2A6E F;  1P4A A;  1HST A;  4AVP A;  4WXC A;  3Q9V A;  5HLH A;  1IXR C;  2EA4 A;  4Q4Z F;  1GXP A;  2MLK A;  3F8M A;  3BZ6 A;  2HQR A;  3FMR A;  2IP2 A;  4HLY A;  2KRF A;  4OIR F;  3HSR A;  3GFM A;  2XRN A;  2GIV A;  4EJO A;  1YW8 A;  4A5M A;  3WGI A;  3GFJ A;  3M8E A;  2DU9 A;  3QU6 A;  1LDK B;  1TBX A;  1SD6 A;  3K0L A;  1W7P D;  4MGR A;  3D5L A;  3K2Z A;  3ISP A;  1C0W A;  5DEQ A;  2F5D A;  2XV4 S;  2K86 A;  3RPQ A;  5DCM B;  5D6E A;  4FHT A;  1SD7 A;  4AIK A;  2D2W A;  2W57 A;  1TNT A;  5IT9 K;  1F4K A;  3MFK A;  1XSX A;  3QRF F;  2L4M A;  5E1X A;  1PP8 F;  2YX4 A;  2HS5 A;  1J2X A;  4ZH4 F;  2P5L C;  1X3U A;  5D5X B;  1SFE A;  2Y0M A;  5D4R A;  2QVO A; 
#chains in the Genus database with same CATH topology
 2MD5 A;  1KGS A;  2V1D A;  2DN0 A;  5TJJ A;  4YIF A;  4ENN A;  2F5V A;  3CCQ I;  2YSR A;  2DTR A;  3VDX A;  3LMM A;  3S1N J;  4M6Y A;  2ELH A;  2EIM H;  2HOE A;  3BQY A;  4LLL A;  3A4C A;  2HVS A;  1J0R A;  4HQM A;  1W0T A;  2DFI A;  4B43 A;  4IHY A;  2HZT A;  2VT2 A;  2FBI A;  4IX7 A;  1LPQ A;  3HXL A;  1PDN C;  1UG2 A;  2K9L A;  2RRE A;  2LY1 A;  2Y30 A;  2Z16 A;  2K4B A;  4QPO A;  2COM A;  1JHH A;  3ABU A;  1LVK A;  2DA3 A;  3OYN A;  2OJE D;  2KHM A;  1AKH A;  3D0S A;  2F48 A;  5H2F C;  1OQY A;  4D7M A;  1JUM A;  2EFN A;  4YII A;  2HEO A;  2YU3 A;  3DXJ F;  2CQK A;  1ZTR A;  2Q2E A;  4L18 B;  2BW3 A;  1WI3 A;  4O6J A;  3L2V A;  2EQR A;  2ZFW A;  2WA0 A;  4IRG A;  2PFB A;  2PMZ N;  4CH7 A;  4HPQ A;  2ME6 A;  1PYV A;  1GXQ A;  3M9A A;  3PJR A;  4GDF A;  2DCE A;  3R0J A;  2Z33 A;  1MJ9 A;  2KL4 A;  1WJB A;  3SZT A;  3TDZ C;  5CVI A;  4ZDL A;  2A6H F;  2JA2 A;  3FXK A;  2HFH A;  2LD5 A;  3OR1 C;  1P9Q C;  4FAS D;  5HS7 A;  3FDY A;  3DKW A;  4X0G A;  2D1V A;  2GXG A;  2YS9 A;  2ZC2 A;  2K85 A;  4J19 A;  4Y17 A;  3WTV C;  1HSJ A;  4LK1 F;  3ML6 A;  3ZMV A;  3M8F A;  3OS1 A;  1VND A;  4L5I A;  3LAJ A;  1R4N B;  1UFM A;  3FXL A;  3S32 A;  1PVE A;  3CLO A;  2QQ9 A;  5ICG A;  1WHU A;  2P5K A;  1GUU A;  1VQ7 I;  1UAA A;  3K6G A;  1JGS A;  2XVC A;  4B44 A;  4WWC A;  3H3V K;  1HKQ A;  4H4K C;  1AWC A;  3PNV A;  4V19 K;  4IJA A;  3DPL C;  5IY5 H;  3FBN B;  3OIQ A;  3J81 Z;  4OU0 A;  1KON A;  5E3M A;  5L3G A;  5DCM A;  2VJ5 A;  1TWC J;  5J4V A;  5JR3 A;  4DZJ A;  1FNN A;  5LLQ A;  3COA C;  2ELK A;  1R71 A;  4FTH A;  2YR2 A;  2M4K A;  1BI0 A;  1RET A;  2ZCW A;  1XMK A;  2VXD A;  3C2B A;  4BE1 A;  2LFB A;  2JPB A;  4XLP F;  3BR6 A;  4XLN F;  3K4B A;  5IP7 J;  2LRD A;  4M6X A;  5DCF A;  2AXT C;  1VQK I;  1JTX A;  4WF2 A;  3A03 A;  1FWZ A;  2IA2 A;  1UB9 A;  2ZXI A;  1MSF C;  4KJZ A;  2A05 A;  1E3H A;  3EYY A;  2STT A;  3KE2 A;  2LDU A;  4CCM A;  2EZI A;  3GTK J;  1Y39 A;  1HLV A;  4PK4 A;  2JQ7 A;  1LNW A;  4IF4 A;  3D1N I;  3E5Q A;  3H92 A;  2NOJ B;  4G8X A;  2W25 A;  1K79 A;  1XC5 A;  4IHV A;  2KMU A;  1OLT A;  5FRO A;  2BGC A;  2LC2 A;  2EFP A;  2E2I J;  2IJL A;  5GAH J;  1SFK A;  4NB5 A;  5FB2 A;  1LB2 A;  2NVY J;  2AHQ A;  1XCB A;  4Q48 A;  2A07 F;  1EH7 A;  1DP3 A;  4HG2 A;  2L54 A;  3HKZ N;  2MW8 A;  5AIQ A;  2MD0 A;  2I8D A;  3HTU A;  4BYY A;  4E7K A;  3JTG A;  1OYI A;  3V7C A;  3ZXS A;  2AS5 F;  3GYH X;  2X48 A;  4DZP A;  3V7R A;  5EEG A;  2V1X A;  3DV8 A;  1U5T B;  1SEU A;  2UV1 A;  1MMG A;  2GA1 A;  3SFZ A;  4UV8 A;  1SFU A;  2MH9 A;  5J4Y A;  2Y31 A;  3GLX A;  4PGG A;  1U8B A;  2ID3 A;  2KIU A;  5JVT A;  1MH4 A;  2DK5 A;  4A3G J;  1IRF A;  3CCR I;  4RM2 A;  5LHH A;  3GO5 A;  5EGO B;  4BE2 A;  1IF1 A;  2OCC H;  2IGN A;  4XKW A;  2V79 A;  5A2Q Z;  4EGZ A;  2Y9Z A;  1G8X A;  2RVC A;  3ECO A;  4L5J A;  1ZR4 A;  4JQF A;  1QVT A;  2HPM A;  3U9G A;  2HYG D;  2JVH A;  1X1A A;  4XID A;  2IA1 A;  4DYQ A;  4M3F A;  2B7E A;  1JT6 A;  2QKM B;  2HQA A;  4II3 A;  1OR7 C;  1XDU A;  4AD9 A;  1ZHF A;  1EH8 A;  3ZMS A;  1UEL B;  4G12 A;  4PFO A;  4Y3O A;  4AVZ A;  3LFU A;  5IOY A;  2CUF A;  2XPW A;  3F8N A;  3K4J A;  4II2 A;  3I64 A;  3ZQQ A;  4C3H J;  1VQO I;  2QBY B;  1V54 H;  1NH3 A;  3OYD A;  3E6C C;  3HG9 A;  3K69 A;  3JAM Z;  2WV0 A;  4ZZD A;  5DM7 F;  3JSO A;  1YTY A;  2PMU A;  4YEJ A;  3ZN1 A;  5FLM J;  1MJB A;  3JRF A;  4BJT A;  4KDP A;  2EZH A;  2L9R A;  1WQ2 A;  1BI1 A;  3H36 A;  3UKG A;  4A3K J;  4GRI A;  3CCE I;  4WXH A;  2M45 A;  1PJR A;  2HPI A;  3CCL I;  2Y75 A;  1WJE A;  2EIL H;  2CQX A;  2EFW A;  5B3S H;  3PQK A;  1BI2 A;  1ZH5 A;  3RSN A;  2GOM A;  1U9N A;  2QYO A;  3F9K A;  1QO0 D;  5FKO A;  2NAZ A;  2PEX A;  3GTM J;  5TGT A;  3MZ8 A;  1RKW A;  1V5E A;  1YFH A;  4RAG A;  3WTX C;  4C3I J;  4NBQ A;  2W4S A;  3OOP A;  4R8H A;  3NRV A;  2KZG A;  1BJA A;  2H1K A;  3U2R A;  2W24 A;  5LEJ A;  4JP0 A;  2VL8 A;  1EV7 A;  3W2W A;  3ZN0 A;  5GPA A;  5IYB J;  2K7L A;  2EFO A;  5DUI A;  2IA0 A;  4M6V A;  4RGS A;  3C2H A;  2OTL I;  3FMS A;  5J3L A;  4UVA A;  3G4S I;  2GXA A;  2EH3 A;  2Z5U A;  1SAX A;  3QPL A;  2GA2 A;  1OKR A;  5FGM A;  4WXD A;  4AWX B;  2WB1 N;  1ZK8 A;  2DYS H;  1Y56 A;  2LSO A;  3BJO A;  3LSI A;  2HKO A;  2JA8 J;  4D7N A;  2L3D A;  3BG9 A;  3CO7 C;  2XAQ A;  4A3C J;  4B3A A;  2NYX A;  2DOE A;  2FNP A;  4KIC A;  4BQQ A;  3V8L A;  4GFB A;  4I0B A;  1Y0U A;  1QRY A;  2FNA A;  2V1N A;  2VBX A;  3PO3 J;  4BUP A;  2M2E A;  5K7Z A;  2YUS A;  4PZJ A;  5GTI C;  2BEO