1UCXA

Crystal structure of proglycinin c12g mutant
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
457
structure length
367
Chain Sequence
IQKLNALKPDNRIESEGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQGGSILSGFTLEFLEHAFSVDKQIAKNLQGEKGAIVTVKGGLSVIKPICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPFKFLVPPQES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycinin G1
publication title Crystal Structures and Structural Stabilities of the Disulfide Bond-Deficient Soybean Proglycinin Mutants C12G and C88S.
pubmed doi rcsb
source organism Glycine max
molecule tags Plant protein
total genus 89
structure length 367
sequence length 457
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ucxA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ucxA01
2IXJA 1CAWA 3WW1A 1J3PA 1RC6A 4IEZA 1WA4A 1ZZ9A 4KWKA 4AQ2A 2UY9A 3OGJA 3CO2A 3ACLA 2ET1A 3E5UA 3M3IA 4N9HA 2VQAA 3GYDA 5C8WA 4WZCA 1UIKA 2H6BA 5JSPA 5JSRA 1ZZ7A 3EO6A 1UCXA 1VR3A 3FWEA 3OCPA 1NZCA 1VJ2A 1GQGA 2ATFA 2GU9A 4IETA 5BY5A 4AXOA 4LTAA 1VP6A 3NVCA 1UPIA 3LOIA 4LA2A 2N7GA 2IXKA 4I0BA 4L11A 3KSCA 5LEJA 3NSTA 2V09A 3OD0A 4BH9A 3S7EA 1RUOA 1XE7A 1XRUA 1ZZ8A 2VPVA 1LB2A 1IPKA 3U10A 1EY2A 2XKOA 3H1MA 3OF1A 5FCCA 2D5FA 3H1YA 5F1RA 4PJYA 1WLTA 1FI2A 3HQXA 2XLFA 4EV0A 2KXLA 5J3UA 2GC1A 4LUMA 2IXHA 1X7NA 3UKTA 1SFNA 4XFAA 2UY8A 4D7SA 1LR5A 1CAWB 1ZRRA 4K8FA 5JSOA 1O7FA 1WGPA 3B02A 4I01A 4KWJA 2QCSB 1YUDA 1ZRFA 5FQ0A 3E6CC 1U12A 5BPXA 4F8AA 5KHKA 2GC0A 4MZUA 3FJSA 1G6NA 4E2QA 3H3ZA 5FDBA 2D40A 5I0RA 1OFNA 1OMIA 3FX3A 1CAVA 4PIYA 4QXKA 3OTFA 2BNNA 1L3JA 4Q0QA 5FLJA 3SCFA 2PTMA 3E6BA 4HLTA 3S7IA 4MUVA 4BHPA 1EPZA 1X8MA 3DL3A 4OLLA 4R8HA 4XFGA 5I0TA 3D0SA 2GH2A 3RYPA 4JVAA 2OZJA 3ELNA 3HIFA 3I59A 3WW4A 4META 4O9EA 1SEFA 5EZWA 3SMHA 4IEOA 4Q29A 5CADA 1YHFA 3L2HA 4I09A 1ZVFA 2MNGA 3HT2A 3WW3A 1PMIA 4TLFA 5KHHA 1LRHA 2B8MA 3RPQA 2BYVE 4X6RB 2XKPA 4QGNA 4ONUA 3ROUA 4XF1A 3KGZA 2IXCA 3CL1A 3U0ZA 3HT1A 3IIAA 4HN1A 3EHKA 3EBRA 4XF0A 1YFUA 4XFCA 1HW5A 2OZ6A 1CAXA 4YARA 4PIXA 4HN0A 3FFQA 3EJKA 4EWDA 4AVBA 3TNQA 1CAVB 2C0ZA 2XL7A 3MPBA 4MGKE 4Z82A 3LA2A 5FLHA 2E9QA 3WW2A 3FZ3A 1LKNA 4EWAA 5I93A 4WVZA 4F7ZA 3LWCA 3USSA 2IXLA 2Y0OA 2BGCA 2O8QA 4JV4A 3DKWA 4YRDA 3H3UA 4RD7A 5E16A 4XF3A 1CAUB 3SCGA 4AVCA 3DV8A 3I59B 2PFWA 1YLLA 4MV2A 1XE8A 5BXXA 1H1IA 3E6DA 3I54A 4QGLA 3H9AA 5I91A 3SXWA 1O3SA 3RNSA 3H7JA 3D0JA 4J1WA 2VECA 1NE4A 4FT8A 1OI6A 4EROA 3SHRA 2H0VA 3LA7A 2Q1ZB 2Z2SB 2K9ZA 3H7YA 4E2GA 4YNIA 4DINB 3PLQA 1QXJA 3CF6E 1QWRA 3H1WA 1CAXB 1EYBA 2Q4SA 1RGSA 3UKVA 4HVOA 2PYTA 5C6CA 2Z69A 3QOPA 4IEWA 2OA2A 1JUHA 2GC2A 2D5HA 4N9IA 1X82A 3R6SA 1Q43A 3RZZA 4KWLA 2EAAA 1ZX5A 2Q0AA 2HJIA 2DCTA 4HMZA 3QACA 5CU1A 1QXRA 4OFGA 5JAXA 4X6QB 2BNOA 2ZCWA 3I7DA 2XL9A 4IEXA 3RYKA 5E1RA 4HSJA 4LLOA 1O3RA 2CAUA 1NYWA 5I8YA 4J1XA 2PHLA 3E5XA 3NKTA 4ORFA 4IEUA 2D93A 5JR7B 3BU7A 3CEWA 1CAUA 2XLGA 3LA3A 3ES1A 4YYOA 4IERA 1ZRCA 1J1LA 3D82A 1OD5A 5I8SA 4FAHA 5KHIA 5JCTA 3KGLA 4MGIE 1GQHA 1UIJA 3H8UA 5KBFA 4IEVA 2EVXA 