1UCVA

Sterile alpha motif (sam) domain of ephrin type-a receptor 8
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
GSSGSSGLTVGDWLDSIRMGRYRDHFAAGGYSSLGMVLRMNAQDVRALGITLMGHQKKILGSIQTMRAQLTSTQGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structure of Sterile alpha motif (SAM) domain of ephrin type-A receptor 8
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords EPHRIN TYPE-A RECEPTOR 8
total genus 18
structure length 81
sequence length 81
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2003-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1ucvA00
2E8MA 3KKAC 1B4FA 2ES6A 1LKYB 3K1RB 2QKQA 4RQNA 2YTUA 1X66A 2ESEA 1V38A 2D8CA 1X9XA 3TADA 5J8YC 1SXEA 1Z1VA 2KIVA 2F3NA 3TADC 5J8YA 1DXSA 2EAMA 2EAOA 3SEIA 2E8NA 2DKXA 1UQVA 2B6GA 2L5YA 2EAPA 2D3DA 1SV4A 1SGGA 4NJ8A 3BS5B 5JU5A 2KE7A 1SV0A 2F8KA 1PK1A 2GLEA 4PZNA 1PK1B 5KNIA 1PK3A 4MHVA 3KKAA 5JRTA 2E8PA 1JI7A 4NL9A 1V85A 1LKYA 3BQ7A 2QB0A 2K60A 2QARB 4RQMA 1F0MA 2DKZA 1SXDA 2KG5A 1OW5A 4PZOA 2JV3A 2Y9UA 3TACB 4IS7A 2LPEA 2QB0B 2QARA 3H8MA 2QB1A 2KSOB 2F44A 4NL9C 1KW4A 1B0XA 1UCVA 3SENA 3HILA 1SV0C 2KMDA 2DL0A 5JTIA 2KSOA 5L1MA 1WWVA 1RG6A 3BS5A 1X40A 5F3XB 2FE9A 2K4PA 3IDWA 1OXJA 2LMRA 2EANA 2E8OA 2Y9TA 3BS7A 1WWUA 1COKA
chains in the Genus database with same CATH superfamily
1IG6A 2AGPA 2QKQA 4P0PA 5KT7A 4Z6DA 2CXYA 1PVPA 2BPGA 1L7PA 2ZUBA 5KG7A 5C0YA 1NJWA 4IRDA 4O5EA 3OHBA 2OXOA 5GTIU 2W55A 1TAUA 4PHDA 3ISCA 3SAHA 2HSZA 4HYKA 2MUTA 3AU6A 2GWSA 1IXRA 5HHHA 4F50A 2JEFA 3E58A 2ZIVA 2W9AA 2JEJA 4I2DA 5AKGA 1JRPA 2UVWA 1NK4A 2CPRA 5DBBA 1RYSA 4Z6FA 3C2MA 4F8RA 4QW9A 3Q8KA 1RDFA 5ALRA 2WAQF 4KLHA 1J2MA 5IIOA 1NOMA 5EE3A 1QTMA 4I29A 1Q3VA 1SXDA 1ZQAA 3JPPA 3SAFA 2F1JA 2LPEA 3MR5A 2G5HB 4GC7A 1NKEA 1N5WA 2J6TA 2R8KA 5DKWA 4KLEA 4DSFA 3H40A 8ICSA 4O5KA 3MGVA 2XIDA 2ZIWA 4BUGA 2AQ0A 3M9OB 8ICNA 3GZFA 5HNKA 3RAXA 1T3NA 2WB1F 3RJHA 5KFIA 2NO5A 3GIIA 3HKZF 5ALHA 5ALDA 2ZIXB 5L1LA 8ICFA 2KFZA 1NK6A 4NV0A 1T3QA 5AKZA 5DBAA 5CB1A 3HPOA 3EW9A 4DFKA 2BHNA 5KFHA 4UB4A 4ACOA 1KL9A 5KG4A 4EYIB 2FDRA 4IR1A 1V38A 1CRXA 1JN3A 5AICA 2W9CB 2BCQA 4RZRA 3J81j 5AHXA 2P66A 9ICFA 1A6SA 7ICUA 3PX4A 2KN7A 1JIHA 5AI8A 3CNHA 2R8HA 4U6PA 4M9JA 5T14A 1N62A 4I2CA 3B0YA 1WG8A 3PR5B 8ICEA 5KAFU 5ALUA 2PFOA 2B6GA 2EAPA 3NTUA 2PMZF 2CN1A 1ZQKA 3FAHA 5KG3A 5KFLA 3PMNA 2I9GA 3QUCA 3PSTA 1XO0A 2MRLA 1ZQOA 5J0XA 1B43A 2W11A 2UVVA 4YD1A 3MR6A 1CI4A 2HBJA 2OHFA 2MAXA 2NRZA 1NK7A 5ALLA 3RAQA 4QWCA 9ICCA 3N7RC 4FE3A 4BXOB 2N1RA 3WKEA 3GV8B 2K60A 3EUB2 4UAWA 2R18A 4ECVA 4HAIA 2GOLA 3G6YA 4GFJA 5J0YA 4KLDA 2MU2A 1WUDA 3RJGA 2RDJA 7ICSA 1BNOA 5L1IA 4XRHA 1XSNA 3RJEA 5ALEA 4K4IA 4UB2A 4X5VA 2AGQA 3UQ2A 3ED5A 1BPYA 3VCBA 4KLMA 5HHIA 1ZQDA 2H3FA 4QWDA 1WWVA 3WKAA 4UW9A 5CWRA 4RPZA 3BS5A 4PGQA 3RJIA 2KOBA 3N4MB 3F2BA 3GIKA 3M8RA 2Q4TA 5ALFA 5AI5A 3RR7A 2ASJA 2PFQA 1PVRA 3UXOA 4DL7A 1ZQ1C 1N2XA 2KFNA 3H4DA 4QZBA 3F5AA 4C7ZA 8ICAA 4O3SA 2XICA 3R9KA 5J8YC 4U7CA 3H4BA 3QEBZ 9ICGA 5KL1B 3WK5A 5EE9A 1DXSA 4PPXA 3WKDA 3AEVA 4NLZA 2EAMA 2HBMA 4C8KA 4KLFA 5KFTA 2DUYA 1MC8A 4ZOHC 4FS2A 5KFQA 1SV4A 1ZD3A 2KZZA 1DRGA 3SV4A 1V9PA 1L6NA 3VC8A 3OPXA 2F8KA 2VANA 1Y88A 2GLEA 1PK1B 2E1EA 4ICAA 2HBLA 4IR9A 1HIWA 1RYUA 3FYHA 2F2AB 3AMZA 3T79A 3PSPA 1ZRNA 3ZD9A 3ZDAA 4GIBA 2ZIUA 2Y9UA 3HJEA 2VA8A 4QJFB 3N7PD 7ICGA 3JPNA 2QB0B 2I1QA 2VJ4A 2ATLA 8ICOA 2KP7A 5ALZA 1YZ7A 4NL9C 2ZXIA 1MQ2A 4RQ3A 5HR6A 1PVQA 2Z7JA 5AM1A 5HP4A 2ZIWB 2F76X 4DL3A 5AKYA 1U47A 1ECWA 4KMOB 1T4GA 2HHVA 4F4KA 4QWEA 4YR0A 2NRWA 3V6JA 1ZQZA 2KHQA 3QUTA 4Y2JA 4P0PB 2BQ3A 9ICEA 1F44A 3BS7A 4CE6A 5J0OA 4OCZA 3EPIA 2IOHA 9ICJA 1L3UA 2LYAA 3AUOA 1QQ7A 5ALVA 1DGJA 4ELVA 3ICXA 3KOOA 4F5QA 3RH5A 1X66A 1TK5A 1S0MA 1X9XA 2KJ5A 2A3VA 5AKLA 3C28A 2WTFA 3EZ5A 5EWGA 8ICCA 2DKXA 2WF8A 4J9QA 2XCPA 1S9FA 4OO1J 7ICPA 9ICKA 2JHDA 5KG0A 2W9BB 3GDXA 2XO7A 4C0ZA 1Z19A 4B9LA 3MR3A 5KNIA 3OTQA 5KFAA 3RBEA 1TKDA 2P6UA 3F2CA 4Q8FA 1V85A 2XY6A 4RUCA 3Q8SB 4RNOA 4M6WB 5J2FA 3HWTA 2OH2A 1IIPA 3L5KA 4RQ5A 2BCRA 4PZOA 3TACB 4F4XA 3CYMA 1L7NA 1MN8A 2ISOA 3D6JA 5J2KA 