1UCVA

Sterile alpha motif (sam) domain of ephrin type-a receptor 8
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
GSSGSSGLTVGDWLDSIRMGRYRDHFAAGGYSSLGMVLRMNAQDVRALGITLMGHQKKILGSIQTMRAQLTSTQGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPHRIN TYPE-A RECEPTOR 8
publication title NMR Structure of Sterile alpha motif (SAM) domain of ephrin type-A receptor 8
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 18
structure length 81
sequence length 81
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2003-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1ucvA00
1B4FA 1B0XA 2F8KA 3HILA 2Y9UA 2QB0B 3TACB 1OW5A 1LKYB 2QARA 2L5YA 3IDWA 2KIVA 4RQNA 1UQVA 2GLEA 2JV3A 2E8MA 3KKAC 3SENA 1X40A 1SXEA 2KSOB 5L1MA 2KMDA 4MHVA 1KW4A 3TADC 3KKAA 1OXJA 1PK1B 2ES6A 2D3DA 5J8YC 5JU5A 4NL9C 3TADA 2DL0A 5J8YA 2QB0A 2K60A 4NL9A 2B6GA 1SV0C 1DXSA 2E8NA 2KE7A 4PZOA 1SV4A 1LKYA 2EAMA 1SV0A 1V38A 2ESEA 3BS5B 2DKXA 1UCVA 1WWUA 2KSOA 2D8CA 1JI7A 2KG5A 2QKQA 1PK1A 2F44A 4IS7A 1X9XA 3H8MA 2LMRA 2K4PA 1SXDA 1WWVA 4NJ8A 2FE9A 1PK3A 3BS7A 3K1RB 2QB1A 3BS5A 1V85A 2Y9TA 1Z1VA 5F3XB 1F0MA 1RG6A 1SGGA 2QARB 2DKZA 3BQ7A 2F3NA 2E8PA 5JTIA 1COKA 2EANA 2YTUA 2E8OA 3SEIA 4RQMA 2EAOA 2LPEA 5KNIA 5JRTA 1X66A 4PZNA 2EAPA
chains in the Genus database with same CATH superfamily
4Y2YA 5AKIA 5KT4A 3RH6A 3PVXA 4ECRA 1ZQYA 1S77D 4UB5A 2HCFA 3TANA 1XNSA 3UXOA 1UA0A 2J6TA 1TAQA 3ZD9A 1L8LA 3B0YA 3ZI4A 3SENA 1Q3UA 5KG3A 4NV0A 1ZD5A 1P7DA 5IILA 3V7KA 4CF3A 5CJ7A 3QZ8A 1FIQA 3HP6A 3PNCA 4MFAA 4F3OA 5AK6A 3M9MB 3OSNA 2NRVA 4TUPA 3ISBA 7ICQA 3AQFA 3MR6A 4O3MA 1IM4A 2VA3A 3F2DA 1NKBA 2I5HA 5KFDA 5AM4A 1N5WA 3RF9A 1N60A 5KT6A 3TKAA 4F50A 4NLKA 3PSPA 3VC8A 4YR0A 3H8JA 2P6RA 2D6FC 4IQUA 5KFHA 5BOLA 1ZQIA 3M1YA 3ED5A 5DGAA 2BQUA 5DQIA 7ICRA 3U26A 4DQSA 4NJ8A 2BPGA 2DWQA 3RB6A 1ZQJA 2W03A 3BS5A 1TK0A 2FPLA 1SWVA 4DWIA 1NI3A 9ICKA 1F0MA 5CWRA 1DGJA 3K1ZA 2JMGA 4RPXA 4RQ3A 3T5HA 1BPDA 2A19A 3BQTA 1HUOA 4ZOHC 3RRHA 2JEIA 3PW0A 2EAOA 4GXJA 2IHNA 1KFTA 2BQ3A 1ZJMA 4B9VA 1BNOA 5J2JA 3AUOA 3QUTA 2LYAA 4P4OA 2QB0B 2W54A 1S97A 2HHSA 2Y0SF 3D2NA 3ZDBA 7ICSA 2EZZA 5ALLA 1MN8A 3RB3A 5DB7A 3PX6A 3E0FA 5ALGA 5KG5A 4LVSA 2XY6A 2KMDA 2ZTEA 4UAZA 4GIBA 2HI0A 4PHDA 2JEFA 3ZDDA 1A0PA 4R65A 5AI0A 5DDMA 3WK4A 4WJ3B 2B6GA 5EE0A 4UBBA 4DOAA 4R8UB 5AKHA 8ICOA 5B5EU 3KTQA 2RLTA 2K8BB 2ZJ8A 3WKDA 2KKPA 2MA1A 5KFLA 5KFEA 3QEAZ 2M0NA 4I2IA 2KJ5A 2FPMA 2DPJA 1PK1A 4PJ0U 4RNNA 1C20A 4FBUA 8ICBA 4DSJA 3S6JA 4YVZA 5KT7A 4BXOA 5AM0A 3T3FA 4A8EA 5ALSA 2GH1A 3K4GA 3GZFA 2JR5A 2ASJA 4QWEA 4Q44A 3MDCA 4QZ9A 1FO4A 2K4EA 5KG2A 5KFPA 1EXNA 2ZUBA 8ICRA 2BCSA 1ZXIA 3JPSA 3KOOA 4YR2A 5J2EA 2OWOA 2V4QA 5AKKA 4USAA 4RNMA 5KFYA 1ZQVA 1KSPA 3RJIA 3F2BA 1TAUA 3TFRA 8ICYA 4F72A 9ICJA 4F91B 4DL5A 4J9SA 2XI9A 4F2RA 3AL0B 4ED1A 4GXKA 4F5OA 1QSSA 3ZD8A 5T14A 2PFOA 1Y88A 5DBBA 4B9UA 1L7OA 4F93B 5HR6A 1Z19A 1SKSA 5K4LA 1OXJA 3OHBA 2AJQA 3MGIA 5D4BA 3WK7A 4ED6A 1BPBA 2HHVA 2KJ9A 2DL0A 4QWAA 5J8YA 3C5GA 4NL9A 1AROP 5KFMA 2BKEA 2JGAA 3EW9A 2KD1A 2YMQA 4RU9A 3EZ5A 5AICA 4E0DA 2DKXA 2K4IA 2LBOA 5DKWA 1TFRA 3OHAA 4ED7A 8ICTA 4AYBF 1BPZA 4B9LA 4M9JA 5KFKA 2F44A 2YN4A 1TVAA 5L1KA 1JN3A 1N5XA 1NJZA 2UVWA 9ICTA 3N28A 2DGZA 5KFTA 4C7YA 2A3VA 9ICVA 1JX4A 5IIOA 4KX5A 4IQTA 5ALWA 3RR8A 4FFDA 4YP3A 2KHQA 2XGQA 1V85A 2CXYA 3BZKA 1RG6A 5KT2A 1QCKA 3FAHA 1L3UA 4C8KA 1QQ7A 3MDAA 3CP8A 2E1FA 2PXIA 1ZQ1C 1L3TA 2ZTDA 1J2MA 4DQQA 8ICXA 2IMWP 1HIWA 5DQHA 3F53A 1IV8A 4Q8EA 1ZQNA 1NKCA 4IR1A 4KLOA 4QJFB 1MSWD 2FLNA 1OW5A 3VCBA 5IIKA 3RAXA 2L5YA 5ALPA 3SAGA 2JV3A 4JMUA 2AQ0A 1ZQGA 1L3SA 1QQ6A 1X40A 4QWBA 1KLNA 3QUCA 3ZDEA 5KG1A 4TUSA 4NY8A 3FDSA 1L7PA 5KFOA 2D3DA 4BWJA 3SQIA 1A76A 3QNMA 1KTQA 1WCLA 4CNQA 2K60A 4IQVA 4CF5A 4ECVA 3Q8MA 1TE2A 5IIMA 1LKYA 3BS5B 4YFKA 1RXWA 1WWUA 5ALIA 1XC9A 1JIHA 5AK5A 2HHQA 4EENA 4P0QA 4Z6DA 4TURA 2WAQC 2H3FA 3NGDA 4YCXA 3QZ7A 2J6UA 4IS7A 4UASA 5HR7A 3ETLA 1S0NA 2HVIA 3QX7A 1T8EA 4UATA 3G6YA 3K1RB 2ZXIA 3C2MA 1J2NA 2Y9TA 5KFXA 2ZIWA 1NNLA 3HPOA 3JPQA 2H3QA 3SYZA 1RZTA 2KIWA 5HNKA 3PY8A 3HW8A 3N4MB 