1UCVA

Sterile alpha motif (sam) domain of ephrin type-a receptor 8
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
GSSGSSGLTVGDWLDSIRMGRYRDHFAAGGYSSLGMVLRMNAQDVRALGITLMGHQKKILGSIQTMRAQLTSTQGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPHRIN TYPE-A RECEPTOR 8
publication title NMR Structure of Sterile alpha motif (SAM) domain of ephrin type-A receptor 8
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 18
structure length 81
sequence length 81
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2003-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1ucvA00
5JTIA 1B4FA 3HILA 2KMDA 2KSOA 2K4PA 4PZNA 2D3DA 1V38A 2B6GA 4NL9A 3TADA 3SEIA 3KKAC 3SENA 3TACB 2QARB 4PZOA 2EANA 2E8NA 1UCVA 3H8MA 2YTUA 2F3NA 5J8YA 2DKZA 2Y9UA 5L1MA 1X66A 5JRTA 2F8KA 1Z1VA 2QB0A 2FE9A 3KKAA 1LKYB 2EAMA 2EAPA 1SV0C 2KIVA 2JV3A 4IS7A 2EAOA 1V85A 2KG5A 4MHVA 1PK1B 3BS5A 2K60A 1SXDA 1F0MA 2KSOB 1OW5A 2LPEA 4RQMA 4RQNA 1X40A 2DKXA 1B0XA 2QKQA 1SV0A 5KNIA 1COKA 1WWVA 2ESEA 3K1RB 4NJ8A 3IDWA 3BQ7A 1SGGA 2E8OA 1KW4A 1RG6A 1WWUA 2E8PA 2ES6A 2QB0B 1SV4A 2E8MA 2QARA 2QB1A 2KE7A 2Y9TA 2DL0A 2GLEA 5J8YC 2F44A 2D8CA 2LMRA 1X9XA 1UQVA 3BS5B 1LKYA 1DXSA 3BS7A 1SXEA 4NL9C 3TADC 2L5YA 5JU5A 5F3XB 1OXJA 1PK1A 1PK3A 1JI7A
chains in the Genus database with same CATH superfamily
3WKCA 3NRWA 5KFEA 4UB5A 2F1HA 7ICQA 3J81j 1D8BA 3N7RC 3JPSA 4IRDA 1D9DA 1BVSA 3CW2C 2AH5A 4C0ZA 5J0YA 8ICBA 5ALNA 1FFVA 3AN1A 3JPNA 5EE1A 3PSTA 1X66A 4YCXA 5JRTA 4KLJA 5DBAA 2WB1F 4QWCA 2I6XA 4UAUA 1SV0C 3V7KA 3PO5A 3GIMA 5DG9A 4KMOB 3ISBA 7ICIA 1S9FA 2ZIVB 1A76A 3K1ZA 5T14A 4QIWC 3C1YA 3UMGA 4Y2JA 1SV0A 1S0VA 3AQEA 5KT4A 4G3IA 2HSZA 2AGQA 3LWLA 2H5XA 4ELVA 2P6UA 3IDWA 5KT7A 3RAQA 3ICXA 5L1LA 1ZQ1C 1SL1A 2YQEA 3S6JA 1VDVA 5ALYA 3OGUA 1QSYA 1RPLA 3GIIA 1S0MA 8ICFA 2ZIWA 7ICVA 3WKAA 2RHFA 2H3IA 4QZ8A 5AIBA 1NKBA 2LMRA 1XSPA 4NLCA 3UMBA 4RPXA 1LV5A 1TVAA 1LKYA 3H40A 2KVSA 1JIHA 2H3ZA 1TAMA 1U48A 4TUPA 5IINA 1TFRA 3F2CA 4DFJA 2A3VA 1PUZA 3MDAA 2RP5A 2OM6A 7ICPA 2KNJA 4DL2A 2KEYA 2VA3A 3I1YA 1XC9A 3ZDEA 2K4PA 8ICWA 2XO7A 3KHHA 1X9SA 2FPMA 3PO4A 1KQQA 1J2MA 4PJ0U 4C4RA 1TK0A 2Q0ZX 5AIAA 8ICCA 2QLTA 3NVYA 1J2NA 1WYGA 5KG4A 4UB1A 5KL8B 3QU9A 4O3PA 4O9MA 2AHOB 2KKPA 3M9MB 4B9TA 1RYRA 9ICNA 3RBDA 1RDFA 5D46A 4UB4A 4F3OA 1V85A 2JGAA 2ISPA 1SXDA 2NRXA 1PVRA 4RU9A 2BCQA 3CYMA 2IHMA 5AK4A 4FS2A 2W9MA 1T4GA 1L7NA 3EWAA 5ALOA 2XCAA 5AI4A 5CJ7A 5AKLA 1YZ6A 4ECZA 3PW4A 3H8SA 4ZOHC 4EZ9A 9ICQA 4M6WA 7ICMA 2VJ4A 5KFVA 5KFDA 2BCUA 4YMOA 2IHNA 1QH9A 4ECQA 2E3TA 3MR2A 1JRPA 5AKGA 3WK7A 2HCFA 3ORYA 4DL3A 4BXOA 2DL0A 2ASJA 2A1JA 1SL2A 1NI3A 4PGXA 2W8KA 3RJJA 4RPZA 9ICBA 4IR9A 2BKEA 3LDAA 4J9OA 4DS4A 2E5SA 4KLHA 1AROP 3A0HU 3MBYA 4Z6FA 3V6HA 3ZDCA 3RB3A 5J2EA 2HW3A 1SIJA 4MEXA 2B6GA 2LYHA 4IQTA 1ZQDA 3RJFA 3SYZA 4Y2TA 1DRGA 2FMQA 3EYZA 3QEAZ 4B6JA 1ECWA 3HRDD 1ED1A 4F5RA 4GXKA 4KLMA 5EE3A 1S0NA 8ICRA 3F5EA 3PMLA 1MQ3A 3QU5A 3MABA 4DL7A 2C2EA 2HHWA 3FYHA 3H4DA 8ICTA 1KEJA 4O3QA 9ICCA 1N62A 4QW8A 4QZIA 2K89A 3UQ0A 3IN5A 3LVVA 2IBKA 4Y2QA 3IG5A 4YD2A 3T5KA 1X6JA 1ZQHA 2DKXA 2E1EA 5J2IA 2ESEA 3NVWA 3LVWA 4PHAA 2KOBA 2BZFA 4JV0A 4QWEA 1KRPA 3D2QA 3EPGA 4JV1A 2G5HB 1V97A 3G6YA 5HMMA 1D8LA 5KT6A 4UAWA 1LVHA 3Q8PB 3UMCA 3WKDA 2K8BB 4RQ7A 2GH1A 1NK7A 1CRXA 1X9XA 5BOLA 5DB7A 7ICOA 5ALFA 4FE3A 1Q46A 4K4GA 3TADC 5KFCA 2L5YA 5L9XA 4C8NA 3UXOA 1SB3C 3TANA 4OJLA 1L8LA 3QU2A 3D6JA 3HWTA 1S97A 1Z3EB 2D3DA 3C1ZA 3TADA 5HR6A 2K4IA 3C28A 3PX4A 5ALGA 2F8LA 4JUZA 2BCSA 2F3NA 2VKQA 5DDYA 3ZI4A 5J0QA 2JH1A 4P2HA 4EBCA 3ZDBA 2ZTCA 4O3NA 5ALMA 2KVCA 9ICUA 4XA5A 2JMGA 5AKZA 5D49A 4DWIA 4ACOA 4YN4A 3SAFA 5DG8A 2LM4A 5J2BA 2HDOA 1Q3UA 5EE9A 3WK6A 5ALEA 2KHQA 4NWIA 1ZQAA 4Y2PA 4NLGA 1NK5A 4QWDA 4RQ0A 4EBDA 2XY6A 1ZQEA 5KG2A 5AM2A 3PV8A 4J9QA 2J6TA 4KLTA 4RQ1A 2BCVA 3KHRA 1KTQA 2KE7A 2ZIVA 1ZRMA 2Y0SC 1FEZA 2D8CA 2ZXHA 3BS5B 1U45A 1P7DA 4QWAA 1OUQA 4KX5A 3FDSA 1IV8A 1ZQJA 5AKXA 5J0WA 4EZ6A 5IILA 5J2JA 3V72A 4P0PB 4TURA 3MDCA 4EYIB 4EENA 1ZJNA 5JTIA 4KN4A 1T8EA 3RRHA 4B9MA 4J03A 5KAFU 2W11A 3RH5A 3B0YA 5AKJA 2ZTEA 