1UCVA

Sterile alpha motif (sam) domain of ephrin type-a receptor 8
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
GSSGSSGLTVGDWLDSIRMGRYRDHFAAGGYSSLGMVLRMNAQDVRALGITLMGHQKKILGSIQTMRAQLTSTQGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structure of Sterile alpha motif (SAM) domain of ephrin type-A receptor 8
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords EPHRIN TYPE-A RECEPTOR 8
total genus 18
structure length 81
sequence length 81
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2003-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1ucvA00
2EANA 3TADA 2EAOA 2E8MA 2GLEA 2K60A 3BS7A 2F3NA 5KNIA 1SV0C 2JV3A 1DXSA 2D8CA 1LKYB 1SV4A 1OXJA 2DL0A 1WWVA 1X66A 2E8OA 1SGGA 3TADC 3HILA 3BS5A 2EAMA 1X9XA 4PZOA 5L1MA 1RG6A 1KW4A 5JU5A 2QB1A 2LMRA 2B6GA 2QB0A 3H8MA 2KSOB 3BS5B 1UQVA 1V85A 2D3DA 3KKAA 5JRTA 2E8NA 2QB0B 5F3XB 3TACB 2EAPA 1COKA 4IS7A 3BQ7A 2KSOA 4MHVA 2KIVA 1JI7A 1B0XA 1SV0A 4PZNA 3KKAC 5J8YC 4RQMA 1WWUA 1SXDA 1Z1VA 5JTIA 2QARB 3IDWA 1UCVA 2K4PA 1OW5A 1X40A 2KMDA 2ESEA 1PK3A 4NL9C 2ES6A 2Y9UA 1V38A 2YTUA 2DKZA 4NJ8A 3K1RB 5J8YA 2LPEA 1LKYA 2KG5A 2L5YA 2F44A 2QKQA 4NL9A 1F0MA 3SEIA 1B4FA 4RQNA 1PK1A 3SENA 2F8KA 2QARA 1SXEA 2DKXA 2FE9A 2KE7A 2E8PA 2Y9TA 1PK1B
chains in the Genus database with same CATH superfamily
1WG8A 2C2DA 1QTMA 4PHPA 3BQ1A 3AQEA 3ZD8A 4OCZA 5HP4A 3RJFA 4YR0A 2BCQA 4DF8A 4DFDA 2R8IA 4P4OA 4FE3A 4DQQA 8ICJA 4OJOA 4U7CA 2G5IB 3QYPA 3ZDAA 1IM4A 1D8LA 5ALYA 3AU2A 1Z4NA 2EH9A 3MR5A 4F3OA 4KLGA 5DB8A 3MC1A 3RRHA 5J0UA 3QZ8A 2F1HA 9ICBA 1JMSA 3MFIA 2JEFA 2DQNB 3RBDA 2LMRA 4RQ3A 2BCUA 3UMGA 4UAWA 2ZXIA 4RQ4A 3C21A 2K4HA 4EEYA 1PVQA 1NZPA 4R8UA 2PI4A 2LYBA 3JPNA 3MBYA 3UQ0A 1ZD4A 4QIWF 2HSZA 5J2EA 4QZCA 2KSOA 3D2QA 9ICHA 4BUGA 4DLGA 5L1LA 1Z19A 3RR8A 1SV0A 3LDAA 4AP9A 4ECZA 2W54A 2W04A 4YMNA 3PV8A 4QW9A 4TQSA 7ICTA 1S8OA 4Y2XA 2F2AB 3M8RA 3O0FA 5ALZA 1X40A 1NZBA 2ESEA 2KMDA 3EZ5A 4UBBA 2YTUA 2KVSA 5AK5A 2XCPA 5KFKA 2IBKA 1BPBA 3N4MB 4DS4A 4IQWA 1LKYA 3PX4A 2K8CB 5EWEA 9ICKA 3H8JA 4Q44A 2ZIXB 3TADA 4DFJA 2EAOA 2JRZA 2HOQA 2PFQA 4KLQA 2VJ4A 3DV9A 5AIBA 4ECWA 2BQRA 1DK3A 4C4TA 1NOMA 2B21A 5KT2A 4I2CA 1DGSA 2PFNA 2ZIUB 5DKWA 4DL2A 1ZQ1C 1IXRA 1L3SA 4DSKA 4QWDA 1XSPA 1SL2A 2AQ4A 2RP5A 4Y2UA 3RRGA 5KFCA 4MFFA 2EAMA 4FS1A 1QSYA 2KZ3A 3ZDCA 9ICCA 2Z7JA 5ALDA 4F4YA 5KFFA 3CNHA 4K4HA 4YR3A 3MGIA 2MUTB 4UB6U 3ZDEA 4CF3A 4C8MA 4ED6A 4NM1A 3OJUA 4PH5A 4J9RA 3ZDBA 5KAFU 3QEBZ 2W03A 2WB1C 2DUYA 7ICKA 3PVXA 5F9LA 4Y2RA 3QE9Y 1ZQLA 3MABA 3BQTA 1U45A 2DFLA 1ED1A 4PL1A 5J2IA 3Q8RB 5JTIA 3RJGA 1AROP 4I29A 8ICSA 4C4SA 4LZDA 2H3FA 1PK3A 4CRXA 4F4ZA 1LVHA 3J81j 2ZIUA 1NK7A 4IQTA 2LM4A 2F44A 3QU4A 4O3OA 2OWOA 1NK8A 3JPPA 1JN3A 5AHXA 1PK1A 4DSLA 2F8KA 2V4QA 1L8LA 3PW2A 2FDRA 1RM6C 3IRUA 2GOLA 2QLTA 3TAQA 1MN8A 5KTQA 2E8MA 3Q8QB 5KFQA 3T5HA 3MR2A 4C7ZA 4PHDA 4PHAA 2VA8A 4KN4A 2IHMA 3PSFA 3T5LA 3PSTA 1M6YA 3M7DA 3M8SA 7ICUA 1ZRNA 4C8KA 1QQ5A 5AM3A 3HX0A 4F2RA 2AGQA 3UM9A 2XI9A 3VCBA 2R18A 3OHBA 4ED2A 2HCFA 5JU5A 5E79U 1C7YA 2JEIA 5HHIA 3KHRA 3ALRA 3WK6A 1A77A 3BS5B 2BZFA 4GXKA 5H2FU 4QZEA 2R8JA 4LZGA 3C5GA 2I1QA 1SL1A 5IIMA 4XRHA 2A1AA 8ICNA 8ICWA 4CF4A 2EAPA 3NRWA 5JUMA 4F71A 3QX7A 4EX6A 1UA1A 3T5KA 1MSWD 5J0QA 4F93B 1KDHA 1BPDA 3GFKB 2BPCA 4UB4A 1HIWA 2YB1A 3NRZA 3KHHA 2BDUA 4Y2SA 1BPXA 8ICXA 5KL8B 4QNLA 3ISDA 3AEVA 1SKWA 1RZTA 1FFVA 2KFNA 1LB2B 2LYAA 4Y2QA 9ICGA 3AQFA 2KP7A 5ALFA 4UATA 5ALHA 2ZG6A 5AM5A 2DKZA 1XO1A 5AI5A 2AGPA 5KFEA 7ICNA 3V7KA 3MR3A 4ECTA 3NGDA 2KK0A 4GFJA 5DB9A 3H4BA 5KT5A 5ALKA 1T3NA 5J0SA 3SENA 1ZQMA 2JEJA 2H3VA 5KFDA 4IR1A 4J9SA 5KT6A 5C5JA 3IG5A 4F92B 5J0OA 1CUKA 2NYVA 3F5AA 4BWJA 2W9MA 3CW2C 3H0LB 1ZQBA 2NRTA 4J9KA 3H8SA 2H3ZA 4E0DA 8ICPA 4BDPA 4O3QA 5J2CA 1SGGA 4DSFA 2JEGA 4M9JA 1COOA 3SMVA 1N62A 4LVSA 9ICTA 2XY7A 3C1ZA 1X9SA 4A8EA 2VKQA 4XA5A 2QB0A 5AM2A 4DQIA 2ZTCA 3SV3A 5KFAA 2ATLA 2OCEA 1F5SA 5GTIU 5KFUA 3T3FA 1TAMA 8ICFA 4Q43A 2E8NA 3RJKA 3G6XA 3TACB 3SAGA 4OJPA 4AYBC 1FFUA 4YN4A 2CN1A 2AXTU 2NO5A 4M6WB 4K4IA 2EDUA 2YQEA 4ELTA 4DL5A 4DLEA 4DO9A 3KOOA 