1ZQPA 2DF4B 8ICJA 2EANA 4QZ8A 1SZHA 3I76A 4J9QA 4UARA 2G5HB 4QZBA 4YXMA 4FS2A 5CHGA 2G06A 2K4HA 1NZPA 2W8KA 4F4WA 2C2EA 4RQ8A 3H8SA 1N56A 2C2DA 3KZIU 4DSIA 3BQ0A 3GIJA 1RM6C 4NLBA 3RJKA 4ED2A 4M9LA 1ZQTA 4ECSA 1RYSA 4QWDA 4O3QA 9ICIA 2I6XA 4B9NA 2NO5A 3N97B 3PW4A 4BX9C 3NRZA 4Z6EA 2I1QA 3KKAA 1NK9A 1PK1B 8ICUA 8ICSA 2ODGA 1XS9D 5G5GA 1QQ5A 2W04A 5HP4A 5J2KA 3PX0A 4PGQA 3BQ2A 1TK5A 7ICPA 4BXOB 1WYGA 2IOFK 1S0OA 1KL9A 3ORYA 4RQ5A 4Q8FA 4LZDA 1V38A 2ESEA 2YY6A 5DDYA 3SAHA 8ICQA 1UCVA 4ED3A 2DFLA 1ZQOA 1JI7A 5EWEA 3MC1A 2VIXA 4IRKA 4KX3A 4EX6A 7ICFA 5KL8B 3JPPA 4Q45A 3H8MA 2W43A 2NRWA 2OXOA 1ZQAA 4YG2A 4KLDA 2F1HA 1D9DA 4IQWA 4Z6CA 1SGGA 3B0XA 4FE3A 4PH5A 3D2SA 1NZBA 2XO7A 2Y0SC 1HUZA 4DS4A 4RPZA 5KFUA 1NK5A 3QEBZ 3OTQA 4I2GA 1ZQZA 4EZ9A 2CRXA 2JXJA 1DK3A 3ISCA 2DBYA 1ZQFA 1NJYA 1QSLA 2F8KA 3CYMA 3HJEA 3RB4A 1S0MA 4KLQA 4TUQA 2WAQF 2ALZA 4Y2QA 2GLEA 3UQ2A 5ALNA 1UHUA 5AI9A 4I2EA 4F5QA 4MHVA 1SIJA 3KHLA 3MFHA 5HHIA 5L1LA 1N61A 3ZDCA 3ICXA 4DOBA 4ECTA 3T79A 5KFAA 4U7CA 5J0RA 4FO6A 2IBKA 4I27A 4C80A 4UB6U 2W9BA 1QLNA 2D8CA 3IP4B 4Y2VA 1FEZA 2RP5A 2B0CA 2BCVA 8ICIA 3EPIA 3SI8A 1QSYA 4OJ6A 4GC7A 3WKBA 1KRPA 1SL0A 5CB1A 3V6KA 3SV4A 4PGXA 4JV2A 9ICAA 1Z1VA 3QYPA 3PSIA 4J03A 1BVSA 3H0RB 5KFSA 4JWMA 1ZD2P 3DV9A 5JTIA 3NUQA 2YTUA 3MR2A 3EWAA 4O9MA 2XGPA 4OJLA 3GV8B 5ALDA 4RUAA 2ZIUA 5ALJA 5KG7A 3KHRA 5C5JA 5DLGA 3GQCA 3GDXA 9ICNA 4OJPA 1KFSA 1NK0A 1SWWA 4EYHB 1S5LU 2A1JB 3F5EA 2RHFA 2ZUCA 1LKYB 3RJEA 4BGDA 7ICUA 2IOHA 2YB4A 3V7JA 1ZRNA 1CRXA 4QZFA 1NJXA 4KMOB 2E1EA 2HHTA 3Q8RB 1JXEA 4PHAA 4AYBC 1JROA 2EH9A 1ZD4A 2VA2A 5AM5A 2ZIVA 2XVTA 1X9MA 3HWTA 3RB0A 3M6ZA 3F5AA 3RH4A 2JEGA 2E3TA 2V9WA 1KBUA 2W11A 1L3VA 4DLGA 1PVPA 2ZIWB 4O3SA 9ICSA 3AQEA 4QIWF 3KZXA 5KT3A 2C28A 2KJ8A 3Q8LA 3LDAA 5J0PA 3ONNA 2EDUA 3UQ0A 2E5SA 3RTVA 2JHDA 3I1YA 4ZH4A 4B9SA 1D8LA 4I2AA 4RQ2A 4KN4A 1RYUA 5ALEA 2K4PA 2IA6A 8ICPA 5AKZA 4O5KA 2KICA 2W8LA 1O03A 2BQRA 5C0YA 3G6VA 5F3XB 3C2LA 4Y2RA 1ZQXA 1XO0A 2HOQA 3JPTA 2HBKA 7ICIA 4EYIB 9ICPA 3QU2A 4KN7A 2BPFA 3BQ7A 1S9FA 3GFKB 4ELUA 1COKA 2NRXA 3SEIA 3Q8KA 2ASDA 1T3NA 1U49A 4NLNA 2K8AA 3L3FX 4DL3A 7ICJA 4KMUA 4EZ6A 2IHMA 3HILA 4KLIA 4QZDA 4ECWA 3NRWA 3IN5A 1X9WA 4KLUA 9ICBA 4NXZA 4LZGA 4BDPA 5CEHA 1Z3EB 2AGOA 1UQVA 2HHWA 3R9KA 2E8MA 4XUSA 2EQYA 1QTMA 4QZEA 1ZETA 5J8YC 1Z4OA 4O0IA 4NL9C 2OHFA 5KTQA 2A1AA 3TADA 2Z7JA 3QU4A 5AM2A 1ZQRA 2YMPA 2NV3A 5KFWA 4C4TA 1V97A 2BGWA 1WCNA 4RQ6A 2Y1JA 1SV0A 4MEXA 2VKQA 3H7IA 2KVCA 5DB8A 4NM1A 2W9CA 5J0YA 2YMLA 4RQ1A 4C8OA 2KG5A 2CN1A 3DEEA 4DO9A 4YMMA 5J2GA 2FMQA 2LM4A 5J0TA 5J2BA 3GILA 3WK9A 8ICKA 2JH1A 4CDGA 1B43A 3T5JA 5AI5A 5AHXA 4J9NA 2LM1A 4ICAA 4KLEA 3NVWA 4B6JA 3WKCA 5DQGA 2ZJ5A 3IV6A 3BQ1A 1D9FA 2ZUDA 3E2EA 5IIIA 4DQPA 1RQLA 4M47A 3TARA 3OPXA 4M6WA 2R8JA 5B66U 4QZHA 3RAQA 2KZZA 4GLXA 4DCCA 2E8PA 3PMLA 4RQMA 4RQ0A 3GV7B 1N2XA 1JALA 5L9XA 1LVHA 2WF6A 4DFDA 2HBMA 3OJSA 4I28A 4R66A 2GOLA 3D6JA 1XO1A 1SL2A 4LJXA 2WF5A 4G3IA 2UVRA 2PFQA 1RYRA 1SKRA 2W9BB 4EELA 1SXEA 5ALTA 2WTFA 5HMLA 5J0OA 5AI8A 1DRGA 3WK8A 4PPXA 3MFIA 4UB3A 4C4SA 5JU5A 4J9KA 4EBCA 1FFVA 5J0XA 9ICOA 1X6JA 4M04A 7ICEA 4Y2XA 9ICUA 1T7PA 3TAPA 1IIPA 5J29A 3HX0A 2FDRA 2YX8A 1SV4A 4RQ4A 2C2RA 9ICFA 3OSPA 1QH9A 1JUDA 5L1IA 2KOBA 3KHGA 2ASLA 5TISU 2F2AB 3SR6A 3Q8PB 4J9LA 3PZPA 5J2IA 2W9MA 3AU2A 3PO4A 2BDPA 7ICTA 5ALYA 3H8WA 4HAIA 3WKAA 2BR0A 2BZFA 2AH5A 2P6UA 3NVYA 5FP0A 2P66A 2BDUA 2ZIUB 4DEZA 3GIMA 4DSFA 3MABA 3UPQA 1U45A 4Z6FA 4EBDA 4DFJA 1BPXA 2HHXA 5KFVA 2DPIA 3M9OB 5KFBA 1DK2A 4M9HA 2MSNA 3PW5A 4C8NA 4I2JA 4CRXA 2AGPA 2KEYA 4C8LA 4NLGA 1YT3A 2R18A 5ALHA 7ICVA 2B21A 1KDHA 2ZG6A 4OD0A 1UA1A 8ICHA 5ALFA 2ZIVB 1UT5A 2Y9UA 4JUZA 4ECUA 5DB6A 4DQRA 3H4BA 4QZGA 3QXGA 2VJ5A 3KKAC 4Y2UA 2LHTA 5J2DA 4QZAA 3MR5A 1Q3VA 5E79U 5EOZA 5J2FA 1VLBA 3Q8QB 3C1ZA 4PZOA 4M9GA 1SL1A 4NWIA 2PFPA 5AK3A 4RNOA 1L6NA 1MC8A 2KFNA 3MGHA 4TQSA 2R8KA 4KLMA 3IRUA 4FZMA 4UAUA 3RR7A 3C1YA 2H3VA 4GFJA 4AP9A 5CP2A 2KK0A 2QLTA 3M8SA 1J97A 2H3ZA 4F5PA 4DSKA 4YD1A 2YQEA 2NO4A 3WK6A 2ZJAA 2NRZA 5A0LA 1S8OA 3PMNA 1KN5A 1IG6A 4RPYA 3IHQB 