2M9NA 4F71A 2G0AA 3N97B 3RJEA 4GLXA 4I2CA 4IQWA 1L7OA 1ZQZA 4RT2A 2HOIA 4KLSA 1F5SA 3AMZA 2KK0A 2F8KA 3OHAA 1RXVA 4ZH4A 5DQIA 1SZHA 4FZNA 5AKEA 4QZGA 2NRWA 5DQHA 3OPXA 4NY8A 4F72A 5AHXA 3TARA 2MRLA 4CNQA 2HBMA 2HHUA 3TKAA 1UT8A 4C7ZA 2PI4A 1ZD2P 2R18A 5BOMA 4R8UB 2OH2A 3RR8A 3EUB2 4NLBA 1NNLA 2NRVA 5ALWA 2I9GA 3K1RB 5J0PA 4CRXA 5CHGA 2XICA 3NS1A 1BPBA 1V9PA 2NYVA 1BPYA 2OYYA 1RQNA 4PGQA 2OXOA 1CI4A 3V7JA 7ICLA 2MU2A 4UAYA 1PVPA 2JRZA 3C21A 8ICOA 5KFMA 3PR4A 2R8GA 5CEHA 8ICEA 1RM6C 3GU3A 3KFUF 3M7DA 3GV8B 2ASDA 1SWVA 1QSLA 4FZMA 3HW8A 3EW9A 3QNMA 1L3UA 1Y88A 5KG1A 3GQCA 1SXEA 2HHQA 9ICPA 1ZRNA 4DSKA 1PK3A 1JI7A 4CGZA 4UW9A 1ZD5A 3MFHA 5IIKA 5J2DA 4DFKA 2KSOA 4DFDA 4B9VA 3F5AA 2UVVA 4F5QA 1L3TA 3SENA 2KJ8A 3RTVA 3PSFA 4Z6CA 4KLQA 2DWQA 2FPKA 4KN7A 4QZHA 2KJ9A 5J8YA 1BNPA 2KICA 3KBBA 3M1YA 3U26A 4QZDA 4M9HA 1JX4A 2LYAA 5FP0A 4XQ8A 5EOZA 2UVRA 3C2LA 3PMNA 4MHVA 1PK1B 5AK5A 3GFKB 4QZBA 2ODGA 5AKYA 3SZ2A 2V9WA 1RQLA 5J0OA 4J9NA 1D9FA 4KLIA 1OW5A 5AICA 5KG7A 3PSIA 2YMPA 3E2EA 1XO1A 5KTQA 4U7CA 3WKBA 4F4KA 1B22A 3BDPA 5AI6A 5AI8A 4EX7A 3ONNA 4DLEA 1SL0A 2JEIA 2WB1C 5CA7A 4C80A 3E0FA 3QZ7A 2XGPA 7ICFA 3F2DA 2QB0B 1SV4A 2W04A 3V6KA 2YMQA 5F9LA 2RLTA 3PW5A 4G9BA 1ZD4A 2BPFA 1L7MA 5KFGA 4PL2A 4ECVA 3TQ1A 2PFNA 3EPIA 4YR3A 3DDHA 3H0LB 4F5PA 5JU5A 3GDXA 1OXJA 4NM2A 4DL5A 4NLNA 5KFIA 1JXLA 7ICJA 2PFPA 4PHPA 4O5CA 2FMPA 4QW9A 1JMSA 3UXNA 3SEIA 3QU7A 1BPZA 3UPQA 4I28A 1YZ7A 4RUCA 4KLLA 4EBEA 3ZD8A 2OCEA 3HJEA 1NZBA 4BUGA 3T79A 4I2IA 2E1FA 1CUKA 2WF9A 5J0TA 1URJA 2EAMA 1SWWA 2AJQA 2KIVA 3BQ0A 3QU4A 2ZJ5A 2K60A 3KZXA 4F2RA 4UBCA 4HYKA 2YY6A 4DQRA 4C4SA 2BDPA 5DGAA 1B0XA 2QKQA 1NJWA 2EQYA 3SI8A 1WWVA 3HT3A 4F93B 2LBOA 5AM4A 2AQ0A 5DLFA 5HP4A 2ZIXB 4YG2A 4C7YA 7ICHA 4JMUA 4I2EA 2E8PA 2JEGA 5EWGA 3WK4A 2PXIA 2QB1A 4UAVA 3N7SC 3V6JA 4I2BA 1QLNA 3NASA 2EZYA 5DQGA 1UA0A 3HP6A 2CRXA 2HHXA 1JN3A 4K4HA 4ECUA 1ZQKA 1DXSA 4BDPA 2XVTA 2B0CA 2DGZA 2R8JA 5KFHA 5C0YA 2W3RA 5JUMA 1O03A 3H7IA 5KAIU 4M9LA 1B4FA 3KHLA 1LB2B 5G5GA 4PZNA 3AU2A 4QZFA 5F9NA 4OJPA 1BGXT 2J6UA 2OWOA 2W9BB 2EANA 2KD1A 4M9GA 4B9SA 3MGVA 2YTUA 2BQRA 4IRKA 3I28A 4O3RA 3ETRA 3PR5B 2G5IB 3GILA 4P0PA 9ICIA 9ICGA 2XC9A 9ICAA 1XS9D 5J2GA 2EZZA 3PX6A 2PFQA 2GWSA 4Y2RA 2W43A 4Y2YA 3QYPA 1BPDA 4FBUA 1HUZA 1RZTA 8ICUA 3KD3A 1UT5A 1X2IA 4RPYA 4AYBF 4M04A 4J9PA 3C5GA 2ISOA 4EYHB 4Q45A 1PZNA 3RJKA 7ICRA 4PPXA 5AM0A 3FAHA 4E0DA 2XIDA 1SZPA 5DB6A 1IM4A 2KZ3A 3M6KA 3N28A 4MF8A 3BQ7A 2K8CB 3TI0A 4FFDA 1TK8A 5KFLA 4DFPA 4ED3A 1ZQFA 1S8OA 2DBYA 4B9LA 2BR0A 2QARA 5ALKA 8ICAA 3AL0B 2AU0A 2BDUA 1JALA 1TKDA 3THVA 2K8AA 2XY5A 2F44A 4R8UA 4FO6A 1M6YA 2YX8A 2PMZF 4OD0A 3BS7A 3RRGA 4RNOA 5BPCA 4RQ3A 2FLNA 4DL4A 1TE2A 5AK6A 1S76D 4DEZA 8ICGA 1XU4A 3CNHA 2G06A 3IV6A 1NK6A 1S10A 1GO3F 4LJXA 4F91B 4DSFA 3Q8KA 4KITB 4QZCA 4I27A 1K1QA 4PZOA 2ZIWB 2W7OA 1DGJA 1UCVA 3MFIA 1DOQA 1ZQTA 1RYSA 4ED2A 8ICPA 1LKYB 5J2KA 9ICEA 2JV3A 4RNMA 5ALVA 2J6SA 2YB1A 1X9WA 4KTQA 5KG0A 1WUDA 1F0MA 1WCNA 2FI1A 4ED0A 3JPQA 2M0NA 5AM1A 1KL9A 3OJUA 4PGYA 2PKEA 4ED1A 2JZBA 4FZLA 1A77A 2W9AA 1T3QA 1UA1A 2H3FA 4PH5A 2Q4TA 5H2FU 5B66U 2NRTA 3MGIA 7ICEA 1RG6A 7ICNA 2CPRA 3R9KA 4JV2A 4CF4A 5G5HA 2LYBA 5KFNA 3RB6A 2E8MA 3GV7B 5ALXA 5D4BA 3BQTA 3C23A 3IP4B 4O5EA 1ZOLA 2F76X 8ICJA 1ZETA 3QX7A 3QXGA 2DF4B 3NVVA 2HOQA 3BZCA 3B9JA 3RH6A 4I2JA 5ALSA 4Q8EA 3Q8SB 2FPLA 3RFAA 5KT5A 5EE0A 1ZQYA 5KT3A 1JXEA 7ICUA 1ZQQA 1PVQA 5J0SA 1COOA 3TFSA 1HJPA 4O0IA 3JPPA 1KFTA 2YMLA 3C29A 4M6WB 2W54A 2RQ5A 3RBEA 1VJ5A 4J9SA 4ED8A 2JHDA 3H0RB 5ALPA 3OHBA 7ICSA 2CXYA 5AM5A 1KN5A 4PL1A 4MEYA 5ALLA 1UHUA 4P4MA 3TAPA 4CCHA 4O5KA 3PZPA 3PW2A 3ZD9A 4Y2VA 9ICLA 1N63A 1Z00B 4Q8FA 3IRUA 3LWMA 3PX0A 4KLOA 5KFXA 4F50A 4OJ5A 5J2AA 2EDUA 4OCZA 3UQ2A 1L8OA 2F1IA 3NTUA 4QNLA 1ZQSA 3T5LA 5TZVA 3NRZA 3KOOA 1NOMA 2ZJAA 5ALDA 1ZJMA 5ALRA 9ICWA 1TK5A 3RF9A 1SGGA 1F44A 1H38A 2Y1JA 1ZQRA 2LHTA 1HEKA 2BPCA 3E58A 4R64A 2MSNA 4C4TA 2BCRA 3K75D 4Q43A 4F4WA 2KKVA 7ICTA 4DQPA 1ZQIA 1J97A 2AXTU 3MR3A 4IC9A 2K4HA 1ZQGA 2ZIXA 3L5KA 2IOHA 1NK8A 2F77X 2PFOA 2ALZA 3N4MB 2ZUCA 4TUSA 