2ZIXA 3JPOA 4DL7A 4MEXA 4EX7A 8ICKA 3H4DA 5J2BA 2Y0SF 2KIWA 3F5EA 5CRXA 2YB4A 5DLGA 3KHLA 1V38A 1K1QA 4NJ8A 5B5EU 2LPEA 2WF5A 3RB3A 4O3SA 4BWMA 3DEEA 7ICQA 5EE1A 8ICVA 9ICVA 5ALWA 2WF9A 2YMPA 3PX6A 2QARA 1L3UA 2FE9A 2JZBA 4BXOB 1UHUA 9ICWA 3LVVA 3N28A 3C29A 4M6WA 1L7MA 1HUZA 8ICQA 3PW7A 1Q3VA 2YN4A 4MF8A 5ALGA 4YP3A 5DBCA 3WK7A 7ICSA 3C23A 4DOBA 3D2SA 1RYUA 4R64A 5IIIA 3NVVA 4I27A 1ZQKA 3OPXA 3PSPA 2ZTEA 5KFIA 9ICIA 4UAZA 1T94A 4EYHB 1X6IA 1WCLA 4B9UA 1DOQA 1MQ2A 4B9LA 2J6SA 7ICLA 5L1JA 2G07A 2KHVA 5ALSA 2W55A 3MGHA 5IINA 4KLIA 2B0CA 4BXOA 1RQNA 1J2MA 2BDPA 2JH7A 1ECWA 5AKLA 1ZJMA 3RB6A 4I2AA 4JMUA 3MFHA 4B9NA 1B0XA 2WF6A 1ZQPA 3E0FA 4IQUA 2K4IA 4F5NA 1ZQTA 3HKZF 2FLPA 4RU9A 1JROA 3TQ1A 4PGYA 3WK9A 1OW5A 8ICCA 3RF9A 4DOAA 2AJQA 5KL1B 5D4BA 3VC8A 4UB3A 4IRKA 4UB8U 1S0OA 3K1RB 4DS5A 4QZBA 2AU0A 7ICMA 3ZI4A 3C2KA 3RB4A 1BNOA 4UAUA 4UB5A 2JZBB 4FO6A 2HBLA 1PVPA 2DKXA 2KZMA 2E8PA 1BPZA 3GIMA 1EXNA 3KZIU 1BPYA 1T7PA 1S5LU 4RUCA 3GDXA 4ED7A 1S9FA 2OXOA 3WKBA 2ZTDA 3IP4B 1DXSA 4RQ7A 1LKYB 2BR0A 1IV8A 2ASLA 3OHAA 2KJ5A 3R9KA 3UQ2A 2ISOA 4IL6U 4NM2A 4JB3A 5ALJA 1BNPA 3L5KA 4GC7A 4ED3A 2R8HA 1X66A 4YXMA 2UVRA 5AI6A 3LVWA 8ICHA 5KFSA 2XGQA 2F1IA 4J9QA 4O3RA 4RQ8A 1X9XA 4ZH4A 1NJXA 4OJ6A 5KT3A 3K1ZA 5AI8A 1ZXIA 1Y88A 9ICNA 4KX5A 3NS1A 4I2HA 4IRDA 2A3VA 5D49A 8ICZA 1UQVA 9ICXA 9ICPA 2W7PA 1QSLA 3GIJA 4J9PA 1S0NA 5KG4A 5BOLA 4KITB 3SI8A 2HHTA 1QH9A 4KMUA 5DQHA 2I6XA 1TK0A 3C5FA 4QZHA 7ICFA 4DCCA 5AKHA 2PXIA 4EENA 4CCHA 2AGOA 3NTUA 2FPMA 4I2EA 2C22A 1RXWA 2DPJA 3OSPA 1JXEA 3G6YA 5AKXA 4RNMA 3PMLA 5J0WA 9ICEA 4ICAA 1RXVA 4HAIA 4NLGA 3EYZA 1UPHA 4EELA 4TQRA 1V97A 2FLNA 1SXEA 3PNCA 1J2NA 3Q8MA 4XUSA 2KJ8A 3SAFA 4J9OA 1O08A 4F8RA 2JGAA 5ALTA 1ZD5A 3QU2A 4DF4A 1NK0A 4EZ9A 1N5XA 5CB1A 4RQ0A 2F8LA 2DL0A 5J2GA 2H3QA 1ZQCA 4P0QB 8ICAA 3K75D 3BJYA 2OYYA 4NWIA 2EZXA 3F2BA 3M9OB 2G06A 3TAPA 4PJ0U 4IR9A 4ECSA 5L1MA 5KG5A 5ALQA 4F50A 2C28A 1B22A 4NLKA 2FJ6A 4QZGA 1NKCA 5DQGA 3MDCA 3UPQA 4MF2A 4DL3A 1TK8A 2W9CA 2ZIWB 4R65A 3V6JA 2VIXA 4X5VA 2MU2A 2KD1A 4QW8A 3HP6A 4NXZA 1L3TA 1S76D 2LI6A 3KKAC 4RPZA 5EE0A 4PPXA 4PGQA 2W9BB 5KG1A 1P7DA 1NK9A 1PUZA 4BX9C 2G08A 2VJ5A 1ZQUA 5ALIA 4KLOA 8ICUA 2ODGA 3LK9A 2R8GA 4NL9C 4TUQA 4I2FA 3F2DA 3ISBA 5IIKA 4F4KA 5KFHA 1H38A 1HUOA 5J0YA 4DQPA 2XVTA 3UXOA 1F0MA 1DGJA 3QUBA 2WAQC 4J9MA 3PW4A 1TAQA 4O3NA 2E3TA 1ZJNA 4YFKA 4PL2A 4F91B 4YMOA 2ASDA 2Y9TA 2J6TA 2Y1IA 2EANA 1TKDA 1URJA 3UMBA 1XSNA 4DWIA 4QZDA 2HBJA 5AM4A 3KD3A 5KNIA 3EW9A 2NRXA 2ZIVB 3WKEA 5DDYA 2KJ9A 3H0MB 4WJ3B 2ISPA 1D9FA 4GXIA 3V7JA 1Z3EB 1A6SA 4J9LA 4KLFA 4QWCA 1ZQVA 4O3MA 2PFOA 1ZQSA 1XS9D 4P4PA 4YD1A 4RQ5A 3EPIA 8ICIA 3TI0A 2IMWP 3SV4A 4PZOA 3MR6A 3DDHA 5EE9A 1GO3F 2F1JA 1IIPA 2JH1A 3WK8A 5ALUA 4DL6A 4ED0A 4YR2A 5BOMA 1X2IA 4QZFA 2IOFA 1J97A 2KVCA 1V85A 2D3DA 4DQRA 2WF8A 2YX8A 5EWGA 1KBUA 4M04A 3OSNA 4QZAA 1ZQZA 1WYGA 5F3XB 3NUQA 4UAYA 2KIVA 1ZQFA 1JI7A 2JR5A 2VANA 4ECXA 1MA7A 4O3PA 2KNJA 1CI4A 3N7RC 4M47A 7ICGA 2ZUDA 3RJHA 4ELUA 2KHQA 1SB3C 3U26A 1UCVA 5KFWA 4M9NA 4R63A 3V6KA 2DGZA 1TK5A 2YY6A 3F53A 4JWNA 3T5JA 2KFZA 3RJEA 3N7SC 1FEZA 5KFMA 1JXLA 1RPLA 5DG9A 5IILA 2KKPA 2BQ3A 2KG5A 2L5YA 4P2HA 2EZZA 5ALXA 4M9LA 2I5HA 5AKZA 5J0RA 2BHNA 5HMLA 5DQIA 2HW3A 2BQUA 2D8CA 3NVYA 3RAXA 2ALZA 3RTVA 5J2JA 4GLXA 8ICTA 1KKXA 2DPIA 3FC4A 2FMPA 1HJPA 2CXYA 1N5WA 5A0LA 1ZQHA 1L6NA 1RDFA 3ZD9A 2RRDA 4UARA 1BVSA 5L1IA 3RH4A 1N56A 2IOFK 5HMMA 1F44A 2OHFA 1NKBA 4MFAA 7ICPA 2M0NA 1ZETA 4KX3A 2ZIWA 2UVWA 3AUOA 3AN1A 1SWVA 1N48A 4US8A 2HBKA 1ZD2P 5KFNA 3AL0B 2JMGA 4I2IA 5DBBA 1TAUA 1NK6A 3ONNA 4ECUA 4BGDA 3LYSA 2BGWA 3TANA 4GIBA 2VA2A 9ICOA 5J0XA 4ECYA 5CJ7A 5CWRA 5HR6A 2HOIA 1XWLA 2E5SA 3HJEA 4M9HA 1D8YA 3C2LA 4B9MA 1ZQWA 2KV2A 5L9XA 5J2FA 5AK3A 2XICA 2UVVA 2E1EA 3KZXA 2J6UA 2W43A 4B9SA 1NJZA 3JPTA 3Q8KA 4Y2TA 3B0XA 2GLEA 5J29A 1VDVA 5TZVA 1SV4A 3FYHA 4P4MA 1OXJA 1SIJA 5AI9A 4M2YA 3GILA 4F4WA 3IV6A 1WWVA 5ALNA 1X6JA 2WB1F 5KFOA 4Y2YA 4DL4A 3WKCA 1JALA 5DB7A 2F77X 5AKIA 3UMCA 4I2DA 1FIQA 4C8OA 5KG6A 4EBEA 4P0PB 1A0PA 5EOZA 3PMNA 2AQ0A 3M1YA 5DGAA 4M0AA 2FPLA 