3T3FA 4C8OA 4AP9A 5KFRA 3RJFA 1AROP 1JUDA 1SL1A 3BZKA 4QNLA 3PZPA 3OJSA 3UXNA 5J0WA 1Q8KA 3LWLA 2KSOA 2F77X 3PX6A 5KFPA 1ZXIA 1RXWA 4KLLA 5J2IA 2JZBA 3ISDA 2W7PA 1OXJA 1DGSA 1ZQQA 4KLSA 5IIMA 1S5LU 2JH1A 2K4EA 2A1AA 4P0QA 4RPXA 1COKA 5KFOA 2C2EA 7ICEA 4I2FA 1URJA 7ICOA 5HR7A 2W54A 1QQ5A 5KFZA 5J2JA 3Q8RB 2J6SA 4J03A 4BDPA 1UT5A 4EX6A 2K8AA 3WK9A 1IV8A 2DGZA 1ZQGA 4OJPA 4QWBA 2E8NA 3QUQA 5C5JA 4DLGA 4EX7A 4Q43A 4ED7A 4FBTA 1KFSA 1X9MA 1NKCA 1V97A 3TFRA 3GILA 1ZQMA 1KEJA 5DB7A 3RRGA 2EQYA 4PZNA 1P7DA 3Q8MA 4M6WA 4Z6CA 3Q8QB 3QU9A 4MF2A 4KX5A 3QZ7A 1KKXA 3TARA 2UVUA 4UBCA 4CDGA 4F5RA 2PFPA 2KNJA 1PZNA 2DKZA 4IRCA 2NV3A 5BOMA 4IS7A 3RBDA 1QSYA 3H8MA 4J9MA 3LWMA 1S76D 5EWFA 3H7IA 8ICPA 4PL2A 5DB9A 1Q46A 1Z00A 3MDCA 2LM1A 3L3FX 1XS9D 3TFSA 1Z00B 3IDWA 1AQ6A 3IG8A 1TAQA 1U45A 4J9LA 2YX8A 3FM9A 5AI0A 3PW7A 5ALTA 4EZ6A 1VDVA 1TFRA 3KKAC 4J9OA 3PVXA 1U48A 4DOCA 4GC6A 3AQEA 2ZJAA 5KG2A 1FFUA 2B21A 2DFLA 3SMVA 2JEIA 3PW4A 4JB3A 5DGAA 1OUQA 5J8YA 2XCAA 2HOFA 2NO4A 2AU0A 2MUTB 3PW2A 2MSNA 4DQRA 4Y2VA 3IM1A 4DO9A 1UT8A 4RQ7A 4UQGA 2XI9A 2JZBB 4C4SA 3BS5B 4DF4A 8ICLA 4Y2PA 3EWAA 3PO5A 4I2IA 4Y2UA 1QLNA 1ZQCA 4NWIA 4YR3A 1UHUA 4I2BA 5TZVA 4EBEA 4B6JA 3ZDCA 3EPGA 1JI7A 4NL9A 3KHGA 2ZJ8A 5AM2A 5KT3A 5AKJA 5AM5A 3M9MB 1QSSA 1RQLA 8ICKA 3GQCA 4ECYA 1ZQHA 2JV3A 1U9LA 2KJ9A 1SZHA 4P2HA 1NZPA 5DGBA 8ICBA 4DFJA 3MDAA 4I2EA 3AQFA 5KG6A 2EZYA 1KW4A 1B0XA 1RM6C 8ICJA 3B0XA 2KICA 4BWJA 3SENA 3AM9A 3E0FA 4O9MA 5KFBA 4DQSA 1K1SA 4RU9A 1ZQJA 4I2JA 3UPQA 5ALXA 3RH4A 2PI5A 5IIJA 5ALPA 8ICRA 1BVSA 4YQWA 5KFKA 3RRHA 4Y2TA 4FZMA 3SZ2A 2JEGA 1WWUA 3C2LA 5ALJA 3HRDD 4M9NA 9ICIA 3QU7A 2K8BB 4CF5A 4M47A 2E8MA 5TISU 1YZ6A 4JUZA 4Y2RA 5KT2A 4US9A 5DG8A 4IQVA 4OJLA 4ECUA 4IL6U 3FC4A 4ED6A 4YXJA 3M9NB 2EDUA 4J9PA 3L4PA 7ICTA 4UAUA 2K8CB 5KG5A 3HT3A 2ODGA 4EENA 4O3QA 5KFJA 1Z4NA 4Q44A 3NVZA 4NY8A 4IQUA 1RPLA 1Z4OA 1JROA 4DWIA 1N5XA 5AI4A 1JX4A 5D49A 5IIKA 4G9BA 4TUSA 1LKYA 5F9LA 2ASDA 2PI4A 3JPSA 2O6KA 3F53A 1VLBA 4O3RA 4DLEA 5AKIA 5KT5A 5J2AA 9ICQA 4R64A 4JWMA 4TUPA 4WJ3B 3WKBA 3PW5A 4XA5A 4QZDA 1QH9A 2F44A 3C2KA 1JMSA 4BGDA 4RT2A 3E2EA 1D9DA 2WF9A 5KT4A 2HHWA 1J2NA 4B9VA 4JV1A 1Z1BA 3MC1A 5DG9A 2XGPA 4UB6U 4JWNA 7ICFA 5J2BA 2WF7A 1L7MA 1U4BA 1H38A 4KLGA 1L7OA 2HHUA 2FMSA 4YD2A 2AXTU 5HMMA 3MGHA 3UMCA 4ED1A 3K1RB 2BPFA 1KFDA 3OSNA 4DSJA 4ELUA 2D8CA 4PGXA 4KITB 3GV7B 1Z1VA 2KIVA 4OJ6A 5JUMA 2XY7A 3GV5B 1XU4A 4NLBA 4DL6A 4F3OA 1O08A 5KFSA 3SEIA 5DQIA 2AJQA 2MA1A 2BDPA 1UPHA 2P6RA 1K5OA 3MBYA 2BKEA 5AKXA 4BX9C 2W3RA 4UB1A 8ICZA 2WFAA 1KRPA 2FPMA 1BPEA 1CEZA 4UB5A 3TQ1A 1NJXA 1HEKA 2BR0A 3KZXA 2HI0A 2RP5A 4ED2A 2F1IA 1ZD2P 3QNMA 3QEAZ 3KKAA 3QU2A 1UA1A 4C8MA 2LYHA 3GIJA 4RQ2A 3ORYA 3NVVA 3OHAA 5J29A 2ZTEA 3ISBA 5KFEA 2RRDA 1SKRA 1ZQVA 2K89A 5KFYA 1BPXA 2BQRA 1L5UA 3KBBA 1UCVA 2BCVA 4Z6EA 7ICQA 4EBCA 3SI8A 5DBCA 3K4GA 4IQTA 4B9SA 1HJPA 4C8NA 5AM0A 5CP2A 1TE2A 3KTQA 4KLTA 1WCNA 1PUZA 2OEHA 1L3SA 1KDHA 3Q8LA 1TK8A 2W43A 1D8YA 3TI0A 1ZQXA 5J0UA 3M1YA 3NRZA 4F2RA 7ICJA 2ES6A 4MFAA 5KTQA 2RHFA 3V7LA 4B9MA 9ICNA 3QU5A 5ALGA 1SXEA 1NZBA 3QUBA 4DCCA 4KLIA 5B66U 3NASA 4GXKA 2DQNB 4RNMA 4LZDA 4EYHB 3SQIA 4QZ8A 5CA7A 4NLCA 2FLPA 1GO3F 2F1HA 2YMMA 4F92B 5HMLA 4Y2YA 4M9HA 2HMXA 3M7DA 5AKEA 3RJJA 2R8JA 3QZ8A 4DOAA 5AK5A 3QE9Y 4MEXA 2IOFA 2OM6A 2ZUCA 2H3VA 2AH5A 3M6ZA 3WK4A 1HUZA 5AKHA 4E0DA 4DQQA 4ECRA 3CRXA 2FMPA 4ED8A 2R8GA 1RXVA 1C7YA 5J0RA 2NYVA 2H3ZA 1KSPA 2C28A 4US8A 4UB8U 8ICTA 4RQ1A 5JTIA 3OGUA 2HBKA 4JK1A 4PL1A 3BQTA 3H8SA 3IHQB 4UAYA 2BQUA 1NKBA 4BWMA 4QIWF 3PW0A 2KK0A 1NJYA 4M0AA 5FP0A 5J2DA 2YMLA 2XGQA 4RQNA 2ZG6A 3QYPA 4YVZA 1SKSA 5ALYA 2AGOA 1SWVA 5IILA 4QIWC 4KTQA 3IG5A 3K1ZA 2JGAA 1SKWA 1ZD4A 3C5FA 5KFVA 1X6IA 4A8EA 4LVSA 4IQWA 2ZUDA 1IM4A 4ECWA 1QCKA 2E1FA 1S0VA 1X6JA 4Y2SA 1M6YA 4MEYA 4DEZA 8ICHA 3JPQA 9ICMA 1ZQEA 3MABA 5EE0A 4R8UB 2RLTA 3RJKA 4R8UA 5J0QA 4NLNA 4C4TA 3G6XA 3BQ7A 1A0PA 4P4MA 4NM1A 3TAPA 3T5LA 4RQMA 5ALIA 2WAQC 2HDOA 1A77A 2UVRA 1X9WA 1X2IA 4J9KA 1JALA 3RB6A 3NGDA 1T94A 4YFKA 2W04A 4IC9A 1XO1A 4TURA 1L3TA 4CCHA 2W8LA 4QZGA 2YY6A 4JMUA 