1ZRDA 3PVBB 4MGYE 4ZU4A 2OYZA 2O1QA 2UYAA 5CVRA 3IDBB 4KU7A 4XF4A 4UBHA 5D1IA 4ZU7A 1Y9QA 4I2OA 1J58A 3MDPA 2QJVA 3LZZA 1DZRA 4JTNA 2K0GA 5FLIA 3KMHA 5K8SA 2PAMA 2XHKA 3IDCB 4P9GA 3IWZA 3H50A 4L2NA 3FHIB 3FE5A 1FXZA 4AVAA 4UXAA 3KCCA 3E5QA 2CAVA 1SQ4A 4Q0SA 2FMYA 4IEQA 4Q0UA 3S0MA 4O9GA 1RTVA 1FT9A 3EQEA 1J3QA 4EWEA 2GC3A 2H6CA 3GBFA 2MPFA 1YWKA 3LAGA 3SCHA 3TNPB 2BNMA 4Q0VA 4KU8A 4Z07A 4ZU5A 1J3RA 1UW8A 4CYDA 3CJXA 2PAEA 2B5HA 5LRSA 3BCWA 1RUNA 1QY4A 4B29A 4FAGA 2ETEA 5T3NA 1ZNPA 4H7LA 1IPJA 2B9UA 3MYXA 4LEJA 1YFWA 2CGPA 3PNAA 4XFIA 4LUKA 1RL3A 1V70A 3M70A 4PIZA 4JTOA 3ST7A 1DZTA 3O14A 2WC2A 5KHGA 4IEYA 2UYBA 4WBBA 3BB6A 2GAUA 4HBNA 5I0UA 5LEKA 5I0SA 4R52A 4QMAA 1PM7A 1I6XA 4HZFA 1O5LA 1CGPA 4HVRA 2PA7A 3G7DA 2I45A 4BYYA 2QNKA 4E2SA 1YFYA 4I3PA 2QVSB 1TQ5A 2XLAA 2PHDA 3N4MA 1DGRA 1Q5OA 2F4PA 2PQQA 4GULA 1DGWA 2FQPA 2IXIA 4YSFA 3IBMA 4I02A 1Y3TA 4NVPA 4AQ6A 5I8TA 4KL1A 4XEZA 2PAKA 1UD1A 1NE6A 5FPZA 1H1MA 3MZHA 3E97A 3BALA 2GZWA 4XFBA 5HI0A 4MH0E 3RDIA 3NJZA 1YFXA 2HKXA 1ZZ6A 3ZDSA 1EP0A 5J48A 1I5ZA 1ZREA 4UBGA 3RYRA 1J59A 2P17A 2WFPA 2IC1A 4QM8A 2Q30A 4IESA 5BV6A 4HVQA 3NL1A 2ET7A 4XF9A 3C3VA 2MHFA 1CX4A 3ETQA 1O3TA 4QM9A 5FPXA 4XFFA 5EFUA 5AVPA 3ES4A 4XFHA 2QDRA 4I0AA 4XETA 4QGMA 5LRRA 3JZVA 2CV6A 2BEOA 2OPKA 3DN7A 3NW4A 4D7TA 4FBFA 3UKNA 1O3QA 2EA7A 1ZZBA 5J7MA 5KHJA 4HSLA 3VHRA 3CLPA 1X8EA 1Q3EA 4BIFA 1ZZCA 4A2UA 2XGXA 1NXMA 1O4TA 4IEPA 4MGZE 2ZKLA 1O5UA 4LULA 4QX5A 4MX3A 3BPZA 5FQ0B 5BUVA 4LA3A 4Q0PA 3U11A
chains in the Genus database with same CATH superfamily
3MF6A 4KMQA 4Y3OA 4IEZA 1IHMA 1J84A 3NNFA 2EXIA 3M3QA 1UZWA 4A44A 5F39A 1Y7BA 3ASIA 3GZUC 2UY9A 3VZOA 2UU8A 3ACLA 1V0AA 1S0CA 4ZXKA 3POEA 3RS6A 4Z2WA 2RVAA 4WZCA 4OYUA 2OPWA 2VQUA 3ENRA 1UIKA 2H6BA 2Z4FA 1I5PA 1NA1B 2BP6A 2C4XA 1ZZ7A 3OSDA 3TEYA 4B4RA 1I3HA 3PVOA 3FWEA 3OCPA 4AFCA 4CUCA 4K1YA 4K6BA 1VJ2A 1GQGA 3FBYA 3O7OA 1QH6A 4NHXA 3ZR5A 3O0WA 1LGNA 4AXOA 1K5JA 3POBA 2RDQA 2YPDA 1UPIA 3MW4A 4IV1C 2JIGA 5EV7A 1K5MC 3CMGA 1ZRIA 2XQRA 5F2WA 1W3XA 2Y6GA 4LA2A 3RG0A 2R7EB 3V56A 5LW9A 5F32A 4I0BA 1BMV1 4Q4Y3 1LOAA 3TEWA 1XNBA 2LROA 1C8NA 3ZN6A 4CDQC 5E89A 5FO9B 5EIYB 4BMEA 5JPNB 5E8AA 1C3HA 3S7EA 1RUOA 1XE7A 1XPWA 1XRUA 4AEMA 4Q8KA 5CKQA 1ZZ8A 2AZ5A 2HWC2 2VPVA 2P37A 2GNTA 3CBNA 4FPGA 4AVTA 1REDA 2OVUA 1DYKA 2HH9A 3W59A 2A75A 2NLRA 1G9DA 4BB3A 5L9BA 2WR9A 1ENQA 1VE0A 2P6CA 3U10A 4CDXB 1VBC1 3B7MA 3ZDVA 4JDOA 1CWPA 2D5FA 2AYHA 5A3WA 2R041 2RS51 3LSEA 5DZFA 4PJYA 5F1RA 1OA3A 4UW5A 1W0OA 1WLWA 4AHXA 4PBOA 4CCCA 4EV0A 2KXLA 5DZGA 4BISA 5J3UA 2GC1A 1NA1C 4LUMA 1HRV3 4R9DA 5F7UA 3ZXGA 3K4DA 3LOBA 1LR5A 2IUWA 2ZZQA 4CU6A 4F83A 4QX3A 1UMIA 4O65A 4QB6A 1K5MA 1CAWB 2GMEA 1LCLA 1FPN3 2E31A 4UYBA 5CB7A 4TTGA 2JKBA 5F6LB 1O7FA 5B2GB 4ATEA 3VBHA 2BPA2 3AXDA 1D0GA 1AXYA 4CDQA 1KITA 1QJX3 2VJXA 3ZSLA 1IKQA 4R4ZA 2D44A 1KD7A 1QJY3 4EZHA 3DUIA 1ENSA 3TEZA 5FYZA 3WDTA 2VOTA 2VO5A 3ZPOA 3GCXA 4CDXC 3NJYA 1ASJ3 2E7TA 5F5CA 1L3JA 4Q0QA 3I3EA 3M4FA 5LCWL 2PTMA 4LK6A 4YZ4A 1SLAA 2D6KA 2DVGA 1EPZA 2HWC1 