2XY6A 2PKEA 3H8MA 1KL9A 2GWSA 2P66A 4TUSA 3CYMA 5KFRA 2KICA 4RNNA 4Y2PA 1SWWA 4QZ9A 8ICOA 4YD2A 4QZIA 4MHVA 2GO7A 4FZLA 3QU5A 1UA0A 2WTFA 2OH2A 3HPOA 4O9MA 3PO5A 1L5UA 2PI5A 2EZYA 1MC8A 2HVHA 3EWAA 4JWMA 5T14A 1ZQGA 2AH5A 2IA6A 1SZPA 2KEYA 1KLNA 2MA1A 3ICXA 4CDGA 3Q8SB 4KLDA 1D8BA 3BQ0A 2LHTA 2W3SA 3SZ2A 2IHNA 3N97B 2Q4TA 3QUTA 4KLJA 2DWQA 5ALOA 7ICIA 1VLBA 5KG2A 4OD0A 1JUDA 3BZCA 3GIKA 1KFDA 2K8BB 3D2NA 2D6FC 4F2SA 2HMXA 5AIAA 3RR7A 2ZIVA 2CPRA 3L3FX 3V72A 3QEAZ 1X42A 3GV7B 2NRZA 3HT3A 3M9NB 5G5HA 2C2EA 4OO1J 3M6ZA 4RQ1A 7ICHA 4YMMA 4PGXA 1PVRA 4KTQA 5DDMA 4ECVA 2NV3A 5BPCA 1DRGA 3TADC 3WK4A 4P0QA 1TVAA 1QSSA 1ZQXA 2MUTA 2HBMA 3D6JA 2RDJA 3RH5A 1L7OA 1X9MA 2WFAA 5IIJA 3PX0A 1KTQA 1QCKA 3Q8PB 1ZQJA 3H8WA 4FZNA 3LWMA 3ISCA 4J9NA 2CRXA 3AM9A 3OTQA 9ICLA 3OGUA 3ETLA 2FMSA 3QUCA 2NRVA 1YZ6A 2BCSA 2P35A 2OM6A 1T3QA 4O5KA 3Q8LA 1WWUA 4RT2A 3TARA 2W9AA 9ICAA 1NKEA 1HEKA 5HR7A 2W9CB 4UB2A 2K4PA 3B9JA 5HNKA 3QXGA 2BPFA 4DFPA 3NVZA 1ZQIA 1L8OA 1Q8KA 5CR0A 3SAHA 4HYKA 3EPGA 1ZD3A 4OJLA 5J8YA 5KFZA 2ZUBA 1Q3UA 7ICVA 3F2CA 4UQGA 3CP8A 3N7PD 2H5XA 4DSJA 4MEYA 3SEIA 4F5PA 2ZXHA 4RQ2A 9ICQA 1UT8A 5KFGA 7ICRA 2A1JA 4DSEA 3MGVA 3UXNA 1QLNA 4CGZA 4UAVA 4QWEA 1SZHA 3SQIA 5AM1A 2K60A 2AHOB 5EWFA 2O6KA 5J2HA 3S6JA 1SV0C 5KFTA 4RZRA 1MQ3A 2HOFA 3JPQA 1U49A 2E1FA 2G09A 1KEJA 9ICUA 3GZFA 2XO7A 3QUQA 4G9BA 2XY5A 3GIIA 2RQ5A 2Y0SC 9ICFA 4KLUA 1ZQDA 4ELVA 2JHDA 9ICJA 2W11A 4DFMA 2H3IA 1KW4A 1KFSA 2Y1JA 3PSIA 2QB1A 4F5OA 4O5CA 1NK5A 2P6RA 2FI1A 1JX4A 4DOCA 3IG8A 3NVWA 4UW9A 7ICEA 2ZJ5A 1CEZA 1Q46A 4DQSA 5JRTA 3RH6A 4FFDA 4YVZA 4KLMA 3RJIA 2YMLA 4FBTA 5KFVA 5J2DA 1NNLA 1D9DA 1IG6A 5J8YC 1VJ5A 3RB0A 1T4GA 5AKEA 2QARB 1S0MA 2LM1A 2K89A 1KQQA 3UXPA 1T8EA 4YQWA 1S77D 2HHQA 2Y9UA 5C0YA 4NLNA 1XO0A 1ZQOA 2KZZA 3MDAA 2QKQA 3B0YA 4KLSA 3H40A 4RQNA 4RQ6A 4C80A 2ZJAA 4R8UB 4NV0A 5HHHA 5IIOA 1U47A 5KFJA 4KLHA 1XSLA 8ICLA 2HDOA 5B66U 2ZUCA 3K4GA 2V9WA 2XGPA 4ACOA 1C20A 5DG7A 2WF7A 2HHUA 1N60A 4B9VA 3TFSA 4MFCA 1V9PA 2FPKA 5KG0A 4KLTA 4G3IA 8ICGA 4I2GA 1KFTA 8ICYA 2KSOB 3HW8A 3SYZA 4ECRA 4TUPA 3V7LA 1ZOLA 1KSPA 1U48A 4JV1A 3AU6A 3EUB2 2W9BA 4PHEA 1S97A 4FS2A 5KFBA 4K4GA 4QWAA 4Z6CA 2PMZC 4PZNA 4ED8A 2RHFA 5CHGA 3WU2U 2YMMA 3RJJA 1ZQRA 2G5HB 5AK6A 4C8NA 1Z1VA 3PW0A 2A1JB 3ETRA 3KFUF 5AI0A 4JUZA 5CEHA 4CF5A 9ICSA 1U9LA 2K4EA 3I76A 3IHQB 3TKAA 5ALPA 5F9NA 2WAQF 3WKAA 3WK5A 4DFKA 2ES6A 4IQVA 5G5GA 5ALMA 3BDPA 1S10A 4XQ8A 2UVUA 2MRLA 2ZJ8A 5J2AA 1QQ7A 5TISU 4C0ZA 4U6PA 4KLEA 3ORYA 2VA3A 2P6UA 1S0VA 4QWBA 2W8LA 4NLZA 3RAQA 3FDSA 4RNOA 1SL0A 4Q8FA 3C1YA 3QU7A 1K1SA 5CP2A 4JK1A 4QIWC 3RFAA 1SKRA 5ALEA 2W8KA 1Z00B 1WCNA 5ALLA 1LV5A 4RPYA 2N1RA 2BCRA 2BPGA 3V6HA 3HILA 2BKEA 1KN5A 1RG6A 1ZQAA 2GH1A 3GV8B 4Z6EA 4EZ6A 5FP0A 2XIDA 2B6GA 5KAIU 3THVA 4B9TA 2RLTA 4I2JA 2JXJA 1B43A 3TFRA 3PZPA 2W3RA 1TE2A 4BJQA 1A76A 2KKVA 5DB6A 2QB0B 3NASA 5KFYA 1N63A 4R66A 2XC9A 5DLFA 1YZ7A 1Z1BA 4JV2A 4NY8A 1ZQYA 3E58A 2Q0ZX 2G0AA 2R8KA 4TURA 3GV5B 1L7PA 8ICRA 4CE6A 3IDWA 1NJYA 3JPRA 4OJ5A 3HKZC 3L4PA 2PFPA 4ZOHC 5KFXA 3G6VA 1JRPA 2EQYA 3SR6A 1N2XA 2LBOA 2LYHA 5KG3A 5L1KA 2KTQA 5AKJA 9ICRA 5AI4A 2KN7A 3GQCA 2XCAA 5KT7A 3C28A 1ZYQA 2KE7A 1PK1B 2WHEA 1X9WA 4IRCA 5AKGA 4F5RA 4Q8EA 2W7OA 4EYIB 2F3NA 3GU3A 4AYBF 2NO4A 2RDIA 3A0BU 2V4RA 4GC6A 2BCVA 5KG7A 2HI0A 4F4XA 2DBYA 3I1YA 4KMOB 2HHVA 1ZQQA 2PMZF 4M9GA 3KBBA 5GTHU 1U4BA 3BS5A 2MSNA 4QJFB 1NK4A 1FO4A 8ICBA 4Z6FA 1BPEA 3FAHA 3IM1A 9ICMA 1UT5A 4ED1A 4DEZA 2OEHA 1ZRMA 3PR4A 3CRXA 4C8LA 3ZDDA 4NLBA 5J2KA 4CNQA 3KKAA 2DF4B 2ASJA 3KTQA 3BQ2A 4B6JA 4FBUA 4UASA 1COKA 1N61A 2HHSA 1L7NA 1Z4OA 4NLCA 4C4RA 4O5EA 4DSIA 4I2BA 5EE3A 4US9A 3M9MB 1SKSA 3QNMA 4RQMA 1SXDA 5DGBA 3QZ7A 5K4LA 4QZ8A 1AQ6A 4USAA 1TV9A 3M6KA 7ICJA 1XNSA 4GXJA 4P0PA 3T79A 3WKDA 4YG2A 4KN7A 5AICA 2IOHA 3IN5A 4IC9A 3SD7A 1B4FA 4RPXA 7ICOA 2LKYA 2K8AA 1NJWA 3BZKA 4RUAA 2FMQA 4O0IA 1Z00A 2C2RA 4YXJA 3BS7A 4LJXA 1BGXT 2JV3A 3H0RB 5D46A 1RYSA 4EBDA 8ICMA 3JPSA 1RQLA 5KT4A 3KHGA 2M9NA 3PR5B 1JIHA 1K5OA 5AM0A 4EEKA 2HVIA 4I28A 4C7YA 4JV0A 1CRXA 1KRPA 1WUDA 1YT3A 5DG8A 2YMQA 3FM9A 2E8OA 4Y2VA 5J0PA 4Y2JA 5ALVA 4RT3A 4Z6DA 3AMZA 8ICEA 4J03A 3PY8A 2HHXA 1ZQNA 5ALRA 3LWLA 1L3VA 4EBCA 3RBEA 2NRWA 3HWTA 2MAXA 5AKKA 2F76X 4UB1A 1ZQEA 2KOBA 4YCXA 3QU9A 1XU4A 5J0TA 2FLLA 1QQ6A 4UBCA 4KLLA 4IS7A 3BQ7A 4F72A 1PZNA 1XC9A 4FZMA 1NI3A 3I28A 3PW5A 5KFPA 1TFRA 2HHWA 5DBAA 3E2EA 1O03A 5CA7A 1RYRA 3OJSA 5AKYA 5KFLA 4F5QA 3ED5A 3HRDD 2A19A 3A0HU 4ECQA 2I9GA 3H7IA 4NL9A 3PO4A 1OUQA 3C2MA 4Q45A 5AK4A 1DK2A