1ZQWA 1SV0C 2KV2A 1ZRMA 3WU2U 2KMDA 3U26A 1ZQSA 1L8OA 5L1MA 1WYGA 2G06A 9ICLA 4M2YA 5AIAA 1UA0A 3RB3A 4EEKA 2JMGA 2F8LA 3ALRA 8ICVA 2YQEA 5J2EA 4UARA 5DQGA 3HP6A 3PR4A 2KZMA 7ICKA 5DB8A 3T5KA 1D9FA 1NK0A 4KLQA 1B4FA 2FMQA 4F91B 3UQ0A 2RQ5A 5KFMA 5IIIA 5F9NA 1NK8A 2H3IA 2ESEA 3ZDBA 3ZD8A 2G0AA 3M6KA 4ED3A 5DB6A 4I2HA 2WF5A 1TAMA 4R65A 2F3NA 3HX0A 2Y0SF 2W3SA 2HHSA 2DPJA 1FEZA 4EELA 1UQVA 3CW2C 1FIQA 2NRXA 9ICUA 5KG1A 4QZAA 2R8IA 2FI1A 1NK5A 1SGGA 4NJ8A 9ICOA 2FLNA 1FO4A 3V72A 3T5JA 2HCFA 4LZGA 3NVYA 1PK1A 3EYZA 4Q45A 5EE1A 1BGXT 4O3OA 3BQ2A 4QZHA 3PMLA 2E8PA 1BPDA 2NRTA 2P35A 4QWAA 3F5EA 3KFUF 2WB1C 3THVA 4EZ9A 2QARB 1ZQUA 4UB3A 5H2FU 2KG5A 1S0NA 5CEHA 3ZDEA 2LKYA 2EZZA 4KLUA 2W03A 4DF8A 7ICHA 9ICPA 3I1YA 3AN1A 5B5EU 8ICQA 4C4RA 7ICVA 1RZTA 1TK0A 4PGYA 2KD1A 3DV9A 1NI3A 9ICXA 2BZFA 1MA7A 2ZTCA 2C2RA 2B0CA 2DL0A 3SR6A 1VJ5A 5L1JA 2W9BA 7ICRA 2IOFK 2FE9A 2K4PA 3FDSA 2WF6A 2RDIA 4Q8EA 5CR0A 1S77D 4M9GA 3V6HA 4O3MA 7ICMA 3PO4A 4DFDA 2FJ6A 2XC9A 3TAQA 2HHTA 1DK2A 2BCSA 1SZPA 3AU2A 4F4ZA 2GO7A 2V4RA 5DLFA 2G07A 2J6UA 5DDMA 4ED0A 2W9CA 3TADC 3WKCA 4XQ8A 2PXIA 2G09A 4KMUA 5KFGA 3MFIA 2KJ8A 4NLKA 2K4IA 5KL8B 5AI6A 5IINA 1S10A 4TQRA 2JH7A 8ICIA 4OJ5A 1XSPA 1X42A 3O0FA 2LI6A 2LBOA 1N61A 1XWLA 4TQSA 1S97A 1SL2A 3N7SC 1LB2B 3LDAA 2IBKA 4DL4A 2VKQA 4O0IA 2QB0A 3A0BU 3QU4A 2HVHA 4KLOA 3BQ1A 3HW8A 2DPIA 2OWOA 1F0MA 5ALNA 4TUQA 4F5PA 3MFHA 8ICXA 4KX3A 4I2AA 5D4BA 5KFWA 5G5HA 1ZETA 2JR5A 2HHXA 5ALQA 2QB1A 4FFDA 4YP3A 1SB3C 4F93B 1KFTA 2KVCA 3CP8A 1ZQIA 1A76A 4O3NA 5KFXA 9ICSA 4OD0A 2H3QA 4J9RA 2HW3A 2V4QA 2BDUA 4YXMA 4RT3A 4DFMA 3PX0A 2IA6A 3BQ0A 2VIXA 2KVSA 2VA3A 5CJ7A 3ZDDA 1XC9A 4R63A 2KIWA 2AQ4A 2BPCA 4QZ9A 3V6KA 4DQIA 4J9NA 8ICUA 4PHPA 2KTQA 1D8LA 4C80A 2CRXA 4ZH4A 3TADA 4UAZA 9ICBA 3PY8A 3C1YA 3ONNA 1T8EA 3TKAA 2YMQA 3MGIA 4NLGA 3M8SA 3N97B 2DBYA 2EAOA 4QZEA 3DDHA 3S6JA 3GFKB 5ALMA 4PJ0U 4RQ0A 2ZTDA 3SV3A 2HHQA 2GH1A 4QW8A 2BGWA 4F5OA 1CUKA 4CRXA 3QXGA 2W9MA 4QZIA 1X9SA 4YCXA 1SL0A 4MFCA 4DSEA 5AK3A 1K1QA 3B9JA 4JV2A 1ED1A 3SD7A 4JV0A 3G6VA 3C23A 4KLJA 3MR2A 2PFNA 3BDPA 4P4PA 4MF8A 5J2HA 3A0HU 2QARA 4P4OA 4BJQA 4ECSA 5J0TA 1MQ3A 4YR2A 5K4LA 5KT6A 3RF9A 1ZQBA 4G3IA 1O03A 2HOQA 1N60A 4YMMA 4YG2A 2LMRA 1ZQNA 4ECZA 2A19A 1ZQPA 3I76A 2EH9A 3HKZC 2KZ3A 5DLGA 3H0MB 1KBUA 3ETRA 4YN4A 2YTUA 4Y2XA 1C20A 3C1ZA 1Z3EB 2Y1IA 1SIJA 3NVWA 1LVHA 1L8LA 4AYBF 2JXJA 4CNQA 3GIMA 5AIBA 2ASLA 3ZI4A 3PV8A 3NRWA 4B9TA 3H8JA 9ICWA 4UASA 4UAVA 2OYYA 4DL2A 5CRXA 4DL5A 3BZCA 2K4HA 2L5YA 2YMPA 3KZIU 4K4HA 2D3DA 1MSWD 3NS1A 4UBBA 5KFDA 1NK9A 4F72A 4R66A 4GXIA 5BOLA 4RQ6A 8ICYA 4USAA 1ZYQA 5ALWA 3OSPA 4FO6A 2W8KA 3UM9A 3RH6A 1PK3A 4GXJA 4C7YA 4RQ8A 2ZXHA 4DS5A 1RYRA 5CHGA 1TVAA 3I28A 1KN5A 4QZFA 1ZQFA 5J2CA 5ALOA 1ZOLA 5ALSA 4RNNA 5E79U 4Y2QA 4QZCA 2FPLA 4FS1A 5DDYA 1U49A 2I5HA 2YN4A 3HILA 4NM2A 3V7KA 3JPTA 1BPBA 4GLXA 3PSFA 5ALKA 5AM4A 5A0LA 3JPRA 2LHTA 3H0LB 1RQNA 4DSLA 5F3XB 1X40A 1ZJMA 3V7JA 1EXNA 1KQQA 2ZIXA 4ECTA 1XSLA 2DWQA 2EANA 3RB0A 3KD3A 4PHAA 2G5IB 1ZQTA 3WK6A 3DEEA 3KHRA 3BJYA 1QQ6A 2EZXA 3RB4A 2AHOB 1KLNA 4I27A 4F71A 9ICVA 2BCUA 3ETLA 4ELTA 3N28A 2ALZA 5KAIU 4NXZA 1ZQYA 2VJ5A 3KHHA 3C21A 4RUAA 4DS4A 3PNCA 7ICIA 2OCEA 2HVIA 4RPYA 1ZQLA 4IRKA 3UMBA 1T7PA 1DK3A 2KKVA 5AKKA 5EOZA 5JU5A 1WCLA 2NRVA 1SV0A 4UATA 5KFNA 2ZIVB 3JPOA 1DOQA 3K75D 2ZJ5A 4KN7A 4K4GA 2IHNA 4O5CA 3C29A 3Q8PB 3IRUA 5D46A 2FPKA 2E5SA 4OJOA 1S0OA 4F2SA 1F5SA 1QSLA 1ZQRA 9ICRA 5AK6A 3LYSA 4P0QB 7ICNA 3KHLA 1OW5A 3AL0B 1S8OA 3OJUA 3LK9A 3F2DA 3PSIA 5J0PA 4FBUA 1N56A 2DF4B 3WK8A 1D8BA 5DG7A 2KSOB 5GTHU 1NNLA 1COOA 1LV5A 2PMZC 3RR8A 9ICHA 1SWWA 3SYZA 2I6XA 1KTQA 9ICTA 3TANA 3D2SA 2M0NA 5DQHA 4CF4A 2A1JB 5KFUA 4EEYA 1RG6A 4F4YA 8ICGA 1L3VA 2W7OA 4RQ4A 2PKEA 4BXOA 2FLLA 4B9NA 2E8OA 4PH5A 2E3TA 5J0SA 1JXLA 4CGZA 4C8LA 4YMNA 4FZLA 1LKYB 8ICWA 4I2GA 4DFPA 3LVVA 8ICMA 4MFFA 2VA2A 4ECXA 3UXPA 1BNPA 1BPZA 4KN4A 3GU3A 1Q3UA 7ICLA 2ZIUB 3C5GA 4DSKA 5G5GA 2V9WA 9ICAA 3NUQA 2QLTA 2IHMA 1XNSA 3D2NA 3UMGA 3WK7A 4LJXA 5EWEA 2XVTA 3H8WA 2IMWP 4B9UA 2LYBA 2KE7A 5L9XA 2XY5A 2H5XA 2C22A 4DQPA 3SAGA 4MHVA 1FFVA 1YT3A 4DOBA 5JRTA 2Y1JA 4AYBC 1N63A 4PHEA 1HUOA 5AI9A 3IN5A 4J9SA 4M04A 5L1KA 3D2QA 3LVWA 4YMOA 2G08A 3RFAA 1J97A 4O3PA 5KFFA 1B22A 2KEYA 2KHVA 2LM4A 3T5HA 2ISPA 2Q0ZX 3IP4B 4F5NA 2C2DA 2M9NA 1JXEA 4F4WA 1N48A 4ECQA 3QX7A 2D6FC 4FZNA 2YB4A 4EBDA 2JRZA 4CF3A 4I28A 2WHEA 2Y0SC 4XUSA 3IV6A 3RTVA 4DSIA 5AM3A 1TV9A 5BPCA 2A1JA 5AK4A 1ZJNA 1NJZA 2YB1A 1ZD5A 2Y9TA 4M9LA 5KFCA 2KKPA 2HOIA 3H0RB 5J2GA