1X50A 3DL3A 4JKMA 4Q1PA 2FZ1A 5IVYA 2VZVA 1CJPA 2VNGA 4COUA 3N7MA 4YM3A 3JD71 4GIQA 4IV3C 1PZ9A 2OZJA 3AMNA 1RMU1 3ELNA 4GAZA 1UWWA 3HIFA 4WVWA 2QQKA 3U78A 1DIWA 4GH4B 4M4RA 1OOPB 2R072 2RMU3 2F6BA 3OY8A 1G8WA 1PX4A 3SH4A 3U07A 1WBLA 5DN2A 2QQJA 1D7PM 2QUOA 1OLQA 1W8NA 4IEOA 4MGQA 1QEXA 4Q29A 4YGEA 5FIXA 5FZ7A 4L97A 5F37A 2ZA9A 4R9BA 3JCIA 1YJLA 1NLSA 3A0NA 3GBWA 1KFXL 4A42A 2WBKA 5GM0A 4NR1A 2XJQA 1UOBA 4CDXA 1QF3A 1OQEA 1GWLA 1GU3A 2XKPA 4CCDA 4PDWB 3O0XA 4WZFA 1UX6A 3AVSA 2IXCA 3CL1A 1IOAA 4HN1A 2HWE1 3N7LA 4QPWA 3EBRA 4DUVA 2UWBA 1YFUA 3IDAA 2XQXA 3AB0A 1Z0HA 3RZGA 1HW5A 2JE7A 4NWVA 2R062 2YBPA 4RGAA 3GHNA 4E4DX 3WNPA 5FXXA 1R1A3 2VBBA 1FOD3 1LU2A 3FFQA 4AI0A 4LLFA 5CA6A 4GH4C 2JDNA 1OOPC 3ZIXA 4HK9A 3U4XA 3H3LA 4OUSA 4M0NA 3LCPA 4PI2A 1LKNA 2DTWA 3M3OA 3ZYGA 2WZR2 1VRH3 1PO13 2BERA 1DQ6A 2R6QA 3HVDA 4F7ZA 2IXLA 2W2IA 3WNMA 2BGCA 1GWMA 4XUNA 3VZNA 1R093 4FFGA 4ET7A 2R071 5BNPA 1OVPA 4RR3A 4ARXA 3T0DA 5FPUA 1H4HA 3IB3A 3ACFA 4C1WA 1UYZA 3C7OA 2PHWA 3I3QA 4QPGA 4PDWC 4C0BA 5L9VA 4OUMA 4MV2A 3ABZA 3OEAA 4ZS2A 1IZ3A 2WNOA 2J1RA 1GOGA 1R083 1QH7A 5IW0A 1XC6A 5BNOA 2QDNA 1CZVA 4YZ5A 1GR3A 1Q56A 1O3SA 1IS3A 4LKSA 2Z79A 1OOPA 3D0JA 1DQ4A 3N7JA 5FY7A 4J1WA 3LKJA 4K1ZA 3T4VA 1VBE2 5CAZA 2BQPA 3RI9A 1OI6A 1EUTA 1AR72 3SHRA 4BQXA 1SLBA 4GQ7A 2WQ8A 3LA7A 5IWFA 4NIGA 5FOJB 1TE1B 2E51A 1U5IA 3SKJE 4XJUA 3TN91 1HRI3 4W6YA 1C1LA 4INDA 5BNNA 4XUQA 2HWD3 3QBQA 1HDKA 1W6NB 2BZDA 3PLQA 5ANNA 1COV1 4DINB 1FATA 5FYTA 1QXJA 4XUTA 2XPJA 1SFYA 3H1WA 2DCZA 4NIAA 4CP1A 1BEV3 3KT7A 3PTYA 1DG6A 1VBA3 4PDWA 2HWF2 3POJA 3LEIA 3QLQA 3UKVA 2DF7A 5CG9A 3A0KA 2WWJA 3O1UA 4HVOA 5A1LA 3NKGA 2KM2A 1H30A 1JYIA 1OA4A 3R4UA 2OA2A 3D8CA 2RE9A 3WP6A 1QJFA 3N7KA 3AL5A 2GC2A 1QJEA 5F5AA 1JU3A 5CG8A 3VBFA 1VB4A 4N9IA 2QQIA 4GXLA 5FK8A 5A7WA 3R6SA 2EAAA 5JXGA 1ZX5A 1BBT2 2Q0AA 3WHUA 5IVCA 1G86A 1GNZA 4HMZA 4Q4X3 5HV4A 3LD8A 1RUF2 1US3A 4TWTA 3T2QA 2OUHA 4URAA 1DZQA 2BNOA 1JS9A 4LO6B 1VBB1 4DNYA 4MOAA 3RYKA 2QQPA 5C3QA 1O4YA 4IGPA 4BCUA 2CAUA 2P6HA 3J8F1 1YQ8A 2DTYA 4R9CA 5A1FA 3RZKA 5T5OA 1DP0A 5I8YA 3POGA 2YC2A 2WNUB 2PHLA 5EJZB 5JLVA 1RINA 4ORFA 4IEUA 2D93A 2ZMKA 2CTVA 3VLBB 2YHJA 4CDWB 3MIEA 1Q8QA 3OPWA 3LA3A 4W6WA 1QXPA 4SLIA 4IERA 3RJ2X 3D82A 1RUD2 3W58A 5JCTA 1SLTA 1NOVA 3MLLA 4MGIE 2ZHNA 5FWEA 3RZJA 2RR11 1BJQA 2G19A 1ST8A 3PVEA 5D2AA 5FYBA 2EVXA 2R16A 5FZHA 3LSDA 1XBFA 3MLKA 1ALYA 4UOJA 4CUAA 5F3IA 2O1QA 2UYAA 5FZFA 1QOOA 1A6CA 4Q5OA 2Z42A 3Q8BA 4UBHA 4RA0A 3VDBA 1LHOA 4HKWA 1FNYA 1QHDA 3A4UA 2VG9A 3LZZA 2JKXA 3ME2A 4QDSA 1VALA 5FKCA 1O59A 1LHVA 2W0XA 4EN9B 3THCA 1JZ8A 2WNUC 3EMRA 3NAPA 1S0JA 1K42A 1RUF1 1ZA4A 5HCHA 3IDCB 2ZGLA 1P8JA 3AZVA 5F3GA 3T0AA 4OZXA 3GM8A 4CDWC 4RGKA 1KS4A 1GMMA 1CESA 4QKFA 4UXAA 1V6MA 2RJ2A 1VIWB 2X10A 5DZEA 5ACA3 2P1BA 2VY0A 4BM8A 1W2TA 1XNAA 2ZX3A 4GWMA 3S0MA 2VNOA 4QX8A 3KT4A 1PNFA 4I3GA 1YQ6A 3EQEA 3PUQA 2ORZA 1SLLA 3VD3A 4BE3A 1WCSA 5JDBA 3GBFA 4ES8A 1S0DA 5FY4A 1RUD1 1ULPA 1Z7S3 2J1TA 1TVGA 3M7AA 2A71A 1HXS1 1WUVA 1WMFA 1AYM2 3MIDA 3ZN5A 1VLNA 