chains in the Genus database with same CATH topology
2EANA 3TADA 2EAOA 2E8MA 2GLEA 2K60A 3BS7A 2F3NA 5KNIA 1SV0C 2JV3A 1DXSA 2D8CA 1LKYB 1SV4A 1OXJA 2DL0A 1WWVA 1X66A 2E8OA 1SGGA 3TADC 3HILA 3BS5A 2EAMA 1X9XA 4PZOA 5L1MA 1RG6A 1KW4A 5JU5A 2QB1A 2LMRA 2B6GA 2QB0A 3H8MA 2KSOB 3BS5B 1UQVA 1V85A 2D3DA 3KKAA 5JRTA 2E8NA 2QB0B 5F3XB 3TACB 2EAPA 1COKA 4IS7A 3BQ7A 2KSOA 4MHVA 2KIVA 1JI7A 1B0XA 1SV0A 4PZNA 3KKAC 5J8YC 4RQMA 1WWUA 1SXDA 1Z1VA 5JTIA 2QARB 3IDWA 1UCVA 2K4PA 1OW5A 1X40A 2KMDA 2ESEA 1PK3A 4NL9C 2ES6A 2Y9UA 1V38A 2YTUA 2DKZA 4NJ8A 3K1RB 5J8YA 2LPEA 1LKYA 2KG5A 2L5YA 2F44A 2QKQA 4NL9A 1F0MA 3SEIA 1B4FA 4RQNA 1PK1A 3SENA 2F8KA 2QARA 1SXEA 2DKXA 2FE9A 2KE7A 2E8PA 2Y9TA 1PK1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EAN A;  3TAD A;  2EAO A;  2E8M A;  2GLE A;  2K60 A;  3BS7 A;  2F3N A;  5KNI A;  1SV0 C;  2JV3 A;  1DXS A;  2D8C A;  1LKY B;  1SV4 A;  1OXJ A;  2DL0 A;  1WWV A;  1X66 A;  2E8O A;  1SGG A;  3TAD C;  3HIL A;  3BS5 A;  2EAM A;  1X9X A;  4PZO A;  5L1M A;  1RG6 A;  1KW4 A;  5JU5 A;  2QB1 A;  2LMR A;  2B6G A;  2QB0 A;  3H8M A;  2KSO B;  3BS5 B;  1UQV A;  1V85 A;  2D3D A;  3KKA A;  5JRT A;  2E8N A;  2QB0 B;  5F3X B;  3TAC B;  2EAP A;  1COK A;  4IS7 A;  3BQ7 A;  2KSO A;  4MHV A;  2KIV A;  1JI7 A;  1B0X A;  1SV0 A;  4PZN A;  3KKA C;  5J8Y C;  4RQM A;  1WWU A;  1SXD A;  1Z1V A;  5JTI A;  2QAR B;  3IDW A;  1UCV A;  2K4P A;  1OW5 A;  1X40 A;  2KMD A;  2ESE A;  1PK3 A;  4NL9 C;  2ES6 A;  2Y9U A;  1V38 A;  2YTU A;  2DKZ A;  4NJ8 A;  3K1R B;  5J8Y A;  2LPE A;  1LKY A;  2KG5 A;  2L5Y A;  2F44 A;  2QKQ A;  4NL9 A;  1F0M A;  3SEI A;  1B4F A;  4RQN A;  1PK1 A;  3SEN A;  2F8K A;  2QAR A;  1SXE A;  2DKX A;  2FE9 A;  2KE7 A;  2E8P A;  2Y9T A;  1PK1 B; 
#chains in the Genus database with same CATH topology
 1WG8 A;  2C2D A;  1QTM A;  4PHP A;  3BQ1 A;  3AQE A;  3ZD8 A;  4OCZ A;  5HP4 A;  3RJF A;  4YR0 A;  2BCQ A;  4DF8 A;  4DFD A;  2R8I A;  4P4O A;  4FE3 A;  4DQQ A;  8ICJ A;  4OJO A;  4U7C A;  2G5I B;  3QYP A;  3ZDA A;  1IM4 A;  1D8L A;  5ALY A;  3AU2 A;  1Z4N A;  2EH9 A;  3MR5 A;  4F3O A;  4KLG A;  5DB8 A;  3MC1 A;  3RRH A;  5J0U A;  3QZ8 A;  2F1H A;  9ICB A;  1JMS A;  3MFI A;  2JEF A;  2DQN B;  3RBD A;  2LMR A;  4RQ3 A;  2BCU A;  3UMG A;  4UAW A;  2ZXI A;  4RQ4 A;  3C21 A;  2K4H A;  4EEY A;  1PVQ A;  1NZP A;  4R8U A;  2PI4 A;  2LYB A;  3JPN A;  3MBY A;  3UQ0 A;  1ZD4 A;  4QIW F;  2HSZ A;  5J2E A;  4QZC A;  2KSO A;  3D2Q A;  9ICH A;  4BUG A;  4DLG A;  5L1L A;  1Z19 A;  3RR8 A;  1SV0 A;  3LDA A;  4AP9 A;  4ECZ A;  2W54 A;  2W04 A;  4YMN A;  3PV8 A;  4QW9 A;  4TQS A;  7ICT A;  1S8O A;  4Y2X A;  2F2A B;  3M8R A;  3O0F A;  5ALZ A;  1X40 A;  1NZB A;  2ESE A;  2KMD A;  3EZ5 A;  4UBB A;  2YTU A;  2KVS A;  5AK5 A;  2XCP A;  5KFK A;  2IBK A;  1BPB A;  3N4M B;  4DS4 A;  4IQW A;  1LKY A;  3PX4 A;  2K8C B;  5EWE A;  9ICK A;  3H8J A;  4Q44 A;  2ZIX B;  3TAD A;  4DFJ A;  2EAO A;  2JRZ A;  2HOQ A;  2PFQ A;  4KLQ A;  2VJ4 A;  3DV9 A;  5AIB A;  4ECW A;  2BQR A;  1DK3 A;  4C4T A;  1NOM A;  2B21 A;  5KT2 A;  4I2C A;  1DGS A;  2PFN A;  2ZIU B;  5DKW A;  4DL2 A;  1ZQ1 C;  1IXR A;  1L3S A;  4DSK A;  4QWD A;  1XSP A;  1SL2 A;  2AQ4 A;  2RP5 A;  4Y2U A;  3RRG A;  5KFC A;  4MFF A;  2EAM A;  4FS1 A;  1QSY A;  2KZ3 A;  3ZDC A;  9ICC A;  2Z7J A;  5ALD A;  4F4Y A;  5KFF A;  3CNH A;  4K4H A;  4YR3 A;  3MGI A;  2MUT B;  4UB6 U;  3ZDE A;  4CF3 A;  4C8M A;  4ED6 A;  4NM1 A;  3OJU A;  4PH5 A;  4J9R A;  3ZDB A;  5KAF U;  3QEB Z;  2W03 A;  2WB1 C;  2DUY A;  7ICK A;  3PVX A;  5F9L A;  4Y2R A;  3QE9 Y;  1ZQL A;  3MAB A;  3BQT A;  