chains in the Genus database with same CATH topology
2E8MA 3KKAC 1B4FA 2ES6A 1LKYB 3K1RB 2QKQA 4RQNA 2YTUA 1X66A 2ESEA 1V38A 2D8CA 1X9XA 3TADA 5J8YC 1SXEA 1Z1VA 2KIVA 2F3NA 3TADC 5J8YA 1DXSA 2EAMA 2EAOA 3SEIA 2E8NA 2DKXA 1UQVA 2B6GA 2L5YA 2EAPA 2D3DA 1SV4A 1SGGA 4NJ8A 3BS5B 5JU5A 2KE7A 1SV0A 2F8KA 1PK1A 2GLEA 4PZNA 1PK1B 5KNIA 1PK3A 4MHVA 3KKAA 5JRTA 2E8PA 1JI7A 4NL9A 1V85A 1LKYA 3BQ7A 2QB0A 2K60A 2QARB 4RQMA 1F0MA 2DKZA 1SXDA 2KG5A 1OW5A 4PZOA 2JV3A 2Y9UA 3TACB 4IS7A 2LPEA 2QB0B 2QARA 3H8MA 2QB1A 2KSOB 2F44A 4NL9C 1KW4A 1B0XA 1UCVA 3SENA 3HILA 1SV0C 2KMDA 2DL0A 5JTIA 2KSOA 5L1MA 1WWVA 1RG6A 3BS5A 1X40A 5F3XB 2FE9A 2K4PA 3IDWA 1OXJA 2LMRA 2EANA 2E8OA 2Y9TA 3BS7A 1WWUA 1COKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E8M A;  3KKA C;  1B4F A;  2ES6 A;  1LKY B;  3K1R B;  2QKQ A;  4RQN A;  2YTU A;  1X66 A;  2ESE A;  1V38 A;  2D8C A;  1X9X A;  3TAD A;  5J8Y C;  1SXE A;  1Z1V A;  2KIV A;  2F3N A;  3TAD C;  5J8Y A;  1DXS A;  2EAM A;  2EAO A;  3SEI A;  2E8N A;  2DKX A;  1UQV A;  2B6G A;  2L5Y A;  2EAP A;  2D3D A;  1SV4 A;  1SGG A;  4NJ8 A;  3BS5 B;  5JU5 A;  2KE7 A;  1SV0 A;  2F8K A;  1PK1 A;  2GLE A;  4PZN A;  1PK1 B;  5KNI A;  1PK3 A;  4MHV A;  3KKA A;  5JRT A;  2E8P A;  1JI7 A;  4NL9 A;  1V85 A;  1LKY A;  3BQ7 A;  2QB0 A;  2K60 A;  2QAR B;  4RQM A;  1F0M A;  2DKZ A;  1SXD A;  2KG5 A;  1OW5 A;  4PZO A;  2JV3 A;  2Y9U A;  3TAC B;  4IS7 A;  2LPE A;  2QB0 B;  2QAR A;  3H8M A;  2QB1 A;  2KSO B;  2F44 A;  4NL9 C;  1KW4 A;  1B0X A;  1UCV A;  3SEN A;  3HIL A;  1SV0 C;  2KMD A;  2DL0 A;  5JTI A;  2KSO A;  5L1M A;  1WWV A;  1RG6 A;  3BS5 A;  1X40 A;  5F3X B;  2FE9 A;  2K4P A;  3IDW A;  1OXJ A;  2LMR A;  2EAN A;  2E8O A;  2Y9T A;  3BS7 A;  1WWU A;  1COK A; 
#chains in the Genus database with same CATH topology
 1IG6 A;  2AGP A;  2QKQ A;  4P0P A;  5KT7 A;  4Z6D A;  2CXY A;  1PVP A;  2BPG A;  1L7P A;  2ZUB A;  5KG7 A;  5C0Y A;  1NJW A;  4IRD A;  4O5E A;  3OHB A;  2OXO A;  5GTI U;  2W55 A;  1TAU A;  4PHD A;  3ISC A;  3SAH A;  2HSZ A;  4HYK A;  2MUT A;  3AU6 A;  2GWS A;  1IXR A;  5HHH A;  4F50 A;  2JEF A;  3E58 A;  2ZIV A;  2W9A A;  2JEJ A;  4I2D A;  5AKG A;  1JRP A;  2UVW A;  1NK4 A;  2CPR A;  5DBB A;  1RYS A;  4Z6F A;  3C2M A;  4F8R A;  4QW9 A;  3Q8K A;  1RDF A;  5ALR A;  2WAQ F;  4KLH A;  1J2M A;  5IIO A;  1NOM A;  5EE3 A;  1QTM A;  4I29 A;  1Q3V A;  1SXD A;  1ZQA A;  3JPP A;  3SAF A;  2F1J A;  2LPE A;  3MR5 A;  2G5H B;  4GC7 A;  1NKE A;  1N5W A;  2J6T A;  2R8K A;  5DKW A;  4KLE A;  4DSF A;  3H40 A;  8ICS A;  4O5K A;  3MGV A;  2XID A;  2ZIW A;  4BUG A;  2AQ0 A;  3M9O B;  8ICN A;  3GZF A;  5HNK A;  3RAX A;  1T3N A;  2WB1 F;  3RJH A;  5KFI A;  2NO5 A;  3GII A;  3HKZ F;  5ALH A;  5ALD A;  2ZIX B;  5L1L A;  8ICF A;  2KFZ A;  1NK6 A;  4NV0 A;  1T3Q A;  5AKZ A;  5DBA A;  5CB1 A;  3HPO A;  3EW9 A;  4DFK A;  2BHN A;  5KFH A;  4UB4 A;  4ACO A;  1KL9 A;  5KG4 A;  4EYI B;  2FDR A;  4IR1 A;  1V38 A;  1CRX A;  1JN3 A;  5AIC A;  2W9C B;  2BCQ A;  4RZR A;  3J81 j;  5AHX A;  2P66 A;  9ICF A;  1A6S A;  7ICU A;  3PX4 A;  2KN7 A;  1JIH A;  5AI8 A;  3CNH A;  2R8H A;  4U6P A;  4M9J A;  5T14 A;  1N62 A;  4I2C A;  3B0Y A;  1WG8 A;  3PR5 B;  8ICE A;  5KAF U;  5ALU A;  2PFO A;  2B6G A;  2EAP A;  3NTU A;  2PMZ F;  2CN1 A;  1ZQK A;  3FAH A;  5KG3 A;  5KFL A;  3PMN A;  2I9G A;  3QUC A;  3PST A;  1XO0 A;  2MRL A;  1ZQO A;  5J0X A;  1B43 A;  2W11 A;  2UVV A;  4YD1 A;  3MR6 A;  1CI4 A;  2HBJ A;  2OHF A;  2MAX A;  2NRZ A;  1NK7 A;  5ALL A;  3RAQ A;  4QWC A;  9ICC A;  3N7R C;  4FE3 A;  4BXO B;  2N1R A;  3WKE A;  3GV8 B;  2K60 A;  