5EWSA 5FPVA 1AR61 3IM0A 3BKZA 1POV0 4ZU5A 3RSJA 4LXLA 2CSGA 4CYDA 4OQ8A 1SBDA 4NPRA 4S2GA 2ZBJA 4N7IA 2PAEA 2B5HA 4YVSB 4AE2A 5LRSA 3BCWA 3GHMA 1ND3A 3CDZB 1W0PA 3VKNA 1QY4A 4B29A 4CDWA 5GZCA 1MQTB 3KLSA 3J4UH 3MYXA 3JBG3 2CGPA 5FP3A 2WKKA 4IE7A 5CFDB 1LGCA 1RL3A 1PZ8A 3ZSJA 3APBA 4AHZA 4YVWC 4FPYA 2Q5TA 2FCVA 2GMMA 5FY1A 3U37A 2FZ2A 3O1OA 3ST7A 2WN2A 1L7LA 4YGDA 2J42A 2GSYA 1HKDA 2HLEA 4HPKA 1PK6A 3BB6A 2VNRA 3BI3A 4L0PA 4HBNA 2KR2A 4GB33 4PF5A 4FPHA 4LR4A 1HB4A 2PHTA 5FYYA 4BQ4A 2QE3A 2WLQA 4JAAA 1CGPA 4HVRA 3OGSA 3RYPA 2ZGKA 3G7DA 1DQ0A 4BYYA 4LBKA 1KJRA 1W2NA 1PVC1 1YFYA 1VAKA 2XB6C 2XH6A 5FP8A 4P5YA 3UNPA 5FPBA 1WCKA 4C0HA 4LKEA 1AVBA 4QHOA 4YVSC 2WT1A 1VB2A 2VOWA 2Y60A 2J7MA 1AYN3 5HV0A 1Q5OA 5FZGA 2PQQA 1JU4A 1YQCA 3BPSA 4GULA 1MQTC 2VXRA 4XZPA 5FZ1A 1AR83 1WLCA 5JOYA 2IXIA 1AJOA 4H3WA 1OH4A 2X29A 1TMF3 2BUKA 3KCXA 4JDMA 2MEV2 4KG0A 3U14A 1V9U1 1JODA 3OUJA 3AX4A 4PHZA 3ZXDA 5I8TA 2VH9A 4XEZA 1MVEA 4LKFA 5GJ6A 4RHV3 3M8LA 2CL2A 5C4WB 1BVP1 2DYCA 3BALA 1YI7A 2Q8OA 1GUIA 2EIDA 5LBEA 1PO21 3LEMA 5T50A 3AKQA 2JJ6A 4XHXA 4JRAA 3ZDSA 1F5FA 1YIPA 4OI2A 3AKPA 5J48A 4OI1A 1I5ZA 1ZREA 1Q8VA 1XU1A 1AHSA 1WCQA 4XQ4A 1UOGA 3DPRB 1SPPB 2I2SA 2JDYA 2Q30A 3LF7A 2GH8A 5BV6A 4HVQA 3NL1A 4AOCA 2MHFA 2RM23 1C5IA 2XJSA 3B3QE 3KF3A 2R0HA 3VBRA 5CFDA 1C4RA 2ZHKA 4Y22B 1YNAA 3HNBM 5AVPA 2LALA 4Q4V3 3CIHA 4XFHA 3IAQA 3TRSB 5FY8A 3KV6A 3R05A 4I0AA 4QX1A 5C4WC 2E6VA 2E7AA 4OULA 2CV6A 2PELA 3LQCA 1NXD1 2WT0A 3NW4A 4D7TA 1Z78A 1O3QA 1VBD2 4D3WA 4DUWA 2TEPA 1JI6A 1YCIA 2YBSA 4AI3A 4D7YA 1JZ4A 2OKXA 1W04A 4HSLA 4I0WB 4B3NA 1Y9GA 1UXZA 3ZYBA 4AGVA 1ZZCA 3FN9A 4JGZB 3VKMA 4B1MA 3JQWA 5AC93 1YRZA 3DPRC 2JIJA 4PF1A 2JICA 2Y6HA 4KWUA 1W8TA 2A3XA 4UF0B 2WNVB 4CUBA 2VOXA 4CEYB 2IVIB 2AENA 2VCAA 3PUIA 5EYYA 4WM7B 1J3PA 2AC1A 3CQOA 1MS8A 3VGIA 1WA4A 4AF9A 3WY6A 3LB9A 1ZZ9A 1CN1A 4KWKA 4AYUA 1YXWA 4AQ2A 3HN1A 5K7PA 1H0BA 2ET1A 1E5RA 3M3IA 1AXZA 2E7QA 2ZEWA 4N9HA 3VBOA 2VQAA 4XQDA 1WMEA 4ES9A 2VL4A 3GYDA 4MGTA 2XWJB 4KQ7A 4OHVA 5C8WA 4Q4W1 3DKQA 3HBZA 3ZXEA 3BTYA 3AJYA 3OPZA 3U1XA 3HNMA 3VDDA 5JSRA 5FZ9A 3BU0A 3JU9A 3MGUA 4Q4Y2 2ARXA 3KWVA 1QJU1 2ATFA 2AEZA 2R30A 2YBKA 3AFGA 1JZ6A 1SLCA 2D3RA 3C7HA 5A32B 3NVCA 4B7EA 4EN8B 1SBEA 1SPPA 2A6XA 2RS13 3FC0A 4JGZC 3IKWA 5IK7A 1KRIA 2ZX4A 3RZHA 5FY0A 4NHMA 5F3EA 5FR3A 1AL21 1CQ9A 2WNVC 4B4PA 3VD9A 4FOYA 3KS7A 1PIV3 4CEYC 1MZFA 2ADEA 3B00A 3ZFGC 2SBAA 4WM7C 4XOGA 1LTEA 3ZX7A 4M3CA 5FAXA 1HRV2 1IPKA 5F8PA 2AREA 2Y34A 3GCWA 1CVNA 3WDUA 2XBO3 2XKOA 4KBZA 3CKHA 4LHKA 3TWIA 5BYNA 1BK0A 1UYXA 2NZ9A 5FMCA 1Y4WA 1FPN2 5FP4A 3SISA 1SHWB 3WX5A 3KCYA 4UFKA 3N3HA 4PQQA 1X7NA 4YW1A 3UKTA 1VAVA 1QJX2 4TLGA 5A3LA 1TZOA 4D7SA 1RHI3 5A3OA 1IQAA 4URTA 5FZ8A 2YUEA 1ZRRA 3HN3A 1XQNA 2VNVA 4JGZA 4U36A 1QJY2 5FZOB 2Q8CA 4XHBA 3DECA 3B02A 1OXCA 4I01A 4KWJA 2QCSB 1SDDB 2ZGSA 2XJPA 3WQ0A 2VUAA 3WQBA 1LAJA 3WD5A 5LASA 1HQWA 4CEYA 2QTWB 5BPXA 1ASJ2 5LA2A 2B46X 4MZUA 4RL7A 4AGRA 4QB2A 1W03A 2NMOA 1W8ZA 3HWJA 3ZYPA 1RUC2 4E2QA 2BBVA 3NJXA 3H3ZA 3MUY1 5FDBA 