1U45 A;  2DFL A;  1ED1 A;  4PL1 A;  5J2I A;  3Q8R B;  5JTI A;  3RJG A;  1ARO P;  4I29 A;  8ICS A;  4C4S A;  4LZD A;  2H3F A;  1PK3 A;  4CRX A;  4F4Z A;  1LVH A;  3J81 j;  2ZIU A;  1NK7 A;  4IQT A;  2LM4 A;  2F44 A;  3QU4 A;  4O3O A;  2OWO A;  1NK8 A;  3JPP A;  1JN3 A;  5AHX A;  1PK1 A;  4DSL A;  2F8K A;  2V4Q A;  1L8L A;  3PW2 A;  2FDR A;  1RM6 C;  3IRU A;  2GOL A;  2QLT A;  3TAQ A;  1MN8 A;  5KTQ A;  2E8M A;  3Q8Q B;  5KFQ A;  3T5H A;  3MR2 A;  4C7Z A;  4PHD A;  4PHA A;  2VA8 A;  4KN4 A;  2IHM A;  3PSF A;  3T5L A;  3PST A;  1M6Y A;  3M7D A;  3M8S A;  7ICU A;  1ZRN A;  4C8K A;  1QQ5 A;  5AM3 A;  3HX0 A;  4F2R A;  2AGQ A;  3UM9 A;  2XI9 A;  3VCB A;  2R18 A;  3OHB A;  4ED2 A;  2HCF A;  5JU5 A;  5E79 U;  1C7Y A;  2JEI A;  5HHI A;  3KHR A;  3ALR A;  3WK6 A;  1A77 A;  3BS5 B;  2BZF A;  4GXK A;  5H2F U;  4QZE A;  2R8J A;  4LZG A;  3C5G A;  2I1Q A;  1SL1 A;  5IIM A;  4XRH A;  2A1A A;  8ICN A;  8ICW A;  4CF4 A;  2EAP A;  3NRW A;  5JUM A;  4F71 A;  3QX7 A;  4EX6 A;  1UA1 A;  3T5K A;  1MSW D;  5J0Q A;  4F93 B;  1KDH A;  1BPD A;  3GFK B;  2BPC A;  4UB4 A;  1HIW A;  2YB1 A;  3NRZ A;  3KHH A;  2BDU A;  4Y2S A;  1BPX A;  8ICX A;  5KL8 B;  4QNL A;  3ISD A;  3AEV A;  1SKW A;  1RZT A;  1FFV A;  2KFN A;  1LB2 B;  2LYA A;  4Y2Q A;  9ICG A;  3AQF A;  2KP7 A;  5ALF A;  4UAT A;  5ALH A;  2ZG6 A;  5AM5 A;  2DKZ A;  1XO1 A;  5AI5 A;  2AGP A;  5KFE A;  7ICN A;  3V7K A;  3MR3 A;  4ECT A;  3NGD A;  2KK0 A;  4GFJ A;  5DB9 A;  3H4B A;  5KT5 A;  5ALK A;  1T3N A;  5J0S A;  3SEN A;  1ZQM A;  2JEJ A;  2H3V A;  5KFD A;  4IR1 A;  4J9S A;  5KT6 A;  5C5J A;  3IG5 A;  4F92 B;  5J0O A;  1CUK A;  2NYV A;  3F5A A;  4BWJ A;  2W9M A;  3CW2 C;  3H0L B;  1ZQB A;  2NRT A;  4J9K A;  3H8S A;  2H3Z A;  4E0D A;  8ICP A;  4BDP A;  4O3Q A;  5J2C A;  1SGG A;  4DSF A;  2JEG A;  4M9J A;  1COO A;  3SMV A;  1N62 A;  4LVS A;  9ICT A;  2XY7 A;  3C1Z A;  1X9S A;  4A8E A;  2VKQ A;  4XA5 A;  2QB0 A;  5AM2 A;  4DQI A;  2ZTC A;  3SV3 A;  5KFA A;  2ATL A;  2OCE A;  1F5S A;  5GTI U;  5KFU A;  3T3F A;  1TAM A;  8ICF A;  4Q43 A;  2E8N A;  3RJK A;  3G6X A;  3TAC B;  3SAG A;  4OJP A;  4AYB C;  1FFU A;  4YN4 A;  2CN1 A;  2AXT U;  2NO5 A;  4M6W B;  4K4I A;  2EDU A;  2YQE A;  4ELT A;  4DL5 A;  4DLE A;  4DO9 A;  3KOO A;  2ZIX A;  3JPO A;  4DL7 A;  4MEX A;  4EX7 A;  8ICK A;  3H4D A;  5J2B A;  2Y0S F;  2KIW A;  3F5E A;  5CRX A;  2YB4 A;  5DLG A;  3KHL A;  1V38 A;  1K1Q A;  4NJ8 A;  5B5E U;  2LPE A;  2WF5 A;  3RB3 A;  4O3S A;  4BWM A;  3DEE A;  7ICQ A;  5EE1 A;  8ICV A;  9ICV A;  5ALW A;  2WF9 A;  2YMP A;  3PX6 A;  2QAR A;  1L3U A;  2FE9 A;  2JZB A;  4BXO B;  1UHU A;  9ICW A;  3LVV A;  3N28 A;  3C29 A;  4M6W A;  1L7M A;  1HUZ A;  8ICQ A;  3PW7 A;  1Q3V A;  2YN4 A;  4MF8 A;  5ALG A;  4YP3 A;  5DBC A;  3WK7 A;  7ICS A;  3C23 A;  4DOB A;  3D2S A;  1RYU A;  4R64 A;  5III A;  3NVV A;  4I27 A;  1ZQK A;  3OPX A;  3PSP A;  2ZTE A;  5KFI A;  9ICI A;  4UAZ A;  1T94 A;  4EYH B;  1X6I A;  1WCL A;  4B9U A;  1DOQ A;  1MQ2 A;  4B9L A;  2J6S A;  7ICL A;  5L1J A;  2G07 A;  2KHV A;  5ALS A;  2W55 A;  3MGH A;  5IIN A;  4KLI A;  2B0C A;  4BXO A;  1RQN A;  1J2M A;  2BDP A;  2JH7 A;  1ECW A;  5AKL A;  1ZJM A;  3RB6 A;  4I2A A;  4JMU A;  3MFH A;  4B9N A;  1B0X A;  2WF6 A;  1ZQP A;  3E0F A;  4IQU A;  2K4I A;  4F5N A;  1ZQT A;  3HKZ F;  2FLP A;  4RU9 A;  1JRO A;  3TQ1 A;  4PGY A;  3WK9 A;  1OW5 A;  8ICC A;  3RF9 A;  4DOA A;  2AJQ A;  5KL1 B;  5D4B A;  3VC8 A;  4UB3 A;  4IRK A;  4UB8 U;  1S0O A;  3K1R B;  4DS5 A;  4QZB A;  2AU0 A;  7ICM A;  3ZI4 A;  3C2K A;  3RB4 A;  1BNO A;  4UAU A;  4UB5 A;  2JZB B;  4FO6 A;  2HBL A;  1PVP A;  2DKX A;  2KZM A;  2E8P A;  1BPZ A;  3GIM A;  1EXN A;  3KZI U;  1BPY A;  1T7P A;  1S5L U;  4RUC A;  3GDX A;  4ED7 A;  1S9F A;  2OXO A;  3WKB A;  2ZTD A;  3IP4 B;  1DXS A;  4RQ7 A;  1LKY B;  2BR0 A;  1IV8 A;  2ASL A;  3OHA A;  2KJ5 A;  3R9K A;  3UQ2 A;  2ISO A;  4IL6 U;  4NM2 A;  4JB3 A;  5ALJ A;  1BNP A;  3L5K A;  4GC7 A;  4ED3 A;  2R8H A;  1X66 A;  4YXM A;  2UVR A;  5AI6 A;  