3EUB 2;  4UAW A;  2R18 A;  4ECV A;  4HAI A;  2GOL A;  3G6Y A;  4GFJ A;  5J0Y A;  4KLD A;  2MU2 A;  1WUD A;  3RJG A;  2RDJ A;  7ICS A;  1BNO A;  5L1I A;  4XRH A;  1XSN A;  3RJE A;  5ALE A;  4K4I A;  4UB2 A;  4X5V A;  2AGQ A;  3UQ2 A;  3ED5 A;  1BPY A;  3VCB A;  4KLM A;  5HHI A;  1ZQD A;  2H3F A;  4QWD A;  1WWV A;  3WKA A;  4UW9 A;  5CWR A;  4RPZ A;  3BS5 A;  4PGQ A;  3RJI A;  2KOB A;  3N4M B;  3F2B A;  3GIK A;  3M8R A;  2Q4T A;  5ALF A;  5AI5 A;  3RR7 A;  2ASJ A;  2PFQ A;  1PVR A;  3UXO A;  4DL7 A;  1ZQ1 C;  1N2X A;  2KFN A;  3H4D A;  4QZB A;  3F5A A;  4C7Z A;  8ICA A;  4O3S A;  2XIC A;  3R9K A;  5J8Y C;  4U7C A;  3H4B A;  3QEB Z;  9ICG A;  5KL1 B;  3WK5 A;  5EE9 A;  1DXS A;  4PPX A;  3WKD A;  3AEV A;  4NLZ A;  2EAM A;  2HBM A;  4C8K A;  4KLF A;  5KFT A;  2DUY A;  1MC8 A;  4ZOH C;  4FS2 A;  5KFQ A;  1SV4 A;  1ZD3 A;  2KZZ A;  1DRG A;  3SV4 A;  1V9P A;  1L6N A;  3VC8 A;  3OPX A;  2F8K A;  2VAN A;  1Y88 A;  2GLE A;  1PK1 B;  2E1E A;  4ICA A;  2HBL A;  4IR9 A;  1HIW A;  1RYU A;  3FYH A;  2F2A B;  3AMZ A;  3T79 A;  3PSP A;  1ZRN A;  3ZD9 A;  3ZDA A;  4GIB A;  2ZIU A;  2Y9U A;  3HJE A;  2VA8 A;  4QJF B;  3N7P D;  7ICG A;  3JPN A;  2QB0 B;  2I1Q A;  2VJ4 A;  2ATL A;  8ICO A;  2KP7 A;  5ALZ A;  1YZ7 A;  4NL9 C;  2ZXI A;  1MQ2 A;  4RQ3 A;  5HR6 A;  1PVQ A;  2Z7J A;  5AM1 A;  5HP4 A;  2ZIW B;  2F76 X;  4DL3 A;  5AKY A;  1U47 A;  1ECW A;  4KMO B;  1T4G A;  2HHV A;  4F4K A;  4QWE A;  4YR0 A;  2NRW A;  3V6J A;  1ZQZ A;  2KHQ A;  3QUT A;  4Y2J A;  4P0P B;  2BQ3 A;  9ICE A;  1F44 A;  3BS7 A;  4CE6 A;  5J0O A;  4OCZ A;  3EPI A;  2IOH A;  9ICJ A;  1L3U A;  2LYA A;  3AUO A;  1QQ7 A;  5ALV A;  1DGJ A;  4ELV A;  3ICX A;  3KOO A;  4F5Q A;  3RH5 A;  1X66 A;  1TK5 A;  1S0M A;  1X9X A;  2KJ5 A;  2A3V A;  5AKL A;  3C28 A;  2WTF A;  3EZ5 A;  5EWG A;  8ICC A;  2DKX A;  2WF8 A;  4J9Q A;  2XCP A;  1S9F A;  4OO1 J;  7ICP A;  9ICK A;  2JHD A;  5KG0 A;  2W9B B;  3GDX A;  2XO7 A;  4C0Z A;  1Z19 A;  4B9L A;  3MR3 A;  5KNI A;  3OTQ A;  5KFA A;  3RBE A;  1TKD A;  2P6U A;  3F2C A;  4Q8F A;  1V85 A;  2XY6 A;  4RUC A;  3Q8S B;  4RNO A;  4M6W B;  5J2F A;  3HWT A;  2OH2 A;  1IIP A;  3L5K A;  4RQ5 A;  2BCR A;  4PZO A;  3TAC B;  4F4X A;  3CYM A;  1L7N A;  1MN8 A;  2ISO A;  3D6J A;  5J2K A;  3T3F A;  4C8O A;  4AP9 A;  5KFR A;  3RJF A;  1ARO P;  1JUD A;  1SL1 A;  3BZK A;  4QNL A;  3PZP A;  3OJS A;  3UXN A;  5J0W A;  1Q8K A;  3LWL A;  2KSO A;  2F77 X;  3PX6 A;  5KFP A;  1ZXI A;  1RXW A;  4KLL A;  5J2I A;  2JZB A;  3ISD A;  2W7P A;  1OXJ A;  1DGS A;  1ZQQ A;  4KLS A;  5IIM A;  1S5L U;  2JH1 A;  2K4E A;  2A1A A;  4P0Q A;  4RPX A;  1COK A;  5KFO A;  2C2E A;  7ICE A;  4I2F A;  1URJ A;  7ICO A;  5HR7 A;  2W54 A;  1QQ5 A;  5KFZ A;  5J2J A;  3Q8R B;  2J6S A;  4J03 A;  4BDP A;  1UT5 A;  4EX6 A;  2K8A A;  3WK9 A;  1IV8 A;  2DGZ A;  1ZQG A;  4OJP A;  4QWB A;  2E8N A;  3QUQ A;  5C5J A;  4DLG A;  4EX7 A;  4Q43 A;  4ED7 A;  4FBT A;  1KFS A;  1X9M A;  1NKC A;  1V97 A;  3TFR A;  3GIL A;  1ZQM A;  1KEJ A;  5DB7 A;  3RRG A;  2EQY A;  4PZN A;  1P7D A;  3Q8M A;  4M6W A;  4Z6C A;  3Q8Q B;  3QU9 A;  4MF2 A;  4KX5 A;  3QZ7 A;  1KKX A;  3TAR A;  2UVU A;  4UBC A;  4CDG A;  4F5R A;  2PFP A;  2KNJ A;  1PZN A;  2DKZ A;  4IRC A;  2NV3 A;  5BOM A;  4IS7 A;  3RBD A;  1QSY A;  3H8M A;  4J9M A;  3LWM A;  1S76 D;  5EWF A;  3H7I A;  8ICP A;  4PL2 A;  5DB9 A;  1Q46 A;  1Z00 A;  3MDC A;  2LM1 A;  3L3F X;  1XS9 D;  3TFS A;  1Z00 B;  3IDW A;  1AQ6 A;  3IG8 A;  1TAQ A;  1U45 A;  4J9L A;  2YX8 A;  3FM9 A;  5AI0 A;  3PW7 A;  5ALT A;  4EZ6 A;  1VDV A;  1TFR A;  3KKA C;  4J9O A;  3PVX A;  1U48 A;  4DOC A;  4GC6 A;  3AQE A;  2ZJA A;  5KG2 A;  1FFU A;  2B21 A;  2DFL A;  3SMV A;  2JEI A;  3PW4 A;  4JB3 A;  5DGA A;  1OUQ A;  5J8Y A;  2XCA A;  2HOF A;  2NO4 A;  2AU0 A;  2MUT B;  3PW2 A;  2MSN A;  4DQR A;  4Y2V A;  3IM1 A;  4DO9 A;  1UT8 A;  4RQ7 A;  4UQG A;  2XI9 A;  2JZB B;  4C4S A;  3BS5 B;  4DF4 A;  8ICL A;  4Y2P A;  3EWA A;  3PO5 A;  4I2I A;  4Y2U A;  1QLN A;  1ZQC A;  4NWI A;  4YR3 A;  