4F2SA 5GTIU 3AU6A 2R8KA 2ATLA 2D6FC 3IG8A 3IHQB 2K4EA 1XWLA 2HHSA 3KTQA 8ICXA 3KKAC 4UQGA 4ECRA 2VA8A 1WCLA 4YVZA 4US9A 8ICIA 1NZPA 3BQ2A 3T5HA 3PSPA 2FLPA 3K4GA 3KHGA 2V4QA 3PNCA 3KZIU 3L3FX 1Z1VA 1O08A 3KKAA 9ICRA 3RAXA 5KFFA 4M9NA 3DV9A 4FBTA 2P6RA 8ICQA 3N7PD 1RYUA 3ISDA 3M9NB 1ZD3A 4ED6A 9ICVA 1UPHA 5KG3A 2HVHA 3QUCA 9ICJA 3PW0A 3ALRA 1T7PA 4RQNA 1Z4OA 4DQSA 1COKA 5K4LA 2GO7A 2WF5A 2NO5A 4CF3A 2W8LA 3PY8A 5ALZA 2CN1A 4O3OA 1ZQXA 2KHVA 1QQ5A 2E8OA 3B0XA 5CWRA 1IG6A 4JWMA 3JPRA 4I29A 2DPIA 5ALTA 2IOFA 3Q8QB 5AKIA 1TAUA 4ECXA 3C2KA 8ICMA 4DS5A 3BQ1A 4RQ2A 3ZDAA 2NO4A 4O3MA 4DF4A 2I5HA 3TFRA 4NL9C 3D2SA 1L3SA 3IM1A 3M8SA 2N1RA 2KFNA 3OJSA 2C28A 2HBLA 1X42A 4F5OA 4CF5A 3Q8MA 3QUBA 8ICVA 5ALHA 2BPGA 2MAXA 3HX0A 4NL9A 1S5LU 4CDGA 2Y1IA 4I2GA 1YT3A 4BJQA 4QIWF 4B9UA 5ALIA 4I2AA 9ICMA 4QZEA 8ICHA 2GOLA 3SAHA 2DFLA 3Q8RB 2FLLA 5KFUA 3RJGA 2PI5A 5HHHA 4UBBA 3G6XA 4NXZA 4DOCA 5KFTA 5KFQA 3GZFA 1NKCA 2JR5A 4Z6EA 3UM9A 4IS7A 2G08A 3WU2U 4ECWA 2XCPA 3H4BA 2KP7A 1ZQVA 4IQVA 2KZMA 2VANA 2MUTB 4I2HA 3GIKA 2LPEA 4RQMA 2I1QA 3GV5B 4AP9A 1T3NA 1N60A 5KFPA 1L6NA 2LKYA 5KT2A 4DCCA 5E79U 4GXJA 3LK9A 8ICYA 3SAGA 1VLBA 4I2DA 2OHFA 1U49A 4O3SA 1C20A 4ICAA 2YMMA 3SQIA 3NVZA 9ICKA 2W7PA 2Y9TA 4MFFA 3M6ZA 7ICGA 5CB1A 1S0OA 1UQVA 1KFSA 5ALUA 3WK5A 5J2FA 1QQ7A 4KLFA 5DLGA 4IQUA 2RDJA 3SV3A 1U4BA 4ECYA 3LYSA 5CR0A 2KFZA 5AKHA 3AM9A 2OEHA 5F3XB 2W9CB 1NJZA 5AKKA 4YP3A 4C8LA 1U9LA 1ZYQA 4MFCA 2KIWA 1MSWD 5J29A 1NK4A 4F4YA 5KG6A 2ZUDA 4CE6A 5HHIA 2B21A 5DBCA 2BGWA 1N2XA 3MR5A 1SKRA 3WKEA 8ICLA 5KL1B 2NV3A 5DG7A 4OJ6A 5L1JA 3V7LA 4F92B 4F8RA 2F2AB 1AQ6A 4P0QB 4RT3A 4Q44A 3Q8LA 1HIWA 1ZQCA 4RQ6A 2H3VA 3VC8A 4JWNA 2IMWP 2ZIUB 4DOBA 2FE9A 1BPEA 4IRCA 5IIOA 1XSNA 1D8YA 3QUQA 4ED7A 3BS5A 1QQ6A 4K4IA 3JPOA 1NJXA 5J0XA 1QSSA 3WK8A 1ZQNA 2KSOB 5AM3A 4DSLA 8ICSA 1ZQBA 5L1KA 1IIPA 1L7PA 5KNIA 2R8IA 3ETLA 2ZXIA 2R8HA 4Y2SA 4C8KA 3UXPA 5DB9A 4RQ4A 3SD7A 2KJ5A 1KW4A 1Z00A 2HI0A 3NGDA 2C2RA 1WWUA 4BWJA 4ECSA 3T3FA 4OO1J 4YFKA 1FO4A 2C2DA 2WHEA 4J9KA 1A6SA 4MFAA 2DUYA 2G09A 2JXJA 4NLKA 4AYBC 1Q3VA 4NV0A 4X5VA 3C5FA 5KFZA 4UB3A 1KLNA 1TV9A 2KN7A 2XI9A 9ICTA 3M8RA 1KDHA 4R65A 2HMXA 3CP8A 4J9RA 7ICKA 1ZQWA 2ZG6A 4KLDA 3HILA 1KKXA 2IA6A 8ICKA 2WAQF 2HHTA 4IL6U 5IIIA 1K1SA 2HBJA 5AK3A 2WAQC 4UB2A 5C5JA 3DEEA 3TACB 4OJOA 3D2NA 4ECTA 2PMZC 4LZDA 4R66A 3G6VA 4RUAA 8ICZA 5KFWA 3JPTA 3MGHA 5AI0A 3H8WA 2KZZA 1WG8A 4RQ5A 3SMVA 1N5XA 2WF8A 5KFYA 1KSPA 3FM9A 5AI5A 1FIQA 5A0LA 4BGDA 2YN4A 4DF8A 4WJ3B 4Y2UA 2EAOA 2F1JA 5J0UA 1A0PA 5ALJA 2VJ5A 4DQIA 2RDIA 4KLUA 5J2HA 5J2CA 2W3SA 1DGSA 2EZXA 4FS1A 4GC6A 1X40A 4F5NA 5GTHU 1T94A 2V4RA 4RZRA 4NJ8A 5EWEA 5KG5A 1MQ2A 4C8OA 2C22A 2EH9A 4NLZA 3SV4A 2XY7A 3WK9A 1N5WA 2ES6A 2AQ4A 1DK2A 3TAQA 2ZTDA 4YXJA 2KTQA 1N56A 2AGOA 1IXRA 2JH7A 3L4PA 2MA1A 1NKEA 1EXNA 4YXMA 4IR1A 3OSPA 4J9MA 3QE9Y 2P66A 3H8JA 4ELUA 3PVXA 2BQ3A 1PK1A 1SKSA 5CRXA 1B43A 4QZ9A 1ZQUA 3NUQA 4ELTA 4HAIA 4YR0A 3VCBA 4UATA 2H3QA 5TISU 2WTFA 5KFKA 1V38A 4BWMA 4UAZA 1X6IA 4YQWA 1X9MA 2IOFK 4B9NA 4EEKA 5KFAA 1QTMA 4UASA 2E8NA 4TQSA 3H8MA 4RNNA 2DKZA 2Y9UA 3OTQA 5L1MA 1L3VA 1CEZA 5DDMA 1BNOA 5ALQA 2QB0A 2RRDA 5CP2A 1ZQPA 2VA2A 1ZQLA 2LM1A 1MN8A 1ZXIA 2KG5A 3ED5A 1HUOA 4KLGA 5KFSA 3HKZF 4QWBA 2Y0SF 4A8EA 4BXOB 4XUSA 4J9LA 2DQNB 3HKZC 5DB8A 2A19A 2A1JB 3QEBZ 4M2YA 4PHDA 4US8A 2WF6A 4RQ8A 2A1AA 2XGQA 1L5UA 2KV2A 1DK3A 2WF7A 5HR7A 3AQFA 4I2FA 1XSLA 4DFMA 5KFJA 5DKWA 2HHVA 4M47A 1NK9A 4JB3A 4P4PA 3M9OB 1S77D 5HMLA 5DGBA 4Z6DA 5L1IA 4GFJA 3QZ8A 4GC7A 2MUTA 4DSJA 3FC4A 1KFDA 2GLEA 1QCKA 2ZUBA 4KLEA 4DO9A 1U47A 3AEVA 3RB4A 2JEFA 3RJHA 8ICNA 4EELA 2NRZA 2JEJA 5KFOA 4UARA 5KFBA 1JROA 9ICXA 3SR6A 4BX9C 1XO0A 4MF2A 4C8MA 4R63A 3F2BA 2UVWA 4TQRA 3RH4A 4NM1A 2P35A 1RXWA 3EZ5A 3AUOA 3A0BU 1XNSA 4DOAA 2KMDA 2G07A 3HPOA 4DSEA 2BQUA 4KX3A 1ZQMA 3T5JA 4QZAA 9ICOA 1Z4NA 2YB4A 2QARB 3QUTA 3I76A 4M0AA 1K5OA 1KBUA 4QJFB 1NK0A 5IIMA 2DPJA 4XRHA 4U6PA 3BZKA 5AI9A 4PHEA 2FDRA 2W9CA 4UB8U 3ISCA 4LZGA 1C7YA 2Z7JA 4GIBA 9ICHA 2LI6A 4DLGA 4DQQA 2FMSA 4EX6A 3RB0A 2AGPA 2EAPA 3RJIA 1FFUA 3GIJA 3O0FA 3BJYA 5DBBA 4LVSA 4P4OA 2ZJ8A 1Z1BA 3OSNA 5IIJA 1MC8A 4Y2XA 2BHNA 3PW7A 3H0MB 1MA7A 1NJYA 3RR7A 4P0QA 5KFRA 1N48A 4DL6A 4F4XA 1TAQA 3MR6A 3ZDDA 2HOFA 2ZIUA 2HVIA 1N61A 4DSIA 4EEYA 5B5EU 2FJ6A 1Z19A 3C2MA 4JK1A 4YR2A 1JUDA 2UVUA 2HBKA 4YD1A 9ICFA 4YMNA 2W9BA 2W55A 4M9JA 5J0RA 5J8YC 1SKWA 3CRXA 4GXIA 5EWFA 3MC1A 3F53A 2O6KA 2W03A 5HNKA 2ASLA 2VIXA 2WFAA 4F4ZA 4TUQA 1Q8KA 1ZQOA 4KMUA 1BPXA 4UB6U 9ICSA 2JZBB 4YMMA 4USAA