3LVW A;  8ICH A;  5KFS A;  2XGQ A;  2F1I A;  4J9Q A;  4O3R A;  4RQ8 A;  1X9X A;  4ZH4 A;  1NJX A;  4OJ6 A;  5KT3 A;  3K1Z A;  5AI8 A;  1ZXI A;  1Y88 A;  9ICN A;  4KX5 A;  3NS1 A;  4I2H A;  4IRD A;  2A3V A;  5D49 A;  8ICZ A;  1UQV A;  9ICX A;  9ICP A;  2W7P A;  1QSL A;  3GIJ A;  4J9P A;  1S0N A;  5KG4 A;  5BOL A;  4KIT B;  3SI8 A;  2HHT A;  1QH9 A;  4KMU A;  5DQH A;  2I6X A;  1TK0 A;  3C5F A;  4QZH A;  7ICF A;  4DCC A;  5AKH A;  2PXI A;  4EEN A;  4CCH A;  2AGO A;  3NTU A;  2FPM A;  4I2E A;  2C22 A;  1RXW A;  2DPJ A;  3OSP A;  1JXE A;  3G6Y A;  5AKX A;  4RNM A;  3PML A;  5J0W A;  9ICE A;  4ICA A;  1RXV A;  4HAI A;  4NLG A;  3EYZ A;  1UPH A;  4EEL A;  4TQR A;  1V97 A;  2FLN A;  1SXE A;  3PNC A;  1J2N A;  3Q8M A;  4XUS A;  2KJ8 A;  3SAF A;  4J9O A;  1O08 A;  4F8R A;  2JGA A;  5ALT A;  1ZD5 A;  3QU2 A;  4DF4 A;  1NK0 A;  4EZ9 A;  1N5X A;  5CB1 A;  4RQ0 A;  2F8L A;  2DL0 A;  5J2G A;  2H3Q A;  1ZQC A;  4P0Q B;  8ICA A;  3K75 D;  3BJY A;  2OYY A;  4NWI A;  2EZX A;  3F2B A;  3M9O B;  2G06 A;  3TAP A;  4PJ0 U;  4IR9 A;  4ECS A;  5L1M A;  5KG5 A;  5ALQ A;  4F50 A;  2C28 A;  1B22 A;  4NLK A;  2FJ6 A;  4QZG A;  1NKC A;  5DQG A;  3MDC A;  3UPQ A;  4MF2 A;  4DL3 A;  1TK8 A;  2W9C A;  2ZIW B;  4R65 A;  3V6J A;  2VIX A;  4X5V A;  2MU2 A;  2KD1 A;  4QW8 A;  3HP6 A;  4NXZ A;  1L3T A;  1S76 D;  2LI6 A;  3KKA C;  4RPZ A;  5EE0 A;  4PPX A;  4PGQ A;  2W9B B;  5KG1 A;  1P7D A;  1NK9 A;  1PUZ A;  4BX9 C;  2G08 A;  2VJ5 A;  1ZQU A;  5ALI A;  4KLO A;  8ICU A;  2ODG A;  3LK9 A;  2R8G A;  4NL9 C;  4TUQ A;  4I2F A;  3F2D A;  3ISB A;  5IIK A;  4F4K A;  5KFH A;  1H38 A;  1HUO A;  5J0Y A;  4DQP A;  2XVT A;  3UXO A;  1F0M A;  1DGJ A;  3QUB A;  2WAQ C;  4J9M A;  3PW4 A;  1TAQ A;  4O3N A;  2E3T A;  1ZJN A;  4YFK A;  4PL2 A;  4F91 B;  4YMO A;  2ASD A;  2Y9T A;  2J6T A;  2Y1I A;  2EAN A;  1TKD A;  1URJ A;  3UMB A;  1XSN A;  4DWI A;  4QZD A;  2HBJ A;  5AM4 A;  3KD3 A;  5KNI A;  3EW9 A;  2NRX A;  2ZIV B;  3WKE A;  5DDY A;  2KJ9 A;  3H0M B;  4WJ3 B;  2ISP A;  1D9F A;  4GXI A;  3V7J A;  1Z3E B;  1A6S A;  4J9L A;  4KLF A;  4QWC A;  1ZQV A;  4O3M A;  2PFO A;  1ZQS A;  1XS9 D;  4P4P A;  4YD1 A;  4RQ5 A;  3EPI A;  8ICI A;  3TI0 A;  2IMW P;  3SV4 A;  4PZO A;  3MR6 A;  3DDH A;  5EE9 A;  1GO3 F;  2F1J A;  1IIP A;  2JH1 A;  3WK8 A;  5ALU A;  4DL6 A;  4ED0 A;  4YR2 A;  5BOM A;  1X2I A;  4QZF A;  2IOF A;  1J97 A;  2KVC A;  1V85 A;  2D3D A;  4DQR A;  2WF8 A;  2YX8 A;  5EWG A;  1KBU A;  4M04 A;  3OSN A;  4QZA A;  1ZQZ A;  1WYG A;  5F3X B;  3NUQ A;  4UAY A;  2KIV A;  1ZQF A;  1JI7 A;  2JR5 A;  2VAN A;  4ECX A;  1MA7 A;  4O3P A;  2KNJ A;  1CI4 A;  3N7R C;  4M47 A;  7ICG A;  2ZUD A;  3RJH A;  4ELU A;  2KHQ A;  1SB3 C;  3U26 A;  1UCV A;  5KFW A;  4M9N A;  4R63 A;  3V6K A;  2DGZ A;  1TK5 A;  2YY6 A;  3F53 A;  4JWN A;  3T5J A;  2KFZ A;  3RJE A;  3N7S C;  1FEZ A;  5KFM A;  1JXL A;  1RPL A;  5DG9 A;  5IIL A;  2KKP A;  2BQ3 A;  2KG5 A;  2L5Y A;  4P2H A;  2EZZ A;  5ALX A;  4M9L A;  2I5H A;  5AKZ A;  5J0R A;  2BHN A;  5HML A;  5DQI A;  2HW3 A;  2BQU A;  2D8C A;  3NVY A;  3RAX A;  2ALZ A;  3RTV A;  5J2J A;  4GLX A;  8ICT A;  1KKX A;  2DPI A;  3FC4 A;  2FMP A;  1HJP A;  2CXY A;  1N5W A;  5A0L A;  1ZQH A;  1L6N A;  1RDF A;  3ZD9 A;  2RRD A;  4UAR A;  1BVS A;  5L1I A;  3RH4 A;  1N56 A;  2IOF K;  5HMM A;  1F44 A;  2OHF A;  1NKB A;  4MFA A;  7ICP A;  2M0N A;  1ZET A;  4KX3 A;  2ZIW A;  2UVW A;  3AUO A;  3AN1 A;  1SWV A;  1N48 A;  4US8 A;  2HBK A;  1ZD2 P;  5KFN A;  3AL0 B;  2JMG A;  4I2I A;  5DBB A;  1TAU A;  1NK6 A;  3ONN A;  4ECU A;  4BGD A;  3LYS A;  2BGW A;  3TAN A;  4GIB A;  2VA2 A;  9ICO A;  5J0X A;  4ECY A;  5CJ7 A;  5CWR A;  5HR6 A;  2HOI A;  1XWL A;  2E5S A;  3HJE A;  4M9H A;  1D8Y A;  3C2L A;  4B9M A;  1ZQW A;  2KV2 A;  5L9X A;  5J2F A;  5AK3 A;  2XIC A;  2UVV A;  2E1E A;  3KZX A;  2J6U A;  2W43 A;  4B9S A;  1NJZ A;  3JPT A;  3Q8K A;  4Y2T A;  3B0X A;  2GLE A;  5J29 A;  1VDV A;  5TZV A;  1SV4 A;  3FYH A;  4P4M A;  1OXJ A;  1SIJ A;  5AI9 A;  4M2Y A;  3GIL A;  4F4W