1UHU A;  4I2B A;  5TZV A;  4EBE A;  4B6J A;  3ZDC A;  3EPG A;  1JI7 A;  4NL9 A;  3KHG A;  2ZJ8 A;  5AM2 A;  5KT3 A;  5AKJ A;  5AM5 A;  3M9M B;  1QSS A;  1RQL A;  8ICK A;  3GQC A;  4ECY A;  1ZQH A;  2JV3 A;  1U9L A;  2KJ9 A;  1SZH A;  4P2H A;  1NZP A;  5DGB A;  8ICB A;  4DFJ A;  3MDA A;  4I2E A;  3AQF A;  5KG6 A;  2EZY A;  1KW4 A;  1B0X A;  1RM6 C;  8ICJ A;  3B0X A;  2KIC A;  4BWJ A;  3SEN A;  3AM9 A;  3E0F A;  4O9M A;  5KFB A;  4DQS A;  1K1S A;  4RU9 A;  1ZQJ A;  4I2J A;  3UPQ A;  5ALX A;  3RH4 A;  2PI5 A;  5IIJ A;  5ALP A;  8ICR A;  1BVS A;  4YQW A;  5KFK A;  3RRH A;  4Y2T A;  4FZM A;  3SZ2 A;  2JEG A;  1WWU A;  3C2L A;  5ALJ A;  3HRD D;  4M9N A;  9ICI A;  3QU7 A;  2K8B B;  4CF5 A;  4M47 A;  2E8M A;  5TIS U;  1YZ6 A;  4JUZ A;  4Y2R A;  5KT2 A;  4US9 A;  5DG8 A;  4IQV A;  4OJL A;  4ECU A;  4IL6 U;  3FC4 A;  4ED6 A;  4YXJ A;  3M9N B;  2EDU A;  4J9P A;  3L4P A;  7ICT A;  4UAU A;  2K8C B;  5KG5 A;  3HT3 A;  2ODG A;  4EEN A;  4O3Q A;  5KFJ A;  1Z4N A;  4Q44 A;  3NVZ A;  4NY8 A;  4IQU A;  1RPL A;  1Z4O A;  1JRO A;  4DWI A;  1N5X A;  5AI4 A;  1JX4 A;  5D49 A;  5IIK A;  4G9B A;  4TUS A;  1LKY A;  5F9L A;  2ASD A;  2PI4 A;  3JPS A;  2O6K A;  3F53 A;  1VLB A;  4O3R A;  4DLE A;  5AKI A;  5KT5 A;  5J2A A;  9ICQ A;  4R64 A;  4JWM A;  4TUP A;  4WJ3 B;  3WKB A;  3PW5 A;  4XA5 A;  4QZD A;  1QH9 A;  2F44 A;  3C2K A;  1JMS A;  4BGD A;  4RT2 A;  3E2E A;  1D9D A;  2WF9 A;  5KT4 A;  2HHW A;  1J2N A;  4B9V A;  4JV1 A;  1Z1B A;  3MC1 A;  5DG9 A;  2XGP A;  4UB6 U;  4JWN A;  7ICF A;  5J2B A;  2WF7 A;  1L7M A;  1U4B A;  1H38 A;  4KLG A;  1L7O A;  2HHU A;  2FMS A;  4YD2 A;  2AXT U;  5HMM A;  3MGH A;  3UMC A;  4ED1 A;  3K1R B;  2BPF A;  1KFD A;  3OSN A;  4DSJ A;  4ELU A;  2D8C A;  4PGX A;  4KIT B;  3GV7 B;  1Z1V A;  2KIV A;  4OJ6 A;  5JUM A;  2XY7 A;  3GV5 B;  1XU4 A;  4NLB A;  4DL6 A;  4F3O A;  1O08 A;  5KFS A;  3SEI A;  5DQI A;  2AJQ A;  2MA1 A;  2BDP A;  1UPH A;  2P6R A;  1K5O A;  3MBY A;  2BKE A;  5AKX A;  4BX9 C;  2W3R A;  4UB1 A;  8ICZ A;  2WFA A;  1KRP A;  2FPM A;  1BPE A;  1CEZ A;  4UB5 A;  3TQ1 A;  1NJX A;  1HEK A;  2BR0 A;  3KZX A;  2HI0 A;  2RP5 A;  4ED2 A;  2F1I A;  1ZD2 P;  3QNM A;  3QEA Z;  3KKA A;  3QU2 A;  1UA1 A;  4C8M A;  2LYH A;  3GIJ A;  4RQ2 A;  3ORY A;  3NVV A;  3OHA A;  5J29 A;  2ZTE A;  3ISB A;  5KFE A;  2RRD A;  1SKR A;  1ZQV A;  2K89 A;  5KFY A;  1BPX A;  2BQR A;  1L5U A;  3KBB A;  1UCV A;  2BCV A;  4Z6E A;  7ICQ A;  4EBC A;  3SI8 A;  5DBC A;  3K4G A;  4IQT A;  4B9S A;  1HJP A;  4C8N A;  5AM0 A;  5CP2 A;  1TE2 A;  3KTQ A;  4KLT A;  1WCN A;  1PUZ A;  2OEH A;  1L3S A;  1KDH A;  3Q8L A;  1TK8 A;  2W43 A;  1D8Y A;  3TI0 A;  1ZQX A;  5J0U A;  3M1Y A;  3NRZ A;  4F2R A;  7ICJ A;  2ES6 A;  4MFA A;  5KTQ A;  2RHF A;  3V7L A;  4B9M A;  9ICN A;  3QU5 A;  5ALG A;  1SXE A;  1NZB A;  3QUB A;  4DCC A;  4KLI A;  5B66 U;  3NAS A;  4GXK A;  2DQN B;  4RNM A;  4LZD A;  4EYH B;  3SQI A;  4QZ8 A;  5CA7 A;  4NLC A;  2FLP A;  1GO3 F;  2F1H A;  2YMM A;  4F92 B;  5HML A;  4Y2Y A;  4M9H A;  2HMX A;  3M7D A;  5AKE A;  3RJJ A;  2R8J A;  3QZ8 A;  4DOA A;  5AK5 A;  3QE9 Y;  4MEX A;  2IOF A;  2OM6 A;  2ZUC A;  2H3V A;  2AH5 A;  3M6Z A;  3WK4 A;  1HUZ A;  5AKH A;  4E0D A;  4DQQ A;  4ECR A;  3CRX A;  2FMP A;  4ED8 A;  2R8G A;  1RXV A;  1C7Y A;  5J0R A;  2NYV A;  2H3Z A;  1KSP A;  2C28 A;  4US8 A;  4UB8 U;  8ICT A;  4RQ1 A;  5JTI A;  3OGU A;  2HBK A;  4JK1 A;  4PL1 A;  3BQT A;  3H8S A;  3IHQ B;  4UAY A;  2BQU A;  1NKB A;  4BWM A;  4QIW F;  3PW0 A;  2KK0 A;  1NJY A;  4M0A A;  5FP0 A;  5J2D A;  2YML A;  2XGQ A;  4RQN A;  2ZG6 A;  3QYP A;  4YVZ A;  1SKS A;  5ALY A;  2AGO A;  1SWV A;  5IIL A;  4QIW C;  4KTQ A;  3IG5 A;  3K1Z A;  2JGA A;  1SKW A;  1ZD4 A;  3C5F A;  5KFV A;  1X6I A;  4A8E A;  4LVS A;  4IQW A;  2ZUD A;  1IM4 A;  4ECW A;  1QCK A;  2E1F A;  1S0V A;  1X6J A;  4Y2S A;  1M6Y A;  4MEY A;  4DEZ A;  8ICH A;  3JPQ A;  9ICM A;  1ZQE A;  3MAB A;  5EE0 A;  4R8U B;  2RLT A;  3RJK A;  4R8U A;  5J0Q A;  4NLN A;  4C4T A;  3G6X A;  3BQ7 A;  1A0P