2MRLA 4US8A 2MUTA 1H38A 2FLLA 3THVA 5CR0A 8ICNA 2JZBA 4UAVA 5ALOA 4DL7A 4DFMA 4O3OA 2XY5A 1KEJA 4J9PA 2ISOA 1JRPA 2KKVA 5KFJA 3PX4A 7ICLA 4Q43A 1M6YA 2VA8A 3HKZF 3F2CA 1Q46A 4IR9A 2XY7A 4XA5A 2FMPA 4QW8A 1ZOLA 3A0BU 2HOFA 1ZQQA 4M2YA 2QARA 5EWFA 2W9CB 7ICNA 3FYHA 2F77X 3M6KA 4PL1A 2ZTCA 3KD3A 4QIWC 4Y2PA 4IC9A 2R8GA 2N1RA 3PSTA 2W9AA 2PI4A 1NK7A 1SZPA 4OJ5A 4MFCA 1NOMA 5ALQA 1BPYA 1IXRA 4F71A 9ICMA 5ALZA 3RRGA 3C28A 3C29A 4F4YA 4B9TA 7ICHA 3C21A 1Q8KA 4M9NA 3H4DA 1GO3F 3TFSA 5G5HA 2C22A 3LVVA 2J6SA 1PUZA 5J0WA 4M6WB 2WB1F 3PW2A 8ICZA 1VJ5A 2OEHA 3NVZA 4ECZA 1ZQMA 5AKLA 2LKYA 4EBEA 4RZRA 1DGSA 2OCEA 4OJOA 5AI6A 5ALMA 5KFIA 2LYHA 5AM1A 1WWVA 3M9NB 5L1JA 4DS5A 2FE9A 3HRDD 3RJGA 5J2CA 8ICGA 3IG5A 4BWMA 3GIKA 4FS1A 2FI1A 5IINA 3PO5A 4C8MA 2PMZC 2OYYA 2MU2A 3V6JA 4DSEA 2BPCA 3V7LA 4ELVA 2HVHA 3C23A 1SKWA 1U9LA 2GO7A 2LPEA 3AM9A 1D8YA 2F1JA 4DL6A 5ALRA 4KLTA 3ETRA 2EAPA 1XWLA 2RRDA 4FBTA 3EUB2 4I2FA 4YQWA 4Y2JA 5KFGA 3J81j 3IDWA 2WFAA 1D8BA 2NRTA 5F9LA 3I28A 3LK9A 2KVSA 3PV8A 5L1MA 4XQ8A 4F5NA 1ZQHA 1Z00A 3LYSA 9ICQA 4R64A 1CEZA 2O6KA 3C2KA 3OJUA 2KZ3A 2VJ4A 3CNHA 4DOCA 1B22A 5BPCA 2ZIXA 1DXSA 3HT3A 2KE7A 1ZQBA 5HMMA 5J0QA 3H40A 3V6HA 4IRCA 3JPRA 1T3QA 3QUQA 4OO1J 5ALVA 3BZCA 1ZD3A 4IRDA 2KSOA 4F4XA 4P0QB 5HHHA 1ZQCA 2G09A 1K1QA 4QWCA 3DDHA 3LVWA 3L5KA 4CCHA 2AGQA 2G5IB 4Y2SA 2Y1IA 4NM2A 3SZ2A 5D46A 3WK5A 4J9OA 1ED1A 2M9NA 2OH2A 4QNLA 1TKDA 3NVVA 5KFNA 2R8HA 2KHVA 2KP7A 2XCAA 2MAXA 4DLEA 4C7ZA 1KQQA 2E8OA 4UB4A 1JMSA 3MBYA 4O3PA 2JRZA 1X6IA 3N7PD 3ZDAA 4I2DA 4O3NA 2K8CB 3UXPA 3UMGA 4QW9A 1B4FA 1F5SA 2IOFA 1ZQEA 5AKGA 4P4MA 1RPLA 4ECQA 9ICGA 3EPGA 2KIVA 4ED0A 2WF7A 4QZCA 4EX7A 3QU7A 1NK6A 3WKEA 4G9BA 5KG4A 4UAWA 4P2HA 1KW4A 3TADC 2PMZF 5KFZA 1UT8A 3UMCA 4DFKA 1S10A 1RDFA 3PSFA 1OUQA 1N62A 2KTQA 1HEKA 3M7DA 8ICWA 4QZIA 2P35A 1T4GA 1SV0C 3SMVA 3AEVA 5KT5A 3FM9A 3CRXA 3RJFA 7ICGA 3PW7A 5DG9A 1K1SA 4ED8A 2MUTB 1ECWA 2KN7A 4ELTA 5IIJA 2PI5A 4P0PA 5KFFA 8ICLA 2JZBB 5DG7A 1A6SA 1RQNA 4C0ZA 2BCRA 2GWSA 2KNJA 4FZLA 3SV3A 1K5OA 2I9GA 5J0UA 2FPKA 4ECXA 3AU6A 2HBJA 5KL1B 5DB9A 3Q8SB 3JPOA 4KLGA 3QU5A 4IL6U 4MF8A 4F8RA 3RBEA 2HW3A 3BJYA 2UVUA 2QARB 5EE9A 3UXNA 2DKZA 1X2IA 2PFNA 1BPEA 2AXTU 4RQ7A 1A77A 4DF8A 3WU2U 1XSLA 8ICAA 3MR3A 3ALRA 4YR3A 4PHEA 1MQ3A 3GV5B 9ICEA 2YB1A 1F44A 2RQ5A 5DGBA 8ICCA 2WF8A 4JV1A 1NK4A 1MQ2A 3H0MB 4R63A 3GU3A 3FC4A 2H5XA 3MGVA 4Y2TA 4DL2A 1TAMA 3QE9Y 4I29A 2JH7A 4DL4A 5KFRA 3SD7A 4GC6A 2BHNA 3PR4A 1XSPA 5KFCA 2Q4TA 1MA7A 2YMMA 5J2AA 4J9MA 4J9RA 3D2QA 9ICLA 4DSLA 2ZXHA 3H0LB 5AIAA 1WUDA 3N7SC 3C5FA 4UB8U 1PVRA 2AU0A 2ATLA 9ICHA 1T94A 5KG6A 1L7MA 3TI0A 5EWGA 1N48A 1PVQA 5KFQA 1TK8A 5H2FU 4M0AA 3V72A 3IM1A 4YXJA 1JXLA 7ICOA 3RJJA 4JB3A 4JK1A 4FZNA 3NS1A 1XU4A 4OCZA 5DLFA 2BCQA 1YZ7A 2HDOA 3O0FA 3EYZA 1ZQLA 2F1IA 1Z1BA 1X9XA 5ALKA 9ICRA 2FMSA 4MF2A 3K75D 1BNPA 1ZQWA 2H3IA 2OM6A 9ICWA 3KBBA 3G6XA 2QB1A 5AKJA 2HMXA 2K89A 1U48A 1X42A 3HKZC 4I2HA 8ICVA 4ECYA 1COOA 3GIIA 4B9MA 4KLJA 4RUCA 4ACOA 2EZXA 1SB3C 1Z00B 5AKYA 4RT3A 3UM9A 5BOMA 1U4BA 4YN4A 5KNIA 3AMZA 5JRTA 2R8IA 2W3SA 4EEYA 1L7NA 3ISDA 2KV2A 2HHUA 2W55A 2FJ6A 2ZIXB 2EZYA 4KTQA 1V9PA 1U47A 4JWNA 3KHHA 1UPHA 3NTUA 1L8OA 2A1JA 3UMBA 4MFFA 4RQNA 3LWMA 4DF4A 2KFZA 4US9A 2KSOB 2W7OA 2PKEA 5AI4A 4KLSA 9ICCA 5TZVA 4HYKA 4NLCA 3L4PA 2WB1C 5DBCA 2QB0A 1ZRMA 5ALXA 1CI4A 5KAIU 4PL2A 2E8NA 1LV5A 4BJQA 2EAMA 1ZQKA 2UVVA 1BGXT 2XCPA 4F4ZA 3QUBA 8ICMA 4P4PA 2V4RA 2W7PA 4UB1A 5AKEA 2RDJA 4I2CA 2KZMA 2FLPA 4EEKA 1NKEA 5J2HA 5D49A 5CA7A 1O08A 4R8UA 4O5EA 1PK3A 1Z4NA 3BS7A 1DOQA 2AHOB 2LYBA 3RBDA 5EE3A 3A0HU 4KLHA 3JPNA 2BCUA 3AN1A 5DG8A 4CGZA 4CF4A 3KFUF 1RXVA 3LWLA 1ZJNA 1ZYQA 5AIBA 1C7YA 2F3NA 3NASA 4KLFA 3SAFA 4KLLA 5ALUA 2Q0ZX 3OGUA 2F76X 1S76D 1X66A 5GTHU 4NLZA 1S0VA 1B0XA 3T5KA 2XIDA 4YD2A 1XSNA 3N7RC 3TACB 3TAQA 5AM3A 4UQGA 8ICFA 3RH5A 4I2BA 4TQRA 2HOIA 4F4KA 3E58A 4KITB 4UBCA 1LB2B 2WHEA 2AQ4A 4K4IA 4O5CA 2DUYA 4P0PB 1URJA 3T5LA 1VDVA 2JEJA 2ES6A 2LI6A 5EE1A 1WG8A 1KKXA 4DQIA 2F8LA 4YMNA 5KG0A 2CPRA 3BDPA 4U6PA 9ICXA 1FFUA 2WF9A 4PGYA 4UAYA 3TQ1A 4O3RA 3PR5B 2HBLA 2W3RA 1HJPA 2XICA 4XRHA 4F2SA 2QKQA 2G08A 5GTIU 3CW2C 1KFDA 2RDIA 2ISPA 2HSZA 4YMOA 2LMRA 4RT2A 1AQ6A 1SXDA 4K4GA 3QU9A 1NJWA 1N63A 5DBAA 5JUMA 1ZQDA 2DQNB 1L5UA 4F5RA 7ICKA 4UB2A 4UW9A 1CUKA 2G07A 3IG8A 3B9JA 3RJHA 4PHPA 4MEYA 2XC9A 5AKXA 7ICMA 1NK8A 1PZNA 5CRXA 4C4RA 1X9SA 8ICEA 4DFPA 2VANA 1ZQUA 5KAFU 4F92B 1TV9A 3M8RA 2NYVA 1YZ6A 4GXIA 4BUGA 5F9NA 4X5VA 5AK4A 3RFAA 4CE6A 2G0AA 4PZNA 4K4HA 4JV0A 5J0SA 1ZQSA
