1UCVA

Sterile alpha motif (sam) domain of ephrin type-a receptor 8
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
b'GSSGSSGLTVGDWLDSIRMGRYRDHFAAGGYSSLGMVLRMNAQDVRALGITLMGHQKKILGSIQTMRAQLTSTQGSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structure of Sterile alpha motif (SAM) domain of ephrin type-A receptor 8
rcsb
molecule keywords EPHRIN TYPE-A RECEPTOR 8
source organism Homo sapiens
molecule tags Transferase
total genus 18
structure length 81
sequence length 81
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2003-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1ucvA00
5JRTA 1KW4A 1F0MA 2E8OA 2E8NA 2QKQA 1SV0C 4NJ8A 3KKAC 3SEIA 1PK1A 2F44A 1V38A 2QB0B 1UQVA 2QARB 3TADA 1PK3A 3TADC 2B6GA 3BS5B 5KNIA 2JV3A 2DL0A 4RQNA 2YTUA 4MHVA 3TACB 2EAMA 2KSOA 1SV0A 2QB1A 2F3NA 3KKAA 4NL9A 2ESEA 1SV4A 4PZNA 1Z1VA 4NL9C 1OXJA 3H8MA 3IDWA 1DXSA 2GLEA 1OW5A 4PZOA 2FE9A 1X9XA 2E8PA 1B0XA 2KE7A 1B4FA 2EANA 2KG5A 2LMRA 1SGGA 2D8CA 2F8KA 2ES6A 2KSOB 2KMDA 2D3DA 2EAPA 2QARA 2DKZA 1COKA 3HILA 2Y9TA 2DKXA 2E8MA 1PK1B 5JU5A 2LPEA 2Y9UA 5JTIA 1LKYA 2L5YA 4RQMA 5J8YC 2EAOA 5L1MA 2K60A 3K1RB 3BQ7A 1JI7A 1X66A 2QB0A 1WWUA 1V85A 5F3XB 1UCVA 1WWVA 1SXEA 3BS5A 5J8YA 1RG6A 3BS7A 2K4PA 1X40A 1LKYB 4IS7A 3SENA 1SXDA 2KIVA
chains in the Genus database with same CATH superfamily
1QSSA 1BNPA 1KL9A 1ZD4A 2NV3A 1KKXA 4Q8EA 3SEIA 4NWIA 3J81j 1UQVA 3HX0A 1RM6C 2AJQA 5EE3A 4O5CA 2RHFA 3E58A 1NJXA 2RLTA 4RPZA 2W03A 7ICRA 3C2MA 5AI9A 3N4MB 3PW0A 4I2CA 3C1YA 2C2EA 1ZQTA 2EAMA 4DSLA 2G0AA 9ICFA 5L1KA 1AQ6A 2P6UA 1KFTA 2IOFA 5ALOA 2XCAA 8ICVA 2KHVA 4RU9A 3T5LA 1NKBA 4F2RA 4JV1A 4QJFB 4Y2RA 4FS1A 4IQWA 1ZQEA 1Z19A 2KJ8A 4ED7A 5CB1A 2OYYA 3RF9A 3M8RA 4O3PA 2ZUDA 5DBCA 5DB6A 5KFXA 4P0PB 3M1YA 3CP8A 4DS4A 1U48A 4O3MA 2E1FA 3MFIA 8ICWA 4J03A 3MDCA 3PR4A 1FO4A 1S0OA 4R65A 4DQSA 2ZTEA 2F1JA 2WHEA 4Y2SA 3SI8A 4RQ8A 3Q8LA 2IMWP 1P7DA 3N97B 3RBEA 2R8IA 5L1MA 2HSZA 4CF4A 1TAUA 2ODGA 3WK9A 1SXEA 1ZQYA 5J0XA 1N5XA 4BX9C 1ZQIA 2KP7A 4P4PA 5KAFU 3MGIA 5KT4A 2HHTA 1DK2A 3RBDA 1F5SA 1F0MA 4ED6A 1BPYA 4QZHA 4KLQA 3CNHA 5ALJA 4DF4A 4JMUA 2QARB 3O0FA 8ICHA 4DCCA 4U6PA 1MQ2A 1ZQKA 5DQIA 1T3NA 3N28A 2DFLA 1WUDA 2BDUA 1NKEA 3QE9Y 2BZFA 4F92B 2FLPA 4DFPA 2NO5A 3F5EA 1ZQXA 4JUZA 4KMOB 5CHGA 8ICXA 4F3OA 3HWTA 3JPOA 2K4HA 4ICAA 2HCFA 5KFHA 1WCNA 2NRTA 4YD2A 1OW5A 5IIKA 1YT3A 3IV6A 2G5IB 1FFVA 1S0MA 1B4FA 5ALGA 2W55A 4FBTA 3PR5B 1JXLA 4IRCA 5TZVA 4J9QA 1XO0A 2XCPA 3IN5A 2QARA 4ELTA 2Y9TA 1J97A 5DBBA 3UPQA 2W04A 4Z6FA 2W9MA 5AKKA 4YCXA 9ICCA 2EDUA 5KFIA 3GFKB 1N2XA 2VJ4A 3EW9A 4Q44A 2G5HB 5GTIU 4ELUA 3E0FA 3MGVA 1D9DA 2HBJA 2KK0A 4F8RA 2B21A 2AGQA 5J2IA 3PSFA 4B9LA 2ZIVA 4X5VA 8ICLA 1HIWA 4BJQA 5DGAA 3BQTA 3I76A 4PGQA 2ZJ8A 5AKLA 1LKYB 3BZCA 9ICRA 5ALMA 5JRTA 4C8OA 5AK3A 8ICFA 5ALFA 4LZGA 4NLGA 1SV0C 3ALRA 2CN1A 5BOLA 2F76X 2H3ZA 2OHFA 3EUB2 3RJHA 5ALHA 5TISU 4GXIA 5AKHA 4B9MA 3TADC 4LJXA 1BVSA 1D8LA 4QW9A 3C5GA 4DSIA 3SAFA 1WYGA 1VLBA 5AI8A 3UXOA 3ZI4A 4XRHA 3GU3A 3AEVA 4NY8A 1L7MA 4ECSA 3PX4A 4O3SA 4IC9A 4DWIA 3SD7A 1J2MA 2K4IA 3H8MA 4J9RA 1JX4A 4DFDA 3PW2A 2ISPA 1X9XA 1L3TA 4MFAA 2XC9A 1KLNA 4P2HA 5KFAA 2HI0A 2NO4A 5KT5A 2BHNA 2D8CA 2HMXA 5KFDA 2FJ6A 2VIXA 3KD3A 5AKGA 5J2KA 1COKA 4Z6DA 3CW2C 2M0NA 4BWMA 5CA7A 1AROP 2ZUBA 5JU5A 3WK4A 2YX8A 2MU2A 4FBUA 2R8GA 9ICTA 2PFNA 2BDPA 5AK4A 3GV5B 4YFKA 1D8YA 1NKCA 8ICEA 3LVVA 5HR6A 4ECZA 4KLDA 2I9GA 5J2DA 2PFOA 2K60A 1JI7A 5AI4A 4RQ3A 5EE0A 4YXMA 5DQHA 3ETLA 8ICIA 4RQ0A 1IV8A 5KG6A 4RNMA 5J8YA 4JB3A 1XO1A 1JALA 1UT5A 3PSTA 4YG2A 4ED0A 3HW8A 1NK6A 3PW7A 3PX6A 4B9TA 5KFEA 2OCEA 5KG0A 1ZQWA 1QQ7A 4NJ8A 3K4GA 3KZIU 1V38A 2QB0B 2J6UA 1N5WA 5IIJA 8ICZA 2WB1F 1S76D 1TAMA 2JEJA 2B6GA 4FFDA 3PMNA 5C5JA 3SR6A 4B6JA 4J9MA 3LWMA 2HHWA 2UVUA 4XUSA 3CRXA 4UAVA 4JV0A 1A0PA 4QIWC 1C20A 4UB8U 3MDAA 3EPIA 1SB3C 3IDWA 4IQVA 1A6SA 4IRKA 3AMZA 5KFCA 2KOBA 9ICMA 3MGHA 5ALDA 1SKRA 2KE7A 1U45A 3N7SC 4Y2YA 4YVZA 2UVRA 3M6KA 1SZHA 3IG5A 1CUKA 4C4SA 2ES6A 1TK0A 3I28A 2KSOB 5B5EU 3G6VA 4QZIA 4J9SA 3IG8A 2F8LA 1YZ7A 1CI4A 4QZ9A 4I2FA 2Y9UA 