A;  2R7U A;  4DNC A;  1I1G A;  4GXO A;  3KZY A;  3SJM A;  4BJ5 C;  2BVM A;  3O6B B;  1Y1W J;  4Y52 J;  2RAE A;  1R58 A;  1KU3 A;  3WGH A;  2QQB A;  3E7L A;  4BJ6 C;  2DDA A;  4W97 A;  4CYD A;  1U5T A;  2XAJ A;  3HSF A;  4IHS A;  3A02 A;  3BCA A;  4KN4 X;  2K9N A;  2LRE A;  1ZYR F;  1W4M A;  1QZE A;  3BTL A;  3TL4 X;  3GVA A;  4N0B A;  4DYR A;  4PSW A;  1FYM A;  3M7G A;  2GQQ A;  5B1B H;  1NG7 A;  2R3S A;  1NTC A;  2K27 A;  2BY3 A;  1MDM B;  4HNV A;  1N78 A;  4ETS A;  1FTT A;  2L7F P;  3OYB A;  5M5Y J;  3CJN A;  1LFB A;  2KDO A;  5EGO A;  1RIO H;  1UMQ A;  1IUY A;  4P55 A;  4OIN F;  4ZDP A;  1HA8 A;  2O5R A;  5E1W A;  5IOZ A;  2DPD A;  3SZG A;  4CCN A;  2F4I A;  1JT0 A;  2DAO A;  3Q0W A;  4BQA A;  1P4X A;  3QP5 A;  2XGX A;  4QSH A;  5J47 A;  3F0C A;  1A36 A;  2N8G A;  2Y48 A;  1XGO A;  2VIX A;  4G7H F;  2NS8 A;  3LA2 A;  4AU7 A;  4DIQ A;  1MBG A;  1S7A A;  2PMZ A;  3FK6 A;  2QBY A;  2DMQ A;  2VKV A;  4LG0 B;  2DA1 A;  1UHM A;  3WHB A;  4GCV A;  1Y0N A;  2LYC A;  1NHA A;  1WRJ A;  3H5A A;  1Q1V A;  3ABK H;  3NWT A;  5KCM A;  5D5W B;  4EJV A;  3J81 K;  2H6B A;  2ZNZ A;  4YG2 F;  2BZT A;  2IXS A;  3OYI A;  1XD7 A;  2I5U A;  1X2M A;  4MEX F;  2Z99 A;  2OZ6 A;  1HDP A;  1ZG1 A;  5EZG A;  4ZYG A;  1OFC X;  5FFX A;  4B8X A;  2F2E A;  2RGV A;  2KIS A;  1ERD A;  2L02 A;  4NUB A;  2VPL A;  3HYI A;  1LQ1 A;  1JHF A;  4PJN A;  3ZQC A;  4OWR B;  3KP5 A;  3F8F A;  3FMQ A;  5ERI A;  1ZQ3 P;  1K61 A;  5CKT A;  1MND A;  2EFQ A;  5D6F A;  3HPG A;  4XNF A;  5EG0 A;  4ZTF A;  5IPA A;  2KT0 A;  1Z91 A;  2W82 A;  2E5Z A;  3QPH A;  3CC2 I;  1FPQ A;  1POG A;  4B3X A;  2X9D A;  5K7F A;  3X2Q H;  3OSG A;  3KEQ A;  1FOK A;  3E97 A;  2E1M B;  5HNF A;  2E7W A;  4MHG A;  3G71 I;  3QOE A;  3WTT C;  3H0D A;  3CCU I;  1ULY A;  3DPU A;  1R23 A;  2WV1 A;  1JUS A;  3IL2 A;  4RAY A;  4A3M J;  5JFR A;  2VKE A;  2EWN A;  2MFZ A;  1QPM A;  3FHN A;  3KP3 A;  5ILV A;  3MKZ A;  1TWG J;  1DP7 P;  3BPV A;  3CUQ C;  4EJT A;  2R7W A;  3ABM H;  3S3N A;  2ISY A;  2JA6 J;  4WX9 A;  1I1S A;  2IW5 A;  2RV8 A;  3OYL A;  3ZMD A;  2IGM A;  1MNM C;  2VBZ A;  2L9S A;  4XMY A;  1FZP B;  2DA5 A;  4HF0 A;  3QU3 A;  5K5R A;  2TCT A;  3T1B A;  1R6R A;  1OCP A;  2EV6 A;  3DEE A;  5J6X A;  3ZRG A;  4ZDO A;  3IH4 A;  4IHX A;  4G94 A;  3S15 J;  3DTE A;  1ZN2 A;  3ZR8 X;  5DD4 A;  4QIW N;  2QKL B;  3WGG A;  4BQN A;  4A2U A;  5D5U B;  4M3B A;  1NK2 P;  1Z21 A;  2UXN A;  2ZXW H;  2XUB A;  2DJI A;  2OU2 A;  2YX7 A;  3E5X A;  1PUE E;  2E71 A;  3FWE A;  2EIK H;  3OMY A;  5A2Q K;  1F43 A;  1ZGJ A;  2V9V A;  3CZ6 A;  3HC7 A;  1RNL A;  3JRC A;  1ZRC A;  4XOR A;  2QGU A;  3KYC B;  1IN7 A;  3K9T A;  3AG1 H;  1X19 A;  1XGN A;  1MDM A;  2IS2 A;  2COB A;  1JXS A;  1FMW A;  1BN5 A;  1T08 B;  2EA2 A;  3Q9S A;  3HRS A;  4NQW B;  2W7N A;  1FP2 A;  1K6O A;  2H09 A;  4XLH A;  3EUA A;  1P4W A;  2CSO A;  4RAZ A;  1FYL A;  2JMW A;  3QQA A;  2ESH A;  3E6D A;  2CV2 A;  4U7B A;  3GF2 A;  5HS9 A;  1YRN B;  1AOY A;  1MMN A;  4EJW A;  1IN5 A;  2VON A;  3H5R A;  1G4D A;  2MG4 A;  1JKO C;  3KPH A;  2MBF A;  5CYV A;  2CQQ A;  5E20 A;  1GVD A;  4MEY F;  3TP3 A;  1ONV A;  2M30 A;  1SVM A;  5F64 A;  2EPF A;  1NK3 P;  4KIF A;  4N9H A;  1QPI A;  4RS8 A;  4HLX A;  2V7F A;  3PSF A;  2R5Y B;  3ZCO A;  3QYB A;  4YFX F;  4RGX A;  5L3E A;  2DI3 A;  2Y9Y A;  2JTV A;  2VOO A;  1MMD A;  3OYK A;  1XS9 A;  1V5G A;  4Y13 A;  2UZK A;  2VQG A;  3LSH A;  1SC7 A;  4BAY A;  5FRM A;  4RLQ A;  1U78 A;  1YG2 A;  3B73 A;  2NNN A;  4M9S A;  2YU9 J;  2VBY A;  1J5Y A;  2JWT A;  3RJP A;  2L01 A;  3HB9 A;  2OPT A;  3AKZ A;  2GM4 A;  2AQF A;  3CJQ B;  2DJN A;  3M07 A;  4UUS B;  4MIM A;  3OL3 A;  2X85 A;  1WPK A;  3JRH A;  2KDZ A;  3ASN H;  3HRM A;  3ECH A;  3JRB A;  4KA4 A;  3LNQ A;  4UUV A;  4LIU A;  2DMT A;  5J1Y A;  3B02 A;  3V42 A;  3TED A;  1IDY A;  4MFE A;  4N4O B;  3GXO A;  4BHC A;  1G2H A;  1BIA A;  3HDD A;  1ZKG A;  1GDT A;  1OYY A;  1T6S A;  1R22 A;  3HSE A;  3O8G A;  4KUM A;  3BQZ A;  4NNJ A;  1JTY A;  4EJU A;  4E7L A;  3LSG A;  1AU7 A;  1G6N A;  4XLF A;  4E70 A;  2HVR A;  3MCZ A;  2ZME C;  1SD5 A;  1K7A A;  1YQA A;  1OMI A;  2JA5 J;  4R1H A;  3H0G J;  1JKP C;  4UV9 A;  3ZQL A;  1P92 A;  5E17 F;  2DW4 A;  2E19 A;  5DV5 A;  2M0M A;  1I27 A;  1HQC A;  1FJL A;  2VOD A;  2H94 A;  4PGH A;  3FM5 A;  4XRF A;  4H0E A;  1W36 D;  2EZL A;  1YYV A;  2CYY A;  4A69 C;  1SAU A;  3PIO F;  1YE9 A;  4XKB A;  3CTA A;  4CZZ A;  1T0F C;  5F1J A;  4MFD A;  2KFD A;  2AQE A;  1G3T A;  4A0Z A;  3EUH C;  2EB7 A;  1IG7 A;  2CWE A;  2L9N A;  1A5J A;  1F9N A;  2JRT A;  2W84 A;  5BQT A;  3VSK A;  1R4M B;  2VI6 A;  2XGD A;  1RPW A;  1BJZ A;  5DM6 F;  3IKV A;  3TBI A;  4IQJ A;  4D1Q A;  1DUX C;  2HDC A;  1X1P A;  1BOA A;  2XB5 A;  5LHI A;  4A93 J;  4P96 A;  2PBI A;  1HBX G;  1MBJ A;  5LFA A;  5BS6 A;  2M7B A;  3PIP F;  3W2A A;  1FTZ A;  3MAJ A;  1HC8 A;  1SMT A;  1STZ A;  2XAS A;  5IP6 A;  5E1Z B;  3I54 A;  1K78 B;  3CCJ I;  4NQW A;  4F91 B;  4HAM A;  5HOO A;  3HEF A;  2M34 A;  5M5X J;  2FU4 A;  4A3D J;  2M3A A;  4W1U A;  4IHT A;  1R49 A;  3MEX A;  1V5F A;  1REP C;  3FX3 A;  3TDU C;  3PM1 A;  1RRJ A;  4ABZ A;  3DBR B;  4HDU A;  3QOP A;  3J80 Z;  4AC0 A;  1YRN A;  2LY2 A;  1TNS A;  3EYI A;  2EIN H;  1ZGA A;  3KX2 A;  