2D40A 2XJRA 3SH5A 5LWBA 5H9PA 4YFWA 1V6KA 2G4IA 1X36A 2PXJA 1T2XA 2WAOA 1CAVA 3FX3A 2JDPA 1U5ZA 5B4XA 4QXKA 5FZCA 1F15A 3OTFA 3JB8A 4Y5TA 4M01A 5FLJA 4FPFA 4AI9A 2OS2A 1C8M3 3NNMA 3PJQA 2TNFA 5IFPA 3FHAA 3LIGA 3AL6A 4MUVA 4Q27A 3MV01 2RMU2 4R9AA 1X8MA 3ZLIA 4R8HA 4XFGA 4XXPA 1JOBA 3ZN6B 2NQYA 1QQP3 5I0TA 4LBLA 3M3CA 3Q8EA 1SBFA 4Y33A 3HPNA 5A32A 3JUUA 3NRUA 5L7OB 4IGQA 3AMQA 1LEMA 5FWJA 1RJ8A 3O1VA 3CNAA 3I3MA 1FPN1 3I59A 3WW4A 4DXTA 1MS4A 2ARBA 3OBZA 4META 4AEJA 2W3JA 2XWBB 4LBQD 4QQHA 3VBSA 2FDFA 5DAXA 3SMHA 2RJLA 3AKTA 4QX0A 3NV1A 1QJX1 5KR7A 4P02B 1OKQA 1TEIA 2VMGA 2Q8EA 2VZTA 4LO8A 4NAMA 1UY0A 1ZVFA 3N9OA 4UI9L 3WW3A 1GYKA 1PMIA 2UWCA 3M1HA 4TLFA 4C90A 5IVFA 1QJY1 5KHHA 1MEC3 3C2UA 1ZA7A 4M3CE 3NV3A 4BOWA 5CEHA 5FZ6A 2BYVE 5FZMA 2W68A 2JECA 3AYEA 4ONUA 4ASKA 2PLV1 2YFUA 1R1A2 3VBHB 1FOD2 1HN0A 4Y26A 4AQTA 4B8EA 2RG4A 3UL2A 4A6SA 4OHYA 2Y38A 2YY1A 2GNDA 2HWB1 5GZGA 2O14A 4HKOA 2DCYA 4LPLA 1CAXA 4NHKA 3UK9A 4IUGA 1RUG1 4PIXA 1VRH2 1PO12 3QCWA 4HETA 5FZOA 5FP7A 3LIHA 5L7OC 4CXYA 3EJKA 3VKFC 2GNBA 2JXAA 4KBBA 1R092 2YU1A 4UFJA 5FK7A 3T09A 4AL9A 4AVBA 4DS0A 3ZOIA 2XL7A 3MPBA 4H55A 2RMU1 2R0FA 4E8CA 4PLNA 3NMBA 5FYUA 2WS91 2PQSA 4XAEA 3IT8A 3WQ1A 1IGOA 1STMA 3S6PA 3ZSKA 5I93A 1DYPA 4FXGB 3PMSA 5C3RA 5D8AB 2JE9A 1JYNA 4QDRA 4X8PA 3KHCA 1NCQB 1J1TA 3DKWA 4JV4A 4YRDA 3ZXJA 4Z92B 2XG3A 3OBTA 2VC9A 2C6SA 3H3UA 3PUSA 1X9TA 1BYHA 2L9LA 1R082 4H14A 4RD7A 4TYSA 4Y1ZA 3TEXA 4CEWB 3SCGA 4TXWA 1S2KA 1RVF1 3DV8A 3AKRA 4W8JA 4FFFA 1GV9A 2BV4A 3OY8B 2FBEA 3VBHC 1YLLA 5JXIA 3AK0A 4MXVA 2FDIA 4FSJA 1XE8A 5BXXA 3WF3A 3H9AA 3OUHA 5APAA 3VDCA 2ZX0A 4FTSA 5L7OA 1UKGA 4ASMB 4BIOA 1HRI2 4LT5A 1HN1A 1MS1A 2VTFA 4XJ8A 2HWD2 1GP4A 4N90A 4YWAA 1S4CA 1X33A 1NE4A 2P4EA 3TOJA 4GJZA 2H0VA 5LB6A 3C8XA 3VL9A 2VMHA 1BEV2 2Q1ZB 3PU8A 4L8QA 1VBA2 1XYOA 4GKXA 1TME3 2K9ZA 2YXSA 1AX0A 1HJGA 1ULEA 2VUCA 4CDUA 1PO11 2LUWA 3WDWA 5D8AC 5DDJ3 5GZFA 5JUVA 2JG9A 1NCQC 1R091 5DPNA 1QWRA 2JD9A 3D4KA 1JW6A 3T3YA 5EJ1B 4E8DA 2VAUA 1WWYA 5FTTC 1U5YA 1RUI3 2GN7A 4E4ZA 5E88A 1RGSA 4CEWC 3KF5A 2CYFA 2D3PA 1OH3A 1S0IA 4MHRA 2W1WA 2RJKA 5C5TA 2VZQA 4Q4X2 4AEDA 3K4AA 2Z69A 1RUE3 1OQDA 1UY4A 4Y1VA 1OBNA 4NIIA 1LULA 1PM4A 3WINE 3B94A 4D94A 4LE4A 2NPIA 3RZZA 4KWLA 2DCTA 5A3UA 4L92A 2A5ZA 2VBPA 5LK5A 3SITA 3MFCA 2A3WA 1AR93 2W47A 1QXRA 4W50A 5BNPB 5HXVA 1MS0A 4RR3B 5KXCA 2ZCWA 3ILRA 2XL9A 4CCMA 1JZ7A 2J22A 5FZLA 3V64A 1RUC3 4QPGB 1L7QA 2BFUL 4LLOA 3T30A 2Y6JA 2ZJCA 5D8AA 3RZLA 3PU3A 3HNYM 2RS33 5KWRA 2YV8A 1NCQA 1NYWA 3KV4A 4FFHA 4A45A 3ZSMA 3NKTA 4LQRA 3ALQA 5JR7B 3CEWA 2ZGTA 1XSQA 5BNOB 5ISLA 1NT0A 4MG2A 1XXNA 2DFBA 1N1SA 2W9XA 5FXZA 3UGFA 1HLCA 2WNEA 4YYOA 3WG1A 3FFZA 4COWA 4XBNA 4DB5A 1OD5A 1LJ7A 1N3OA 1W9SA 5KHIA 1OC1A 3KGLA 1GOHA 1IS6A 5FKBA 3H8UA 5FYVA 5KBFA 4N53B 1QOSA 4QKBA 2YGLA 1PGW2 1RB8G 2OIIA 3VHOA 5BNNB 1OHFA 2J1AA 2CDOA 1BZWA 3PVBB 1SZBA 4ZU4A 2OYZA 4LITA 5DG2A 1JYCA 5BNPC 5JI7A 1LHUA 4RR3C 3DCQA 4K8RB 4GALA 1H2KA 1UAIA 1W05A 2XONA 4XF4A 4IL7A 4ZU7A 4IXLA 1RUJ3 1Y9QA 3AZXA 4QPGC 4I2OA 