2I6XA 4UW9A 1UA0A 4QNLA 9ICEA 5KTQA 1N48A 3V7JA 3H40A 3D2NA 5EE9A 2C2RA 2MUTA 4M9HA 4RPYA 2RDJA 1V85A 1QCKA 4M9LA 2V9WA 5KAIU 2KEYA 1WWVA 4QZDA 2JR5A 8ICUA 4CCHA 4QWCA 4I2EA 1HEKA 2D6FC 3BS7A 5IIIA 1H38A 1JROA 5IINA 5D46A 5AI5A 3UMCA 5J2GA 1KTQA 1PVQA 4KLEA 3NGDA 1Z3EB 3OSPA 2YB4A 4KTQA 2ZTDA 5HNKA 3ED5A 4K4HA 2DL0A 3C23A 3QYPA 3TARA 1ZQZA 2DGZA 2R8HA 4C8NA 1WG8A 5D49A 2Q0ZX 4K4GA 2W9CB 3NVZA 4E0DA 1ED1A 4KLFA 1OXJA 2RP5A 2NYVA 4P4MA 3RRHA 7ICIA 1Z4OA 2WF8A 4I2JA 2E1EA 3NVYA 1COOA 4UAWA 5KL1B 2UVVA 2LMRA 4AYBC 2K4EA 1K1QA 5KT6A 1ZETA 3WKBA 3OTQA 8ICBA 2WF9A 3V7LA 1S8OA 4F4XA 4M04A 3MR5A 4RNNA 2JEGA 5L1LA 3QNMA 1FFUA 2WAQC 2L5YA 4MEXA 4RT2A 2BCQA 4GC7A 5ALNA 2ZIUB 4DS5A 4J9LA 2KTQA 1V97A 2HHSA 4QZEA 2LBOA 4MF8A 3DV9A 3NUQA 4ED1A 4I27A 1MA7A 1U49A 5AIAA 4B9SA 1XS9D 3NVVA 4EBEA 4JV2A 4P0QB 1S0VA 2DPIA 1QSYA 5C0YA 4QWDA 2LKYA 1BPEA 3GIIA 2KKPA 1KW4A 2P66A 1RYSA 7ICTA 3SV3A 3NRZA 2LYAA 5ALUA 1NK0A 4EBCA 4C4TA 1RPLA 4C8LA 4PHAA 1DGJA 4PPXA 1T7PA 4Q45A 4RQ4A 2QLTA 3L3FX 3UXPA 3V6HA 4K4IA 5KFWA 4I2GA 5IIOA 1F44A 3HKZF 2BCSA 2EZXA 9ICKA 5ALLA 4EX7A 8ICOA 4B9VA 4IQTA 4NL9A 5JUMA 4PZNA 1HJPA 3T3FA 5J2CA 2ISOA 5ALPA 2YB1A 3MR2A 4GXJA 1D9FA 2A3VA 1BPXA 3B0YA 3C2LA 4RQ2A 4QWAA 4GC6A 3SZ2A 2KZZA 2YMMA 1LB2B 7ICLA 1RXVA 1BGXT 5KT3A 1RYRA 1Q8KA 2A19A 3M6ZA 1N62A 2W8LA 2XI9A 2DKXA 2E8MA 3V6KA 4NV0A 3T5HA 3AN1A 2EQYA 3BJYA 2KV2A 1DGSA 2GOLA 3RRGA 4FZNA 4KLLA 1L8OA 1FEZA 3RJEA 2WAQF 1XSNA 4ECUA 2DWQA 4OJOA 4YN4A 2ZJ5A 4US8A 3TAPA 3U26A 4ZOHC 2XICA 4M9GA 1SXDA 4FZMA 4C0ZA 1SKSA 4KLUA 2HBMA 5EWGA 3QZ8A 2BPGA 4DSKA 3PV8A 3TAQA 4IQUA 8ICJA 2QKQA 2W43A 4Z6CA 7ICMA 2AGOA 4UAYA 3Q8MA 2LYHA 4KLGA 1X6JA 7ICHA 4RQ1A 2G07A 8ICCA 4ELVA 3MABA 1TV9A 1NI3A 5KT7A 3FDSA 5KG3A 2ASDA 1FIQA 4NLBA 4P0PA 5KFQA 3Q8KA 1D8BA 2F3NA 5HMMA 2HHVA 1LV5A 3WKEA 4QW8A 3ISBA 4OJ6A 2XY7A 2ZIXB 3MFHA 2JEFA 2FE9A 2H3FA 1LVHA 2BR0A 3SAGA 3RR8A 3PNCA 3FM9A 5KFZA 1N56A 4PHEA 3F2DA 3M9MB 2ZIWB 4DL4A 9ICAA 2G08A 1VJ5A 2R8JA 2AXTU 1Q3VA 1X9SA 5AKEA 3JPNA 2EAPA 3L5KA 4Z6EA 3HILA 1Y88A 4FZLA 1ZQFA 2A1AA 4AP9A 2H3IA 2Y1JA 1L3VA 4NM1A 3KHRA 1TKDA 4KLSA 2HVHA 3DEEA 1OUQA 1KDHA 3MR6A 5AM2A 9ICPA 5F9LA 3WK7A 2MA1A 5J2EA 2EAOA 2J6SA 2BPCA 5AICA 3Q8RB 1CEZA 3LVWA 2LHTA 3GIJA 2WF7A 3TANA 4KX3A 3D2QA 5F3XB 4KLOA 4Y2XA 1KFSA 5DDMA 4EEKA 2W9AA 4YR2A 5KT2A 3N7RC 2ZIWA 1S5LU 4I2DA 3F2BA 2IOFK 4F2SA 1RG6A 5ALTA 4JK1A 5F9NA 1HUOA 3T79A 7ICNA 4B9NA 1V9PA 3GZFA 2IHMA 4BDPA 4MFCA 2KKVA 9ICQA 9ICHA 1ZD2P 2VKQA 3H0MB 5J2AA 4QZGA 1ZOLA 4UATA 1ZD3A 3H4BA 5T14A 1J2NA 5HHIA 5DB7A 1C7YA 3LK9A 1X42A 5ALKA 2YTUA 4Q8FA 2M9NA 1XC9A 9ICWA 2QB1A 3CYMA 2KZMA 2W9BB 1KSPA 3NVWA 1ZQOA 1UT8A 3M7DA 3PZPA 4RQ6A 4UB4A 3OJUA 1ZJMA 1ECWA 1T8EA 1X9MA 2JEIA 2HW3A 9ICOA 2EANA 1QLNA 2ASJA 1SGGA 2H3VA 3F5AA 4M9NA 4PH5A 5A0LA 4F72A 2D3DA 3ISDA 4DLEA 2CPRA 4JWNA 4U7CA 1K1SA 2OXOA 2DUYA 3SV4A 4O3OA 5KG7A 1NK8A 4YMNA 1JMSA 5KG5A 1JN3A 3AL0B 5ALRA 1LKYA 2XIDA 5J8YC 5KFGA 4F71A 2BPFA 2W9BA 1KFDA 3ZD9A 1SL2A 2G09A 1BPBA 1ZJNA 1L7PA 2VA8A 3RAQA 1RQNA 3NRWA 3TFRA 4OD0A 1S97A 4DF8A 2AU0A 1N63A 2JZBB 8ICSA 2KFNA 1NK4A 1L8LA 5AK5A 4IS7A 4Y2UA 2PFPA 1PZNA 5DG8A 4MFFA 1ZQAA 3VCBA 7ICEA 2R8KA 4CF3A 3KHHA 3C5FA 3BZKA 5G5GA 4CE6A 4UAZA 1A76A 3TADA 4ZH4A 3QEBZ 4EBDA 5J2FA 5AM1A 3ZD8A 2DQNB 2KZ3A 9ICIA 4NLKA 3OSNA 4DL3A 4XA5A 4YXJA 4MHVA 3RH6A 2IHNA 4KLHA 3NASA 4TQSA 2Q4TA 4UBCA 4C8MA 5J0PA 5DQGA 1EXNA 1L3SA 5DB9A 5KFYA 2PMZC 1ZQNA 4UB1A 4DQQA 1BPDA 5IILA 1NZBA 3A0HU 1VDVA 2HOQA 1TFRA 2ZJAA 4Y2PA 2AQ0A 1DK3A 4RQ7A 1S10A 4NLNA 4DQRA 1L3UA 3TI0A 2DBYA 3L4PA 9ICJA 2OEHA 3PW5A 3E2EA 3WKDA 5AKXA 2ZUCA 3RB6A 3EWAA 5AKIA 2Y0SC 3K1RB 3BQ7A 2QB0A 3C29A 4DOAA 1NK7A 3M9NB 2KJ5A 2P35A 2KHQA 2BCVA 1Z1BA 5AHXA 3QUBA 2KIWA 1B22A 4DFKA 1M6YA 4ACOA 4KN7A 3MR3A 3RR7A 3SENA 2FLNA 1ZRNA 1RQLA 3THVA 2FDRA 5ALWA 3OPXA 3RB3A 1O03A 8ICPA 5L1IA 2BQUA 4GXKA 4ECTA 2VJ5A 1MN8A 4NLZA 2KD1A 4M6WB 4O9MA 3BS5B 2JV3A 1UHUA 1GO3F 4P4OA 4C8KA 5J0SA 2C28A 2KSOA 4DFMA 2GH1A 3KKAA 2ESEA 8ICAA 1SV4A 3RH5A 5J2JA 1QSLA 2KNJA 3T5JA 9ICVA 5KFVA 2GLEA 1TK8A 2YMLA 3NS1A 1ZQRA 