chains in the Genus database with same CATH topology
5JTIA 1B4FA 3HILA 2KMDA 2KSOA 2K4PA 4PZNA 2D3DA 1V38A 2B6GA 4NL9A 3TADA 3SEIA 3KKAC 3SENA 3TACB 2QARB 4PZOA 2EANA 2E8NA 1UCVA 3H8MA 2YTUA 2F3NA 5J8YA 2DKZA 2Y9UA 5L1MA 1X66A 5JRTA 2F8KA 1Z1VA 2QB0A 2FE9A 3KKAA 1LKYB 2EAMA 2EAPA 1SV0C 2KIVA 2JV3A 4IS7A 2EAOA 1V85A 2KG5A 4MHVA 1PK1B 3BS5A 2K60A 1SXDA 1F0MA 2KSOB 1OW5A 2LPEA 4RQMA 4RQNA 1X40A 2DKXA 1B0XA 2QKQA 1SV0A 5KNIA 1COKA 1WWVA 2ESEA 3K1RB 4NJ8A 3IDWA 3BQ7A 1SGGA 2E8OA 1KW4A 1RG6A 1WWUA 2E8PA 2ES6A 2QB0B 1SV4A 2E8MA 2QARA 2QB1A 2KE7A 2Y9TA 2DL0A 2GLEA 5J8YC 2F44A 2D8CA 2LMRA 1X9XA 1UQVA 3BS5B 1LKYA 1DXSA 3BS7A 1SXEA 4NL9C 3TADC 2L5YA 5JU5A 5F3XB 1OXJA 1PK1A 1PK3A 1JI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JTI A;  1B4F A;  3HIL A;  2KMD A;  2KSO A;  2K4P A;  4PZN A;  2D3D A;  1V38 A;  2B6G A;  4NL9 A;  3TAD A;  3SEI A;  3KKA C;  3SEN A;  3TAC B;  2QAR B;  4PZO A;  2EAN A;  2E8N A;  1UCV A;  3H8M A;  2YTU A;  2F3N A;  5J8Y A;  2DKZ A;  2Y9U A;  5L1M A;  1X66 A;  5JRT A;  2F8K A;  1Z1V A;  2QB0 A;  2FE9 A;  3KKA A;  1LKY B;  2EAM A;  2EAP A;  1SV0 C;  2KIV A;  2JV3 A;  4IS7 A;  2EAO A;  1V85 A;  2KG5 A;  4MHV A;  1PK1 B;  3BS5 A;  2K60 A;  1SXD A;  1F0M A;  2KSO B;  1OW5 A;  2LPE A;  4RQM A;  4RQN A;  1X40 A;  2DKX A;  1B0X A;  2QKQ A;  1SV0 A;  5KNI A;  1COK A;  1WWV A;  2ESE A;  3K1R B;  4NJ8 A;  3IDW A;  3BQ7 A;  1SGG A;  2E8O A;  1KW4 A;  1RG6 A;  1WWU A;  2E8P A;  2ES6 A;  2QB0 B;  1SV4 A;  2E8M A;  2QAR A;  2QB1 A;  2KE7 A;  2Y9T A;  2DL0 A;  2GLE A;  5J8Y C;  2F44 A;  2D8C A;  2LMR A;  1X9X A;  1UQV A;  3BS5 B;  1LKY A;  1DXS A;  3BS7 A;  1SXE A;  4NL9 C;  3TAD C;  2L5Y A;  5JU5 A;  5F3X B;  1OXJ A;  1PK1 A;  1PK3 A;  1JI7 A; 
#chains in the Genus database with same CATH topology
 3WKC A;  3NRW A;  5KFE A;  4UB5 A;  2F1H A;  7ICQ A;  3J81 j;  1D8B A;  3N7R C;  3JPS A;  4IRD A;  1D9D A;  1BVS A;  3CW2 C;  2AH5 A;  4C0Z A;  5J0Y A;  8ICB A;  5ALN A;  1FFV A;  3AN1 A;  3JPN A;  5EE1 A;  3PST A;  1X66 A;  4YCX A;  5JRT A;  4KLJ A;  5DBA A;  2WB1 F;  4QWC A;  2I6X A;  4UAU A;  1SV0 C;  3V7K A;  3PO5 A;  3GIM A;  5DG9 A;  4KMO B;  3ISB A;  7ICI A;  1S9F A;  2ZIV B;  1A76 A;  3K1Z A;  5T14 A;  4QIW C;  3C1Y A;  3UMG A;  4Y2J A;  1SV0 A;  1S0V A;  3AQE A;  5KT4 A;  4G3I A;  2HSZ A;  2AGQ A;  3LWL A;  2H5X A;  4ELV A;  2P6U A;  3IDW A;  5KT7 A;  3RAQ A;  3ICX A;  5L1L A;  1ZQ1 C;  1SL1 A;  2YQE A;  3S6J A;  1VDV A;  5ALY A;  3OGU A;  1QSY A;  1RPL A;  3GII A;  1S0M A;  8ICF A;  2ZIW A;  7ICV A;  3WKA A;  2RHF A;  2H3I A;  4QZ8 A;  5AIB A;  1NKB A;  2LMR A;  1XSP A;  4NLC A;  3UMB A;  4RPX A;  1LV5 A;  1TVA A;  1LKY A;  3H40 A;  2KVS A;  1JIH A;  2H3Z A;  1TAM A;  1U48 A;  4TUP A;  5IIN A;  1TFR A;  3F2C A;  4DFJ A;  2A3V A;  1PUZ A;  3MDA A;  2RP5 A;  2OM6 A;  7ICP A;  2KNJ A;  4DL2 A;  2KEY A;  2VA3 A;  3I1Y A;  1XC9 A;  3ZDE A;  2K4P A;  8ICW A;  2XO7 A;  3KHH A;  1X9S A;  2FPM A;  3PO4 A;  1KQQ A;  1J2M A;  4PJ0 U;  4C4R A;  1TK0 A;  2Q0Z X;  5AIA A;  8ICC A;  2QLT A;  3NVY A;  1J2N A;  1WYG A;  5KG4 A;  4UB1 A;  5KL8 B;  3QU9 A;  4O3P A;  4O9M A;  2AHO B;  2KKP A;  3M9M B;  4B9T A;  1RYR A;  9ICN A;  3RBD A;  1RDF A;  5D46 A;  4UB4 A;  4F3O A;  1V85 A;  2JGA A;  2ISP A;  1SXD A;  2NRX A;  1PVR A;  4RU9 A;  2BCQ A;  3CYM A;  2IHM A;  5AK4 A;  4FS2 A;  2W9M A;  1T4G A;  1L7N A;  3EWA A;  5ALO A;  2XCA A;  5AI4 A;  5CJ7 A;  5AKL A;  1YZ6 A;  4ECZ A;  3PW4 A;  3H8S A;  4ZOH C;  4EZ9 A;  9ICQ A;  4M6W A;  7ICM A;  2VJ4 A;  5KFV A;  5KFD A;  2BCU A;  4YMO A;  2IHN A;  1QH9 