chains in the Genus database with same CATH topology
1B4FA 1B0XA 2F8KA 3HILA 2Y9UA 2QB0B 3TACB 1OW5A 1LKYB 2QARA 2L5YA 3IDWA 2KIVA 4RQNA 1UQVA 2GLEA 2JV3A 2E8MA 3KKAC 3SENA 1X40A 1SXEA 2KSOB 5L1MA 2KMDA 4MHVA 1KW4A 3TADC 3KKAA 1OXJA 1PK1B 2ES6A 2D3DA 5J8YC 5JU5A 4NL9C 3TADA 2DL0A 5J8YA 2QB0A 2K60A 4NL9A 2B6GA 1SV0C 1DXSA 2E8NA 2KE7A 4PZOA 1SV4A 1LKYA 2EAMA 1SV0A 1V38A 2ESEA 3BS5B 2DKXA 1UCVA 1WWUA 2KSOA 2D8CA 1JI7A 2KG5A 2QKQA 1PK1A 2F44A 4IS7A 1X9XA 3H8MA 2LMRA 2K4PA 1SXDA 1WWVA 4NJ8A 2FE9A 1PK3A 3BS7A 3K1RB 2QB1A 3BS5A 1V85A 2Y9TA 1Z1VA 5F3XB 1F0MA 1RG6A 1SGGA 2QARB 2DKZA 3BQ7A 2F3NA 2E8PA 5JTIA 1COKA 2EANA 2YTUA 2E8OA 3SEIA 4RQMA 2EAOA 2LPEA 5KNIA 5JRTA 1X66A 4PZNA 2EAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B4F A;  1B0X A;  2F8K A;  3HIL A;  2Y9U A;  2QB0 B;  3TAC B;  1OW5 A;  1LKY B;  2QAR A;  2L5Y A;  3IDW A;  2KIV A;  4RQN A;  1UQV A;  2GLE A;  2JV3 A;  2E8M A;  3KKA C;  3SEN A;  1X40 A;  1SXE A;  2KSO B;  5L1M A;  2KMD A;  4MHV A;  1KW4 A;  3TAD C;  3KKA A;  1OXJ A;  1PK1 B;  2ES6 A;  2D3D A;  5J8Y C;  5JU5 A;  4NL9 C;  3TAD A;  2DL0 A;  5J8Y A;  2QB0 A;  2K60 A;  4NL9 A;  2B6G A;  1SV0 C;  1DXS A;  2E8N A;  2KE7 A;  4PZO A;  1SV4 A;  1LKY A;  2EAM A;  1SV0 A;  1V38 A;  2ESE A;  3BS5 B;  2DKX A;  1UCV A;  1WWU A;  2KSO A;  2D8C A;  1JI7 A;  2KG5 A;  2QKQ A;  1PK1 A;  2F44 A;  4IS7 A;  1X9X A;  3H8M A;  2LMR A;  2K4P A;  1SXD A;  1WWV A;  4NJ8 A;  2FE9 A;  1PK3 A;  3BS7 A;  3K1R B;  2QB1 A;  3BS5 A;  1V85 A;  2Y9T A;  1Z1V A;  5F3X B;  1F0M A;  1RG6 A;  1SGG A;  2QAR B;  2DKZ A;  3BQ7 A;  2F3N A;  2E8P A;  5JTI A;  1COK A;  2EAN A;  2YTU A;  2E8O A;  3SEI A;  4RQM A;  2EAO A;  2LPE A;  5KNI A;  5JRT A;  1X66 A;  4PZN A;  2EAP A; 
#chains in the Genus database with same CATH topology
 4Y2Y A;  5AKI A;  5KT4 A;  3RH6 A;  3PVX A;  4ECR A;  1ZQY A;  1S77 D;  4UB5 A;  2HCF A;  3TAN A;  1XNS A;  3UXO A;  1UA0 A;  2J6T A;  1TAQ A;  3ZD9 A;  1L8L A;  3B0Y A;  3ZI4 A;  3SEN A;  1Q3U A;  5KG3 A;  4NV0 A;  1ZD5 A;  1P7D A;  5IIL A;  3V7K A;  4CF3 A;  5CJ7 A;  3QZ8 A;  1FIQ A;  3HP6 A;  3PNC A;  4MFA A;  4F3O A;  5AK6 A;  3M9M B;  3OSN A;  2NRV A;  4TUP A;  3ISB A;  7ICQ A;  3AQF A;  3MR6 A;  4O3M A;  1IM4 A;  2VA3 A;  3F2D A;  1NKB A;  2I5H A;  5KFD A;  5AM4 A;  1N5W A;  3RF9 A;  1N60 A;  5KT6 A;  3TKA A;  4F50 A;  4NLK A;  3PSP A;  3VC8 A;  4YR0 A;  3H8J A;  2P6R A;  2D6F C;  4IQU A;  5KFH A;  5BOL A;  1ZQI A;  3M1Y A;  3ED5 A;  5DGA A;  2BQU A;  5DQI A;  7ICR A;  3U26 A;  4DQS A;  4NJ8 A;  2BPG A;  2DWQ A;  3RB6 A;  1ZQJ A;  2W03 A;  3BS5 A;  1TK0 A;  2FPL A;  1SWV A;  4DWI A;  1NI3 A;  9ICK A;  1F0M A;  5CWR A;  1DGJ A;  3K1Z A;  2JMG A;  4RPX A;  4RQ3 A;  3T5H A;  1BPD A;  2A19 A;  3BQT A;  1HUO A;  4ZOH C;  3RRH A;  2JEI A;  3PW0 A;  2EAO A;  4GXJ A;  2IHN A;  1KFT A;  2BQ3 A;  1ZJM A;  4B9V A;  1BNO A;  5J2J A;  3AUO A;  3QUT A;  2LYA A;  4P4O A;  2QB0 B;  2W54 A;  1S97 A;  2HHS A;  2Y0S F;  3D2N A;  3ZDB A;  7ICS A;  2EZZ A;  5ALL A;  1MN8 A;  3RB3 A;  5DB7 A;  3PX6 A;  3E0F A;  5ALG A;  5KG5 A;  4LVS A;  2XY6 A;  2KMD A;  2ZTE A;  4UAZ A;  4GIB A;  2HI0 A;  4PHD A;  2JEF A;  3ZDD A;  1A0P A;  4R65 A;  5AI0 A;  5DDM A;  3WK4 A;  4WJ3 B;  2B6G A;  5EE0 A;  4UBB A;  4DOA A;  4R8U B;  5AKH A;  8ICO A;  5B5E U;  3KTQ A;  2RLT A;  2K8B B;  2ZJ8 A;  3WKD A;  2KKP A;  2MA1 A;  5KFL A;  5KFE A;  3QEA Z;  2M0N A;  4I2I A;  2KJ5 A;  2FPM A;  2DPJ A;  1PK1 A;  4PJ0 U;  4RNN A;  1C20 A;  4FBU A;  8ICB A;  4DSJ A;  3S6J A;  4YVZ A;  5KT7 A;  4BXO A;  5AM0 A;  3T3F A;  4A8E A;  5ALS