2DPJA 5K4LA 3AUOA 5KG2A 4Y2TA 4IR1A 1SZPA 2H5XA 3C2KA 2PMZF 2VA2A 4J9NA 3I1YA 5E79U 2LPEA 3V6JA 2W7PA 4F4YA 3H8JA 5CP2A 7ICUA 4DOCA 2HHXA 3GILA 4QIWF 2OWOA 5CJ7A 1ZQLA 5DG9A 3QU7A 3BQ1A 3HPOA 4CGZA 4UB3A 2NRXA 3DDHA 2FMQA 3QUCA 2HDOA 8ICMA 2Y0SF 3ONNA 3LYSA 2R18A 1X40A 3F53A 4F4WA 5KL8B 5EWEA 3AQFA 4UASA 2ZXIA 2W9CA 1Z4NA 3UQ2A 3H8SA 2FI1A 2ZTCA 2GO7A 4DLGA 3H7IA 1SL1A 7ICFA 4PL1A 1Z00B 2W3RA 1PUZA 3UQ0A 4O0IA 3RB4A 3KBBA 4EX6A 2FMPA 2RRDA 5ALXA 2A1JB 2J6TA 4Y2QA 2MRLA 4R8UB 3D2SA 4QZAA 2LM4A 4QZ8A 4YP3A 9ICUA 3OHAA 1ZQBA 5KFRA 3H0LB 4HYKA 2Y1IA 8ICNA 8ICKA 3RJFA 1QTMA 1DXSA 3RB0A 5HMLA 2YQEA 5AK6A 3PY8A 2E8PA 3UMBA 2YMPA 2ZIUA 4I2IA 1N60A 1DRGA 2KG5A 5BOMA 4IRDA 3D6JA 2FMSA 5KFTA 4UARA 4DL5A 4F5RA 2XVTA 3PVXA 1Z00A 2C2DA 3IM1A 2KMDA 1ZQPA 3ORYA 4P0QA 4ECRA 4C80A 3JPQA 2FPLA 3IRUA 4QZFA 2JH7A 2AH5A 3FYHA 4R63A 1U47A 4KN4A 1ZD5A 4TURA 4ECQA 3TQ1A 1TK5A 2MAXA 2W3SA 3HRDD 1N61A 4CF5A 1ZQSA 4NM2A 2HVIA 1Q3UA 3H0RB 3UMGA 4GFJA 4FS2A 2P6RA 4I28A 3OJSA 4AYBF 5J0OA 5L1JA 5ALZA 1NK9A 2V4QA 2LYBA 3RJJA 4QZCA 2CXYA 2E8OA 1ZQJA 1X2IA 4F93B 5CWRA 1KQQA 3QZ7A 1ZQCA 5KFSA 1ZQDA 1Q46A 2G06A 3FAHA 2PKEA 5J0RA 4I2AA 4EYIB 2RDIA 3JPPA 2CRXA 3QU2A 2NRZA 2IOHA 4UB5A 1ZQUA 4ECVA 1S0NA 5AI6A 4ED2A 2K8BB 1Z1VA 1YZ6A 3N7PD 3NTUA 3QU9A 1U4BA 4RUAA 4EELA 1RYUA 4LVSA 4J9OA 5AM4A 2Z7JA 2W54A 2FPMA 3EPGA 2HBLA 3KZXA 2JH1A 2DF4B 9ICNA 2YMQA 5L9XA 4KLMA 1SWVA 2LI6A 3UM9A 1TAQA 4DFJA 1ZQMA 1SIJA 2VANA 3G6XA 1PK1B 2WF5A 1IM4A 5J2HA 5DLFA 4CDGA 4R66A 3B9JA 3TKAA 2NRWA 5AKJA 1RZTA 5DLGA 2K89A 4R64A 4YD1A 3KHGA 4G3IA 3ISCA 3IHQB 2V4RA 3AQEA 4F5QA 2PXIA 1SL0A 1NJWA 3WKCA 2BGWA 3Q8PB 3BDPA 3UXNA 3C28A 1L5UA 4BXOB 4BGDA 2MSNA 1TE2A 5ALQA 4RT3A 1RXWA 4RQ5A 3RH4A 2AQ4A 4UB6U 3BQ0A 3AU6A 5CEHA 3KFUF 1T4GA 4YR0A 4BUGA 1JIHA 5KG1A 9ICBA 2XGPA 1UA1A 2ZIXA 1PK1A 4USAA 1ZXIA 3GDXA 5B66U 3LDAA 4Y2VA 2JMGA 5AI0A 5D4BA 2E5SA 3GQCA 2ZIVB 5J0WA 3PX0A 5KNIA 2BCRA 5J2BA 2PI4A 4RQNA 2C22A 1JRPA 4KX5A 3MBYA 1NJZA 4I29A 3WK8A 3SYZA 3T5KA 2EZYA 1K5OA 4RNOA 3KOOA 8ICTA 5DBAA 3QUQA 7ICQA 1ZQGA 4PGYA 3RFAA 2XY5A 3IP4B 4BXOA 2I1QA 4CNQA 1MSWD 7ICJA 5ALSA 3EYZA 4EYHB 2KN7A 2GWSA 1ZYQA 2YN4A 3PO4A 1B43A 4J9PA 4EEYA 3AU2A 3RTVA 4C7YA 5J0TA 3QUTA 2YY6A 3TFSA 5KG4A 4M0AA 1KEJA 7ICVA 3PO5A 2KVCA 3V72A 4A8EA 1KRPA 1PVRA 1U9LA 4DQIA 2K8CB 4PGXA 3BQ2A 4C4RA 2WB1C 5EOZA 3AM9A 4DOBA 1ZQ1C 2F1IA 5J0YA 3WU2U 2PFQA 2XGQA 1L6NA 1ZQQA 5BPCA 2BQRA 2BQ3A 5KFBA 2W7OA 5ALYA 3GV7B 2H3QA 1MQ3A 2AHOB 5KFOA 4JWMA 7ICSA 3ZDCA 1DOQA 3PSIA 3GIKA 4DL6A 3PSPA 5FP0A 3RJGA 4KMUA 2E8NA 4TUPA 2ALZA 3MC1A 3GV8B 1WCLA 4I2HA 5ALVA 4EZ9A 2IBKA 1PK3A 4C7ZA 9ICLA 1XNSA 5HR7A 3SAHA 5J0UA 1NK5A 2W8KA 1KN5A 2JXJA 2HBKA 3TACB 4ED3A 8ICYA 5DB8A 4F91B 1SV0A 2JHDA 2HHQA 1QH9A 2EZZA 4O3NA 2AGPA 3M8SA 1L7OA 1NNLA 4PL2A 4FO6A 4KLTA 4YQWA 5KFUA 1X9WA 4I2BA 4TUQA 5DDYA 2JRZA 2IA6A 4RUCA 4HAIA 1XWLA 4DEZA 3KTQA 5J0QA 4B9UA 2DKZA 1BPZA 5KFMA 2LM1A 3FC4A 2F2AB 8ICGA 1PVPA 5AM3A 2OM6A 3S6JA 8ICRA 1ZRMA 2JZBA 2KICA 3ZDDA 4M47A 5JTIA 4G9BA 1CRXA 3ETRA 4RPXA 2WTFA 5G5HA 3OHBA 4UQGA 1SWWA 4OCZA 1X66A 2BCUA 1WWUA 2EH9A 4MF2A 2O6KA 1QQ6A 4CRXA 1UCVA 3G6YA 1ZQHA 4UBBA 4PHPA 4Q43A 1IG6A 3QXGA 2FLLA 3R9KA 2K4PA 1XU4A 2WF6A 3K1ZA 4KLIA 4KLJA 5EWFA 3ZDEA 2FPKA 1SKWA 1X6IA 3KKAC 3C1ZA 3HP6A 2F44A 1S77D 4M9JA 3PMLA 2MUTB 4NXZA 4F50A 4IL6U 3QU4A 2KJ9A 4UB2A 4QZBA 4QWEA 4GIBA 4UAUA 2F1HA 4ECXA 1T3QA 5AKZA 5CRXA 4DSFA 4J9KA 1JUDA 5KFNA 4NLCA 5AM0A 3RJKA 2PI5A 2ASLA 3KHLA 1KBUA 5KFFA 1IXRA 4ED8A 4DL7A 3ICXA 4PHDA 4M2YA 4OJPA 1QQ5A 4Y2JA 2N1RA 8ICQA 1L7NA 4US9A 5DG7A 4WJ3B 2K8AA 1NJYA 1B0XA 4ECWA 4F5OA 3WK5A 2UVWA 4EENA 3HT3A 5J29A 2BKEA 5HHHA 2F8KA 1O08A 1XSPA 2HHUA 3WK6A 2XY6A 5KFKA 5HP4A 2ZG6A 4F4ZA 5GTHU 3JPRA 4BWJA 3EZ5A 2F77X 3QEAZ 4RQMA 5DKWA 4TQRA 9ICSA 3HJEA 2OH2A 4DQPA 2I5HA 4O5EA 4YMMA 5AKYA 3SMVA 4F4KA 3HKZC 5KFPA 4F5PA 2HOIA 4M6WA 5ALEA 2NRVA 3BS5A 4DSJA 5KFLA 4YMOA 5IIMA 3GIMA 1NOMA 2XO7A 7ICOA 3JPTA 5AIBA 3Q8SB 4GLXA 2KIVA 4DL2A 1ZQVA 9ICGA 3SQIA 1RDFA 4F5NA 1TVAA 3VC8A 4FE3A 3RJIA 4TUSA 3LWLA 3PW4A 4OJLA 5DGBA 1IIPA 1JXEA 1T94A 4OJ5A 1MC8A 4YR3A 3ZDBA 4NL9C 3M9OB 7ICKA 2WFAA 7ICPA 5EE1A 3ZDAA 4PZOA 1UPHA 4QWBA 5KFJA 1URJA 2JGAA 5AM5A 2VA3A 4DO9A 1XSLA 3Q8QB 4ECYA 2E3TA 2RQ5A 3A0BU 2ZXHA 3QX7A 4IR9A 3OGUA 5H2FU 7ICGA 1A77A 3H4DA 3H8WA 4O3QA 4O3RA 1S9FA 3QU5A 2KFZA 3B0XA 9ICXA 1NZPA 5CR0A 3V7KA 1HUZA 4OO1J 4O5KA 4MEYA 3K75D 2KVSA 3C21A 1BNOA 2A1JA 3F2CA 4PJ0U 5ALIA 2W11A 2B0CA 4KITB 3WKAA 2ATLA 4R8UA 4EZ6A 4RZRA 4LZDA 2HOFA 3RAXA 3JPSA 4DSEA 4XQ8A