A;  4P4M A;  4NM1 A;  3TAP A;  3T5L A;  4RQM A;  5ALI A;  2WAQ C;  2HDO A;  1A77 A;  2UVR A;  1X9W A;  1X2I A;  4J9K A;  1JAL A;  3RB6 A;  3NGD A;  1T94 A;  4YFK A;  2W04 A;  4IC9 A;  1XO1 A;  4TUR A;  1L3T A;  4CCH A;  2W8L A;  4QZG A;  2YY6 A;  4JMU A;  1ZQW A;  1SV0 C;  2KV2 A;  1ZRM A;  3WU2 U;  2KMD A;  3U26 A;  1ZQS A;  1L8O A;  5L1M A;  1WYG A;  2G06 A;  9ICL A;  4M2Y A;  5AIA A;  1UA0 A;  3RB3 A;  4EEK A;  2JMG A;  2F8L A;  3ALR A;  8ICV A;  2YQE A;  5J2E A;  4UAR A;  5DQG A;  3HP6 A;  3PR4 A;  2KZM A;  7ICK A;  5DB8 A;  3T5K A;  1D9F A;  1NK0 A;  4KLQ A;  1B4F A;  2FMQ A;  4F91 B;  3UQ0 A;  2RQ5 A;  5KFM A;  5III A;  5F9N A;  1NK8 A;  2H3I A;  2ESE A;  3ZDB A;  3ZD8 A;  2G0A A;  3M6K A;  4ED3 A;  5DB6 A;  4I2H A;  2WF5 A;  1TAM A;  4R65 A;  2F3N A;  3HX0 A;  2Y0S F;  2W3S A;  2HHS A;  2DPJ A;  1FEZ A;  4EEL A;  1UQV A;  3CW2 C;  1FIQ A;  2NRX A;  9ICU A;  5KG1 A;  4QZA A;  2R8I A;  2FI1 A;  1NK5 A;  1SGG A;  4NJ8 A;  9ICO A;  2FLN A;  1FO4 A;  3V72 A;  3T5J A;  2HCF A;  4LZG A;  3NVY A;  1PK1 A;  3EYZ A;  4Q45 A;  5EE1 A;  1BGX T;  4O3O A;  3BQ2 A;  4QZH A;  3PML A;  2E8P A;  1BPD A;  2NRT A;  2P35 A;  4QWA A;  3F5E A;  3KFU F;  2WB1 C;  3THV A;  4EZ9 A;  2QAR B;  1ZQU A;  4UB3 A;  5H2F U;  2KG5 A;  1S0N A;  5CEH A;  3ZDE A;  2LKY A;  2EZZ A;  4KLU A;  2W03 A;  4DF8 A;  7ICH A;  9ICP A;  3I1Y A;  3AN1 A;  5B5E U;  8ICQ A;  4C4R A;  7ICV A;  1RZT A;  1TK0 A;  4PGY A;  2KD1 A;  3DV9 A;  1NI3 A;  9ICX A;  2BZF A;  1MA7 A;  2ZTC A;  2C2R A;  2B0C A;  2DL0 A;  3SR6 A;  1VJ5 A;  5L1J A;  2W9B A;  7ICR A;  2IOF K;  2FE9 A;  2K4P A;  3FDS A;  2WF6 A;  2RDI A;  4Q8E A;  5CR0 A;  1S77 D;  4M9G A;  3V6H A;  4O3M A;  7ICM A;  3PO4 A;  4DFD A;  2FJ6 A;  2XC9 A;  3TAQ A;  2HHT A;  1DK2 A;  2BCS A;  1SZP A;  3AU2 A;  4F4Z A;  2GO7 A;  2V4R A;  5DLF A;  2G07 A;  2J6U A;  5DDM A;  4ED0 A;  2W9C A;  3TAD C;  3WKC A;  4XQ8 A;  2PXI A;  2G09 A;  4KMU A;  5KFG A;  3MFI A;  2KJ8 A;  4NLK A;  2K4I A;  5KL8 B;  5AI6 A;  5IIN A;  1S10 A;  4TQR A;  2JH7 A;  8ICI A;  4OJ5 A;  1XSP A;  1X42 A;  3O0F A;  2LI6 A;  2LBO A;  1N61 A;  1XWL A;  4TQS A;  1S97 A;  1SL2 A;  3N7S C;  1LB2 B;  3LDA A;  2IBK A;  4DL4 A;  2VKQ A;  4O0I A;  2QB0 A;  3A0B U;  3QU4 A;  2HVH A;  4KLO A;  3BQ1 A;  3HW8 A;  2DPI A;  2OWO A;  1F0M A;  5ALN A;  4TUQ A;  4F5P A;  3MFH A;  8ICX A;  4KX3 A;  4I2A A;  5D4B A;  5KFW A;  5G5H A;  1ZET A;  2JR5 A;  2HHX A;  5ALQ A;  2QB1 A;  4FFD A;  4YP3 A;  1SB3 C;  4F93 B;  1KFT A;  2KVC A;  3CP8 A;  1ZQI A;  1A76 A;  4O3N A;  5KFX A;  9ICS A;  4OD0 A;  2H3Q A;  4J9R A;  2HW3 A;  2V4Q A;  2BDU A;  4YXM A;  4RT3 A;  4DFM A;  3PX0 A;  2IA6 A;  3BQ0 A;  2VIX A;  2KVS A;  2VA3 A;  5CJ7 A;  3ZDD A;  1XC9 A;  4R63 A;  2KIW A;  2AQ4 A;  2BPC A;  4QZ9 A;  3V6K A;  4DQI A;  4J9N A;  8ICU A;  4PHP A;  2KTQ A;  1D8L A;  4C80 A;  2CRX A;  4ZH4 A;  3TAD A;  4UAZ A;  9ICB A;  3PY8 A;  3C1Y A;  3ONN A;  1T8E A;  3TKA A;  2YMQ A;  3MGI A;  4NLG A;  3M8S A;  3N97 B;  2DBY A;  2EAO A;  4QZE A;  3DDH A;  3S6J A;  3GFK B;  5ALM A;  4PJ0 U;  4RQ0 A;  2ZTD A;  3SV3 A;  2HHQ A;  2GH1 A;  4QW8 A;  2BGW A;  4F5O A;  1CUK A;  4CRX A;  3QXG A;  2W9M A;  4QZI A;  1X9S A;  4YCX A;  1SL0 A;  4MFC A;  4DSE A;  5AK3 A;  1K1Q A;  3B9J A;  4JV2 A;  1ED1 A;  3SD7 A;  4JV0 A;  3G6V A;  3C23 A;  4KLJ A;  3MR2 A;  2PFN A;  3BDP A;  4P4P A;  4MF8 A;  5J2H A;  3A0H U;  2QAR A;  4P4O A;  4BJQ A;  4ECS A;  5J0T A;  1MQ3 A;  4YR2 A;  5K4L A;  5KT6 A;  3RF9 A;  1ZQB A;  4G3I A;  1O03 A;  2HOQ A;  1N60 A;  4YMM A;  4YG2 A;  2LMR A;  1ZQN A;  4ECZ A;  2A19 A;  1ZQP A;  3I76 A;  2EH9 A;  3HKZ C;  2KZ3 A;  5DLG A;  3H0M B;  1KBU A;  3ETR A;  4YN4 A;  2YTU A;  4Y2X A;  1C20 A;  3C1Z A;  1Z3E B;  2Y1I A;  1SIJ A;  3NVW A;  1LVH A;  1L8L A;  4AYB F;  2JXJ A;  4CNQ A;  3GIM A;  5AIB A;  2ASL A;  3ZI4 A;  3PV8 A;  3NRW A;  4B9T A;  3H8J A;  9ICW A;  4UAS A;  4UAV A;  2OYY A;  4DL2 A;  5CRX A;  4DL5 A;  3BZC A;  2K4H A;  2L5Y A;  2YMP A;  3KZI U;  4K4H A;  2D3D