3I2FA 1EPWA 2JDHA 3AKSA 4JTNA 3I97A 4BU2A 3KMHA 2E26A 5ACA2 3IZOA 4FQZA 3VBFB 5A7WB 4ZPIA 3UGGA 2CU5A 5HBAA 2X05A 2DCJA 5BNOC 3H50A 4QU1A 5JPMB 5CZKA 4LORA 4Z2AA 2VE1A 3D3AA 4NUBA 1O4ZA 4OMCA 1Z7S2 3WF0A 1OUXA 4JC1A 5FXVA 1W3VA 4FI9A 1NZIA 4ISRA 1WD3A 5C8CA 1E5IA 1CPMA 1F9KA 1J3QA 5BNNC 5JZGA 1W0NA 4EWEA 2GC3A 1IPSA 1DFQA 3KVAA 4OMDA 4CRQA 5LZ6A 1YWKA 1BK1A 1CIYA 4LMFA 2NN8A 3ATGA 3RGBA 5IFTA 5A6YA 1AZDA 1ZBE3 3SCHA 3ZPYA 3TNPB 4RFT0 3HOBA 4XMAA 4PQ9A 3UETA 1B35A 2XHNA 2YPJA 4NO4A 1MS9A 1POV3 1UXXX 2R043 1MZ5A 3KV9A 3PIJA 3JBG2 4M00A 4Q0VA 4QPYA 1J3RA 4CSWA 2FDHA 1SG3A 3CJXA 4YM1A 4YFZA 4DXRA 4LK7A 3DYMA 1JOJA 2NMNA 4Y4RA 3PIGA 4BMBA 1UMZA 1RUNA 3VBFC 1WW7A 3WNLA 1S2BA 4AQSA 1IPJA 1FNZA 2B9UA 4BXSV 2J1UA 4XJZA 1WD4A 3WDYA 4ZHNA 4NHLA 2W1SA 4D69A 1H9PA 2VTXJ 2G1MA 4GB32 1V00A 4HONA 2XJUA 2ZABA 2QQWA 3MICA 4N53A 4YW7A 1DZTA 2R061 5ACA1 1YEWA 3PUAA 3MLJA 4KGQA 4IEYA 3RRDA 5LA1A 4WBBA 1QOTA 4NIDA 1GZTA 5DG1A 2JB8A 3NAPB 3THPA 3WNNA 5I0UA 1QIQA 4LHNA 1F8VA 5A7NA 4CCJA 5LEKA 4BK4A 4R52A 4QMAA 1Z7S1 3Q8FA 1LODA 1AYN2 2ZAHA 1MPXA 2WQ4A 2WZR1 1PNGA 3N9NA 5K4LA 2WO3A 3PVNA 1AR82 2QQNA 4DFSA 4YM2A 1TMF2 3N9QA 1JYTA 3QD6A 3OEBA 4XTMA 3VV1A 3N4MA 3AZZA 3AMPA 2Y6FA 3CU7A 4HANA 4RHV2 2AEYA 3NNJA 1QGLA 1UU5A 2WFF3 3JD73 3T2TA 5CFDC 1RMU3 4LE3A 5FY5A 1DGWA 4DY3A 3O1RA 2FQPA 1W6MA 3IBMA 3KQ4B 3O1PA 3JBG1 2Y33A 3AP9A 1BLZA 3GBGA 2QFEA 3HEIA 5A3PA 5KC6A 4AFBA 4XUOA 3ZR6A 1SFPA 3PMEA 1H1MA 4LO5B 5DXDA 1CIWA 3CZUA 4OUEA 1PZ7A 1A34A 3MHZA 1OD3A 4XIOA 1AX2A 4BLIA 2IFWA 4KI5M 3NJZA 1F35A 1VBE1 3ZYHA 1ND3B 4OI4A 1EP0A 3NAPC 1AR71 4BJ0A 4GB31 4LNVA 2RDNA 2RM22 4QX7A 4UBGA 3WXPA 4EJRA 3AP7A 3QH6A 2P34A 5K9YA 2WFPA 5FUPA 2HWE3 2IC1A 2DDUA 3VHNA 3VUOA 4Q4V2 1LOEA 4XF9A 4ZXEA 1KQRA 2HWF1 4HPKB 1PK6B 3ETQA 4CXXA 1AYN1 2P5BA 3IMNA 1Q8OA 1M4WA 4QU2A 2BWAA 2ZEYA 5FPXA 4XFFA 1AR81 3T0BA 1XU2A 4BWOA 1TMF1 3Q8AA 1N1YA 4A7ZA 4E4SA 3WNKA 5FUIA 3WSOA 2E63A 4OCTA 1BBT1 4C1XA 1H2LA 3OBRA 4RHV1 1W8WA 1UF2C 2OPKA 5F9TA 5AC92 3I2HA 1N3PA 4CTEA 4NPLA 1ZZBA 1CR7A 1ND3C 1ZBA3 4AGGA 5IK4A 4YGBA 1X8EA 2ES3A 1A8DA 1CJDA 3ZSEA 1Q3EA 1UX7A 2VZSA 1YQ5A 3NV2A 2XGXA 2VW0A 3WV6A 1O4TA 4A41A 1O5UA 3ON7A 1ENXA 3MIBA 1CZTA 1PVXA 3OYWB 4GD4A 4JQTA 4LULA 3WNOA 2VZRA 4AVSA 5LBBA 1DHKB 1K3IA 4RQPA 5FQ0B 1UOJA 5BUVA 4LA3A 3FLRA 4CUGA 2VW2A 4QKDA 3U11A 3AP4A 1AF9A 1PK6C 3LPGA 3NNGA 3PTRB 5L36A 1Y43B 5JXHA 2TBVA 1E57A 3OGJA 3OBAA 3SEPA 3B69A 2ZGNA 4OZOA 2B4KA 3TN93 4K20A 2BJSA 3ZXKA 4JHZA 5EJ3A 5HCBA 5IK8A 2D43A 2RS12 1COV3 3EO6A 3VD4A 3MF9A 2OT7A 1VR3A 3K3NA 3FUQA 1NZCA 1BVVA 3VBRB 3U4SA 3DXUA 1ODNA 4LJHA 4IETA 1DLLA 1FMD3 1PIV2 2HEYF 2V73A 1L7RA 4LTAA 3D5OA 4QT6A 4HXCA 1QKQA 1PX3A 1RXFA 3LOIA 3BOPA 2ZGPA 4JGYB 5A6QA 1H8VA 2IXKA 3BODA 2J1EA 4L11A 4MLOA 2XBO2 2A6YA 3NSTA 3V0BA 2V09A 2AACA 3OD0A 4BH9A 1KS5A 2VVDA 2R32A 2HBTA 2ARAA 3BYWA 4P08A 5JWPA 3Q9OA 3ZFFB 5CBLA 1LB2A 4EN0A 3CZJA 1EV13 1OKOA 3T1MA 3O0VA 1GWKA 1NY72 2LS6A 3L2YA 4GMP1 1VBB3 2VULA 4AEKA 5IVJA 5LY1A 1RHI2 3TBDA 1XNCA 1G7YA 4NMIA 3H1YA 