chains in the Genus database with same CATH topology
5JRTA 1KW4A 1F0MA 2E8OA 2E8NA 2QKQA 1SV0C 4NJ8A 3KKAC 3SEIA 1PK1A 2F44A 1V38A 2QB0B 1UQVA 2QARB 3TADA 1PK3A 3TADC 2B6GA 3BS5B 5KNIA 2JV3A 2DL0A 4RQNA 2YTUA 4MHVA 3TACB 2EAMA 2KSOA 1SV0A 2QB1A 2F3NA 3KKAA 4NL9A 2ESEA 1SV4A 4PZNA 1Z1VA 4NL9C 1OXJA 3H8MA 3IDWA 1DXSA 2GLEA 1OW5A 4PZOA 2FE9A 1X9XA 2E8PA 1B0XA 2KE7A 1B4FA 2EANA 2KG5A 2LMRA 1SGGA 2D8CA 2F8KA 2ES6A 2KSOB 2KMDA 2D3DA 2EAPA 2QARA 2DKZA 1COKA 3HILA 2Y9TA 2DKXA 2E8MA 1PK1B 5JU5A 2LPEA 2Y9UA 5JTIA 1LKYA 2L5YA 4RQMA 5J8YC 2EAOA 5L1MA 2K60A 3K1RB 3BQ7A 1JI7A 1X66A 2QB0A 1WWUA 1V85A 5F3XB 1UCVA 1WWVA 1SXEA 3BS5A 5J8YA 1RG6A 3BS7A 2K4PA 1X40A 1LKYB 4IS7A 3SENA 1SXDA 2KIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JRT A;  1KW4 A;  1F0M A;  2E8O A;  2E8N A;  2QKQ A;  1SV0 C;  4NJ8 A;  3KKA C;  3SEI A;  1PK1 A;  2F44 A;  1V38 A;  2QB0 B;  1UQV A;  2QAR B;  3TAD A;  1PK3 A;  3TAD C;  2B6G A;  3BS5 B;  5KNI A;  2JV3 A;  2DL0 A;  4RQN A;  2YTU A;  4MHV A;  3TAC B;  2EAM A;  2KSO A;  1SV0 A;  2QB1 A;  2F3N A;  3KKA A;  4NL9 A;  2ESE A;  1SV4 A;  4PZN A;  1Z1V A;  4NL9 C;  1OXJ A;  3H8M A;  3IDW A;  1DXS A;  2GLE A;  1OW5 A;  4PZO A;  2FE9 A;  1X9X A;  2E8P A;  1B0X A;  2KE7 A;  1B4F A;  2EAN A;  2KG5 A;  2LMR A;  1SGG A;  2D8C A;  2F8K A;  2ES6 A;  2KSO B;  2KMD A;  2D3D A;  2EAP A;  2QAR A;  2DKZ A;  1COK A;  3HIL A;  2Y9T A;  2DKX A;  2E8M A;  1PK1 B;  5JU5 A;  2LPE A;  2Y9U A;  5JTI A;  1LKY A;  2L5Y A;  4RQM A;  5J8Y C;  2EAO A;  5L1M A;  2K60 A;  3K1R B;  3BQ7 A;  1JI7 A;  1X66 A;  2QB0 A;  1WWU A;  1V85 A;  5F3X B;  1UCV A;  1WWV A;  1SXE A;  3BS5 A;  5J8Y A;  1RG6 A;  3BS7 A;  2K4P A;  1X40 A;  1LKY B;  4IS7 A;  3SEN A;  1SXD A;  2KIV A; 
#chains in the Genus database with same CATH topology
 1QSS A;  1BNP A;  1KL9 A;  1ZD4 A;  2NV3 A;  1KKX A;  4Q8E A;  3SEI A;  4NWI A;  3J81 j;  1UQV A;  3HX0 A;  1RM6 C;  2AJQ A;  5EE3 A;  4O5C A;  2RHF A;  3E58 A;  1NJX A;  2RLT A;  4RPZ A;  2W03 A;  7ICR A;  3C2M A;  5AI9 A;  3N4M B;  3PW0 A;  4I2C A;  3C1Y A;  2C2E A;  1ZQT A;  2EAM A;  4DSL A;  2G0A A;  9ICF A;  5L1K A;  1AQ6 A;  2P6U A;  1KFT A;  2IOF A;  5ALO A;  2XCA A;  8ICV A;  2KHV A;  4RU9 A;  3T5L A;  1NKB A;  4F2R A;  4JV1 A;  4QJF B;  4Y2R A;  4FS1 A;  4IQW A;  1ZQE A;  1Z19 A;  2KJ8 A;  4ED7 A;  5CB1 A;  2OYY A;  3RF9 A;  3M8R A;  4O3P A;  2ZUD A;  5DBC A;  5DB6 A;  5KFX A;  4P0P B;  3M1Y A;  3CP8 A;  4DS4 A;  1U48 A;  4O3M A;  2E1F A;  3MFI A;  8ICW A;  4J03 A;  3MDC A;  3PR4 A;  1FO4 A;  1S0O A;  4R65 A;  4DQS A;  2ZTE A;  2F1J A;  2WHE A;  4Y2S A;  3SI8 A;  4RQ8 A;  3Q8L A;  2IMW P;  1P7D A;  3N97 B;  3RBE A;  2R8I A;  5L1M A;  2HSZ A;  4CF4 A;  1TAU A;  2ODG A;  3WK9 A;  1SXE A;  1ZQY A;  5J0X A;  1N5X A;  4BX9 C;  1ZQI A;  2KP7 A;  4P4P A;  5KAF U;  3MGI A;  5KT4 A;  2HHT A;  1DK2 A;  3RBD A;  1F5S A;  1F0M A;  4ED6 A;  1BPY A;  4QZH A;  4KLQ A;  3CNH A;  5ALJ A;  4DF4 A;  4JMU A;  2QAR B;  3O0F A;  8ICH A;  4DCC A;  4U6P A;  1MQ2 A;  1ZQK A;  5DQI A;  1T3N A;  3N28 A;  2DFL A;  1WUD A;  2BDU A;  1NKE A;  3QE9 Y;  2BZF A;  4F92 B;  2FLP A;  4DFP A;  2NO5 A;  3F5E A;  1ZQX A;  4JUZ A;  4KMO B;  5CHG A;  8ICX A;  4F3O A;  3HWT A;  3JPO A;  2K4H A;  4ICA A;  2HCF A;  5KFH A;  1WCN A;  2NRT A;  4YD2 A;  1OW5 A;  5IIK A;  1YT3 A;  3IV6 A;  2G5I B;  1FFV A;  1S0M A;  1B4F A;  5ALG A;  2W55 A;  4FBT A;  3PR5 B;  1JXL A;  4IRC A;  5TZV A;  4J9Q A;  1XO0 A;  2XCP A;  3IN5 A;  2QAR A;  4ELT A;  2Y9T A;  1J97 A;  5DBB A;  3UPQ A;  2W04 A;  4Z6F A;  2W9M A;  5AKK A;  4YCX