A;  4ECQ A;  2E3T A;  3MR2 A;  1JRP A;  5AKG A;  3WK7 A;  2HCF A;  3ORY A;  4DL3 A;  4BXO A;  2DL0 A;  2ASJ A;  2A1J A;  1SL2 A;  1NI3 A;  4PGX A;  2W8K A;  3RJJ A;  4RPZ A;  9ICB A;  4IR9 A;  2BKE A;  3LDA A;  4J9O A;  4DS4 A;  2E5S A;  4KLH A;  1ARO P;  3A0H U;  3MBY A;  4Z6F A;  3V6H A;  3ZDC A;  3RB3 A;  5J2E A;  2HW3 A;  1SIJ A;  4MEX A;  2B6G A;  2LYH A;  4IQT A;  1ZQD A;  3RJF A;  3SYZ A;  4Y2T A;  1DRG A;  2FMQ A;  3EYZ A;  3QEA Z;  4B6J A;  1ECW A;  3HRD D;  1ED1 A;  4F5R A;  4GXK A;  4KLM A;  5EE3 A;  1S0N A;  8ICR A;  3F5E A;  3PML A;  1MQ3 A;  3QU5 A;  3MAB A;  4DL7 A;  2C2E A;  2HHW A;  3FYH A;  3H4D A;  8ICT A;  1KEJ A;  4O3Q A;  9ICC A;  1N62 A;  4QW8 A;  4QZI A;  2K89 A;  3UQ0 A;  3IN5 A;  3LVV A;  2IBK A;  4Y2Q A;  3IG5 A;  4YD2 A;  3T5K A;  1X6J A;  1ZQH A;  2DKX A;  2E1E A;  5J2I A;  2ESE A;  3NVW A;  3LVW A;  4PHA A;  2KOB A;  2BZF A;  4JV0 A;  4QWE A;  1KRP A;  3D2Q A;  3EPG A;  4JV1 A;  2G5H B;  1V97 A;  3G6Y A;  5HMM A;  1D8L A;  5KT6 A;  4UAW A;  1LVH A;  3Q8P B;  3UMC A;  3WKD A;  2K8B B;  4RQ7 A;  2GH1 A;  1NK7 A;  1CRX A;  1X9X A;  5BOL A;  5DB7 A;  7ICO A;  5ALF A;  4FE3 A;  1Q46 A;  4K4G A;  3TAD C;  5KFC A;  2L5Y A;  5L9X A;  4C8N A;  3UXO A;  1SB3 C;  3TAN A;  4OJL A;  1L8L A;  3QU2 A;  3D6J A;  3HWT A;  1S97 A;  1Z3E B;  2D3D A;  3C1Z A;  3TAD A;  5HR6 A;  2K4I A;  3C28 A;  3PX4 A;  5ALG A;  2F8L A;  4JUZ A;  2BCS A;  2F3N A;  2VKQ A;  5DDY A;  3ZI4 A;  5J0Q A;  2JH1 A;  4P2H A;  4EBC A;  3ZDB A;  2ZTC A;  4O3N A;  5ALM A;  2KVC A;  9ICU A;  4XA5 A;  2JMG A;  5AKZ A;  5D49 A;  4DWI A;  4ACO A;  4YN4 A;  3SAF A;  5DG8 A;  2LM4 A;  5J2B A;  2HDO A;  1Q3U A;  5EE9 A;  3WK6 A;  5ALE A;  2KHQ A;  4NWI A;  1ZQA A;  4Y2P A;  4NLG A;  1NK5 A;  4QWD A;  4RQ0 A;  4EBD A;  2XY6 A;  1ZQE A;  5KG2 A;  5AM2 A;  3PV8 A;  4J9Q A;  2J6T A;  4KLT A;  4RQ1 A;  2BCV A;  3KHR A;  1KTQ A;  2KE7 A;  2ZIV A;  1ZRM A;  2Y0S C;  1FEZ A;  2D8C A;  2ZXH A;  3BS5 B;  1U45 A;  1P7D A;  4QWA A;  1OUQ A;  4KX5 A;  3FDS A;  1IV8 A;  1ZQJ A;  5AKX A;  5J0W A;  4EZ6 A;  5IIL A;  5J2J A;  3V72 A;  4P0P B;  4TUR A;  3MDC A;  4EYI B;  4EEN A;  1ZJN A;  5JTI A;  4KN4 A;  1T8E A;  3RRH A;  4B9M A;  4J03 A;  5KAF U;  2W11 A;  3RH5 A;  3B0Y A;  5AKJ A;  2ZTE A;  2M9N A;  4F71 A;  2G0A A;  3N97 B;  3RJE A;  4GLX A;  4I2C A;  4IQW A;  1L7O A;  1ZQZ A;  4RT2 A;  2HOI A;  4KLS A;  1F5S A;  3AMZ A;  2KK0 A;  2F8K A;  3OHA A;  1RXV A;  4ZH4 A;  5DQI A;  1SZH A;  4FZN A;  5AKE A;  4QZG A;  2NRW A;  5DQH A;  3OPX A;  4NY8 A;  4F72 A;  5AHX A;  3TAR A;  2MRL A;  4CNQ A;  2HBM A;  2HHU A;  3TKA A;  1UT8 A;  4C7Z A;  2PI4 A;  1ZD2 P;  2R18 A;  5BOM A;  4R8U B;  2OH2 A;  3RR8 A;  3EUB 2;  4NLB A;  1NNL A;  2NRV A;  5ALW A;  2I9G A;  3K1R B;  5J0P A;  4CRX A;  5CHG A;  2XIC A;  3NS1 A;  1BPB A;  1V9P A;  2NYV A;  1BPY A;  2OYY A;  1RQN A;  4PGQ A;  2OXO A;  1CI4 A;  3V7J A;  7ICL A;  2MU2 A;  4UAY A;  1PVP A;  2JRZ A;  3C21 A;  8ICO A;  5KFM A;  3PR4 A;  2R8G A;  5CEH A;  8ICE A;  1RM6 C;  3GU3 A;  3KFU F;  3M7D A;  3GV8 B;  2ASD A;  1SWV A;  1QSL A;  4FZM A;  3HW8 A;  3EW9 A;  3QNM A;  1L3U A;  1Y88 A;  5KG1 A;  3GQC A;  1SXE A;  2HHQ A;  9ICP A;  1ZRN A;  4DSK A;  1PK3 A;  1JI7 A;  4CGZ A;  4UW9 A;  1ZD5 A;  3MFH A;  5IIK A;  5J2D A;  4DFK A;  2KSO A;  4DFD A;  4B9V A;  3F5A A;  2UVV A;  4F5Q A;  1L3T A;  3SEN A;  2KJ8 A;  3RTV A;  3PSF A;  4Z6C A;  4KLQ A;  2DWQ A;  2FPK A;  4KN7 A;  4QZH A;  2KJ9 A;  5J8Y A;  1BNP A;  2KIC A;  3KBB A;  3M1Y A;  3U26 A;  4QZD A;  4M9H A;  1JX4 A;  2LYA A;  5FP0 A;  4XQ8 A;  5EOZ A;  2UVR A;  3C2L A;  3PMN A;  4MHV A;  1PK1 B;  5AK5 A;  3GFK B;  4QZB A;  2ODG A;  5AKY A;  3SZ2 A;  2V9W A;  1RQL A;  5J0O A;  4J9N A;  1D9F A;  4KLI A;  1OW5 A;  5AIC A;  5KG7 A;  3PSI A;  2YMP A;  3E2E A;  1XO1 A;  5KTQ A;  4U7C A;  3WKB A;  4F4K A;  1B22 A;  3BDP A;  5AI6 A;  5AI8 A;  4EX7 A;  3ONN A;  4DLE A;  1SL0 A;  2JEI A;  2WB1 C;  5CA7 A;  4C80 A;  3E0F A;  3QZ7 A;  2XGP A;  7ICF A;  3F2D A;  2QB0 B;  