2ZJQ F;  4JX6 A;  4RDU A;  4I99 C;  3WE3 A;  4E7S A;  4G7O F;  3GCM A;  3MZY A;  4XR6 A;  5KAI C;  5D8L B;  4J01 A;  1XDS A;  3BTJ A;  4QLC U;  2H8R A;  3BJA A;  2XRO A;  3QP6 A;  2Y2Z A;  2BBY A;  2RDP A;  3NWS A;  4BEH B;  4U7D A;  3JSP A;  3DPT A;  4CIC A;  3O8H A;  3FKI J;  3HOT A;  3CDI A;  3I9V 2;  1R9T J;  2R5Y A;  3WE2 A;  2DT7 B;  2BYV E;  1B8I B;  2R7F A;  4QPQ A;  4HDV A;  4XQF A;  5FKK A;  5JLW A;  4XIC A;  2QCO A;  3AL0 B;  2V4J C;  3WG7 H;  4MTD A;  1D1A A;  2L2O A;  2HQ5 A;  2CMP A;  1AHD P;  1P7I A;  4KIB A;  2OZU A;  3KFW X;  5C3E J;  2HKX A;  4WK8 F;  4XN3 A;  5TIS C;  4RB3 C;  4UUS A;  4IVN A;  4ANJ A;  1W5S A;  2X6W A;  4PCQ A;  3AG4 H;  3VSL A;  1WH7 A;  1I6X A;  4E7I A;  1U8R A;  4G7Z F;  3FIS A;  1TTY A;  1IV6 A;  2W1O A;  1YHQ I;  3BOQ A;  4E4H A;  4RB2 C;  3OS2 A;  1J9I A;  3ROU A;  2R7T A;  1IN8 A;  4XSX F;  2FE3 A;  4BXU A;  4XN0 A;  2DYR H;  3RYP A;  4P9U A;  4L0Z B;  2X51 A;  5E18 F;  2M0C A;  1T56 A;  1B9N A;  3SXY A;  4AUX A;  3CP2 A;  2ZJP F;  4S04 A;  2OA4 A;  2ZJR F;  4U0V A;  1APL C;  1W5C C;  1LEA A;  3I4N J;  2FBK A;  2IS6 A;  3WU0 A;  1Z7U A;  4LIT A;  3J7A O;  2DTZ A;  3DEU A;  2NS7 A;  2E36 A;  3KZI C;  1V3F A;  2QQ8 A;  2WC2 A;  1RR8 C;  1OIS A;  2VE9 A;  3WTZ A;  4XM3 A;  1K4T A;  1Z1D A;  5H20 A;  1WFX A;  1H0M A;  2BV6 A;  2HGC A;  2O0Y A;  3ABL H;  3FXQ A;  4FQG A;  2EK5 A;  3ZMT A;  1WJA A;  2H1L A;  3GX4 X;  3ZPL A;  5LGU A;  2K4J A;  3CCS I;  3L09 A;  4BHB A;  4ZC3 A;  1ZLK A;  1QZZ A;  2LOO A;  3IWF A;  1GT0 C;  2FSW A;  3DLL F;  2V1U A;  1F36 A;  3L00 A;  2G9W A;  3M1C A;  3G6E I;  1R5G A;  3WU1 B;  3ULQ B;  3JR9 A;  3LWF A;  1JKR C;  2F4M B;  3HOU J;  1R5I D;  3Q0U A;  1IXS B;  3I0T A;  4IOC F;  2OTJ I;  4EQQ A;  3IV5 A;  1TWA J;  3SZP A;  4KIG A;  2A69 F;  2HXI A;  4DYC A;  4HNU A;  4ENM A;  3K2A A;  3A0H C;  3K4M A;  1WH5 A;  1T8I A;  3IRR A;  1K78 A;  1DPU A;  1I3A A;  5JHU A;  1E2X A;  3BG5 A;  2MAB A;  2VKH A;  3ABT A;  5CQE A;  3CLQ A;  4RM3 A;  3ZGK A;  1L0O C;  2FOW A;  2VT3 A;  3L2U A;  3GLL A;  4FET A;  1R1V A;  3EUK L;  4A0Y A;  3OYM A;  3DTK A;  2MA3 A;  3P5J A;  5HDN A;  2P7C B;  2O7O A;  2X6X A;  5IT3 A;  4OMZ A;  2K3P A;  3SEQ A;  1OCR H;  3FM3 A;  3GUD A;  4IXA A;  1YS7 A;  2KJB A;  2CQ7 A;  1OCZ H;  3HGG A;  1D5Y A;  1B9M A;  1E0E A;  4BGD A;  1HW1 A;  4EV0 A;  1BI3 A;  4ITV A;  1IRX A;  2M9H A;  5KVR A;  3MVP A;  4BEH A;  4DQ2 A;  1MSE C;  1N77 A;  2PJR B;  1CF7 B;  1OYW A;  3JTH A;  2DQR A;  4BL0 B;  2VC1 A;  5E8I A;  2QSG X;  3IRQ A;  1B8I A;  3SQN A;  2HTS A;  5HOD A;  1QBJ A;  3BR2 A;  1U2W A;  3TOA A;  1R00 A;  4HZF A;  2QZ8 A;  3FXO A;  2DA4 A;  3NEU A;  5J1R A;  1QGP A;  3IWZ A;  1QHH D;  1FOW A;  1I3Q J;  1P2F A;  3PL8 A;  4UUT A;  3TO9 A;  1K6Y A;  1FOY A;  4FX0 A;  3T5X A;  4BS9 A;  2BHY A;  1KQ9 A;  5F0C A;  3W6V A;  3ZQ7 A;  2HYJ A;  1B4A A;  4F7Z A;  1WI9 A;  3KP2 A;  4C2U A;  3PNT A;  1R1U A;  3BR3 A;  3C18 A;  4XLC A;  3C1D A;  2VQH A;  2L0K A;  1TWF J;  2O03 A;  2CW0 F;  4PFP A;  3HOZ J;  5KK1 A;  2R92 J;  4IZZ A;  1ZLJ A;  3V8J A;  4F93 B;  5K1Y A;  1U3E M;  4BY1 J;  2PX9 A;  2VQL A;  1MH3 A;  4MNU A;  4F52 A;  4LB5 A;  3GTJ J;  2UXX A;  2HTJ A;  2E60 A;  4FE4 A;  2VUM J;  2E1C A;  2DA7 A;  3VEP A;  2DO7 A;  5E8G A;  3S16 J;  3W3C A;  2HDD A;  4K2E A;  4TV7 A;  2MGQ A;  2QA4 I;  2Y0S N;  3MKL A;  5H6R A;  2CRG A;  3LST A;  3CC7 I;  1J09 A;  3OYG A;  4YIR X;  4ESF A;  3B6A A;  3OR2 C;  4G9Y A;  4GGG A;  2R5Z A;  3IAS 2;  1MGT A;  1HW2 A;  1TC3 C;  2V26 A;  4PUS A;  1IN6 A;  2ZNY A;  5BPD A;  2HOS A;  3BTI A;  3W6J B;  5CVU A;  2R7Z J;  3M3Y J;  4I01 A;  4KN7 X;  2XHK A;  2UWM A;  5EG0 B;  1H89 C;  5L3B A;  3SEZ A;  4CDG A;  3IKT A;  4IHW A;  3I4M J;  1TWH J;  3LQR A;  4XL9 A;  1DU0 A;  2CFO A;  3CCY A;  3I58 A;  3J80 K;  3OS0 A;  4ESJ A;  4YEL A;  2HOT A;  2XPU A;  3S14 J;  1WZ2 A;  4CCJ A;  3F6V A;  4R79 A;  5FFZ A;  4PJL A;  2CU7 A;  4A3E J;  3J7A Y;  2AXL A;  1LDJ A;  3KEO A;  2LP0 A;  4HX8 A;  4KYW A;  4BE0 A;  5F6F A;  4B47 A;  1MNE A;  3BY6 A;  2E35 A;  3L1P A;  1JJ6 C;  4OAY A;  5J40 A;  3V8K A;  2DLL A;  1SFX A;  2OC6 A;  4XON A;  4L9J A;  5EJC A;  3CF2 A;  1EA3 A;  5B5E C;  2HVQ A;  2ZXJ A;  4F92 B;  2JUG A;  3WTU C;  4AID A;  4UXN A;  4IOA F;  3N05 A;  5BPI A;  1JKQ C;  5BMZ A;  1DGW Y;  3CMM A;  1Z7L A;  3IH3 A;  1RUO A;  2FUG 2;  2J5O A;  2CUZ A;  3H3U A;  2DMU A;  3ZQH A;  1TT5 B;  2W48 A;  2DXI A;  1IN4 A;  1I50 J;  2PJR A;  3C3W A;  1S6L A;  4LMY A;  1CF7 A;  3SDB A;  2LVS A;  1F1Z A;  1X4P A;  2KIM A;  2IPQ X;  1USS A;  3WTY C;  4ZJZ A;  2KKO A;  3KEY A;  2F6C A;  2FXA A;  3O3K A;  5F04 A;  3WOD F;  4IRH A;  5C4X J;  1XB4 A;  5HLG A;  1GV2 A;  1UHW A;  2QUF A;  3K4N A;  3FZV A;  2P8T A;  2DK8 A;  1J7K A;  3PNY A;  4OOI A;  3N97 A;  3GEZ A;  4BH9 A;  1W36 C;  2CV0 A;  1FLI A;  1WKM A;  3JRD A;  4CXF A;  2M7A A;  3HOV J;  2G7U A;  4C2T A;  4XRS G;  1XCV A;  3TW6 A;  3TP0 A;  1EKE A;  3D5S C;  4B48 A;  1P7J A;  1I6H J;  2JVG A;  1S7O A;  3WU2 C;  3QPS A;  3DCF A;  2R7S A;  2XAH A;  5ED4 A;  1WGX A;  2F4O B;  2LR8 A;  1H8A C;  2ISZ A;  3NAU A;  2WAE A;  2VC0 A;  1EJ9 A;  1O7F A;  3K4C A;  1EH6 A;  3DTI A;  2L7K A;  1VQ5 I;  4EGY A;  1TQP A;  4A0X A;  5HDG A;  2E2H J;  2XF5 