A;  9ICC A;  2EDU A;  5KFI A;  3GFK B;  1N2X A;  2VJ4 A;  3EW9 A;  4Q44 A;  2G5H B;  5GTI U;  4ELU A;  3E0F A;  3MGV A;  1D9D A;  2HBJ A;  2KK0 A;  4F8R A;  2B21 A;  2AGQ A;  5J2I A;  3PSF A;  4B9L A;  2ZIV A;  4X5V A;  8ICL A;  1HIW A;  4BJQ A;  5DGA A;  3BQT A;  3I76 A;  4PGQ A;  2ZJ8 A;  5AKL A;  1LKY B;  3BZC A;  9ICR A;  5ALM A;  5JRT A;  4C8O A;  5AK3 A;  8ICF A;  5ALF A;  4LZG A;  4NLG A;  1SV0 C;  3ALR A;  2CN1 A;  5BOL A;  2F76 X;  2H3Z A;  2OHF A;  3EUB 2;  3RJH A;  5ALH A;  5TIS U;  4GXI A;  5AKH A;  4B9M A;  3TAD C;  4LJX A;  1BVS A;  1D8L A;  4QW9 A;  3C5G A;  4DSI A;  3SAF A;  1WYG A;  1VLB A;  5AI8 A;  3UXO A;  3ZI4 A;  4XRH A;  3GU3 A;  3AEV A;  4NY8 A;  1L7M A;  4ECS A;  3PX4 A;  4O3S A;  4IC9 A;  4DWI A;  3SD7 A;  1J2M A;  2K4I A;  3H8M A;  4J9R A;  1JX4 A;  4DFD A;  3PW2 A;  2ISP A;  1X9X A;  1L3T A;  4MFA A;  2XC9 A;  1KLN A;  4P2H A;  5KFA A;  2HI0 A;  2NO4 A;  5KT5 A;  2BHN A;  2D8C A;  2HMX A;  5KFD A;  2FJ6 A;  2VIX A;  3KD3 A;  5AKG A;  5J2K A;  1COK A;  4Z6D A;  3CW2 C;  2M0N A;  4BWM A;  5CA7 A;  1ARO P;  2ZUB A;  5JU5 A;  3WK4 A;  2YX8 A;  2MU2 A;  4FBU A;  2R8G A;  9ICT A;  2PFN A;  2BDP A;  5AK4 A;  3GV5 B;  4YFK A;  1D8Y A;  1NKC A;  8ICE A;  3LVV A;  5HR6 A;  4ECZ A;  4KLD A;  2I9G A;  5J2D A;  2PFO A;  2K60 A;  1JI7 A;  5AI4 A;  4RQ3 A;  5EE0 A;  4YXM A;  5DQH A;  3ETL A;  8ICI A;  4RQ0 A;  1IV8 A;  5KG6 A;  4RNM A;  5J8Y A;  4JB3 A;  1XO1 A;  1JAL A;  1UT5 A;  3PST A;  4YG2 A;  4ED0 A;  3HW8 A;  1NK6 A;  3PW7 A;  3PX6 A;  4B9T A;  5KFE A;  2OCE A;  5KG0 A;  1ZQW A;  1QQ7 A;  4NJ8 A;  3K4G A;  3KZI U;  1V38 A;  2QB0 B;  2J6U A;  1N5W A;  5IIJ A;  8ICZ A;  2WB1 F;  1S76 D;  1TAM A;  2JEJ A;  2B6G A;  4FFD A;  3PMN A;  5C5J A;  3SR6 A;  4B6J A;  4J9M A;  3LWM A;  2HHW A;  2UVU A;  4XUS A;  3CRX A;  4UAV A;  4JV0 A;  1A0P A;  4QIW C;  1C20 A;  4UB8 U;  3MDA A;  3EPI A;  1SB3 C;  3IDW A;  4IQV A;  1A6S A;  4IRK A;  3AMZ A;  5KFC A;  2KOB A;  9ICM A;  3MGH A;  5ALD A;  1SKR A;  2KE7 A;  1U45 A;  3N7S C;  4Y2Y A;  4YVZ A;  2UVR A;  3M6K A;  1SZH A;  3IG5 A;  1CUK A;  4C4S A;  2ES6 A;  1TK0 A;  3I28 A;  2KSO B;  5B5E U;  3G6V A;  4QZI A;  4J9S A;  3IG8 A;  2F8L A;  1YZ7 A;  1CI4 A;  4QZ9 A;  4I2F A;  2Y9U A;  2I6X A;  4UW9 A;  1UA0 A;  4QNL A;  9ICE A;  5KTQ A;  1N48 A;  3V7J A;  3H40 A;  3D2N A;  5EE9 A;  2C2R A;  2MUT A;  4M9H A;  4RPY A;  2RDJ A;  1V85 A;  1QCK A;  4M9L A;  2V9W A;  5KAI U;  2KEY A;  1WWV A;  4QZD A;  2JR5 A;  8ICU A;  4CCH A;  4QWC A;  4I2E A;  1HEK A;  2D6F C;  3BS7 A;  5III A;  1H38 A;  1JRO A;  5IIN A;  5D46 A;  5AI5 A;  3UMC A;  5J2G A;  1KTQ A;  1PVQ A;  4KLE A;  3NGD A;  1Z3E B;  3OSP A;  2YB4 A;  4KTQ A;  2ZTD A;  5HNK A;  3ED5 A;  4K4H A;  2DL0 A;  3C23 A;  3QYP A;  3TAR A;  1ZQZ A;  2DGZ A;  2R8H A;  4C8N A;  1WG8 A;  5D49 A;  2Q0Z X;  4K4G A;  2W9C B;  3NVZ A;  4E0D A;  1ED1 A;  4KLF A;  1OXJ A;  2RP5 A;  2NYV A;  4P4M A;  3RRH A;  7ICI A;  1Z4O A;  2WF8 A;  4I2J A;  2E1E A;  3NVY A;  1COO A;  4UAW A;  5KL1 B;  2UVV A;  2LMR A;  4AYB C;  2K4E A;  1K1Q A;  5KT6 A;  1ZET A;  3WKB A;  3OTQ A;  8ICB A;  2WF9 A;  3V7L A;  1S8O A;  4F4X A;  4M04 A;  3MR5 A;  4RNN A;  2JEG A;  5L1L A;  3QNM A;  1FFU A;  2WAQ C;  2L5Y A;  4MEX A;  4RT2 A;  2BCQ A;  4GC7 A;  5ALN A;  2ZIU B;  4DS5 A;  4J9L A;  2KTQ A;  1V97 A;  2HHS A;  4QZE A;  2LBO A;  4MF8 A;  3DV9 A;  3NUQ A;  4ED1 A;  4I27 A;  1MA7 A;  1U49 A;  5AIA A;  4B9S A;  1XS9 D;  3NVV A;  4EBE A;  4JV2 A;  4P0Q B;  1S0V A;  2DPI A;  1QSY A;  5C0Y A;  4QWD A;  2LKY A;  1BPE A;  3GII A;  2KKP A;  1KW4 A;  2P66 A;  1RYS A;  7ICT A;  3SV3 A;  3NRZ A;  2LYA A;  5ALU A;  1NK0 A;  4EBC A;  4C4T A;  1RPL A;  4C8L A;  4PHA A;  1DGJ A;  4PPX A;  1T7P A;  4Q45 A;  4RQ4 A;  2QLT A;  3L3F X;  3UXP A;  3V6H A;  4K4I A;  5KFW A;  4I2G A;  5IIO A;  1F44 A;  3HKZ F;  2BCS A;  2EZX A;  9ICK A;  5ALL A;  4EX7 A;  8ICO A;  4B9V A;  4IQT A;  4NL9 A;  5JUM A;  4PZN A;  1HJP A;  3T3F A;  5J2C A;  2ISO A;  5ALP A;  2YB1 A;  3MR2 A;  