1SV4 A;  2W04 A;  3V6K A;  2YMQ A;  5F9L A;  2RLT A;  3PW5 A;  4G9B A;  1ZD4 A;  2BPF A;  1L7M A;  5KFG A;  4PL2 A;  4ECV A;  3TQ1 A;  2PFN A;  3EPI A;  4YR3 A;  3DDH A;  3H0L B;  4F5P A;  5JU5 A;  3GDX A;  1OXJ A;  4NM2 A;  4DL5 A;  4NLN A;  5KFI A;  1JXL A;  7ICJ A;  2PFP A;  4PHP A;  4O5C A;  2FMP A;  4QW9 A;  1JMS A;  3UXN A;  3SEI A;  3QU7 A;  1BPZ A;  3UPQ A;  4I28 A;  1YZ7 A;  4RUC A;  4KLL A;  4EBE A;  3ZD8 A;  2OCE A;  3HJE A;  1NZB A;  4BUG A;  3T79 A;  4I2I A;  2E1F A;  1CUK A;  2WF9 A;  5J0T A;  1URJ A;  2EAM A;  1SWW A;  2AJQ A;  2KIV A;  3BQ0 A;  3QU4 A;  2ZJ5 A;  2K60 A;  3KZX A;  4F2R A;  4UBC A;  4HYK A;  2YY6 A;  4DQR A;  4C4S A;  2BDP A;  5DGA A;  1B0X A;  2QKQ A;  1NJW A;  2EQY A;  3SI8 A;  1WWV A;  3HT3 A;  4F93 B;  2LBO A;  5AM4 A;  2AQ0 A;  5DLF A;  5HP4 A;  2ZIX B;  4YG2 A;  4C7Y A;  7ICH A;  4JMU A;  4I2E A;  2E8P A;  2JEG A;  5EWG A;  3WK4 A;  2PXI A;  2QB1 A;  4UAV A;  3N7S C;  3V6J A;  4I2B A;  1QLN A;  3NAS A;  2EZY A;  5DQG A;  1UA0 A;  3HP6 A;  2CRX A;  2HHX A;  1JN3 A;  4K4H A;  4ECU A;  1ZQK A;  1DXS A;  4BDP A;  2XVT A;  2B0C A;  2DGZ A;  2R8J A;  5KFH A;  5C0Y A;  2W3R A;  5JUM A;  1O03 A;  3H7I A;  5KAI U;  4M9L A;  1B4F A;  3KHL A;  1LB2 B;  5G5G A;  4PZN A;  3AU2 A;  4QZF A;  5F9N A;  4OJP A;  1BGX T;  2J6U A;  2OWO A;  2W9B B;  2EAN A;  2KD1 A;  4M9G A;  4B9S A;  3MGV A;  2YTU A;  2BQR A;  4IRK A;  3I28 A;  4O3R A;  3ETR A;  3PR5 B;  2G5I B;  3GIL A;  4P0P A;  9ICI A;  9ICG A;  2XC9 A;  9ICA A;  1XS9 D;  5J2G A;  2EZZ A;  3PX6 A;  2PFQ A;  2GWS A;  4Y2R A;  2W43 A;  4Y2Y A;  3QYP A;  1BPD A;  4FBU A;  1HUZ A;  1RZT A;  8ICU A;  3KD3 A;  1UT5 A;  1X2I A;  4RPY A;  4AYB F;  4M04 A;  4J9P A;  3C5G A;  2ISO A;  4EYH B;  4Q45 A;  1PZN A;  3RJK A;  7ICR A;  4PPX A;  5AM0 A;  3FAH A;  4E0D A;  2XID A;  1SZP A;  5DB6 A;  1IM4 A;  2KZ3 A;  3M6K A;  3N28 A;  4MF8 A;  3BQ7 A;  2K8C B;  3TI0 A;  4FFD A;  1TK8 A;  5KFL A;  4DFP A;  4ED3 A;  1ZQF A;  1S8O A;  2DBY A;  4B9L A;  2BR0 A;  2QAR A;  5ALK A;  8ICA A;  3AL0 B;  2AU0 A;  2BDU A;  1JAL A;  1TKD A;  3THV A;  2K8A A;  2XY5 A;  2F44 A;  4R8U A;  4FO6 A;  1M6Y A;  2YX8 A;  2PMZ F;  4OD0 A;  3BS7 A;  3RRG A;  4RNO A;  5BPC A;  4RQ3 A;  2FLN A;  4DL4 A;  1TE2 A;  5AK6 A;  1S76 D;  4DEZ A;  8ICG A;  1XU4 A;  3CNH A;  2G06 A;  3IV6 A;  1NK6 A;  1S10 A;  1GO3 F;  4LJX A;  4F91 B;  4DSF A;  3Q8K A;  4KIT B;  4QZC A;  4I27 A;  1K1Q A;  4PZO A;  2ZIW B;  2W7O A;  1DGJ A;  1UCV A;  3MFI A;  1DOQ A;  1ZQT A;  1RYS A;  4ED2 A;  8ICP A;  1LKY B;  5J2K A;  9ICE A;  2JV3 A;  4RNM A;  5ALV A;  2J6S A;  2YB1 A;  1X9W A;  4KTQ A;  5KG0 A;  1WUD A;  1F0M A;  1WCN A;  2FI1 A;  4ED0 A;  3JPQ A;  2M0N A;  5AM1 A;  1KL9 A;  3OJU A;  4PGY A;  2PKE A;  4ED1 A;  2JZB A;  4FZL A;  1A77 A;  2W9A A;  1T3Q A;  1UA1 A;  2H3F A;  4PH5 A;  2Q4T A;  5H2F U;  5B66 U;  2NRT A;  3MGI A;  7ICE A;  1RG6 A;  7ICN A;  2CPR A;  3R9K A;  4JV2 A;  4CF4 A;  5G5H A;  2LYB A;  5KFN A;  3RB6 A;  2E8M A;  3GV7 B;  5ALX A;  5D4B A;  3BQT A;  3C23 A;  3IP4 B;  4O5E A;  1ZOL A;  2F76 X;  8ICJ A;  1ZET A;  3QX7 A;  3QXG A;  2DF4 B;  3NVV A;  2HOQ A;  3BZC A;  3B9J A;  3RH6 A;  4I2J A;  5ALS A;  4Q8E A;  3Q8S B;  2FPL A;  3RFA A;  5KT5 A;  5EE0 A;  1ZQY A;  5KT3 A;  1JXE A;  7ICU A;  1ZQQ A;  1PVQ A;  5J0S A;  1COO A;  3TFS A;  1HJP A;  4O0I A;  3JPP A;  1KFT A;  2YML A;  3C29 A;  4M6W B;  2W54 A;  2RQ5 A;  3RBE A;  1VJ5 A;  4J9S A;  4ED8 A;  2JHD A;  3H0R B;  5ALP A;  3OHB A;  7ICS A;  2CXY A;  5AM5 A;  1KN5 A;  4PL1 A;  4MEY A;  5ALL A;  1UHU A;  4P4M A;  3TAP A;  4CCH A;  4O5K A;  3PZP A;  3PW2 A;  3ZD9 A;  4Y2V A;  9ICL A;  1N63 A;  1Z00 B;  4Q8F A;  3IRU A;  3LWM A;  3PX0 A;  4KLO A;  5KFX A;  4F50 A;  4OJ5 A;  5J2A A;  2EDU A;  4OCZ A;  3UQ2 A;  1L8O A;  2F1I A;  3NTU A;  4QNL A;  1ZQS A;  3T5L A;  5TZV A;  3NRZ A;  3KOO A;  1NOM A;  2ZJA A;  5ALD A;  1ZJM A;  5ALR A;  9ICW A;  1TK5 A;  3RF9 A;  1SGG A;  1F44 A;  1H38 A;  2Y1J A;  1ZQR A;  2LHT A;  1HEK A;  2BPC A;  