A;  2FQ4 A;  2X6O A;  3S3O A;  2DMN A;  3BR1 A;  1J59 A;  2VXZ A;  5HLT A;  1X2N A;  5DYM A;  2ZFU A;  3RQ4 A;  1Z3X A;  1VQ4 I;  3RKW A;  5DTD A;  2DQL A;  5CVR A;  2XC7 A;  1VQN I;  3KET A;  3AG3 H;  1V55 H;  2PJP A;  3CDL A;  4EM2 A;  4ENJ A;  4XSZ F;  1TZL A;  1RUN A;  4Q5S F;  1OCO H;  1TQI A;  3HL2 A;  3GWZ A;  4PJJ A;  2EV5 A;  2FQ3 A;  4P9F A;  2RNJ A;  4Y4R A;  4BHP A;  1U5T C;  4BBR J;  2JN6 A;  2E2J J;  3IC7 A;  2FOK A;  2VAS A;  2EIJ H;  4LB6 B;  3RQI A;  2DOF A;  2HI3 A;  1ODD A;  2M5W A;  4PJM A;  5EEH A;  2PQ8 A;  4XKV A;  3QOD A;  3M8J A;  1S8N A;  2NVX J;  3F6O A;  2JK3 A;  2XDV A;  3GFI A;  4NC8 A;  2BVL A;  5J1U A;  1VFC A;  2BXY A;  2V6C A;  1LUJ B;  4S05 A;  2OD5 A;  1QQI A;  5E79 C;  4MTE A;  2GZW A;  4HX4 A;  1R1T A;  1XSV A;  1IRG A;  3F72 A;  2HQN A;  2K02 A;  1XMA A;  4C9Y A;  1GVJ A;  3ONQ A;  1XG1 A;  3QAH A;  3K1M A;  2FJ1 A;  4MLO A;  2IEK A;  4MO7 A;  2CUE A;  3NAR A;  2CG4 A;  4F55 A;  1SVO A;  4LD5 A;  4M3D A;  4S0H B;  5F1R A;  1S5L C;  2XKP A;  6PAX A;  3QYE A;  4KNY A;  2YPR A;  3BJ6 A;  1SD4 A;  2V9K A;  1HXD A;  4UY8 I;  1CQT A;  4KT6 A;  3R60 A;  1L3L A;  5EZH A;  1WVR A;  2VOP A;  3K4L A;  1O3T A;  4HRI A;  1IUF A;  4FT8 A;  2JZY A;  2JSC A;  3EET A;  2R93 J;  5K5O A;  3S2W A;  2JPC A;  4I02 A;  1ZRF A;  2E1O A;  3O2P E;  4LFU A;  4ZZL A;  3ESW B;  4L5E A;  3KZZ A;  2W85 A;  1ACI A;  5E3O A;  4Z2Y A;  2XF6 A;  1X1D A;  3VPR A;  1X3Z B;  2ZB9 A;  3BP8 A;  2TRT A;  1OCC H;  1YIO A;  2WBM A;  3W6K B;  4IQ4 A;  1JI8 A;  1RKT A;  5H6Q A;  5CQG A;  4GO1 A;  1B72 B;  2E7X A;  1D0Z A;  4DBQ A;  5DDG A;  3MD2 A;  3C7J A;  3VYU B;  5FJ8 J;  4HV6 A;  4Q47 A;  2X0L A;  3E5U A;  3OYA A;  1ETQ A;  2GLO A;  3ZOB A;  4BNC A;  1ZAO A;  1ZG5 A;  3MMY B;  4HQE A;  3MKY B;  2GBY A;  3F8B A;  2Q1Z B;  4AIH A;  2O8X A;  4HST A;  4PDK A;  5F0F A;  4RLF A;  5FLX K;  3A01 B;  3BG7 A;  2VJJ A;  3MKW B;  1KQ8 A;  2G0E A;  4C2M J;  2Z3Y A;  4XLA A;  4Y7N J;  2NS0 A;  2OUM A;  2HU9 A;  1QHG A;  3MQ0 A;  4D9J A;  4KIT B;  3TMO A;  1FY7 A;  5HDK A;  1FMV A;  2O9L A;  2IGK A;  4NHJ A;  2ZXH A;  1Y8R B;  1ETY A;  2L4A A;  1Z9C A;  1ETO A;  2OCE A;  3WTS C;  3P9K A;  1W1W E;  1R36 A;  1QZY A;  3NQO A;  1LJ9 A;  1D5V A;  4BY7 J;  2DMP A;  3TOB A;  2G7H A;  1VQ9 I;  2FA5 A;  1KA8 A;  4IKF A;  3A2K A;  2UUZ A;  4XBF A;  3S1Q J;  3LFK A;  2PLY A;  2CO5 A;  2M8G X;  4EM1 A;  3OY9 A;  1YO5 C;  5C4J J;  4B4C A;  2Y0S A;  3HHG A;  3K4K A;  2BY1 A;  2BY2 A;  3R6S A;  1MKM A;  1U6G A;  3HJE A;  2RC4 A;  1YLF A;  2F5F A;  1ZG3 A;  2WAD A;  4D0P A;  3MN2 A;  1GHC A;  5ILU A;  2LBF B;  1SAN A;  4ZYD A;  3REO A;  1VQL I;  2IVM A;  2O61 A;  1Z6R A;  2HYF A;  3ERE D;  2JA7 J;  5TRD A;  1FP1 D;  3U1D A;  4XOP A;  4CA0 A;  4LIV A;  4BBS J;  3JCU C;  3CCM I;  4A3J J;  1MBH A;  2RN7 A;  2ELJ A;  2VBW A;  4FE7 A;  2A3S A;  1XGM A;  3OIO A;  2Q0O A;  2LKX A;  1LE8 B;  1QVU A;  4QWQ A;  2EZK A;  3K1P A;  5D4S A;  1K4S A;  4WCG A;  1I39 A;  1MIJ A;  2O8K A;  2EV0 A;  4JOM A;  2D45 A;  1IGN A;  1SMY F;  2XSD C;  2NRA C;  2GXB A;  3GTO J;  2Q8K A;  2FD5 A;  4KIS A;  3KLN A;  1RR7 A;  1H9G A;  4NDL A;  3L7W A;  1X3W B;  2ZJ2 A;  1YI2 I;  5FKN A;  2CUJ A;  1O3Q A;  1B72 A;  3J7Z I;  3MWM A;  3SHF A;  3K70 D;  4AIJ A;  2A5Y B;  5B1A H;  1B59 A;  2MLG A;  1BW5 A;  2FX0 A;  3RDI A;  5GAG J;  5CVV A;  3I56 I;  4CHU A;  3LA7 A;  2IRF G;  1QA6 A;  1KYW A;  4UB6 C;  1ORK A;  2PMH A;  3BDD A;  1D0X A;  3BZC A;  4CYC B;  1T2K A;  2CGP A;  2E1M C;  5F08 A;  2HZD A;  2O3F A;  5HVQ C;  1YJN I;  5GAD J;  3CMY A;  2M87 A;  4F3Q A;  5AON A;  2RQQ A;  4FCY A;  1XSD A;  3A01 A;  2GWR A;  5M3M J;  3KYL A;  4I0A A;  3F8C A;  1MJA A;  2TDX A;  5ICE A;  3LSM A;  1FX7 A;  4M9X A;  3DQV C;  3E6M A;  1HDD C;  1W0U A;  2B63 J;  1TL8 A;  5CJ9 A;  2HR3 A;  5L3D A;  3SFI A;  3VOE A;  2D5V A;  1YJW I;  3RZO J;  3FBI B;  4LJZ F;  4N9I A;  1H9T A;  3DU5 A;  3JW4 A;  3ZQF A;  1J75 A;  2WY7 Q;  3RKY A;  1DPR A;  2E5N A;  2AO9 A;  2ECB A;  5ICF A;  4GYI A;  2F5C A;  1H88 C;  1V4R A;  4LLG F;  1G3S A;  3CD6 I;  3CJT B;  4HSR A;  3F23 A;  2XAG A;  1BOB A;  3GTQ J;  1UHS A;  2P6S A;  1S7E A;  2LMD A;  2OBP A;  1WJD A;  4X1E A;  2XAU A;  1G59 A;  3I53 A;  1UCR A;  4B1R A;  3GTG J;  2KP6 A;  1BL0 A;  4KMU X;  4ZTJ A;  3GME A;  3FXU A;  3LAP A;  4HOB A;  4UHT A;  2BHZ A;  4GYG A;  1WJ5 A;  3ZQG A;  2ZKZ A;  1YIJ I;  2CW8 A;  3GW2 A;  3F3X A;  1Y6I A;  1MBE A;  1TW2 A;  2IT0 A;  4X6A J;  1XMX A;  1UST A;  2ICW G;  4A3I J;  1MW7 A;  2LBF A;  4BKX A;  5ILS A;  2PN6 A;  2WY8 Q;  3OOU A;  1E17 A;  4XRM A;  2K5C A;  2O6G E;  2B0L A;  1X1B A;  5E3L A;  4HF1 A;  4A5N A;  5L3C A;  1ZEL A;  3K7A J;  3ELK A;  1UJ8 A;  3PUF A;  2ACJ A;  4MQV A;  3E3V A;  1PUF A;  2M4G A;  1FT9 A;  4BU2 A;  4UVB A;  1VQ8 I;  1Z6T A;  4IEJ A;  2Z1D A;  4JX4 A;  4I2O A;  2KLO A;  3R0A A;  4I76 A;  3HGY A;  5EYR A;  5LGT A;  1VQM I;  1ZR2 A;  4XKC A;  2Y69 H;  3CO6 C;  1QNT A;  1BM9 A;  1LE8 A;  2K9Q A;  1T33 A;  4RA2 A;  4RGR A;  4M9Z A;  5K5Q A;  3N4M A;  4CUG A;  1A04 A;  3C2G A;  2KZV A;  1PP7 U;  3RKX A;  5LHG A;  3T8T A;  4MQ9 F;  2CS3 A;  3FK7 A;  2LG4 A;  2X4H A;  1YS6 A;  1LFU P;  1DQU A;  1KQ0 A;  2J5P A;  2R5Z B;  2VE8 A;  4LLN A;  2HWV A;  4EAT A;  4A3F J;  3V7S A;  3TO7 A;  3IUO A;  1U9O A;  1ZGW A;  2R7V A;  3VWB A;  2P5V A;  3VFZ A;  2VN2 A;  1XPX A;  5D5V B;  1FSE A;  3UR3 C;  4JYK A;  1GV5 A;  3TO6 A;  4OIQ F;  3KP4 A;  1Z0X A;  3VOD A;  4CYC A;  3ZMZ A;  2KJC A;  2RKH A;  5E3N A;  2ETH A;  2R4G A;  3AG2 H;  2XIG A;  3T0Y A;  2GAU A;  4M3E A;  2LLK A;  3KIO A;  3DF8 A;  3H9Q A;  4HA8 A;  3ZQI A;  2DPU A;  2L9V A;  4E7Z A;  1YW7 A;  3FHZ A;  2L7M P;  3G1L A;  4DJA A;  2H6C A;  4BDY A;  3HRT A;  3BLY A;  4OIP F;  3K1N A;  1W7P B;  2ESN A;  3GZ5 A;  2DA2 A;  2HNH A;  2P6T A;  1S72 I;  4Y15 A;  1T95 A;  3F21 A;  3PQJ A;  5D8K B;  2H27 A;  1ETV A;  2DBB A;  3BCB A;  2BE5 F;  1WWX A;  1ZRD A;  3IP4 B;  1VF9 A;  4A3B J;  2A61 A;  3W2V A;  4PJ0 C;  2P0W A;  3IHU A;  1O3S A;  2Z9O A;  2FRH A;  4M71 A;  1OR7 A;  3LSK A;  3R61 A;  3KYD B;  3VB2 A;  2QEX I;  1O3R A;  1E3O C;  4A3L J;  4PSX A;  4Z6Y A;  3DBH B;  3CES A;  1RZ4 A;  4DBR A;  2FML A;  1T39 A;  3LQQ A;  2CQN A;  3ASO H;  5M3F J;  1KZH A;  2K40 A;  4JK1 X;  5EEA A;  1YX3 A;  4NC7 A;  1MBK A;  1X58 A;  3PUB A;  2RNG A;  2ECC A;  3H9J A;  2DA6 A;  1Z05 A;  2DT6 A;  3CUO A;  3TGN A;  1XN7 A;  2K3F A;  4ZYH A;  4XLE A;  1DU6 A;  3OV8 A;  1HKT A;  1NG6 A;  1YX5 A;  4XOT A;  2VJ4 A;  4M74 A;  4Y33 A;  4EMS A;  3HRU A;  4C30 A;  3HOS A;  4KT5 C;  3FF5 A;  1Y8Q B;  3LSJ A;  2X6Y A;  3OIP A;  4ON0 A;  3RTR A;  3H3Z A;  3I5U A;  3OL4 A;  1FIA A;  1MBF A;  1OPC A;  2XPV A;  3HM5 A;  4OAZ A;  1TT0 A;  3BT9 A;  4ESB A;  5KAF C;  4OIO F;  4N4N B;  2E1N A;  4QTR A;  3ERM A;  1BR2 A;  5AIP A;  3L2C A;  2P4W A;  1U0J A;  3WHC A;  1ON2 A;  4V2G A;  5LBQ A;  5FLX Z;  3L2R A;  4M72 A;  5CVJ A;  2DFE A;  2HOA A;  1T38 A;  2B9S A;  5IYD J;  2Z2S B;  2XAF A;  3TQN A;  3VYT B;  4ZYE A;  3OYJ A;  2LK2 A;  2R7R A;  4FX4 A;  1FC3 A;  4IPA A;  1FSH A;  3DWL E;  2VJI A;  3G2B A;  1F5T A;  1KU2 A;  3LSR A;  4RMN A;  3CC4 I;  3RI4 A;  2OQG A;  3CUQ B;  3FXR A;  1O4X A;  1VQ6 I;  5FO5 A;  3S1R J;  5M5W J;  1G3W A;  1HKS A;  3H35 A;  1LKX A;  4B09 A;  4AYB A;  4DOZ A;  3AL0 C;  1Y1V J;  1HF0 A;  3BRO A;  2A5W A;  2QEN A;  3DKX A;  1RI7 A;  1IV8 A;  5DUK A;  5BOX A;  2DFF A;  3OWT A;  2WAQ A;  3FKJ A;  2CV1 A;  2R7O A;  3S8P A;  1BC7 C;  4RGU A;  1A31 A;  4O3M A;  1XGS A;  3KLO A;  2M8E A;  2LH9 A;  2LKS A;  5HNH A;  4LG3 A;  3JRA A;  3L2Q A;  5LD2 C;  1BC8 C;  1JUP A;  2EJR A;  5ICC A;  1W5T A;  1A6Q A;  1Z77 A;  4G6D A;  1KU9 A;  3I71 A;  4LK0 F;  2KIQ A;  3CCV I;  1SVL A;  4U87 A;  5F0H A;  3EPZ A;  1YW9 A;  5J8C A;  4J00 A;  3P9C A;  1ETW A;  1B1B A;  4U0W A;  3D5R C;  4P5O A;  1RC9 A;  1S3J A;  3RCO A;  2WWY A;  1D8J A;  1W7P A;  1LDD A;  3WG9 A;  3DKY A;  3OYH A;  3G73 A;  1BIB A;  4P1W A;  3F22 A;  3VYR B;  1IZ1 A;  3LA3 A;  2NVQ J;  2FBH A;  3HHH A;  2R7D A;  5DD8 A;  2BY0 A;  4ENK A;  1FBQ A;  2CFX A;  2XF7 A;  1FIP A;  3KCC A;  2KIF A;  4A6E A;  3RPU A;  2X1D A;  2IGO A;  3A0B C;  3FXJ A;  5EDN A;  4NC6 A;  2M1B A;  1Q1H A;  3DEW A;  1ETK A;  2FEZ A;  4A6D A;  2DFH A;  4EVI A;  2KPM A;  3I59 B;  4CCL A;  5GTH C;  1Z3Y A;  4I09 A;  3GTL J;  3JRE A;  2HDW A;  4DGW B;  1DDN A;  1HW5 A;  1D3Y A;  1FBS A;  1IC8 A;  3BR5 A;  2IS1 A;  1ITY A;  1AA7 A;  3GZN B;  4BDZ A;  2QM3 A;  4E7H A;  1D0Y A;  1VZ0 A;  3E0J B;  1WJF A;  1IJW C;  4CCO A;  2LF7 A;  1D8K A;  3CQZ J;  3PFI A;  5IYC J;  5FD6 A;  3E6B A;  1UZC A;  2R0Q C;  2ZO4 A;  4EM0 B;  5BNG A;  1O57 A;  3G3Z A;  4V2F A;  1DGR M;  3K70 C;  3H1C A;  3Q5F A;  2NVT J;  1KYZ A;  1X4O A;  1EF4 A;  4HW0 A;  4L0Y B;  3R4K A;  5LEK A;  5EF6 A;  1LFP A;  3BZK A;  4UNO A;  2DOA A;  2JSP A;  3CME I;  1BBY A;  3LL7 A;  2DT5 A;  3RYR A;  2MSY A;  2R7Q A;  4HF2 A;  1N75 A;  3KP6 A;  3GFL A;  1XTA A;  1OJL A;  2F5E A;  2CW7 A;  2XGC A;  3HOX J;  1MZB A;  1YOV B;  2QLZ A;  4HBL A;  5IT9 Z;  2BOL A;  4YFN F;  4G6Q A;  3S1M J;  3RIR A;  2PI0 A;  1VQP I;  1FYK A;  4XK4 A;  2ZME B;  1FOX A;  3CUQ A;  3G1O A;  4BXF A;  3S3M A;  3M1E A;  1O7L A;  4UVC A;  1FBU A;  4HYE A;  3S2H J;  2ZBK A;  1G3Y A;  3BG3 A;  3GBG A;  2X1E A;  4L9T A;  2V9P A;  5FKL A;  4RB1 A;  1VTN C;  2GIZ A;  2QQA A;  1TLH B;  3DU6 A;  3LSP A;  5FLV A;  4BQO A;  2PG4 A;  1R7J A;  2LF8 A;  2XGE A;  1ZRE A;  1IDZ A;  5JI6 A;  3JRI A;  5HLI A;  3GZ6 A;  1CGP A;  1TW3 A;  4EEF G;  3S2D J;  1WCM J;  1S29 A;  1WSU A;  5FRN A;  3HUG B;  4L9V A;  2BXZ A;  4HNT A;  2L5Q A;  4HX7 A;  3L9F A;  2IBD A;  2HXO A;  3EQL F;  3CP8 A;  3PFY A;  3FXM A;  3T8R A;  5K7H A;  2WAF A;  4CO8 A;  2OQR A;  4E6K G;  3E1S A;  4U0Y A;  1P6R A;  2JT1 A;  2ZSI B;  2CJJ A;  1VI0 A;  3DP7 A;  1KU7 A;  2D1H A;  3ZP5 A;  1ON1 A;  1R5H A;  5JLX A;  2OAZ A;  3H5N A;  1A6I A;  1ENH A;  5J8F A;  2W00 A;  3ZMU A;  1MD0 A;  2JJ7 A;  4HV5 A;  5KNL A;  5GAE J;  4YFK F;  1YJ9 I;  3I4P A;  2K9M A;  3P9I A;  4O5V A;  4KMF A;  1T98 A;  4JX5 A;  5L3F A;  1IXC A;  2MC4 A;  3FIW A;  3LOC A;  3QYF A;  2NXN B;  1JE8 A;  2IS4 A;  3H9G A;  2NNY A;  3WTW C;  2JRM A;  3RZD J;  2VQC A;  3Q3S A;  4IRI A;  4ZYA A;  1JGG A;  3AAF A;  2RQP A;  3I59 A;  1IO2 A;  1IAW A;  1I5Z A;  4A12 A;  2XKO A;  1TQM A;  3Q0V A;  2I10 A;  3HTS B;  1LVA A;  5LGN A;  1E3P A;  1N25 A;  2WTE A;  1TP4 A;  3BPX A;  2VPR A;  3IAM 2;  1IRZ A;  2DDB A;  4RBO A;  4AM3 A;  1XX5 A;  4JBA A;  4I6Z A;  4FIS A;  3TW7 A;  2E34 A;  3EDP A;  1LEB A;  1FEX A;  4LGW A;  2ZSH B;  3BWG A;  3DFG A;  3HZJ A;  2MH2 A;  2VLA A;  3SYT A;  3HIF A;  3HKZ A;  5LRR A;  1S9H A;  3CDH A;  5CLS A;  3U21 A;  2V6E A;  5HS8 A;  4I98 B;  3CJR B;  3CF5 F;  4RAF A;  3QPT A;  2FF4 A;  3L2W A;  4D5F A;  4KFC A;  1Z67 A;  3KP7 A;  3JAM K;  5GPC A;  3QWL A;  4RB0 A;  4L9N A;  2P7V B;  3B6C A;  3MZH A;  5CPR B;  3BC8 A;  2MC3 A;  3P7N A;  2P81 A;  1B6A A;  4M73 A;  4CGZ A;  5GP9 A;  2C6Y A;  3HOW J;  1OCT C;  3M4O J;  1ZAR A;  3BR0 A;  3U1K A;  5JVG F;  2ZME A;  4I7H A;  3JRG A;  4LG0 A;  3CMA I;  4G6T B;  2VB6 A;  4OMY A;  4ASN A;  4U88 A;  2LY9 A;  2STW A;  4UB8 C;  2QWW A;  3IH2 A;  3V4G A;  2KRC A;  2A68 F;  2ID6 A;  1IW7 F;  2NOG A;  2LKP A;  4IO9 F;  2H8W A;  1ETX A;  5LRS A;  1T0F A;  2FMY A;  1QU3 A;  3TKY A;  5F27 A;  3OYC A;  3EUH A;  3HUG A;  5FD5 A;  1YIT I;  1AKH B;  1WJC A;  2ADU A;  2LNB A;  4HEA 2;  2A6E F;  2NVU B;  3HBL A;  1P4A A;  1HST A;  2DOD A;  4CZC A;  4XRS A;  1PUF B;  4AVP A;  2Q2E B;  4WXC A;  2BW3 B;  9ANT A;  2QF7 A;  1BW6 A;  3AFH A;  3Q9V A;  5HLH A;  1IXR C;  3OYE A;  2EA4 A;  2KRH A;  4Q4Z F;  4BXX J;  4IL6 C;  4DW6 A;  5JHF A;  2IAI A;  1GXP A;  2A6T A;  2MLK A;  4E7J A;  4AYB N;  5B66 C;  3F8M A;  1BA5 A;  3BZ6 A;  1BR4 A;  2CH0 A;  2EBI A;  2HQR A;  1D1B A;  2OF7 A;  2XSJ C;  3OYF A;  2MYS A;  1RES A;  3FMR A;  2IP2 A;  3DBL B;  3J7Y J;  1MMA A;  4HLY A;  2KRF A;  2WAQ N;  2XB0 X;  3S17 J;  4OIR F;  2GOX B;  3HSR A;  3GFM A;  2XRL A;  2XRN A;  2GIV A;  2L7Z A;  4LOC A;  4EJO A;  2X1C A;  2QSH X;  1X1C A;  1YW8 A;  4A5M A;  3WGI A;  3GFJ A;  2OV7 A;  3M8E A;  5IP9 J;  2DU9 A;  4M3G A;  2WB1 A;  1HCR A;  3UNG C;  1JJ8 C;  3OSF A;  4C3J J;  3QU6 A;  1LDK B;  3S93 A;  3SDG A;  3I55 I;  1MMS A;  3A1Y A;  1TBX A;  1SFO J;  3PO2 J;  3I3L A;  1SD6 A;  3K0L A;  1W7P D;  4MGR A;  3GTP J;  3D5L A;  3K2Z A;  3ISP A;  5DS9 A;  1C0W A;  5DEQ A;  2F5D A;  2KQR A;  2XV4 S;  1UG0 A;  4BAC A;  2K86 A;  3RPQ A;  5C44 J;  1K83 J;  3DLA A;  5DCM B;  2VKD A;  5D6E A;  2JUC A;  4FHT A;  1SD7 A;  4AIK A;  2D2W A;  3RPU D;  1M1E B;  2W57 A;  3PSI A;  3HOY J;  1TNT A;  5IT9 K;  1F4K A;  3BTC A;  3MFK A;  1GLN A;  4YRV A;  1XSX A;  3QRF F;  2L4M A;  5E1X A;  3RKQ A;  2ME0 A;  4CCK A;  1A35 A;  1PP8 F;  3BG6 A;  2R7X A;  2YX4 A;  3K10 A;  1BR1 A;  1HOM A;  2HS5 A;  2LTP A;  2K9S A;  3G1M A;  1J2X A;  4ZH4 F;  2P5L C;  2QSF X;  3HPH A;  1X3U A;  5D5X B;  1SFE A;  1D1C A;  5KHD A;  5FKM A;  2Y0M A;  4CSW A;  4D5C A;  5D4R A;  2QVO A;  3VYS B; 
#chains in the Genus database with same CATH homology
 2MD5 A;  1KGS A;  2V1D A;  5TJJ A;  4YIF A;  4ENN A;  2YSR A;  2DTR A;  4M6Y A;  2ELH A;  2HOE A;  4LLL A;  1J0R A;  4HQM A;  2DFI A;  2HZT A;  2VT2 A;  2FBI A;  1PDN C;  2K4B A;  2COM A;  1JHH A;  3ABU A;  3D0S A;  2HEO A;  2EFN A;  4YII A;  2YU3 A;  3DXJ F;  2CQK A;  2Q2E A;  4L18 B;  4O6J A;  2ZFW A;  4IRG A;  2PFB A;  1GXQ A;  3M9A A;  3R0J A;  2Z33 A;  1MJ9 A;  3SZT A;  3TDZ C;  5CVI A;  2A6H F;  2HFH A;  5HS7 A;  3DKW A;  2D1V A;  2GXG A;  4Y17 A;  3WTV C;  1HSJ A;  4LK1 F;  3ML6 A;  3ZMV A;  3M8F A;  4L5I A;  3LAJ A;  1UFM A;  3CLO A;  2QQ9 A;  5ICG A;  2P5K A;  1JGS A;  2XVC A;  4WWC A;  1HKQ A;  1AWC A;  4IJA A;  3DPL C;  3J81 Z;  4OU0 A;  5L3G A;  5DCM A;  5JR3 A;  1FNN A;  5LLQ A;  3COA C;  2YR2 A;  1BI0 A;  2ZCW A;  1XMK A;  2JPB A;  4XLP F;  4XLN F;  4M6X A;  5DCF A;  4WF2 A;  1FWZ A;  2IA2 A;  1UB9 A;  3EYY A;  2STT A;  3KE2 A;  2LDU A;  1LNW A;  4IF4 A;  3E5Q A;  3H92 A;  4G8X A;  2W25 A;  1K79 A;  2BGC A;  2EFP A;  2IJL A;  4NB5 A;  5FB2 A;  1LB2 A;  1XCB A;  4Q48 A;  2A07 F;  1EH7 A;  2L54 A;  5AIQ A;  3HTU A;  4BYY A;  3JTG A;  1OYI A;  3V7C A;  2AS5 F;  3GYH X;  3V7R A;  5EEG A;  2V1X A;  3DV8 A;  1U5T B;  2GA1 A;  3SFZ A;  4UV8 A;  1SFU A;  2MH9 A;  3GLX A;  4PGG A;  2KIU A;  5JVT A;  2DK5 A;  1IRF A;  5LHH A;  3GO5 A;  1IF1 A;  2V79 A;  5A2Q Z;  4EGZ A;  2RVC A;  3ECO A;  4L5J A;  4JQF A;  3U9G A;  2HYG D;  2IA1 A;  1XDU A;  4AD9 A;  1ZHF A;  1EH8 A;  3ZMS A;  3N4M A;  3F8N A;  2QBY B;  3I64 A;  3E6C C;  3K69 A;  3JAM Z;  2WV0 A;  4ZZD A;  3JSO A;  1YTY A;  2PMU A;  3ZN1 A;  1MJB A;  4KDP A;  1WQ2 A;  1BI1 A;  4WXH A;  2M45 A;  2Y75 A;  2EFW A;  3PQK A;  1BI2 A;  1ZH5 A;  2QYO A;  1QO0 D;  2NAZ A;  2PEX A;  1YFH A;  3WTX C;  3OOP A;  4R8H A;  3NRV A;  1BJA A;  3U2R A;  2W24 A;  5LEJ A;  1EV7 A;  3ZN0 A;  2K7L A;  2EFO A;  5DUI A;  2IA0 A;  4RGS A;  3FMS A;  4UVA A;  2Z5U A;  1SAX A;  2GA2 A;  1OKR A;  5FGM A;  4WXD A;  4AWX B;  2LSO A;  3BJO A;  2HKO A;  2L3D A;  3CO7 C;  2XAQ A;  2NYX A;  2FNP A;  4KIC A;  3V8L A;  4I0B A;  1Y0U A;  2FNA A;  2VBX A;  4PZJ A;  2BEO A;  4DNC A;  1I1G A;  4GXO A;  3KZY A;  3O6B B;  1R58 A;  1KU3 A;  3WGH A;  2QQB A;  4CYD A;  1U5T A;  2XAJ A;  3HSF A;  4IHS A;  4KN4 X;  1ZYR F;  1W4M A;  3GVA A;  4N0B A;  1FYM A;  3M7G A;  2GQQ A;  2R3S A;  2K27 A;  1MDM B;  4ETS A;  3CJN A;  1RIO H;  1IUY A;  4P55 A;  4OIN F;  5E1W A;  2DPD A;  2DAO A;  4BQA A;  1P4X A;  3QP5 A;  2XGX A;  2Y48 A;  1XGO A;  4G7H F;  3LA2 A;  1S7A A;  2QBY A;  4LG0 B;  1UHM A;  4GCV A;  1WRJ A;  1NHA A;  5D5W B;  4EJV A;  3J81 K;  2H6B A;  2ZNZ A;  4YG2 