4GXJ A;  1D9F A;  2A3V A;  1BPX A;  3B0Y A;  3C2L A;  4RQ2 A;  4QWA A;  4GC6 A;  3SZ2 A;  2KZZ A;  2YMM A;  1LB2 B;  7ICL A;  1RXV A;  1BGX T;  5KT3 A;  1RYR A;  1Q8K A;  2A19 A;  3M6Z A;  1N62 A;  2W8L A;  2XI9 A;  2DKX A;  2E8M A;  3V6K A;  4NV0 A;  3T5H A;  3AN1 A;  2EQY A;  3BJY A;  2KV2 A;  1DGS A;  2GOL A;  3RRG A;  4FZN A;  4KLL A;  1L8O A;  1FEZ A;  3RJE A;  2WAQ F;  1XSN A;  4ECU A;  2DWQ A;  4OJO A;  4YN4 A;  2ZJ5 A;  4US8 A;  3TAP A;  3U26 A;  4ZOH C;  2XIC A;  4M9G A;  1SXD A;  4FZM A;  4C0Z A;  1SKS A;  4KLU A;  2HBM A;  5EWG A;  3QZ8 A;  2BPG A;  4DSK A;  3PV8 A;  3TAQ A;  4IQU A;  8ICJ A;  2QKQ A;  2W43 A;  4Z6C A;  7ICM A;  2AGO A;  4UAY A;  3Q8M A;  2LYH A;  4KLG A;  1X6J A;  7ICH A;  4RQ1 A;  2G07 A;  8ICC A;  4ELV A;  3MAB A;  1TV9 A;  1NI3 A;  5KT7 A;  3FDS A;  5KG3 A;  2ASD A;  1FIQ A;  4NLB A;  4P0P A;  5KFQ A;  3Q8K A;  1D8B A;  2F3N A;  5HMM A;  2HHV A;  1LV5 A;  3WKE A;  4QW8 A;  3ISB A;  4OJ6 A;  2XY7 A;  2ZIX B;  3MFH A;  2JEF A;  2FE9 A;  2H3F A;  1LVH A;  2BR0 A;  3SAG A;  3RR8 A;  3PNC A;  3FM9 A;  5KFZ A;  1N56 A;  4PHE A;  3F2D A;  3M9M B;  2ZIW B;  4DL4 A;  9ICA A;  2G08 A;  1VJ5 A;  2R8J A;  2AXT U;  1Q3V A;  1X9S A;  5AKE A;  3JPN A;  2EAP A;  3L5K A;  4Z6E A;  3HIL A;  1Y88 A;  4FZL A;  1ZQF A;  2A1A A;  4AP9 A;  2H3I A;  2Y1J A;  1L3V A;  4NM1 A;  3KHR A;  1TKD A;  4KLS A;  2HVH A;  3DEE A;  1OUQ A;  1KDH A;  3MR6 A;  5AM2 A;  9ICP A;  5F9L A;  3WK7 A;  2MA1 A;  5J2E A;  2EAO A;  2J6S A;  2BPC A;  5AIC A;  3Q8R B;  1CEZ A;  3LVW A;  2LHT A;  3GIJ A;  2WF7 A;  3TAN A;  4KX3 A;  3D2Q A;  5F3X B;  4KLO A;  4Y2X A;  1KFS A;  5DDM A;  4EEK A;  2W9A A;  4YR2 A;  5KT2 A;  3N7R C;  2ZIW A;  1S5L U;  4I2D A;  3F2B A;  2IOF K;  4F2S A;  1RG6 A;  5ALT A;  4JK1 A;  5F9N A;  1HUO A;  3T79 A;  7ICN A;  4B9N A;  1V9P A;  3GZF A;  2IHM A;  4BDP A;  4MFC A;  2KKV A;  9ICQ A;  9ICH A;  1ZD2 P;  2VKQ A;  3H0M B;  5J2A A;  4QZG A;  1ZOL A;  4UAT A;  1ZD3 A;  3H4B A;  5T14 A;  1J2N A;  5HHI A;  5DB7 A;  1C7Y A;  3LK9 A;  1X42 A;  5ALK A;  2YTU A;  4Q8F A;  2M9N A;  1XC9 A;  9ICW A;  2QB1 A;  3CYM A;  2KZM A;  2W9B B;  1KSP A;  3NVW A;  1ZQO A;  1UT8 A;  3M7D A;  3PZP A;  4RQ6 A;  4UB4 A;  3OJU A;  1ZJM A;  1ECW A;  1T8E A;  1X9M A;  2JEI A;  2HW3 A;  9ICO A;  2EAN A;  1QLN A;  2ASJ A;  1SGG A;  2H3V A;  3F5A A;  4M9N A;  4PH5 A;  5A0L A;  4F72 A;  2D3D A;  3ISD A;  4DLE A;  2CPR A;  4JWN A;  4U7C A;  1K1S A;  2OXO A;  2DUY A;  3SV4 A;  4O3O A;  5KG7 A;  1NK8 A;  4YMN A;  1JMS A;  5KG5 A;  1JN3 A;  3AL0 B;  5ALR A;  1LKY A;  2XID A;  5J8Y C;  5KFG A;  4F71 A;  2BPF A;  2W9B A;  1KFD A;  3ZD9 A;  1SL2 A;  2G09 A;  1BPB A;  1ZJN A;  1L7P A;  2VA8 A;  3RAQ A;  1RQN A;  3NRW A;  3TFR A;  4OD0 A;  1S97 A;  4DF8 A;  2AU0 A;  1N63 A;  2JZB B;  8ICS A;  2KFN A;  1NK4 A;  1L8L A;  5AK5 A;  4IS7 A;  4Y2U A;  2PFP A;  1PZN A;  5DG8 A;  4MFF A;  1ZQA A;  3VCB A;  7ICE A;  2R8K A;  4CF3 A;  3KHH A;  3C5F A;  3BZK A;  5G5G A;  4CE6 A;  4UAZ A;  1A76 A;  3TAD A;  4ZH4 A;  3QEB Z;  4EBD A;  5J2F A;  5AM1 A;  3ZD8 A;  2DQN B;  2KZ3 A;  9ICI A;  4NLK A;  3OSN A;  4DL3 A;  4XA5 A;  4YXJ A;  4MHV A;  3RH6 A;  2IHN A;  4KLH A;  3NAS A;  4TQS A;  2Q4T A;  4UBC A;  4C8M A;  5J0P A;  5DQG A;  1EXN A;  1L3S A;  5DB9 A;  5KFY A;  2PMZ C;  1ZQN A;  4UB1 A;  4DQQ A;  1BPD A;  5IIL A;  1NZB A;  3A0H U;  1VDV A;  2HOQ A;  1TFR A;  2ZJA A;  4Y2P A;  2AQ0 A;  1DK3 A;  4RQ7 A;  1S10 A;  4NLN A;  4DQR A;  1L3U A;  3TI0 A;  2DBY A;  3L4P A;  9ICJ A;  2OEH A;  3PW5 A;  3E2E A;  3WKD A;  5AKX A;  2ZUC A;  3RB6 A;  3EWA A;  5AKI A;  2Y0S C;  3K1R B;  3BQ7 A;  2QB0 A;  3C29 A;  4DOA A;  1NK7 A;  3M9N B;  2KJ5 A;  2P35 A;  2KHQ A;  2BCV A;  1Z1B A;  5AHX A;  3QUB A;  2KIW A;  1B22 A;  4DFK A;  1M6Y A;  4ACO A;  4KN7 A;  3MR3 A;  3RR7 A;  3SEN A;  2FLN A;  1ZRN A;  1RQL A;  3THV A;  2FDR A;  5ALW A;  3OPX A;  3RB3 A;  1O03 A;  8ICP A;  5L1I A;  2BQU A;  4GXK A;  4ECT A;  2VJ5 A;  1MN8 A;  4NLZ A;  2KD1 A;  4M6W B;  4O9M A;  3BS5 