3E58 A;  4R64 A;  2MSN A;  4C4T A;  2BCR A;  3K75 D;  4Q43 A;  4F4W A;  2KKV A;  7ICT A;  4DQP A;  1ZQI A;  1J97 A;  2AXT U;  3MR3 A;  4IC9 A;  2K4H A;  1ZQG A;  2ZIX A;  3L5K A;  2IOH A;  1NK8 A;  2F77 X;  2PFO A;  2ALZ A;  3N4M B;  2ZUC A;  4TUS A;  4F2S A;  5GTI U;  3AU6 A;  2R8K A;  2ATL A;  2D6F C;  3IG8 A;  3IHQ B;  2K4E A;  1XWL A;  2HHS A;  3KTQ A;  8ICX A;  3KKA C;  4UQG A;  4ECR A;  2VA8 A;  1WCL A;  4YVZ A;  4US9 A;  8ICI A;  1NZP A;  3BQ2 A;  3T5H A;  3PSP A;  2FLP A;  3K4G A;  3KHG A;  2V4Q A;  3PNC A;  3KZI U;  3L3F X;  1Z1V A;  1O08 A;  3KKA A;  9ICR A;  3RAX A;  5KFF A;  4M9N A;  3DV9 A;  4FBT A;  2P6R A;  8ICQ A;  3N7P D;  1RYU A;  3ISD A;  3M9N B;  1ZD3 A;  4ED6 A;  9ICV A;  1UPH A;  5KG3 A;  2HVH A;  3QUC A;  9ICJ A;  3PW0 A;  3ALR A;  1T7P A;  4RQN A;  1Z4O A;  4DQS A;  1COK A;  5K4L A;  2GO7 A;  2WF5 A;  2NO5 A;  4CF3 A;  2W8L A;  3PY8 A;  5ALZ A;  2CN1 A;  4O3O A;  1ZQX A;  2KHV A;  1QQ5 A;  2E8O A;  3B0X A;  5CWR A;  1IG6 A;  4JWM A;  3JPR A;  4I29 A;  2DPI A;  5ALT A;  2IOF A;  3Q8Q B;  5AKI A;  1TAU A;  4ECX A;  3C2K A;  8ICM A;  4DS5 A;  3BQ1 A;  4RQ2 A;  3ZDA A;  2NO4 A;  4O3M A;  4DF4 A;  2I5H A;  3TFR A;  4NL9 C;  3D2S A;  1L3S A;  3IM1 A;  3M8S A;  2N1R A;  2KFN A;  3OJS A;  2C28 A;  2HBL A;  1X42 A;  4F5O A;  4CF5 A;  3Q8M A;  3QUB A;  8ICV A;  5ALH A;  2BPG A;  2MAX A;  3HX0 A;  4NL9 A;  1S5L U;  4CDG A;  2Y1I A;  4I2G A;  1YT3 A;  4BJQ A;  4QIW F;  4B9U A;  5ALI A;  4I2A A;  9ICM A;  4QZE A;  8ICH A;  2GOL A;  3SAH A;  2DFL A;  3Q8R B;  2FLL A;  5KFU A;  3RJG A;  2PI5 A;  5HHH A;  4UBB A;  3G6X A;  4NXZ A;  4DOC A;  5KFT A;  5KFQ A;  3GZF A;  1NKC A;  2JR5 A;  4Z6E A;  3UM9 A;  4IS7 A;  2G08 A;  3WU2 U;  4ECW A;  2XCP A;  3H4B A;  2KP7 A;  1ZQV A;  4IQV A;  2KZM A;  2VAN A;  2MUT B;  4I2H A;  3GIK A;  2LPE A;  4RQM A;  2I1Q A;  3GV5 B;  4AP9 A;  1T3N A;  1N60 A;  5KFP A;  1L6N A;  2LKY A;  5KT2 A;  4DCC A;  5E79 U;  4GXJ A;  3LK9 A;  8ICY A;  3SAG A;  1VLB A;  4I2D A;  2OHF A;  1U49 A;  4O3S A;  1C20 A;  4ICA A;  2YMM A;  3SQI A;  3NVZ A;  9ICK A;  2W7P A;  2Y9T A;  4MFF A;  3M6Z A;  7ICG A;  5CB1 A;  1S0O A;  1UQV A;  1KFS A;  5ALU A;  3WK5 A;  5J2F A;  1QQ7 A;  4KLF A;  5DLG A;  4IQU A;  2RDJ A;  3SV3 A;  1U4B A;  4ECY A;  3LYS A;  5CR0 A;  2KFZ A;  5AKH A;  3AM9 A;  2OEH A;  5F3X B;  2W9C B;  1NJZ A;  5AKK A;  4YP3 A;  4C8L A;  1U9L A;  1ZYQ A;  4MFC A;  2KIW A;  1MSW D;  5J29 A;  1NK4 A;  4F4Y A;  5KG6 A;  2ZUD A;  4CE6 A;  5HHI A;  2B21 A;  5DBC A;  2BGW A;  1N2X A;  3MR5 A;  1SKR A;  3WKE A;  8ICL A;  5KL1 B;  2NV3 A;  5DG7 A;  4OJ6 A;  5L1J A;  3V7L A;  4F92 B;  4F8R A;  2F2A B;  1AQ6 A;  4P0Q B;  4RT3 A;  4Q44 A;  3Q8L A;  1HIW A;  1ZQC A;  4RQ6 A;  2H3V A;  3VC8 A;  4JWN A;  2IMW P;  2ZIU B;  4DOB A;  2FE9 A;  1BPE A;  4IRC A;  5IIO A;  1XSN A;  1D8Y A;  3QUQ A;  4ED7 A;  3BS5 A;  1QQ6 A;  4K4I A;  3JPO A;  1NJX A;  5J0X A;  1QSS A;  3WK8 A;  1ZQN A;  2KSO B;  5AM3 A;  4DSL A;  8ICS A;  1ZQB A;  5L1K A;  1IIP A;  1L7P A;  5KNI A;  2R8I A;  3ETL A;  2ZXI A;  2R8H A;  4Y2S A;  4C8K A;  3UXP A;  5DB9 A;  4RQ4 A;  3SD7 A;  2KJ5 A;  1KW4 A;  1Z00 A;  2HI0 A;  3NGD A;  2C2R A;  1WWU A;  4BWJ A;  4ECS A;  3T3F A;  4OO1 J;  4YFK A;  1FO4 A;  2C2D A;  2WHE A;  4J9K A;  1A6S A;  4MFA A;  2DUY A;  2G09 A;  2JXJ A;  4NLK A;  4AYB C;  1Q3V A;  4NV0 A;  4X5V A;  3C5F A;  5KFZ A;  4UB3 A;  1KLN A;  1TV9 A;  2KN7 A;  2XI9 A;  9ICT A;  3M8R A;  1KDH A;  4R65 A;  2HMX A;  3CP8 A;  4J9R A;  7ICK A;  1ZQW A;  2ZG6 A;  4KLD A;  3HIL A;  1KKX A;  2IA6 A;  8ICK A;  2WAQ F;  2HHT A;  4IL6 U;  5III A;  1K1S A;  2HBJ A;  5AK3 A;  2WAQ C;  4UB2 A;  5C5J A;  3DEE A;  3TAC B;  4OJO A;  3D2N A;  4ECT A;  2PMZ C;  4LZD A;  4R66 A;  3G6V A;  4RUA A;  8ICZ A;  5KFW A;  3JPT A;  3MGH A;  5AI0 A;  3H8W A;  2KZZ A;  1WG8 A;  4RQ5 A;  3SMV A;  1N5X A;  2WF8 A;  5KFY A;  1KSP A;  3FM9 A;  5AI5 A;  1FIQ A;  5A0L A;  4BGD A;  2YN4 A;  4DF8 A;  4WJ3 B;  4Y2U A;  2EAO A;  2F1J A;  5J0U A;  1A0P A;  5ALJ A;  2VJ5 A;  4DQI A;  2RDI A;  4KLU A;  5J2H A;  5J2C A;  2W3S A;  1DGS A;  2EZX A;  4FS1 A;  4GC6 A;  1X40 A;  4F5N A;  5GTH U;  1T94 A;  2V4R A;  4RZR A;  4NJ8 A;  5EWE A;  5KG5 A;  1MQ2 A;  4C8O A;  2C22 A;  2EH9 A;  4NLZ A;  3SV4 A;  2XY7 A;  3WK9 A;  1N5W A;  2ES6 A;  2AQ4 A;  1DK2 A;  3TAQ A;  2ZTD A;  4YXJ A;  2KTQ A;  1N56 A;  2AGO A;  1IXR A;  2JH7 A;  3L4P A;  2MA1 A;  1NKE A;  1EXN A;  4YXM A;  4IR1 A;  3OSP A;  4J9M A;  3QE9 Y;  2P66 A;  3H8J A;  4ELU A;  3PVX A;  2BQ3 A;  1PK1 A;  1SKS A;  5CRX A;  1B43 A;  4QZ9 A;  1ZQU A;  3NUQ A;  4ELT A;  4HAI A;  4YR0 A;  3VCB A;  4UAT A;  2H3Q A;  5TIS U;  2WTF A;  5KFK A;  1V38 A;  4BWM A;  4UAZ A;  1X6I A;  4YQW A;  1X9M A;  2IOF K;  4B9N A;  4EEK A;  5KFA A;  1QTM A;  4UAS A;  2E8N A;  4TQS A;  3H8M A;  4RNN A;  2DKZ A;  2Y9U A;  3OTQ A;  5L1M A;  1L3V A;  1CEZ A;  5DDM A;  1BNO A;  5ALQ A;  2QB0 A;  2RRD A;  5CP2 A;  1ZQP A;  2VA2 A;  1ZQL A;  2LM1 A;  1MN8 A;  1ZXI A;  2KG5 A;  3ED5 A;  1HUO A;  4KLG A;  5KFS A;  3HKZ F;  4QWB A;  2Y0S F;  4A8E A;  4BXO B;  4XUS A;  4J9L A;  2DQN B;  3HKZ C;  5DB8 A;  2A19 A;  2A1J B;  3QEB Z;  4M2Y A;  4PHD A;  4US8 A;  2WF6 A;  4RQ8 A;  2A1A A;  2XGQ A;  1L5U A;  2KV2 A;  1DK3 A;  2WF7 A;  5HR7 A;  3AQF A;  4I2F A;  1XSL A;  4DFM A;  5KFJ A;  5DKW A;  2HHV A;  4M47 A;  1NK9 A;  4JB3 A;  4P4P A;  3M9O B;  1S77 D;  5HML A;  5DGB A;  4Z6D A;  5L1I A;  4GFJ A;  3QZ8 A;  4GC7 A;  2MUT A;  4DSJ A;  3FC4 A;  1KFD A;  2GLE A;  1QCK A;  2ZUB A;  4KLE A;  4DO9 A;  1U47 A;  3AEV A;  3RB4 A;  2JEF A;  3RJH A;  8ICN A;  4EEL A;  2NRZ A;  2JEJ A;  5KFO A;  4UAR A;  5KFB A;  1JRO A;  9ICX A;  3SR6 A;  4BX9 C;  1XO0 A;  4MF2 A;  4C8M A;  4R63 A;  3F2B A;  2UVW A;  4TQR A;  3RH4 A;  4NM1 A;  2P35 A;  1RXW A;  3EZ5 A;  3AUO A;  3A0B U;  1XNS A;  4DOA A;  2KMD A;  2G07 A;  3HPO A;  4DSE A;  2BQU A;  4KX3 A;  1ZQM A;  3T5J A;  4QZA A;  9ICO A;  1Z4N A;  2YB4 A;  2QAR B;  3QUT A;  3I76 A;  4M0A A;  1K5O A;  1KBU A;  4QJF B;  1NK0 A;  5IIM A;  2DPJ A;  4XRH A;  4U6P A;  3BZK A;  5AI9 A;  4PHE A;  2FDR A;  2W9C A;  4UB8 U;  3ISC A;  4LZG A;  1C7Y A;  2Z7J A;  4GIB A;  9ICH A;  2LI6 A;  4DLG A;  4DQQ A;  2FMS A;  4EX6 A;  3RB0 A;  2AGP A;  2EAP A;  3RJI A;  1FFU A;  3GIJ A;  3O0F A;  3BJY A;  5DBB A;  4LVS A;  4P4O A;  2ZJ8 A;  1Z1B A;  3OSN A;  5IIJ A;  1MC8 A;  4Y2X A;  2BHN A;  3PW7 A;  3H0M B;  1MA7 A;  1NJY A;  3RR7 A;  4P0Q A;  5KFR A;  1N48 A;  4DL6 A;  4F4X A;  1TAQ A;  3MR6 A;  3ZDD A;  2HOF A;  2ZIU A;  2HVI A;  1N61 A;  4DSI A;  4EEY A;  5B5E U;  2FJ6 A;  1Z19 A;  3C2M A;  4JK1 A;  4YR2 A;  1JUD A;  2UVU A;  2HBK A;  4YD1 A;  9ICF A;  4YMN A;  2W9B A;  2W55 A;  4M9J A;  5J0R A;  5J8Y C;  1SKW A;  3CRX A;  4GXI A;  5EWF A;  3MC1 A;  3F53 A;  2O6K A;  2W03 A;  5HNK A;  2ASL A;  2VIX A;  2WFA A;  4F4Z A;  4TUQ A;  1Q8K A;  1ZQO A;  4KMU A;  1BPX A;  4UB6 U;  9ICS A;  2JZB B;  4YMM A;  4USA A; 
#chains in the Genus database with same CATH homology
 5JTI A;  1B4F A;  3HIL A;  2KMD A;  2KSO A;  2K4P A;  4PZN A;  2D3D A;  1V38 A;  2B6G A;  4NL9 A;  3TAD A;  3SEI A;  3KKA C;  3SEN A;  3TAC B;  2QAR B;  4PZO A;  2EAN A;  2E8N A;  1UCV A;  3H8M A;  2YTU A;  2F3N A;  5J8Y A;  2DKZ A;  2Y9U A;  5L1M A;  1X66 A;  5JRT A;  2F8K A;  1Z1V A;  2QB0 A;  2FE9 A;  3KKA A;  1LKY B;  2EAM A;  2EAP A;  1SV0 C;  2KIV A;  2JV3 A;  4IS7 A;  2EAO A;  1V85 A;  2KG5 A;  4MHV A;  1PK1 B;  3BS5 A;  2K60 A;  1SXD A;  1F0M A;  2KSO B;  1OW5 A;  2LPE A;  4RQM A;  4RQN A;  1X40 A;  2DKX A;  1B0X A;  2QKQ A;  1SV0 A;  5KNI A;  1COK A;  1WWV A;  2ESE A;  3K1R B;  4NJ8 A;  3IDW A;  3BQ7 A;  1SGG A;  2E8O A;  1KW4 A;  1RG6 A;  1WWU A;  2E8P A;  2ES6 A;  2QB0 B;  1SV4 A;  2E8M A;  2QAR A;  2QB1 A;  2KE7 A;  2Y9T A;  2DL0 A;  2GLE A;  5J8Y C;  2F44 A;  2D8C A;  2LMR A;  1X9X A;  1UQV A;  3BS5 B;  1LKY A;  1DXS A;  3BS7 A;  1SXE A;  4NL9 C;  3TAD C;  2L5Y A;  5JU5 A;  5F3X B;  1OXJ A;  1PK1 A;  1PK3 A;  1JI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...