4XIKA 3ZYFA 1YIFA 3J8F3 2GN3A 3KB5A 2XLFA 2ZGMA 3N9PA 4P9IA 3KV5A 2DU0A 4QPIB 2ZHMA 1ULOA 3A23A 1SFNA 4N8MA 2JX9A 4BQYA 4E9KA 1NQJA 1UQXA 3HJRA 2HEWF 5DUWA 3VBRC 3VD5A 4YPJA 1AYM1 4MXWA 5FZAA 2A6WA 1W6QA 4DOUA 3PHMA 2GDFA 4B4QA 1O91A 3LDRA 3X29B 3MI8A 3T1LA 4G3YC 3OYWA 2LW8A 2WA4A 1LOBA 4K40A 1W6OA 4E4HA 5FYCA 1YUDA 4AZZA 2IZWA 1W06A 3J9SA 4JGYC 5FQ0A 2C9AA 2RR13 3VBOB 4YG0A 4DEQA 3E6CC 2C26A 4F8AA 1LOFC 3GZEA 3AZYA 2DFCA 3FJSA 4D6QA 1G6NA 4BQ2A 2UURA 1C8M2 3VDDB 4YW2A 1DCSA 3WR0A 4A6OA 3ZFFC 1IKPA 1V6JA 1DYOA 3EB7A 4WVMB 4XJWA 5FMOL 5JR2A 1OFNA 4Y20A 1QQP2 2BRTA 4ZY9A 5JOZA 4XAAA 3WG3A 4A4AA 2X53S 4EYUA 4YW3A 3SCFA 3KHBA 5LY2A 3E6BA 4HLTA 2TUNA 3SH3A 1LU1A 3DF0A 1N1TA 2EIBA 4BHPA 5K0UA 4NPMA 2PHXA 5JVVA 4V1PA 1UZYA 1NY71 2GH2A 4JVAA 4LHLA 1RHI1 4CZSA 4Y1UA 2FDGA 1FX5A 1F4HA 5FZDA 5IK5A 2UWAA 4M3CB 3RJRA 4JGYA 1MEC2 3GALA 1M06G 1SEFA 1ACCA 2OXBA 1LOFA 3RVHA 2EXKA 3HBKA 3WDXA 4BQWA 2XVGA 5LBCA 4LKDA 3VBOC 1KGYA 4COVA 5CADA 3I2GA 4I09A 3ZFFA 4W65A 2ZEZA 5GLWA 4XQWA 3OOXA 1E5SA 4XILA 3VDDC 5SV8A 2MEV1 2VTXA 2EF6A 2J1SA 2D6NA 2B8MA 2VMFA 5IAVA 3RPQA 4X6RB 1HXS3 3WNXA 2WIIB 3M2MA 1MS3A 4QGNA 3ROUA 2NP0A 5J36A 4XF1A 1AR63 4WV8A 4CU8A 3O1MA 5A1AA 4NRQA 3HT1A 4QPIA 1C8M1 2EXJA 4MSVA 1G9FA 4XF0A 4WM8A 4EE2A 3ZN4A 1JTZX 4XFCA 1CX1A 2QQLA 2IWGB 2XXZA 3OD4A 1XNDA 1CPNA 1K45A 1OLMA 1YO8A 5SV5A 1KDMA 5CIRA 5C9AB 1IQDC 2WO7A 3AJZA 4Z8BA 3E1F1 3VDAA 3TNQA 2QQUA 1CAVB 4C91A 4LOSA 2VR4A 1T6BX 1RUH3 3LA2A 2I74A 2XJVA 4O7XA 5FLHA 3WW2A 4YW5A 4WVZA 1MR5A 1OVSA 3USSA 3MIHA 2Y0OA 2O8QA 2VM9A 4WVMA 4CP2A 2YZ4A 1B09A 4QWNA 4CCNA 4UFLA 2VU9A 5F5IA 3ORJA 2VVFA 1D4M3 1HV0A 1MS5A 1MEC1 5E16A 2W87A 4CXWA 5C7GA 2WZ8A 4IE6A 1CAUB 2VMIA 2W91A 3L9JT 2RDSA 4ZONA 4M3CF 5GKAC 3MV11 2B42B 3BN6A 3I59B 5A70A 3LGRA 3N9MA 1G9CA 2QZ3A 3EYPA 3OB8A 4XCAA 5FZ4A 1PVC3 2PFWA 1H6XA 2BTVC 1VBD1 3BGAA 1HIXA 2XJTA 1AX1A 3VBSB 1H1IA 1GBGA 4ZZ8A 3E6DA 3I54A 3RZMA 5LA0A 1WW6A 2G9GA 3THDA 2W1UA 1DGLA 1US2A 1REEA 1TME2 2P3YA 1QNWA 2WAAA 5LA9A 4W4ZA 5CFCB 2PHUA 5JIUA 5C9AC 3W5MA 3ZFEA 5DDJ2 1FYUA 2VECA 3WVJA 4DXZA 2EIGA 4EROA 3O1SA 1F4AA 4LO7A 4NROA 3TAYA 4C8DA 1W2OA 1ULCA 4NWWA 2Z2SB 1RUI2 4CA9A 2YMZA 2GP5A 2WT2A 3HQUA 3AVRA 4GJYA 3H8OA 1PO23 3N9LA 1ND2A 5FO8B 4FTEA 1RUE2 3DYPA 1CAXB 2W08A 1EYBA 2PN5A 5C3SA 1RYYA 4OI0A 2D98A 1JBCA 3NNLA 4WVVA 2BOIA 2WABA 4YG6A 2PYTA 5B4NA 5C6CA 3QOPA 3WCSA 1AR92 3IMMA 2ZACA 3OGVA 3R4SA 4Q4Y1 3VBSC 2D5HA 2JG8B 4QD2A 1X82A 1KEXA 1BCXA 1Q43A 1UN1A 1WMXA 2ARCA 1A8MA 2QZ2A 2ZGQA 5C9AA 4NOTA 2HJIA 5FZIA 3K75B 3VN4A 3I49A 2RS32 2DVFA 1OT5A 1OLME 1W8HA 2ZEXA 1D4VB 3POIA 2OUJA 4DEVA 5DUXA 2DURA 2GMPA 2C5DA 2A7AA 4X6QB 5JI9A 2QQOA 2WO2A 3AXEA 2ZPXA 2BW8A 3I2KA 4UFHA 4MVTA 4HK8A 5A33A 4QQOA 5E1RA 4QAWA 2RV9A 3C7EA 4HSJA 3ECQA 2VMCA 4S2DA 1UY1A 2VOVA 4AI1A 2Y64A 2OQ6A 3P1IA 3OGGA 1W99A 4BQ5A 1JZ3A 3VB9A 2ERFA 1HRV1 4J1XA 5FMOS 5FO7B 3W21A 3K46A 4B1LA 1W6PA 5DDJ1 1KFUL 3BU7A 3WEZA 1CAUA 3I8TA 3UESA 5T5LA 2K2SA 2XLGA 1Y9MA 2A70A 4P14A 5FJKA 5FRAA 1TNFA 4CP9A 4NRPA 2OW4A 4QQLA 