A;  1MSW D;  3NS1 A;  4UBB A;  5KFD A;  1NK9 A;  4F72 A;  4R66 A;  4GXI A;  5BOL A;  4RQ6 A;  8ICY A;  4USA A;  1ZYQ A;  5ALW A;  3OSP A;  4FO6 A;  2W8K A;  3UM9 A;  3RH6 A;  1PK3 A;  4GXJ A;  4C7Y A;  4RQ8 A;  2ZXH A;  4DS5 A;  1RYR A;  5CHG A;  1TVA A;  3I28 A;  1KN5 A;  4QZF A;  1ZQF A;  5J2C A;  5ALO A;  1ZOL A;  5ALS A;  4RNN A;  5E79 U;  4Y2Q A;  4QZC A;  2FPL A;  4FS1 A;  5DDY A;  1U49 A;  2I5H A;  2YN4 A;  3HIL A;  4NM2 A;  3V7K A;  3JPT A;  1BPB A;  4GLX A;  3PSF A;  5ALK A;  5AM4 A;  5A0L A;  3JPR A;  2LHT A;  3H0L B;  1RQN A;  4DSL A;  5F3X B;  1X40 A;  1ZJM A;  3V7J A;  1EXN A;  1KQQ A;  2ZIX A;  4ECT A;  1XSL A;  2DWQ A;  2EAN A;  3RB0 A;  3KD3 A;  4PHA A;  2G5I B;  1ZQT A;  3WK6 A;  3DEE A;  3KHR A;  3BJY A;  1QQ6 A;  2EZX A;  3RB4 A;  2AHO B;  1KLN A;  4I27 A;  4F71 A;  9ICV A;  2BCU A;  3ETL A;  4ELT A;  3N28 A;  2ALZ A;  5KAI U;  4NXZ A;  1ZQY A;  2VJ5 A;  3KHH A;  3C21 A;  4RUA A;  4DS4 A;  3PNC A;  7ICI A;  2OCE A;  2HVI A;  4RPY A;  1ZQL A;  4IRK A;  3UMB A;  1T7P A;  1DK3 A;  2KKV A;  5AKK A;  5EOZ A;  5JU5 A;  1WCL A;  2NRV A;  1SV0 A;  4UAT A;  5KFN A;  2ZIV B;  3JPO A;  1DOQ A;  3K75 D;  2ZJ5 A;  4KN7 A;  4K4G A;  2IHN A;  4O5C A;  3C29 A;  3Q8P B;  3IRU A;  5D46 A;  2FPK A;  2E5S A;  4OJO A;  1S0O A;  4F2S A;  1F5S A;  1QSL A;  1ZQR A;  9ICR A;  5AK6 A;  3LYS A;  4P0Q B;  7ICN A;  3KHL A;  1OW5 A;  3AL0 B;  1S8O A;  3OJU A;  3LK9 A;  3F2D A;  3PSI A;  5J0P A;  4FBU A;  1N56 A;  2DF4 B;  3WK8 A;  1D8B A;  5DG7 A;  2KSO B;  5GTH U;  1NNL A;  1COO A;  1LV5 A;  2PMZ C;  3RR8 A;  9ICH A;  1SWW A;  3SYZ A;  2I6X A;  1KTQ A;  9ICT A;  3TAN A;  3D2S A;  2M0N A;  5DQH A;  4CF4 A;  2A1J B;  5KFU A;  4EEY A;  1RG6 A;  4F4Y A;  8ICG A;  1L3V A;  2W7O A;  4RQ4 A;  2PKE A;  4BXO A;  2FLL A;  4B9N A;  2E8O A;  4PH5 A;  2E3T A;  5J0S A;  1JXL A;  4CGZ A;  4C8L A;  4YMN A;  4FZL A;  1LKY B;  8ICW A;  4I2G A;  4DFP A;  3LVV A;  8ICM A;  4MFF A;  2VA2 A;  4ECX A;  3UXP A;  1BNP A;  1BPZ A;  4KN4 A;  3GU3 A;  1Q3U A;  7ICL A;  2ZIU B;  3C5G A;  4DSK A;  5G5G A;  2V9W A;  9ICA A;  3NUQ A;  2QLT A;  2IHM A;  1XNS A;  3D2N A;  3UMG A;  3WK7 A;  4LJX A;  5EWE A;  2XVT A;  3H8W A;  2IMW P;  4B9U A;  2LYB A;  2KE7 A;  5L9X A;  2XY5 A;  2H5X A;  2C22 A;  4DQP A;  3SAG A;  4MHV A;  1FFV A;  1YT3 A;  4DOB A;  5JRT A;  2Y1J A;  4AYB C;  1N63 A;  4PHE A;  1HUO A;  5AI9 A;  3IN5 A;  4J9S A;  4M04 A;  5L1K A;  3D2Q A;  3LVW A;  4YMO A;  2G08 A;  3RFA A;  1J97 A;  4O3P A;  5KFF A;  1B22 A;  2KEY A;  2KHV A;  2LM4 A;  3T5H A;  2ISP A;  2Q0Z X;  3IP4 B;  4F5N A;  2C2D A;  2M9N A;  1JXE A;  4F4W A;  1N48 A;  4ECQ A;  3QX7 A;  2D6F C;  4FZN A;  2YB4 A;  4EBD A;  2JRZ A;  4CF3 A;  4I28 A;  2WHE A;  2Y0S C;  4XUS A;  3IV6 A;  3RTV A;  4DSI A;  5AM3 A;  1TV9 A;  5BPC A;  2A1J A;  5AK4 A;  1ZJN A;  1NJZ A;  2YB1 A;  1ZD5 A;  2Y9T A;  4M9L A;  5KFC A;  2KKP A;  2HOI A;  3H0R B;  5J2G A; 
#chains in the Genus database with same CATH homology
 2E8M A;  3KKA C;  1B4F A;  2ES6 A;  1LKY B;  3K1R B;  2QKQ A;  4RQN A;  2YTU A;  1X66 A;  2ESE A;  1V38 A;  2D8C A;  1X9X A;  3TAD A;  5J8Y C;  1SXE A;  1Z1V A;  2KIV A;  2F3N A;  3TAD C;  5J8Y A;  1DXS A;  2EAM A;  2EAO A;  3SEI A;  2E8N A;  2DKX A;  1UQV A;  2B6G A;  2L5Y A;  2EAP A;  2D3D A;  1SV4 A;  1SGG A;  4NJ8 A;  3BS5 B;  5JU5 A;  2KE7 A;  1SV0 A;  2F8K A;  1PK1 A;  2GLE A;  4PZN A;  1PK1 B;  5KNI A;  1PK3 A;  4MHV A;  3KKA A;  5JRT A;  2E8P A;  1JI7 A;  4NL9 A;  1V85 A;  1LKY A;  3BQ7 A;  2QB0 A;  2K60 A;  2QAR B;  4RQM A;  1F0M A;  2DKZ A;  1SXD A;  2KG5 A;  1OW5 A;  4PZO A;  2JV3 A;  2Y9U A;  3TAC B;  4IS7 A;  2LPE A;  2QB0 B;  2QAR A;  3H8M A;  2QB1 A;  2KSO B;  2F44 A;  4NL9 C;  1KW4 A;  1B0X A;  1UCV A;  3SEN A;  3HIL A;  1SV0 C;  2KMD A;  2DL0 A;  5JTI A;  2KSO A;  5L1M A;  1WWV A;  1RG6 A;  3BS5 A;  1X40 A;  5F3X B;  2FE9 A;  2K4P A;  3IDW A;  1OXJ A;  2LMR A;  2EAN A;  2E8O A;  2Y9T A;  3BS7 A;  1WWU A;  1COK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...