A;  2GH1 A;  3K4G A;  3GZF A;  2JR5 A;  2ASJ A;  4QWE A;  4Q44 A;  3MDC A;  4QZ9 A;  1FO4 A;  2K4E A;  5KG2 A;  5KFP A;  1EXN A;  2ZUB A;  8ICR A;  2BCS A;  1ZXI A;  3JPS A;  3KOO A;  4YR2 A;  5J2E A;  2OWO A;  2V4Q A;  5AKK A;  4USA A;  4RNM A;  5KFY A;  1ZQV A;  1KSP A;  3RJI A;  3F2B A;  1TAU A;  3TFR A;  8ICY A;  4F72 A;  9ICJ A;  4F91 B;  4DL5 A;  4J9S A;  2XI9 A;  4F2R A;  3AL0 B;  4ED1 A;  4GXK A;  4F5O A;  1QSS A;  3ZD8 A;  5T14 A;  2PFO A;  1Y88 A;  5DBB A;  4B9U A;  1L7O A;  4F93 B;  5HR6 A;  1Z19 A;  1SKS A;  5K4L A;  1OXJ A;  3OHB A;  2AJQ A;  3MGI A;  5D4B A;  3WK7 A;  4ED6 A;  1BPB A;  2HHV A;  2KJ9 A;  2DL0 A;  4QWA A;  5J8Y A;  3C5G A;  4NL9 A;  1ARO P;  5KFM A;  2BKE A;  2JGA A;  3EW9 A;  2KD1 A;  2YMQ A;  4RU9 A;  3EZ5 A;  5AIC A;  4E0D A;  2DKX A;  2K4I A;  2LBO A;  5DKW A;  1TFR A;  3OHA A;  4ED7 A;  8ICT A;  4AYB F;  1BPZ A;  4B9L A;  4M9J A;  5KFK A;  2F44 A;  2YN4 A;  1TVA A;  5L1K A;  1JN3 A;  1N5X A;  1NJZ A;  2UVW A;  9ICT A;  3N28 A;  2DGZ A;  5KFT A;  4C7Y A;  2A3V A;  9ICV A;  1JX4 A;  5IIO A;  4KX5 A;  4IQT A;  5ALW A;  3RR8 A;  4FFD A;  4YP3 A;  2KHQ A;  2XGQ A;  1V85 A;  2CXY A;  3BZK A;  1RG6 A;  5KT2 A;  1QCK A;  3FAH A;  1L3U A;  4C8K A;  1QQ7 A;  3MDA A;  3CP8 A;  2E1F A;  2PXI A;  1ZQ1 C;  1L3T A;  2ZTD A;  1J2M A;  4DQQ A;  8ICX A;  2IMW P;  1HIW A;  5DQH A;  3F53 A;  1IV8 A;  4Q8E A;  1ZQN A;  1NKC A;  4IR1 A;  4KLO A;  4QJF B;  1MSW D;  2FLN A;  1OW5 A;  3VCB A;  5IIK A;  3RAX A;  2L5Y A;  5ALP A;  3SAG A;  2JV3 A;  4JMU A;  2AQ0 A;  1ZQG A;  1L3S A;  1QQ6 A;  1X40 A;  4QWB A;  1KLN A;  3QUC A;  3ZDE A;  5KG1 A;  4TUS A;  4NY8 A;  3FDS A;  1L7P A;  5KFO A;  2D3D A;  4BWJ A;  3SQI A;  1A76 A;  3QNM A;  1KTQ A;  1WCL A;  4CNQ A;  2K60 A;  4IQV A;  4CF5 A;  4ECV A;  3Q8M A;  1TE2 A;  5IIM A;  1LKY A;  3BS5 B;  4YFK A;  1RXW A;  1WWU A;  5ALI A;  1XC9 A;  1JIH A;  5AK5 A;  2HHQ A;  4EEN A;  4P0Q A;  4Z6D A;  4TUR A;  2WAQ C;  2H3F A;  3NGD A;  4YCX A;  3QZ7 A;  2J6U A;  4IS7 A;  4UAS A;  5HR7 A;  3ETL A;  1S0N A;  2HVI A;  3QX7 A;  1T8E A;  4UAT A;  3G6Y A;  3K1R B;  2ZXI A;  3C2M A;  1J2N A;  2Y9T A;  5KFX A;  2ZIW A;  1NNL A;  3HPO A;  3JPQ A;  2H3Q A;  3SYZ A;  1RZT A;  2KIW A;  5HNK A;  3PY8 A;  3HW8 A;  3N4M B;  1ZQP A;  2DF4 B;  8ICJ A;  2EAN A;  4QZ8 A;  1SZH A;  3I76 A;  4J9Q A;  4UAR A;  2G5H B;  4QZB A;  4YXM A;  4FS2 A;  5CHG A;  2G06 A;  2K4H A;  1NZP A;  2W8K A;  4F4W A;  2C2E A;  4RQ8 A;  3H8S A;  1N56 A;  2C2D A;  3KZI U;  4DSI A;  3BQ0 A;  3GIJ A;  1RM6 C;  4NLB A;  3RJK A;  4ED2 A;  4M9L A;  1ZQT A;  4ECS A;  1RYS A;  4QWD A;  4O3Q A;  9ICI A;  2I6X A;  4B9N A;  2NO5 A;  3N97 B;  3PW4 A;  4BX9 C;  3NRZ A;  4Z6E A;  2I1Q A;  3KKA A;  1NK9 A;  1PK1 B;  8ICU A;  8ICS A;  2ODG A;  1XS9 D;  5G5G A;  1QQ5 A;  2W04 A;  5HP4 A;  5J2K A;  3PX0 A;  4PGQ A;  3BQ2 A;  1TK5 A;  7ICP A;  4BXO B;  1WYG A;  2IOF K;  1S0O A;  1KL9 A;  3ORY A;  4RQ5 A;  4Q8F A;  4LZD A;  1V38 A;  2ESE A;  2YY6 A;  5DDY A;  3SAH A;  8ICQ A;  1UCV A;  4ED3 A;  2DFL A;  1ZQO A;  1JI7 A;  5EWE A;  3MC1 A;  2VIX A;  4IRK A;  4KX3 A;  4EX6 A;  7ICF A;  5KL8 B;  3JPP A;  4Q45 A;  3H8M A;  2W43 A;  2NRW A;  2OXO A;  1ZQA A;  4YG2 A;  4KLD A;  2F1H A;  1D9D A;  4IQW A;  4Z6C A;  1SGG A;  3B0X A;  4FE3 A;  4PH5 A;  3D2S A;  1NZB A;  2XO7 A;  2Y0S C;  1HUZ A;  4DS4 A;  4RPZ A;  5KFU A;  1NK5 A;  3QEB Z;  3OTQ A;  4I2G A;  1ZQZ A;  4EZ9 A;  2CRX A;  2JXJ A;  1DK3 A;  3ISC A;  2DBY A;  1ZQF A;  1NJY A;  1QSL A;  2F8K A;  3CYM A;  3HJE A;  3RB4 A;  1S0M A;  4KLQ A;  4TUQ A;  2WAQ F;  2ALZ A;  4Y2Q A;  2GLE A;  3UQ2 A;  5ALN A;  1UHU A;  5AI9 A;  4I2E A;  4F5Q A;  4MHV A;  1SIJ A;  3KHL A;  3MFH A;  5HHI A;  5L1L A;  1N61 A;  3ZDC A;  3ICX A;  4DOB A;  4ECT A;  3T79 A;  5KFA A;  4U7C A;  5J0R A;  4FO6 A;  2IBK A;  4I27 A;  4C80 A;  4UB6 U;  2W9B A;  1QLN A;  2D8C A;  3IP4 B;  4Y2V A;  1FEZ A;  2RP5 A;  2B0C A;  2BCV A;  8ICI A;  3EPI A;  3SI8 A;  1QSY A;  4OJ6 A;  4GC7 A;  3WKB A;  1KRP A;  1SL0 A;  