A;  3IV6 A;  1WWV A;  5ALN A;  1X6J A;  2WB1 F;  5KFO A;  4Y2Y A;  4DL4 A;  3WKC A;  1JAL A;  5DB7 A;  2F77 X;  5AKI A;  3UMC A;  4I2D A;  1FIQ A;  4C8O A;  5KG6 A;  4EBE A;  4P0P B;  1A0P A;  5EOZ A;  3PMN A;  2AQ0 A;  3M1Y A;  5DGA A;  4M0A A;  2FPL A;  2XY6 A;  2PKE A;  3H8M A;  1KL9 A;  2GWS A;  2P66 A;  4TUS A;  3CYM A;  5KFR A;  2KIC A;  4RNN A;  4Y2P A;  1SWW A;  4QZ9 A;  8ICO A;  4YD2 A;  4QZI A;  4MHV A;  2GO7 A;  4FZL A;  3QU5 A;  1UA0 A;  2WTF A;  2OH2 A;  3HPO A;  4O9M A;  3PO5 A;  1L5U A;  2PI5 A;  2EZY A;  1MC8 A;  2HVH A;  3EWA A;  4JWM A;  5T14 A;  1ZQG A;  2AH5 A;  2IA6 A;  1SZP A;  2KEY A;  1KLN A;  2MA1 A;  3ICX A;  4CDG A;  3Q8S B;  4KLD A;  1D8B A;  3BQ0 A;  2LHT A;  2W3S A;  3SZ2 A;  2IHN A;  3N97 B;  2Q4T A;  3QUT A;  4KLJ A;  2DWQ A;  5ALO A;  7ICI A;  1VLB A;  5KG2 A;  4OD0 A;  1JUD A;  3BZC A;  3GIK A;  1KFD A;  2K8B B;  3D2N A;  2D6F C;  4F2S A;  2HMX A;  5AIA A;  3RR7 A;  2ZIV A;  2CPR A;  3L3F X;  3V72 A;  3QEA Z;  1X42 A;  3GV7 B;  2NRZ A;  3HT3 A;  3M9N B;  5G5H A;  2C2E A;  4OO1 J;  3M6Z A;  4RQ1 A;  7ICH A;  4YMM A;  4PGX A;  1PVR A;  4KTQ A;  5DDM A;  4ECV A;  2NV3 A;  5BPC A;  1DRG A;  3TAD C;  3WK4 A;  4P0Q A;  1TVA A;  1QSS A;  1ZQX A;  2MUT A;  2HBM A;  3D6J A;  2RDJ A;  3RH5 A;  1L7O A;  1X9M A;  2WFA A;  5IIJ A;  3PX0 A;  1KTQ A;  1QCK A;  3Q8P B;  1ZQJ A;  3H8W A;  4FZN A;  3LWM A;  3ISC A;  4J9N A;  2CRX A;  3AM9 A;  3OTQ A;  9ICL A;  3OGU A;  3ETL A;  2FMS A;  3QUC A;  2NRV A;  1YZ6 A;  2BCS A;  2P35 A;  2OM6 A;  1T3Q A;  4O5K A;  3Q8L A;  1WWU A;  4RT2 A;  3TAR A;  2W9A A;  9ICA A;  1NKE A;  1HEK A;  5HR7 A;  2W9C B;  4UB2 A;  2K4P A;  3B9J A;  5HNK A;  3QXG A;  2BPF A;  4DFP A;  3NVZ A;  1ZQI A;  1L8O A;  1Q8K A;  5CR0 A;  3SAH A;  4HYK A;  3EPG A;  1ZD3 A;  4OJL A;  5J8Y A;  5KFZ A;  2ZUB A;  1Q3U A;  7ICV A;  3F2C A;  4UQG A;  3CP8 A;  3N7P D;  2H5X A;  4DSJ A;  4MEY A;  3SEI A;  4F5P A;  2ZXH A;  4RQ2 A;  9ICQ A;  1UT8 A;  5KFG A;  7ICR A;  2A1J A;  4DSE A;  3MGV A;  3UXN A;  1QLN A;  4CGZ A;  4UAV A;  4QWE A;  1SZH A;  3SQI A;  5AM1 A;  2K60 A;  2AHO B;  5EWF A;  2O6K A;  5J2H A;  3S6J A;  1SV0 C;  5KFT A;  4RZR A;  1MQ3 A;  2HOF A;  3JPQ A;  1U49 A;  2E1F A;  2G09 A;  1KEJ A;  9ICU A;  3GZF A;  2XO7 A;  3QUQ A;  4G9B A;  2XY5 A;  3GII A;  2RQ5 A;  2Y0S C;  9ICF A;  4KLU A;  1ZQD A;  4ELV A;  2JHD A;  9ICJ A;  2W11 A;  4DFM A;  2H3I A;  1KW4 A;  1KFS A;  2Y1J A;  3PSI A;  2QB1 A;  4F5O A;  4O5C A;  1NK5 A;  2P6R A;  2FI1 A;  1JX4 A;  4DOC A;  3IG8 A;  3NVW A;  4UW9 A;  7ICE A;  2ZJ5 A;  1CEZ A;  1Q46 A;  4DQS A;  5JRT A;  3RH6 A;  4FFD A;  4YVZ A;  4KLM A;  3RJI A;  2YML A;  4FBT A;  5KFV A;  5J2D A;  1NNL A;  1D9D A;  1IG6 A;  5J8Y C;  1VJ5 A;  3RB0 A;  1T4G A;  5AKE A;  2QAR B;  1S0M A;  2LM1 A;  2K89 A;  1KQQ A;  3UXP A;  1T8E A;  4YQW A;  1S77 D;  2HHQ A;  2Y9U A;  5C0Y A;  4NLN A;  1XO0 A;  1ZQO A;  2KZZ A;  3MDA A;  2QKQ A;  3B0Y A;  4KLS A;  3H40 A;  4RQN A;  4RQ6 A;  4C80 A;  2ZJA A;  4R8U B;  4NV0 A;  5HHH A;  5IIO A;  1U47 A;  5KFJ A;  4KLH A;  1XSL A;  8ICL A;  2HDO A;  5B66 U;  2ZUC A;  3K4G A;  2V9W A;  2XGP A;  4ACO A;  1C20 A;  5DG7 A;  2WF7 A;  2HHU A;  1N60 A;  4B9V A;  3TFS A;  4MFC A;  1V9P A;  2FPK A;  5KG0 A;  4KLT A;  4G3I A;  8ICG A;  4I2G A;  1KFT A;  8ICY A;  2KSO B;  3HW8 A;  3SYZ A;  4ECR A;  4TUP A;  3V7L A;  1ZOL A;  1KSP A;  1U48 A;  4JV1 A;  3AU6 A;  3EUB 2;  2W9B A;  4PHE A;  1S97 A;  4FS2 A;  5KFB A;  4K4G A;  4QWA A;  4Z6C A;  2PMZ C;  4PZN A;  4ED8 A;  2RHF A;  5CHG A;  3WU2 U;  2YMM A;  3RJJ A;  1ZQR A;  2G5H B;  5AK6 A;  4C8N A;  1Z1V A;  3PW0 A;  2A1J B;  3ETR A;  3KFU F;  5AI0 A;  4JUZ A;  5CEH A;  4CF5 A;  9ICS A;  1U9L A;  2K4E A;  3I76 A;  3IHQ B;  3TKA A;  5ALP A;  5F9N A;  2WAQ F;  3WKA A;  3WK5 A;  4DFK A;  2ES6 A;  4IQV A;  5G5G A;  5ALM A;  3BDP A;  1S10 A;  4XQ8 A;  2UVU A;  2MRL A;  2ZJ8 A;  5J2A A;  1QQ7 A;  5TIS U;  4C0Z A;  4U6P A;  4KLE A;  3ORY A;  2VA3 A;  2P6U A;  1S0V A;  4QWB A;  2W8L A;  4NLZ A;  3RAQ A;  3FDS A;  4RNO A;  1SL0 A;  4Q8F A;  3C1Y A;  3QU7 A;  1K1S A;  5CP2 A;  4JK1 A;  4QIW C;  3RFA A;  1SKR A;  5ALE A;  2W8K A;  1Z00 B;  1WCN A;  5ALL A;  1LV5 A;  4RPY A;  2N1R A;  2BCR A;  2BPG A;  3V6H A;  3HIL A;  2BKE A;  1KN5 A;  1RG6 A;  1ZQA A;  2GH1 A;  3GV8 B;  4Z6E A;  4EZ6 A;  5FP0 A;  2XID A;  2B6G A;  5KAI U;  3THV A;  4B9T A;  2RLT A;  4I2J A;  2JXJ A;  1B43 A;  3TFR A;  3PZP A;  2W3R A;  1TE2 A;  4BJQ A;  1A76 A;  2KKV A;  5DB6 A;  2QB0 B;  3NAS A;  5KFY A;  1N63 A;  4R66 A;  2XC9 A;  5DLF A;  1YZ7 A;  1Z1B A;  4JV2 A;  4NY8 A;  1ZQY A;  3E58 A;  2Q0Z X;  2G0A A;  2R8K A;  4TUR A;  3GV5 B;  1L7P A;  8ICR A;  4CE6 A;  3IDW A;  1NJY A;  3JPR A;  4OJ5 A;  3HKZ C;  3L4P A;  2PFP A;  4ZOH C;  5KFX A;  3G6V A;  1JRP A;  2EQY A;  3SR6 A;  1N2X A;  2LBO A;  2LYH A;  5KG3 A;  5L1K A;  2KTQ A;  5AKJ A;  9ICR A;  5AI4 A;  2KN7 A;  3GQC A;  2XCA A;  5KT7 A;  3C28 A;  1ZYQ A;  2KE7 A;  1PK1 B;  2WHE A;  1X9W A;  4IRC A;  5AKG A;  4F5R A;  4Q8E A;  2W7O A;  4EYI B;  2F3N A;  3GU3 A;  4AYB F;  2NO4 A;  2RDI A;  3A0B U;  2V4R A;  4GC6 A;  2BCV A;  5KG7 A;  2HI0 A;  4F4X A;  2DBY A;  3I1Y A;  4KMO B;  2HHV A;  1ZQQ A;  2PMZ F;  4M9G A;  3KBB A;  5GTH U;  1U4B A;  3BS5 A;  2MSN A;  4QJF B;  1NK4 A;  1FO4 A;  8ICB A;  4Z6F A;  1BPE A;  3FAH A;  3IM1 A;  9ICM A;  1UT5 A;  4ED1 A;  4DEZ A;  2OEH A;  1ZRM A;  3PR4 A;  3CRX A;  4C8L A;  3ZDD A;  4NLB A;  5J2K A;  4CNQ A;  3KKA A;  2DF4 B;  2ASJ A;  3KTQ A;  3BQ2 A;  4B6J A;  4FBU A;  4UAS A;  1COK A;  1N61 A;  2HHS A;  1L7N A;  1Z4O A;  4NLC A;  4C4R A;  4O5E A;  4DSI A;  4I2B A;  5EE3 A;  4US9 A;  3M9M B;  1SKS A;  3QNM A;  4RQM A;  1SXD A;  5DGB A;  3QZ7 A;  5K4L A;  4QZ8 A;  1AQ6 A;  4USA A;  1TV9 A;  3M6K A;  7ICJ A;  1XNS A;  4GXJ A;  4P0P A;  3T79 A;  3WKD A;  4YG2 A;  4KN7 A;  5AIC A;  2IOH A;  3IN5 A;  4IC9 A;  3SD7 A;  1B4F A;  4RPX A;  7ICO A;  2LKY A;  2K8A A;  1NJW A;  3BZK A;  4RUA A;  2FMQ A;  4O0I A;  1Z00 A;  2C2R A;  4YXJ A;  3BS7 A;  4LJX A;  1BGX T;  2JV3 A;  3H0R B;  5D46 A;  1RYS A;  4EBD A;  8ICM A;  3JPS A;  1RQL A;  5KT4 A;  3KHG A;  2M9N A;  3PR5 B;  1JIH A;  1K5O A;  5AM0 A;  4EEK A;  2HVI A;  4I28 A;  4C7Y A;  4JV0 A;  1CRX A;  1KRP A;  1WUD A;  1YT3 A;  5DG8 A;  2YMQ A;  3FM9 A;  2E8O A;  4Y2V A;  5J0P A;  4Y2J A;  5ALV A;  4RT3 A;  4Z6D A;  3AMZ A;  8ICE A;  4J03 A;  3PY8 A;  2HHX A;  1ZQN A;  5ALR A;  3LWL A;  1L3V A;  4EBC A;  3RBE A;  2NRW A;  3HWT A;  2MAX A;  5AKK A;  2F76 X;  4UB1 A;  1ZQE A;  2KOB A;  4YCX A;  3QU9 A;  1XU4 A;  5J0T A;  2FLL A;  1QQ6 A;  4UBC A;  4KLL A;  4IS7 A;  3BQ7 A;  4F72 A;  1PZN A;  1XC9 A;  4FZM A;  1NI3 A;  3I28 A;  3PW5 A;  5KFP A;  1TFR A;  2HHW A;  5DBA A;  3E2E A;  1O03 A;  5CA7 A;  1RYR A;  3OJS A;  5AKY A;  5KFL A;  4F5Q A;  3ED5 A;  3HRD D;  2A19 A;  3A0H U;  4ECQ A;  2I9G A;  3H7I A;  4NL9 A;  3PO4 A;  1OUQ A;  3C2M A;  4Q45 A;  5AK4 A;  1DK2 A; 
#chains in the Genus database with same CATH homology
 2EAN A;  3TAD A;  2EAO A;  2E8M A;  2GLE A;  2K60 A;  3BS7 A;  2F3N A;  5KNI A;  1SV0 C;  2JV3 A;  1DXS A;  2D8C A;  1LKY B;  1SV4 A;  1OXJ A;  2DL0 A;  1WWV A;  1X66 A;  2E8O A;  1SGG A;  3TAD C;  3HIL A;  3BS5 A;  2EAM A;  1X9X A;  4PZO A;  5L1M A;  1RG6 A;  1KW4 A;  5JU5 A;  2QB1 A;  2LMR A;  2B6G A;  2QB0 A;  3H8M A;  2KSO B;  3BS5 B;  1UQV A;  1V85 A;  2D3D A;  3KKA A;  5JRT A;  2E8N A;  2QB0 B;  5F3X B;  3TAC B;  2EAP A;  1COK A;  4IS7 A;  3BQ7 A;  2KSO A;  4MHV A;  2KIV A;  1JI7 A;  1B0X A;  1SV0 A;  4PZN A;  3KKA C;  5J8Y C;  4RQM A;  1WWU A;  1SXD A;  1Z1V A;  5JTI A;  2QAR B;  3IDW A;  1UCV A;  2K4P A;  1OW5 A;  1X40 A;  2KMD A;  2ESE A;  1PK3 A;  4NL9 C;  2ES6 A;  2Y9U A;  1V38 A;  2YTU A;  2DKZ A;  4NJ8 A;  3K1R B;  5J8Y A;  2LPE A;  1LKY A;  2KG5 A;  2L5Y A;  2F44 A;  2QKQ A;  4NL9 A;  1F0M A;  3SEI A;  1B4F A;  4RQN A;  1PK1 A;  3SEN A;  2F8K A;  2QAR A;  1SXE A;  2DKX A;  2FE9 A;  2KE7 A;  2E8P A;  2Y9T A;  1PK1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...