F;  1XD7 A;  4MEX F;  2Z99 A;  2OZ6 A;  1ZG1 A;  4ZYG A;  5FFX A;  4B8X A;  2F2E A;  2RGV A;  2L02 A;  3HYI A;  1LQ1 A;  1JHF A;  3KP5 A;  3F8F A;  3FMQ A;  5ERI A;  2EFQ A;  5D6F A;  1Z91 A;  3QPH A;  1FPQ A;  3KEQ A;  1FOK A;  3E97 A;  2E7W A;  4MHG A;  3WTT C;  1ULY A;  1R23 A;  3IL2 A;  4RAY A;  5JFR A;  2EWN A;  1QPM A;  5ILV A;  3KP3 A;  1DP7 P;  3BPV A;  3CUQ C;  4EJT A;  2ISY A;  4WX9 A;  1I1S A;  2IW5 A;  2RV8 A;  3ZMD A;  2VBZ A;  1FZP B;  5K5R A;  4HF0 A;  3QU3 A;  3T1B A;  2EV6 A;  5J6X A;  4G94 A;  1ZN2 A;  5DD4 A;  3WGG A;  4A2U A;  5D5U B;  2UXN A;  2XUB A;  2OU2 A;  2YX7 A;  3E5X A;  1PUE E;  3FWE A;  5A2Q K;  1ZGJ A;  2V9V A;  1RNL A;  1ZRC A;  1IN7 A;  3K9T A;  1XGN A;  1MDM A;  1JXS A;  1BN5 A;  2EA2 A;  3Q9S A;  3HRS A;  1FP2 A;  1K6O A;  2H09 A;  1P4W A;  4RAZ A;  2CSO A;  1FYL A;  2ESH A;  3E6D A;  4U7B A;  3GF2 A;  5HS9 A;  1AOY A;  4EJW A;  1IN5 A;  2VON A;  1G4D A;  2MBF A;  5CYV A;  5E20 A;  4MEY F;  1ONV A;  2M30 A;  5F64 A;  4KIF A;  4N9H A;  4RS8 A;  4HLX A;  4YFX F;  4RGX A;  5L3E A;  2DI3 A;  2JTV A;  2VOO A;  4Y13 A;  2UZK A;  4BAY A;  1U78 A;  1YG2 A;  3B73 A;  2NNN A;  4M9S A;  2VBY A;  1J5Y A;  3RJP A;  2L01 A;  3HRM A;  3ECH A;  4KA4 A;  4UUV A;  3B02 A;  3GXO A;  4BHC A;  1BIA A;  1OYY A;  1T6S A;  1R22 A;  3HSE A;  4KUM A;  4EJU A;  1G6N A;  4E70 A;  3MCZ A;  1SD5 A;  1K7A A;  1YQA A;  1OMI A;  4R1H A;  4UV9 A;  1P92 A;  5E17 F;  2DW4 A;  5DV5 A;  1I27 A;  1HQC A;  2VOD A;  2H94 A;  4PGH A;  3FM5 A;  4XRF A;  4H0E A;  1YYV A;  2CYY A;  3CTA A;  4CZZ A;  1G3T A;  4A0Z A;  2EB7 A;  2CWE A;  1F9N A;  2JRT A;  2W84 A;  5BQT A;  3IKV A;  1DUX C;  2HDC A;  1BOA A;  5LHI A;  4P96 A;  2PBI A;  1HBX G;  5BS6 A;  3MAJ A;  1SMT A;  1STZ A;  2XAS A;  5E1Z B;  3I54 A;  1K78 B;  4NQW A;  4HAM A;  5HOO A;  2FU4 A;  4IHT A;  3MEX A;  1REP C;  3FX3 A;  3TDU C;  4HDU A;  3QOP A;  3J80 Z;  1TNS A;  3EYI A;  1ZGA A;  3WE3 A;  4G7O F;  3MZY A;  5D8L B;  1XDS A;  4QLC U;  3BJA A;  2XRO A;  3QP6 A;  2BBY A;  2RDP A;  4U7D A;  3JSP A;  3DPT A;  4CIC A;  3HOT A;  3WE2 A;  2BYV E;  2R7F A;  4HDV A;  4MTD A;  4KIB A;  2OZU A;  3KFW X;  4WK8 F;  2HKX A;  4RB3 C;  4IVN A;  1W5S A;  4PCQ A;  1U8R A;  1I6X A;  4G7Z F;  1TTY A;  3BOQ A;  4RB2 C;  1J9I A;  3ROU A;  1IN8 A;  4XSX F;  2FE3 A;  4BXU A;  3RYP A;  4P9U A;  4L0Z B;  5E18 F;  1B9N A;  3SXY A;  4S04 A;  2OA4 A;  4U0V A;  1LEA A;  2FBK A;  3WU0 A;  1Z7U A;  3J7A O;  3DEU A;  1V3F A;  2WC2 A;  2VE9 A;  3WTZ A;  1Z1D A;  5H20 A;  1H0M A;  2BV6 A;  2HGC A;  2O0Y A;  3FXQ A;  2EK5 A;  3ZMT A;  3GX4 X;  3ZPL A;  5LGU A;  2K4J A;  1ZLK A;  3L09 A;  4BHB A;  1QZZ A;  2V1U A;  3IWF A;  2FSW A;  3L00 A;  2G9W A;  3WU1 B;  1R5G A;  3ULQ B;  3LWF A;  1IXS B;  3I0T A;  4EQQ A;  3SZP A;  4KIG A;  2A69 F;  4ENM A;  3IRR A;  1K78 A;  1DPU A;  5JHU A;  1E2X A;  3ABT A;  1L0O C;  2VT3 A;  1R1V A;  4A0Y A;  2MA3 A;  5HDN A;  2P7C B;  5IT3 A;  4OMZ A;  3FM3 A;  3GUD A;  4IXA A;  1YS7 A;  2KJB A;  1B9M A;  1HW1 A;  4EV0 A;  1BI3 A;  5KVR A;  4DQ2 A;  1CF7 B;  1OYW A;  3JTH A;  2DQR A;  2VC1 A;  5E8I A;  3IRQ A;  3SQN A;  2HTS A;  1QBJ A;  3TOA A;  1U2W A;  1R00 A;  4HZF A;  2QZ8 A;  3NEU A;  1QGP A;  3IWZ A;  1P2F A;  3TO9 A;  4FX0 A;  3T5X A;  1KQ9 A;  3ZQ7 A;  4F7Z A;  1B4A A;  1WI9 A;  3KP2 A;  1R1U A;  3C18 A;  3C1D A;  2O03 A;  2CW0 F;  5KK1 A;  1ZLJ A;  3V8J A;  5K1Y A;  1U3E M;  4MNU A;  4LB5 A;  2UXX A;  2HTJ A;  2E1C A;  3VEP A;  2DO7 A;  5E8G A;  4K2E A;  4TV7 A;  5H6R A;  3LST A;  4ESF A;  4G9Y A;  4GGG A;  1MGT A;  1HW2 A;  1IN6 A;  2ZNY A;  5BPD A;  3W6J B;  5CVU A;  4I01 A;  4KN7 X;  2XHK A;  2UWM A;  5L3B A;  4CDG A;  3IKT A;  3LQR A;  4ESJ A;  3I58 A;  3J80 K;  3F6V A;  4R79 A;  5FFZ A;  2AXL A;  1LDJ A;  3KEO A;  4HX8 A;  4KYW A;  5F6F A;  3BY6 A;  3V8K A;  2DLL A;  1SFX A;  4L9J A;  2ZXJ A;  3WTU C;  4UXN A;  5BPI A;  5BMZ A;  1RUO A;  2J5O A;  3H3U A;  1IN4 A;  3C3W A;  1S6L A;  4LMY A;  1CF7 A;  1F1Z A;  2KIM A;  3WTY C;  2IPQ X;  1USS A;  2KKO A;  2FXA A;  3O3K A;  3WOD F;  4IRH A;  1XB4 A;  5HLG A;  1UHW A;  2QUF A;  3FZV A;  2P8T A;  2DK8 A;  4OOI A;  3N97 A;  1J7K A;  3GEZ A;  4BH9 A;  1FLI A;  1WKM A;  4CXF A;  2G7U A;  1XCV A;  1S7O A;  2XAH A;  5ED4 A;  2ISZ A;  2VC0 A;  1O7F A;  1EH6 A;  4EGY A;  1TQP A;  4A0X A;  5HDG A;  1J59 A;  2VXZ A;  5DYM A;  3RKW A;  2DQL A;  5CVR A;  3KET A;  2PJP A;  4EM2 A;  4ENJ A;  4XSZ F;  1RUN A;  4Q5S F;  1TQI A;  3GWZ A;  2EV5 A;  2FQ3 A;  4P9F A;  2RNJ A;  4BHP A;  1U5T C;  3IC7 A;  2FOK A;  4LB6 B;  1ODD A;  2M5W A;  5EEH A;  2PQ8 A;  1S8N A;  3F6O A;  3GFI A;  2V6C A;  4S05 A;  2OD5 A;  1QQI A;  4MTE A;  2GZW A;  4HX4 A;  1R1T A;  1XSV A;  1IRG A;  3F72 A;  2HQN A;  2K02 A;  1XMA A;  1GVJ A;  3QAH A;  3K1M A;  2CG4 A;  4LD5 A;  5F1R A;  6PAX A;  2XKP A;  4KNY A;  2YPR A;  3BJ6 A;  1SD4 A;  1HXD A;  3R60 A;  1L3L A;  2VOP A;  1O3T A;  4FT8 A;  2JZY A;  2JSC A;  3EET A;  5K5O A;  3S2W A;  2JPC A;  4I02 A;  1ZRF A;  3O2P E;  4LFU A;  4ZZL A;  3KZZ A;  2W85 A;  4Z2Y A;  3BP8 A;  3W6K B;  1YIO A;  5H6Q A;  4GO1 A;  2E7X A;  5DDG A;  3C7J A;  4HV6 A;  4Q47 A;  2X0L A;  3E5U A;  4BNC A;  1ZAO A;  1ZG5 A;  4HQE A;  3F8B A;  4AIH A;  2O8X A;  4PDK A;  5FLX K;  1KQ8 A;  