5CB1 A;  3V6K A;  3SV4 A;  4PGX A;  4JV2 A;  9ICA A;  1Z1V A;  3QYP A;  3PSI A;  4J03 A;  1BVS A;  3H0R B;  5KFS A;  4JWM A;  1ZD2 P;  3DV9 A;  5JTI A;  3NUQ A;  2YTU A;  3MR2 A;  3EWA A;  4O9M A;  2XGP A;  4OJL A;  3GV8 B;  5ALD A;  4RUA A;  2ZIU A;  5ALJ A;  5KG7 A;  3KHR A;  5C5J A;  5DLG A;  3GQC A;  3GDX A;  9ICN A;  4OJP A;  1KFS A;  1NK0 A;  1SWW A;  4EYH B;  1S5L U;  2A1J B;  3F5E A;  2RHF A;  2ZUC A;  1LKY B;  3RJE A;  4BGD A;  7ICU A;  2IOH A;  2YB4 A;  3V7J A;  1ZRN A;  1CRX A;  4QZF A;  1NJX A;  4KMO B;  2E1E A;  2HHT A;  3Q8R B;  1JXE A;  4PHA A;  4AYB C;  1JRO A;  2EH9 A;  1ZD4 A;  2VA2 A;  5AM5 A;  2ZIV A;  2XVT A;  1X9M A;  3HWT A;  3RB0 A;  3M6Z A;  3F5A A;  3RH4 A;  2JEG A;  2E3T A;  2V9W A;  1KBU A;  2W11 A;  1L3V A;  4DLG A;  1PVP A;  2ZIW B;  4O3S A;  9ICS A;  3AQE A;  4QIW F;  3KZX A;  5KT3 A;  2C28 A;  2KJ8 A;  3Q8L A;  3LDA A;  5J0P A;  3ONN A;  2EDU A;  3UQ0 A;  2E5S A;  3RTV A;  2JHD A;  3I1Y A;  4ZH4 A;  4B9S A;  1D8L A;  4I2A A;  4RQ2 A;  4KN4 A;  1RYU A;  5ALE A;  2K4P A;  2IA6 A;  8ICP A;  5AKZ A;  4O5K A;  2KIC A;  2W8L A;  1O03 A;  2BQR A;  5C0Y A;  3G6V A;  5F3X B;  3C2L A;  4Y2R A;  1ZQX A;  1XO0 A;  2HOQ A;  3JPT A;  2HBK A;  7ICI A;  4EYI B;  9ICP A;  3QU2 A;  4KN7 A;  2BPF A;  3BQ7 A;  1S9F A;  3GFK B;  4ELU A;  1COK A;  2NRX A;  3SEI A;  3Q8K A;  2ASD A;  1T3N A;  1U49 A;  4NLN A;  2K8A A;  3L3F X;  4DL3 A;  7ICJ A;  4KMU A;  4EZ6 A;  2IHM A;  3HIL A;  4KLI A;  4QZD A;  4ECW A;  3NRW A;  3IN5 A;  1X9W A;  4KLU A;  9ICB A;  4NXZ A;  4LZG A;  4BDP A;  5CEH A;  1Z3E B;  2AGO A;  1UQV A;  2HHW A;  3R9K A;  2E8M A;  4XUS A;  2EQY A;  1QTM A;  4QZE A;  1ZET A;  5J8Y C;  1Z4O A;  4O0I A;  4NL9 C;  2OHF A;  5KTQ A;  2A1A A;  3TAD A;  2Z7J A;  3QU4 A;  5AM2 A;  1ZQR A;  2YMP A;  2NV3 A;  5KFW A;  4C4T A;  1V97 A;  2BGW A;  1WCN A;  4RQ6 A;  2Y1J A;  1SV0 A;  4MEX A;  2VKQ A;  3H7I A;  2KVC A;  5DB8 A;  4NM1 A;  2W9C A;  5J0Y A;  2YML A;  4RQ1 A;  4C8O A;  2KG5 A;  2CN1 A;  3DEE A;  4DO9 A;  4YMM A;  5J2G A;  2FMQ A;  2LM4 A;  5J0T A;  5J2B A;  3GIL A;  3WK9 A;  8ICK A;  2JH1 A;  4CDG A;  1B43 A;  3T5J A;  5AI5 A;  5AHX A;  4J9N A;  2LM1 A;  4ICA A;  4KLE A;  3NVW A;  4B6J A;  3WKC A;  5DQG A;  2ZJ5 A;  3IV6 A;  3BQ1 A;  1D9F A;  2ZUD A;  3E2E A;  5III A;  4DQP A;  1RQL A;  4M47 A;  3TAR A;  3OPX A;  4M6W A;  2R8J A;  5B66 U;  4QZH A;  3RAQ A;  2KZZ A;  4GLX A;  4DCC A;  2E8P A;  3PML A;  4RQM A;  4RQ0 A;  3GV7 B;  1N2X A;  1JAL A;  5L9X A;  1LVH A;  2WF6 A;  4DFD A;  2HBM A;  3OJS A;  4I28 A;  4R66 A;  2GOL A;  3D6J A;  1XO1 A;  1SL2 A;  4LJX A;  2WF5 A;  4G3I A;  2UVR A;  2PFQ A;  1RYR A;  1SKR A;  2W9B B;  4EEL A;  1SXE A;  5ALT A;  2WTF A;  5HML A;  5J0O A;  5AI8 A;  1DRG A;  3WK8 A;  4PPX A;  3MFI A;  4UB3 A;  4C4S A;  5JU5 A;  4J9K A;  4EBC A;  1FFV A;  5J0X A;  9ICO A;  1X6J A;  4M04 A;  7ICE A;  4Y2X A;  9ICU A;  1T7P A;  3TAP A;  1IIP A;  5J29 A;  3HX0 A;  2FDR A;  2YX8 A;  1SV4 A;  4RQ4 A;  2C2R A;  9ICF A;  3OSP A;  1QH9 A;  1JUD A;  5L1I A;  2KOB A;  3KHG A;  2ASL A;  5TIS U;  2F2A B;  3SR6 A;  3Q8P B;  4J9L A;  3PZP A;  5J2I A;  2W9M A;  3AU2 A;  3PO4 A;  2BDP A;  7ICT A;  5ALY A;  3H8W A;  4HAI A;  3WKA A;  2BR0 A;  2BZF A;  2AH5 A;  2P6U A;  3NVY A;  5FP0 A;  2P66 A;  2BDU A;  2ZIU B;  4DEZ A;  3GIM A;  4DSF A;  3MAB A;  3UPQ A;  1U45 A;  4Z6F A;  4EBD A;  4DFJ A;  1BPX A;  2HHX A;  5KFV A;  2DPI A;  3M9O B;  5KFB A;  1DK2 A;  4M9H A;  2MSN A;  3PW5 A;  4C8N A;  4I2J A;  4CRX A;  2AGP A;  2KEY A;  4C8L A;  4NLG A;  1YT3 A;  2R18 A;  5ALH A;  7ICV A;  2B21 A;  1KDH A;  2ZG6 A;  4OD0 A;  1UA1 A;  8ICH A;  5ALF A;  2ZIV B;  1UT5 A;  2Y9U A;  4JUZ A;  4ECU A;  5DB6 A;  4DQR A;  3H4B A;  4QZG A;  3QXG A;  2VJ5 A;  3KKA C;  4Y2U A;  2LHT A;  5J2D A;  4QZA A;  3MR5 A;  1Q3V A;  5E79 U;  5EOZ A;  5J2F A;  1VLB A;  3Q8Q B;  3C1Z A;  4PZO A;  4M9G A;  1SL1 A;  4NWI A;  2PFP A;  5AK3 A;  4RNO A;  1L6N A;  1MC8 A;  2KFN A;  3MGH A;  4TQS A;  2R8K A;  4KLM A;  3IRU A;  