B;  2JV3 A;  1UHU A;  1GO3 F;  4P4O A;  4C8K A;  5J0S A;  2C28 A;  2KSO A;  4DFM A;  2GH1 A;  3KKA A;  2ESE A;  8ICA A;  1SV4 A;  3RH5 A;  5J2J A;  1QSL A;  2KNJ A;  3T5J A;  9ICV A;  5KFV A;  2GLE A;  1TK8 A;  2YML A;  3NS1 A;  1ZQR A;  2DPJ A;  5K4L A;  3AUO A;  5KG2 A;  4Y2T A;  4IR1 A;  1SZP A;  2H5X A;  3C2K A;  2PMZ F;  2VA2 A;  4J9N A;  3I1Y A;  5E79 U;  2LPE A;  3V6J A;  2W7P A;  4F4Y A;  3H8J A;  5CP2 A;  7ICU A;  4DOC A;  2HHX A;  3GIL A;  4QIW F;  2OWO A;  5CJ7 A;  1ZQL A;  5DG9 A;  3QU7 A;  3BQ1 A;  3HPO A;  4CGZ A;  4UB3 A;  2NRX A;  3DDH A;  2FMQ A;  3QUC A;  2HDO A;  8ICM A;  2Y0S F;  3ONN A;  3LYS A;  2R18 A;  1X40 A;  3F53 A;  4F4W A;  5KL8 B;  5EWE A;  3AQF A;  4UAS A;  2ZXI A;  2W9C A;  1Z4N A;  3UQ2 A;  3H8S A;  2FI1 A;  2ZTC A;  2GO7 A;  4DLG A;  3H7I A;  1SL1 A;  7ICF A;  4PL1 A;  1Z00 B;  2W3R A;  1PUZ A;  3UQ0 A;  4O0I A;  3RB4 A;  3KBB A;  4EX6 A;  2FMP A;  2RRD A;  5ALX A;  2A1J B;  2J6T A;  4Y2Q A;  2MRL A;  4R8U B;  3D2S A;  4QZA A;  2LM4 A;  4QZ8 A;  4YP3 A;  9ICU A;  3OHA A;  1ZQB A;  5KFR A;  3H0L B;  4HYK A;  2Y1I A;  8ICN A;  8ICK A;  3RJF A;  1QTM A;  1DXS A;  3RB0 A;  5HML A;  2YQE A;  5AK6 A;  3PY8 A;  2E8P A;  3UMB A;  2YMP A;  2ZIU A;  4I2I A;  1N60 A;  1DRG A;  2KG5 A;  5BOM A;  4IRD A;  3D6J A;  2FMS A;  5KFT A;  4UAR A;  4DL5 A;  4F5R A;  2XVT A;  3PVX A;  1Z00 A;  2C2D A;  3IM1 A;  2KMD A;  1ZQP A;  3ORY A;  4P0Q A;  4ECR A;  4C80 A;  3JPQ A;  2FPL A;  3IRU A;  4QZF A;  2JH7 A;  2AH5 A;  3FYH A;  4R63 A;  1U47 A;  4KN4 A;  1ZD5 A;  4TUR A;  4ECQ A;  3TQ1 A;  1TK5 A;  2MAX A;  2W3S A;  3HRD D;  1N61 A;  4CF5 A;  1ZQS A;  4NM2 A;  2HVI A;  1Q3U A;  3H0R B;  3UMG A;  4GFJ A;  4FS2 A;  2P6R A;  4I28 A;  3OJS A;  4AYB F;  5J0O A;  5L1J A;  5ALZ A;  1NK9 A;  2V4Q A;  2LYB A;  3RJJ A;  4QZC A;  2CXY A;  2E8O A;  1ZQJ A;  1X2I A;  4F93 B;  5CWR A;  1KQQ A;  3QZ7 A;  1ZQC A;  5KFS A;  1ZQD A;  1Q46 A;  2G06 A;  3FAH A;  2PKE A;  5J0R A;  4I2A A;  4EYI B;  2RDI A;  3JPP A;  2CRX A;  3QU2 A;  2NRZ A;  2IOH A;  4UB5 A;  1ZQU A;  4ECV A;  1S0N A;  5AI6 A;  4ED2 A;  2K8B B;  1Z1V A;  1YZ6 A;  3N7P D;  3NTU A;  3QU9 A;  1U4B A;  4RUA A;  4EEL A;  1RYU A;  4LVS A;  4J9O A;  5AM4 A;  2Z7J A;  2W54 A;  2FPM A;  3EPG A;  2HBL A;  3KZX A;  2JH1 A;  2DF4 B;  9ICN A;  2YMQ A;  5L9X A;  4KLM A;  1SWV A;  2LI6 A;  3UM9 A;  1TAQ A;  4DFJ A;  1ZQM A;  1SIJ A;  2VAN A;  3G6X A;  1PK1 B;  2WF5 A;  1IM4 A;  5J2H A;  5DLF A;  4CDG A;  4R66 A;  3B9J A;  3TKA A;  2NRW A;  5AKJ A;  1RZT A;  5DLG A;  2K89 A;  4R64 A;  4YD1 A;  3KHG A;  4G3I A;  3ISC A;  3IHQ B;  2V4R A;  3AQE A;  4F5Q A;  2PXI A;  1SL0 A;  1NJW A;  3WKC A;  2BGW A;  3Q8P B;  3BDP A;  3UXN A;  3C28 A;  1L5U A;  4BXO B;  4BGD A;  2MSN A;  1TE2 A;  5ALQ A;  4RT3 A;  1RXW A;  4RQ5 A;  3RH4 A;  2AQ4 A;  4UB6 U;  3BQ0 A;  3AU6 A;  5CEH A;  3KFU F;  1T4G A;  4YR0 A;  4BUG A;  1JIH A;  5KG1 A;  9ICB A;  2XGP A;  1UA1 A;  2ZIX A;  1PK1 A;  4USA A;  1ZXI A;  3GDX A;  5B66 U;  3LDA A;  4Y2V A;  2JMG A;  5AI0 A;  5D4B A;  2E5S A;  3GQC A;  2ZIV B;  5J0W A;  3PX0 A;  5KNI A;  2BCR A;  5J2B A;  2PI4 A;  4RQN A;  2C22 A;  1JRP A;  4KX5 A;  3MBY A;  1NJZ A;  4I29 A;  3WK8 A;  3SYZ A;  3T5K A;  2EZY A;  1K5O A;  4RNO A;  3KOO A;  8ICT A;  5DBA A;  3QUQ A;  7ICQ A;  1ZQG A;  4PGY A;  3RFA A;  2XY5 A;  3IP4 B;  4BXO A;  2I1Q A;  4CNQ A;  1MSW D;  7ICJ A;  5ALS A;  3EYZ A;  4EYH B;  2KN7 A;  2GWS A;  1ZYQ A;  2YN4 A;  3PO4 A;  1B43 A;  4J9P A;  4EEY A;  3AU2 A;  3RTV A;  4C7Y A;  5J0T A;  3QUT A;  2YY6 A;  3TFS A;  5KG4 A;  4M0A A;  1KEJ A;  7ICV A;  3PO5 A;  2KVC A;  3V72 A;  4A8E A;  1KRP A;  1PVR A;  1U9L A;  4DQI A;  2K8C B;  4PGX A;  3BQ2 A;  4C4R A;  2WB1 C;  5EOZ A;  3AM9 A;  4DOB A;  1ZQ1 C;  2F1I A;  5J0Y A;  3WU2 U;  2PFQ A;  2XGQ A;  1L6N A;  1ZQQ A;  5BPC A;  2BQR A;  2BQ3 A;  5KFB A;  2W7O A;  5ALY A;  3GV7 B;  2H3Q A;  1MQ3 A;  2AHO B;  5KFO A;  4JWM A;  7ICS A;  3ZDC A;  1DOQ A;  3PSI A;  3GIK A;  4DL6 A;  3PSP A;  5FP0 A;  3RJG A;  