2Z3Y A;  2NS0 A;  3MQ0 A;  1FY7 A;  5HDK A;  4NHJ A;  2L4A A;  1Z9C A;  3WTS C;  3P9K A;  1R36 A;  1QZY A;  3NQO A;  1LJ9 A;  1D5V A;  3TOB A;  2G7H A;  2FA5 A;  1KA8 A;  4XBF A;  3LFK A;  2PLY A;  2CO5 A;  4EM1 A;  1YO5 C;  3HHG A;  3R6S A;  1MKM A;  1U6G A;  2RC4 A;  1YLF A;  2F5F A;  1ZG3 A;  4D0P A;  1GHC A;  5ILU A;  4ZYD A;  3REO A;  2IVM A;  2O61 A;  1Z6R A;  2HYF A;  3ERE D;  5TRD A;  1FP1 D;  3U1D A;  2RN7 A;  2VBW A;  2A3S A;  1XGM A;  2Q0O A;  4QWQ A;  3K1P A;  5D4S A;  4WCG A;  2EV0 A;  2D45 A;  1SMY F;  2NRA C;  2GXB A;  2Q8K A;  3KLN A;  1H9G A;  3L7W A;  2ZJ2 A;  1O3Q A;  3MWM A;  3SHF A;  4AIJ A;  2A5Y B;  1B59 A;  2MLG A;  3RDI A;  5CVV A;  4CHU A;  3LA7 A;  2IRF G;  1KYW A;  2PMH A;  3BDD A;  1T2K A;  2CGP A;  2O3F A;  5HVQ C;  2M87 A;  5AON A;  1XSD A;  2GWR A;  4I0A A;  3F8C A;  1MJA A;  2TDX A;  5ICE A;  1FX7 A;  4M9X A;  3DQV C;  3E6M A;  5CJ9 A;  2HR3 A;  5L3D A;  3VOE A;  4LJZ F;  4N9I A;  1H9T A;  3JW4 A;  1J75 A;  3RKY A;  1DPR A;  5ICF A;  4GYI A;  2F5C A;  1V4R A;  4LLG F;  1G3S A;  3F23 A;  2XAG A;  2P6S A;  2OBP A;  3I53 A;  1UCR A;  4KMU X;  3FXU A;  3LAP A;  4HOB A;  4UHT A;  4GYG A;  2ZKZ A;  3GW2 A;  3F3X A;  1TW2 A;  2IT0 A;  1UST A;  5ILS A;  2PN6 A;  1E17 A;  2O6G E;  2B0L A;  4HF1 A;  4A5N A;  5L3C A;  3ELK A;  2ACJ A;  4MQV A;  3E3V A;  1FT9 A;  4UVB A;  1Z6T A;  4I2O A;  3R0A A;  5LGT A;  3CO6 C;  1QNT A;  1BM9 A;  4RGR A;  4M9Z A;  5K5Q A;  1A04 A;  1PP7 U;  3RKX A;  5LHG A;  3T8T A;  4MQ9 F;  2X4H A;  1YS6 A;  1KQ0 A;  2J5P A;  2VE8 A;  4LLN A;  2HWV A;  3V7S A;  3TO7 A;  2P5V A;  3VFZ A;  2VN2 A;  5D5V B;  1FSE A;  3TO6 A;  4OIQ F;  3KP4 A;  3VOD A;  3ZMZ A;  2KJC A;  2RKH A;  2ETH A;  2XIG A;  3T0Y A;  2GAU A;  3DF8 A;  4HA8 A;  2DPU A;  1YW7 A;  3FHZ A;  2H6C A;  3HRT A;  4OIP F;  3K1N A;  1W7P B;  2ESN A;  3GZ5 A;  2P6T A;  4Y15 A;  3F21 A;  3PQJ A;  5D8K B;  2H27 A;  2DBB A;  2BE5 F;  1WWX A;  1ZRD A;  2A61 A;  3IHU A;  1O3S A;  2Z9O A;  2FRH A;  4M71 A;  1OR7 A;  3R61 A;  3VB2 A;  1O3R A;  1RZ4 A;  2FML A;  1T39 A;  3LQQ A;  4JK1 X;  1Z05 A;  3CUO A;  3TGN A;  1XN7 A;  4ZYH A;  3OV8 A;  1HKT A;  4M74 A;  4EMS A;  3HRU A;  3HOS A;  4KT5 C;  3FF5 A;  4ON0 A;  3RTR A;  3H3Z A;  3I5U A;  1OPC A;  4ESB A;  4OIO F;  2E1N A;  5AIP A;  3L2C A;  2P4W A;  1ON2 A;  5LBQ A;  5FLX Z;  4M72 A;  5CVJ A;  1T38 A;  2XAF A;  3TQN A;  4ZYE A;  4FX4 A;  1FC3 A;  4IPA A;  1FSH A;  1F5T A;  1KU2 A;  3RI4 A;  2OQG A;  3CUQ B;  3FXR A;  5FO5 A;  1G3W A;  1HKS A;  4B09 A;  3BRO A;  2QEN A;  1RI7 A;  5DUK A;  5BOX A;  1BC7 C;  4RGU A;  4O3M A;  1XGS A;  3KLO A;  2M8E A;  1BC8 C;  2EJR A;  5ICC A;  1W5T A;  4G6D A;  1KU9 A;  3I71 A;  4LK0 F;  1YW9 A;  5J8C A;  3P9C A;  1B1B A;  4U0W A;  4P5O A;  1S3J A;  2WWY A;  1D8J A;  1W7P A;  1LDD A;  3WG9 A;  3G73 A;  1BIB A;  3F22 A;  1IZ1 A;  3LA3 A;  2FBH A;  3HHH A;  2R7D A;  5DD8 A;  4ENK A;  1FBQ A;  2CFX A;  3KCC A;  2KIF A;  4A6E A;  3RPU A;  2M1B A;  1Q1H A;  2FEZ A;  4A6D A;  4EVI A;  3I59 B;  4I09 A;  1DDN A;  1HW5 A;  1D3Y A;  1FBS A;  2QM3 A;  2LF7 A;  1D8K A;  3PFI A;  5FD6 A;  3E6B A;  2ZO4 A;  4EM0 B;  1O57 A;  3G3Z A;  3Q5F A;  1KYZ A;  4HW0 A;  4L0Y B;  3R4K A;  5LEK A;  4UNO A;  1BBY A;  2DT5 A;  3RYR A;  4HF2 A;  3KP6 A;  3GFL A;  2F5E A;  1MZB A;  2QLZ A;  4HBL A;  5IT9 Z;  4YFN F;  4G6Q A;  3RIR A;  2PI0 A;  1FYK A;  2ZME B;  3CUQ A;  3M1E A;  1O7L A;  4UVC A;  1FBU A;  4HYE A;  2ZBK A;  1G3Y A;  4L9T A;  4RB1 A;  1VTN C;  2QQA A;  1TLH B;  2PG4 A;  1R7J A;  2LF8 A;  1ZRE A;  5JI6 A;  5HLI A;  3GZ6 A;  1CGP A;  1TW3 A;  1S29 A;  1WSU A;  4L9V A;  4HX7 A;  3L9F A;  3EQL F;  3T8R A;  4CO8 A;  2OQR A;  4U0Y A;  1P6R A;  2JT1 A;  3DP7 A;  1KU7 A;  3ZP5 A;  2D1H A;  1ON1 A;  1R5H A;  2OAZ A;  5J8F A;  3ZMU A;  1MD0 A;  4HV5 A;  4YFK F;  3I4P A;  3P9I A;  4O5V A;  4KMF A;  1T98 A;  5L3F A;  1IXC A;  1JE8 A;  2NNY A;  3WTW C;  4IRI A;  3AAF A;  2RQP A;  3I59 A;  1IAW A;  1I5Z A;  4A12 A;  2XKO A;  1TQM A;  3HTS B;  1LVA A;  5LGN A;  2WTE A;  3BPX A;  4JBA A;  1LEB A;  3EDP A;  4LGW A;  3BWG A;  3DFG A;  2MH2 A;  3HIF A;  5LRR A;  3CDH A;  5CLS A;  5HS8 A;  4I98 B;  3QPT A;  2FF4 A;  4KFC A;  3KP7 A;  3JAM K;  4RB0 A;  4L9N A;  2P7V B;  3MZH A;  2MC3 A;  3P7N A;  1B6A A;  4M73 A;  4CGZ A;  2C6Y A;  1ZAR A;  2ZME A;  4I7H A;  4LG0 A;  4OMY A;  4ASN A;  4U88 A;  2STW A;  2QWW A;  3V4G A;  2A68 F;  1IW7 F;  2LKP A;  5LRS A;  1T0F A;  2FMY A;  3TKY A;  3EUH A;  3HUG A;  5FD5 A;  2ADU A;  2LNB A;  2A6E F;  1P4A A;  1HST A;  4AVP A;  4WXC A;  3Q9V A;  5HLH A;  1IXR C;  2EA4 A;  4Q4Z F;  1GXP A;  2MLK A;  3F8M A;  3BZ6 A;  2HQR A;  3FMR A;  2IP2 A;  4HLY A;  2KRF A;  4OIR F;  3HSR A;  3GFM A;  2XRN A;  2GIV A;  4EJO A;  1YW8 A;  4A5M A;  3WGI A;  3GFJ A;  3M8E A;  2DU9 A;  3QU6 A;  1LDK B;  1TBX A;  1SD6 A;  3K0L A;  1W7P D;  4MGR A;  3D5L A;  3K2Z A;  3ISP A;  1C0W A;  5DEQ A;  2F5D A;  2XV4 S;  2K86 A;  3RPQ A;  5DCM B;  5D6E A;  4FHT A;  1SD7 A;  4AIK A;  2D2W A;  2W57 A;  1TNT A;  5IT9 K;  1F4K A;  3MFK A;  1XSX A;  3QRF F;  2L4M A;  5E1X A;  1PP8 F;  2YX4 A;  2HS5 A;  1J2X A;  4ZH4 F;  2P5L C;  1X3U A;  5D5X B;  1SFE A;  2Y0M A;  5D4R A;  2QVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...