4FZM A;  4UAU A;  3RR7 A;  3C1Y A;  2H3V A;  4GFJ A;  4AP9 A;  5CP2 A;  2KK0 A;  2QLT A;  3M8S A;  1J97 A;  2H3Z A;  4F5P A;  4DSK A;  4YD1 A;  2YQE A;  2NO4 A;  3WK6 A;  2ZJA A;  2NRZ A;  5A0L A;  1S8O A;  3PMN A;  1KN5 A;  1IG6 A;  4RPY A;  3IHQ B;  2MRL A;  4US8 A;  2MUT A;  1H38 A;  2FLL A;  3THV A;  5CR0 A;  8ICN A;  2JZB A;  4UAV A;  5ALO A;  4DL7 A;  4DFM A;  4O3O A;  2XY5 A;  1KEJ A;  4J9P A;  2ISO A;  1JRP A;  2KKV A;  5KFJ A;  3PX4 A;  7ICL A;  4Q43 A;  1M6Y A;  2VA8 A;  3HKZ F;  3F2C A;  1Q46 A;  4IR9 A;  2XY7 A;  4XA5 A;  2FMP A;  4QW8 A;  1ZOL A;  3A0B U;  2HOF A;  1ZQQ A;  4M2Y A;  2QAR A;  5EWF A;  2W9C B;  7ICN A;  3FYH A;  2F77 X;  3M6K A;  4PL1 A;  2ZTC A;  3KD3 A;  4QIW C;  4Y2P A;  4IC9 A;  2R8G A;  2N1R A;  3PST A;  2W9A A;  2PI4 A;  1NK7 A;  1SZP A;  4OJ5 A;  4MFC A;  1NOM A;  5ALQ A;  1BPY A;  1IXR A;  4F71 A;  9ICM A;  5ALZ A;  3RRG A;  3C28 A;  3C29 A;  4F4Y A;  4B9T A;  7ICH A;  3C21 A;  1Q8K A;  4M9N A;  3H4D A;  1GO3 F;  3TFS A;  5G5H A;  2C22 A;  3LVV A;  2J6S A;  1PUZ A;  5J0W A;  4M6W B;  2WB1 F;  3PW2 A;  8ICZ A;  1VJ5 A;  2OEH A;  3NVZ A;  4ECZ A;  1ZQM A;  5AKL A;  2LKY A;  4EBE A;  4RZR A;  1DGS A;  2OCE A;  4OJO A;  5AI6 A;  5ALM A;  5KFI A;  2LYH A;  5AM1 A;  1WWV A;  3M9N B;  5L1J A;  4DS5 A;  2FE9 A;  3HRD D;  3RJG A;  5J2C A;  8ICG A;  3IG5 A;  4BWM A;  3GIK A;  4FS1 A;  2FI1 A;  5IIN A;  3PO5 A;  4C8M A;  2PMZ C;  2OYY A;  2MU2 A;  3V6J A;  4DSE A;  2BPC A;  3V7L A;  4ELV A;  2HVH A;  3C23 A;  1SKW A;  1U9L A;  2GO7 A;  2LPE A;  3AM9 A;  1D8Y A;  2F1J A;  4DL6 A;  5ALR A;  4KLT A;  3ETR A;  2EAP A;  1XWL A;  2RRD A;  4FBT A;  3EUB 2;  4I2F A;  4YQW A;  4Y2J A;  5KFG A;  3J81 j;  3IDW A;  2WFA A;  1D8B A;  2NRT A;  5F9L A;  3I28 A;  3LK9 A;  2KVS A;  3PV8 A;  5L1M A;  4XQ8 A;  4F5N A;  1ZQH A;  1Z00 A;  3LYS A;  9ICQ A;  4R64 A;  1CEZ A;  2O6K A;  3C2K A;  3OJU A;  2KZ3 A;  2VJ4 A;  3CNH A;  4DOC A;  1B22 A;  5BPC A;  2ZIX A;  1DXS A;  3HT3 A;  2KE7 A;  1ZQB A;  5HMM A;  5J0Q A;  3H40 A;  3V6H A;  4IRC A;  3JPR A;  1T3Q A;  3QUQ A;  4OO1 J;  5ALV A;  3BZC A;  1ZD3 A;  4IRD A;  2KSO A;  4F4X A;  4P0Q B;  5HHH A;  1ZQC A;  2G09 A;  1K1Q A;  4QWC A;  3DDH A;  3LVW A;  3L5K A;  4CCH A;  2AGQ A;  2G5I B;  4Y2S A;  2Y1I A;  4NM2 A;  3SZ2 A;  5D46 A;  3WK5 A;  4J9O A;  1ED1 A;  2M9N A;  2OH2 A;  4QNL A;  1TKD A;  3NVV A;  5KFN A;  2R8H A;  2KHV A;  2KP7 A;  2XCA A;  2MAX A;  4DLE A;  4C7Z A;  1KQQ A;  2E8O A;  4UB4 A;  1JMS A;  3MBY A;  4O3P A;  2JRZ A;  1X6I A;  3N7P D;  3ZDA A;  4I2D A;  4O3N A;  2K8C B;  3UXP A;  3UMG A;  4QW9 A;  1B4F A;  1F5S A;  2IOF A;  1ZQE A;  5AKG A;  4P4M A;  1RPL A;  4ECQ A;  9ICG A;  3EPG A;  2KIV A;  4ED0 A;  2WF7 A;  4QZC A;  4EX7 A;  3QU7 A;  1NK6 A;  3WKE A;  4G9B A;  5KG4 A;  4UAW A;  4P2H A;  1KW4 A;  3TAD C;  2PMZ F;  5KFZ A;  1UT8 A;  3UMC A;  4DFK A;  1S10 A;  1RDF A;  3PSF A;  1OUQ A;  1N62 A;  2KTQ A;  1HEK A;  3M7D A;  8ICW A;  4QZI A;  2P35 A;  1T4G A;  1SV0 C;  3SMV A;  3AEV A;  5KT5 A;  3FM9 A;  3CRX A;  3RJF A;  7ICG A;  3PW7 A;  5DG9 A;  1K1S A;  4ED8 A;  2MUT B;  1ECW A;  2KN7 A;  4ELT A;  5IIJ A;  2PI5 A;  4P0P A;  5KFF A;  8ICL A;  2JZB B;  5DG7 A;  1A6S A;  1RQN A;  4C0Z A;  2BCR A;  2GWS A;  2KNJ A;  4FZL A;  3SV3 A;  1K5O A;  2I9G A;  5J0U A;  2FPK A;  4ECX A;  3AU6 A;  2HBJ A;  5KL1 B;  5DB9 A;  3Q8S B;  3JPO A;  4KLG A;  3QU5 A;  4IL6 U;  4MF8 A;  4F8R A;  3RBE A;  2HW3 A;  3BJY A;  2UVU A;  2QAR B;  5EE9 A;  3UXN A;  2DKZ A;  1X2I A;  2PFN A;  1BPE A;  2AXT U;  4RQ7 A;  1A77 A;  4DF8 A;  3WU2 U;  1XSL A;  8ICA A;  3MR3 A;  3ALR A;  4YR3 A;  4PHE A;  1MQ3 A;  3GV5 B;  9ICE A;  2YB1 A;  1F44 A;  2RQ5 A;  5DGB A;  8ICC A;  2WF8 A;  4JV1 A;  1NK4 A;  1MQ2 A;  3H0M B;  4R63 A;  3GU3 A;  3FC4 A;  2H5X A;  3MGV A;  4Y2T A;  4DL2 A;  1TAM A;  3QE9 Y;  4I29 A;  2JH7 A;  4DL4 A;  5KFR A;  3SD7 A;  4GC6 A;  2BHN A;  3PR4 A;  1XSP A;  5KFC A;  2Q4T A;  1MA7 A;  2YMM A;  5J2A A;  4J9M A;  4J9R A;  3D2Q A;  9ICL A;  4DSL A;  2ZXH