4KMU A;  2E8N A;  4TUP A;  2ALZ A;  3MC1 A;  3GV8 B;  1WCL A;  4I2H A;  5ALV A;  4EZ9 A;  2IBK A;  1PK3 A;  4C7Z A;  9ICL A;  1XNS A;  5HR7 A;  3SAH A;  5J0U A;  1NK5 A;  2W8K A;  1KN5 A;  2JXJ A;  2HBK A;  3TAC B;  4ED3 A;  8ICY A;  5DB8 A;  4F91 B;  1SV0 A;  2JHD A;  2HHQ A;  1QH9 A;  2EZZ A;  4O3N A;  2AGP A;  3M8S A;  1L7O A;  1NNL A;  4PL2 A;  4FO6 A;  4KLT A;  4YQW A;  5KFU A;  1X9W A;  4I2B A;  4TUQ A;  5DDY A;  2JRZ A;  2IA6 A;  4RUC A;  4HAI A;  1XWL A;  4DEZ A;  3KTQ A;  5J0Q A;  4B9U A;  2DKZ A;  1BPZ A;  5KFM A;  2LM1 A;  3FC4 A;  2F2A B;  8ICG A;  1PVP A;  5AM3 A;  2OM6 A;  3S6J A;  8ICR A;  1ZRM A;  2JZB A;  2KIC A;  3ZDD A;  4M47 A;  5JTI A;  4G9B A;  1CRX A;  3ETR A;  4RPX A;  2WTF A;  5G5H A;  3OHB A;  4UQG A;  1SWW A;  4OCZ A;  1X66 A;  2BCU A;  1WWU A;  2EH9 A;  4MF2 A;  2O6K A;  1QQ6 A;  4CRX A;  1UCV A;  3G6Y A;  1ZQH A;  4UBB A;  4PHP A;  4Q43 A;  1IG6 A;  3QXG A;  2FLL A;  3R9K A;  2K4P A;  1XU4 A;  2WF6 A;  3K1Z A;  4KLI A;  4KLJ A;  5EWF A;  3ZDE A;  2FPK A;  1SKW A;  1X6I A;  3KKA C;  3C1Z A;  3HP6 A;  2F44 A;  1S77 D;  4M9J A;  3PML A;  2MUT B;  4NXZ A;  4F50 A;  4IL6 U;  3QU4 A;  2KJ9 A;  4UB2 A;  4QZB A;  4QWE A;  4GIB A;  4UAU A;  2F1H A;  4ECX A;  1T3Q A;  5AKZ A;  5CRX A;  4DSF A;  4J9K A;  1JUD A;  5KFN A;  4NLC A;  5AM0 A;  3RJK A;  2PI5 A;  2ASL A;  3KHL A;  1KBU A;  5KFF A;  1IXR A;  4ED8 A;  4DL7 A;  3ICX A;  4PHD A;  4M2Y A;  4OJP A;  1QQ5 A;  4Y2J A;  2N1R A;  8ICQ A;  1L7N A;  4US9 A;  5DG7 A;  4WJ3 B;  2K8A A;  1NJY A;  1B0X A;  4ECW A;  4F5O A;  3WK5 A;  2UVW A;  4EEN A;  3HT3 A;  5J29 A;  2BKE A;  5HHH A;  2F8K A;  1O08 A;  1XSP A;  2HHU A;  3WK6 A;  2XY6 A;  5KFK A;  5HP4 A;  2ZG6 A;  4F4Z A;  5GTH U;  3JPR A;  4BWJ A;  3EZ5 A;  2F77 X;  3QEA Z;  4RQM A;  5DKW A;  4TQR A;  9ICS A;  3HJE A;  2OH2 A;  4DQP A;  2I5H A;  4O5E A;  4YMM A;  5AKY A;  3SMV A;  4F4K A;  3HKZ C;  5KFP A;  4F5P A;  2HOI A;  4M6W A;  5ALE A;  2NRV A;  3BS5 A;  4DSJ A;  5KFL A;  4YMO A;  5IIM A;  3GIM A;  1NOM A;  2XO7 A;  7ICO A;  3JPT A;  5AIB A;  3Q8S B;  4GLX A;  2KIV A;  4DL2 A;  1ZQV A;  9ICG A;  3SQI A;  1RDF A;  4F5N A;  1TVA A;  3VC8 A;  4FE3 A;  3RJI A;  4TUS A;  3LWL A;  3PW4 A;  4OJL A;  5DGB A;  1IIP A;  1JXE A;  1T94 A;  4OJ5 A;  1MC8 A;  4YR3 A;  3ZDB A;  4NL9 C;  3M9O B;  7ICK A;  2WFA A;  7ICP A;  5EE1 A;  3ZDA A;  4PZO A;  1UPH A;  4QWB A;  5KFJ A;  1URJ A;  2JGA A;  5AM5 A;  2VA3 A;  4DO9 A;  1XSL A;  3Q8Q B;  4ECY A;  2E3T A;  2RQ5 A;  3A0B U;  2ZXH A;  3QX7 A;  4IR9 A;  3OGU A;  5H2F U;  7ICG A;  1A77 A;  3H4D A;  3H8W A;  4O3Q A;  4O3R A;  1S9F A;  3QU5 A;  2KFZ A;  3B0X A;  9ICX A;  1NZP A;  5CR0 A;  3V7K A;  1HUZ A;  4OO1 J;  4O5K A;  4MEY A;  3K75 D;  2KVS A;  3C21 A;  1BNO A;  2A1J A;  3F2C A;  4PJ0 U;  5ALI A;  2W11 A;  2B0C A;  4KIT B;  3WKA A;  2ATL A;  4R8U A;  4EZ6 A;  4RZR A;  4LZD A;  2HOF A;  3RAX A;  3JPS A;  4DSE A;  4XQ8 A; 
#chains in the Genus database with same CATH homology
 5JRT A;  1KW4 A;  1F0M A;  2E8O A;  2E8N A;  2QKQ A;  1SV0 C;  4NJ8 A;  3KKA C;  3SEI A;  1PK1 A;  2F44 A;  1V38 A;  2QB0 B;  1UQV A;  2QAR B;  3TAD A;  1PK3 A;  3TAD C;  2B6G A;  3BS5 B;  5KNI A;  2JV3 A;  2DL0 A;  4RQN A;  2YTU A;  4MHV A;  3TAC B;  2EAM A;  2KSO A;  1SV0 A;  2QB1 A;  2F3N A;  3KKA A;  4NL9 A;  2ESE A;  1SV4 A;  4PZN A;  1Z1V A;  4NL9 C;  1OXJ A;  3H8M A;  3IDW A;  1DXS A;  2GLE A;  1OW5 A;  4PZO A;  2FE9 A;  1X9X A;  2E8P A;  1B0X A;  2KE7 A;  1B4F A;  2EAN A;  2KG5 A;  2LMR A;  1SGG A;  2D8C A;  2F8K A;  2ES6 A;  2KSO B;  2KMD A;  2D3D A;  2EAP A;  2QAR A;  2DKZ A;  1COK A;  3HIL A;  2Y9T A;  2DKX A;  2E8M A;  1PK1 B;  5JU5 A;  2LPE A;  2Y9U A;  5JTI A;  1LKY A;  2L5Y A;  4RQM A;  5J8Y C;  2EAO A;  5L1M A;  2K60 A;  3K1R B;  3BQ7 A;  1JI7 A;  1X66 A;  2QB0 A;  1WWU A;  1V85 A;  5F3X B;  1UCV A;  1WWV A;  1SXE A;  3BS5 A;  5J8Y A;  1RG6 A;  3BS7 A;  2K4P A;  1X40 A;  1LKY B;  4IS7 A;  3SEN A;  1SXD A;  2KIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...