A;  3H0L B;  5AIA A;  1WUD A;  3N7S C;  3C5F A;  4UB8 U;  1PVR A;  2AU0 A;  2ATL A;  9ICH A;  1T94 A;  5KG6 A;  1L7M A;  3TI0 A;  5EWG A;  1N48 A;  1PVQ A;  5KFQ A;  1TK8 A;  5H2F U;  4M0A A;  3V72 A;  3IM1 A;  4YXJ A;  1JXL A;  7ICO A;  3RJJ A;  4JB3 A;  4JK1 A;  4FZN A;  3NS1 A;  1XU4 A;  4OCZ A;  5DLF A;  2BCQ A;  1YZ7 A;  2HDO A;  3O0F A;  3EYZ A;  1ZQL A;  2F1I A;  1Z1B A;  1X9X A;  5ALK A;  9ICR A;  2FMS A;  4MF2 A;  3K75 D;  1BNP A;  1ZQW A;  2H3I A;  2OM6 A;  9ICW A;  3KBB A;  3G6X A;  2QB1 A;  5AKJ A;  2HMX A;  2K89 A;  1U48 A;  1X42 A;  3HKZ C;  4I2H A;  8ICV A;  4ECY A;  1COO A;  3GII A;  4B9M A;  4KLJ A;  4RUC A;  4ACO A;  2EZX A;  1SB3 C;  1Z00 B;  5AKY A;  4RT3 A;  3UM9 A;  5BOM A;  1U4B A;  4YN4 A;  5KNI A;  3AMZ A;  5JRT A;  2R8I A;  2W3S A;  4EEY A;  1L7N A;  3ISD A;  2KV2 A;  2HHU A;  2W55 A;  2FJ6 A;  2ZIX B;  2EZY A;  4KTQ A;  1V9P A;  1U47 A;  4JWN A;  3KHH A;  1UPH A;  3NTU A;  1L8O A;  2A1J A;  3UMB A;  4MFF A;  4RQN A;  3LWM A;  4DF4 A;  2KFZ A;  4US9 A;  2KSO B;  2W7O A;  2PKE A;  5AI4 A;  4KLS A;  9ICC A;  5TZV A;  4HYK A;  4NLC A;  3L4P A;  2WB1 C;  5DBC A;  2QB0 A;  1ZRM A;  5ALX A;  1CI4 A;  5KAI U;  4PL2 A;  2E8N A;  1LV5 A;  4BJQ A;  2EAM A;  1ZQK A;  2UVV A;  1BGX T;  2XCP A;  4F4Z A;  3QUB A;  8ICM A;  4P4P A;  2V4R A;  2W7P A;  4UB1 A;  5AKE A;  2RDJ A;  4I2C A;  2KZM A;  2FLP A;  4EEK A;  1NKE A;  5J2H A;  5D49 A;  5CA7 A;  1O08 A;  4R8U A;  4O5E A;  1PK3 A;  1Z4N A;  3BS7 A;  1DOQ A;  2AHO B;  2LYB A;  3RBD A;  5EE3 A;  3A0H U;  4KLH A;  3JPN A;  2BCU A;  3AN1 A;  5DG8 A;  4CGZ A;  4CF4 A;  3KFU F;  1RXV A;  3LWL A;  1ZJN A;  1ZYQ A;  5AIB A;  1C7Y A;  2F3N A;  3NAS A;  4KLF A;  3SAF A;  4KLL A;  5ALU A;  2Q0Z X;  3OGU A;  2F76 X;  1S76 D;  1X66 A;  5GTH U;  4NLZ A;  1S0V A;  1B0X A;  3T5K A;  2XID A;  4YD2 A;  1XSN A;  3N7R C;  3TAC B;  3TAQ A;  5AM3 A;  4UQG A;  8ICF A;  3RH5 A;  4I2B A;  4TQR A;  2HOI A;  4F4K A;  3E58 A;  4KIT B;  4UBC A;  1LB2 B;  2WHE A;  2AQ4 A;  4K4I A;  4O5C A;  2DUY A;  4P0P B;  1URJ A;  3T5L A;  1VDV A;  2JEJ A;  2ES6 A;  2LI6 A;  5EE1 A;  1WG8 A;  1KKX A;  4DQI A;  2F8L A;  4YMN A;  5KG0 A;  2CPR A;  3BDP A;  4U6P A;  9ICX A;  1FFU A;  2WF9 A;  4PGY A;  4UAY A;  3TQ1 A;  4O3R A;  3PR5 B;  2HBL A;  2W3R A;  1HJP A;  2XIC A;  4XRH A;  4F2S A;  2QKQ A;  2G08 A;  5GTI U;  3CW2 C;  1KFD A;  2RDI A;  2ISP A;  2HSZ A;  4YMO A;  2LMR A;  4RT2 A;  1AQ6 A;  1SXD A;  4K4G A;  3QU9 A;  1NJW A;  1N63 A;  5DBA A;  5JUM A;  1ZQD A;  2DQN B;  1L5U A;  4F5R A;  7ICK A;  4UB2 A;  4UW9 A;  1CUK A;  2G07 A;  3IG8 A;  3B9J A;  3RJH A;  4PHP A;  4MEY A;  2XC9 A;  5AKX A;  7ICM A;  1NK8 A;  1PZN A;  5CRX A;  4C4R A;  1X9S A;  8ICE A;  4DFP A;  2VAN A;  1ZQU A;  5KAF U;  4F92 B;  1TV9 A;  3M8R A;  2NYV A;  1YZ6 A;  4GXI A;  4BUG A;  5F9N A;  4X5V A;  5AK4 A;  3RFA A;  4CE6 A;  2G0A A;  4PZN A;  4K4H A;  4JV0 A;  5J0S A;  1ZQS A; 
#chains in the Genus database with same CATH homology
 1B4F A;  1B0X A;  2F8K A;  3HIL A;  2Y9U A;  2QB0 B;  3TAC B;  1OW5 A;  1LKY B;  2QAR A;  2L5Y A;  3IDW A;  2KIV A;  4RQN A;  1UQV A;  2GLE A;  2JV3 A;  2E8M A;  3KKA C;  3SEN A;  1X40 A;  1SXE A;  2KSO B;  5L1M A;  2KMD A;  4MHV A;  1KW4 A;  3TAD C;  3KKA A;  1OXJ A;  1PK1 B;  2ES6 A;  2D3D A;  5J8Y C;  5JU5 A;  4NL9 C;  3TAD A;  2DL0 A;  5J8Y A;  2QB0 A;  2K60 A;  4NL9 A;  2B6G A;  1SV0 C;  1DXS A;  2E8N A;  2KE7 A;  4PZO A;  1SV4 A;  1LKY A;  2EAM A;  1SV0 A;  1V38 A;  2ESE A;  3BS5 B;  2DKX A;  1UCV A;  1WWU A;  2KSO A;  2D8C A;  1JI7 A;  2KG5 A;  2QKQ A;  1PK1 A;  2F44 A;  4IS7 A;  1X9X A;  3H8M A;  2LMR A;  2K4P A;  1SXD A;  1WWV A;  4NJ8 A;  2FE9 A;  1PK3 A;  3BS7 A;  3K1R B;  2QB1 A;  3BS5 A;  1V85 A;  2Y9T A;  1Z1V A;  5F3X B;  1F0M A;  1RG6 A;  1SGG A;  2QAR B;  2DKZ A;  3BQ7 A;  2F3N A;  2E8P A;  5JTI A;  1COK A;  2EAN A;  2YTU A;  2E8O A;  3SEI A;  4RQM A;  2EAO A;  2LPE A;  5KNI A;  5JRT A;  1X66 A;  4PZN A;  2EAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...