1JZ2A 3O5SA 2WRAA 1J1LA 1N3QA 2A6VA 2SLIA 4LBQA 5I8SA 4S2HA 4FAHA 1MZEA 4N43A 1UIJA 1QJZA 1NCRA 1GANA 1WBFA 3JXSA 4PLOA 2JG8C 4IEVA 5FYSA 1AUYA 1LESA 3IAPA 4FQ4A 5CNAA 5T54A 5CFCA 1JYXA 2GALA 1VMJA 1RUJ2 5FYMA 1MVQA 4BLJA 4CDUB 3J7MA 1ENRA 3B9CA 4MGYE 3AYDA 2JG9B 3VZKA 4CE8A 4RSUA 1OLRA 1GFF2 3ZO0B 4EZ4A 3IDBB 1AR91 4QQPA 3VBUA 4ZKTB 3PURA 3GJAA 1ASJ1 2BGPA 5D1IA 2VUDA 4AK3A 5JXJA 2W94A 1RUC1 1EAH3 4AEDB 3ZXFA 3MDPA 4FOVA 2X5IA 2RS31 5FLIA 1GZCA 4CCOA 2OX0A 1DDLA 1V6OA 4FPKA 1V6NA 2NM1A 3LFMA 2PAMA 1UZZA 2FMDA 5K8SA 3IIIA 1QJU3 1LHNA 3IWZA 1QMJA 3USUA 4AAPA 4L2NA 4HFSA 4NE9A 1ZYBA 3FHIB 1W8OA 5GLTA 1FXZA 5E6HA 4ASLA 4AVAA 1DBNA 3E5QA 3S5AA 3R0RA 1O6UA 5G04L 5AVAA 1ZBE2 2G9FA 1UL9A 2JG8A 3B9IA 4IEQA 4Q0UA 4JKLA 1NX9A 5AFBA 1AL23 2FHRA 4RYDA 3JQXA 4XJAA 2R042 4XUPA 2QQMA 1FV3A 5M0TA 4CDUC 5HCFA 2Q1MA 3ZM8A 2ZOEB 4E27A 1OSGA 4L9BA 2JG9C 3J7LA 2FCUA 2C24A 4GMP0 2VZOA 4Y1YA 5DUUA 5T5PA 3OGRA 5J37A 1GZWB 4FXKB 4DO0A 1C28A 1RUJ1 4XE9A 2YU2A 4AEDC 2FDJA 1JYWA 4JCKA 4BK5A 4TZDA 2VCCA 3NV4A 3RWNA 3KZ4C 4Y24A 4FAGA 3C7FA 1QU0A 1XB9A 5T3NA 2D6MA 4H7LA 5JOXA 1YI9A 4Z1VA 4LEJA 3S5QA 1E5HA 1YFWA 1R1A1 2Y0IA 1FOD1 3FMGA 3KQRA 3PNAA 3I3DA 2PHFA 4LUKA 4XDQA 4LO4B 1V70A 4FP3A 3WQ7A 4XDOA 4V2VA 4PIZA 5FJHA 1N47A 1V6IA 3POWA 3O14A 2WC2A 3CHXA 2ZZJA 4ZZ5A 4XXAA 1VRH1 2UYBA 4QXHA 4UFMA 2JDAA 3IPVA 3RMXA 5C3OA 2GAUA 3GNEA 1YYNA 1BHGA 1SDWA 2G9ZA 4ISQA 1PHMA 1WA6X 4H2AA 1IS5A 1PM7A 1ZBE1 2DV9A 4HZFA 2W95A 3JD72 2WFF2 2V4AA 1RMU2 3I2OA 2I45A 5IT6A 1POV1 2QNKA 3AP5A 4FOQA 4LOTA 4XVHA 3HD8B 1OFSA 2QVSB 5EXOA 1TQ5A 1W8FA 4J25A 3I3BA 2F17A 1WLDA 3AMMA 2PHDA 2YDEA 3K2OA 3PUHA 1R081 4LBJA 5F5QA 4KNCA 5C8CB 4AFAA 1DGRA 4FPOB 3A7QA 5JZGB 4GZ9A 4FPLA 4IV1A 4IV3B 2QBXA 2V5YA 1RIRA 3F95A 4FTBA 3ZYRA 2W92A 4I30A 1Y3TA 2XVKA 1HV1A 4OHWA 5F6KA 4AQ6A 4KL1A 3TYJA 1B35B 1HB3A 2GP3A 2JDZA 2ZS6B 1NE6A 1HB2A 4RFRB 4AVCA 1HRI1 2C9KA 3E97A 2GZWA 2HWD1 4XFBA 4HG6B 3MW3A 4P9JA 2AR6A 2HWE2 1W2AX 3RDIA 1YFXA 3NJVA 5A6XA 4HKLA 1ZZ6A 2BVVA 3P6BA 1LHWA 3FL7A 1BEV1 5ANQA 2ZGUA 1VBA1 2VZUA 1GZWA 3RYRA 1AL0G 1J59A 2EALA 2R49A 1URXA 3WP3A 1ULFA 1JUIA 2PLV3 1H2NA 2WJSA 5C70A 4PCRA 1UMHA 3LDKA 3KM5A 2ORXA 4IESA 1NA1A 4QM8A 1U0AA 1UYPA 3ZIWA 5JMCA 1PGL2 3ZVXA 2VZ3A 2HWB3 4AFDA 2V4VA 2BGOA 4DRVA 4W6XA 3C3VA 3FHQA 1PGSA 5C8CC 1RUG3 4FOWA 2YFZA 4P9XA 4QDQA 2W46A 1WCDJ 4QHZA 5FFOC 5JZGC 1DQ2A 1WW4A 5T5JA 5A7OA 2WFF1 3K51A 2D6PA 3POYA 4Q4X1 5CISA 1BKZA 3ES4A 2ZGRA 4IE0A 5FP9A 3FLPA 2ADDA 1ZBA2 2WS93 2QDRA 4CPBD 1B35C 4XETA 4CPBA 1FAYA 1IG0A 2QKDA 2WWSA 3URFA 4QGMA 5T55A 2A6ZA 3SNMA 5C33A 5C3PA 4NAOA 2EICA 5EQUA 4XMIA 3JZVA 1JH5A 3DN7A 3INAA 2VMDA 5EPAA 4FBFA 3RI8A 2EA7A 2BWCA 3HR9A 4OHZA 3WF4A 2D6OX 4DZGA 3M3EA 1YC61 5AFEA 2FD8A 3I4IA 4Q1RA 5J7MA 2D6LX 1GSLA 4KGGA 3VHRA 3CLPA 2VD7A 4U2AA 1GP6A 1RITA 2EIEA 1OPOA 1RVF3 1W6MB 2W39A 2W52A 3LFIA 1S0BA 4BIFA 4CCLA 4A2UA 1SLIA 1NXMA 4EQVA 1VRBA 2ZKLA 4HL0A 4PLMA 4N53C 4CP0A 1KXGA 4QQ2A 3BPZA 2JD4A 3AP6A 3DGTA 3LDBA 4RGGA 4H7MA 3BIEA 3TN92 4IV3A 4Q0PA 2CWSA 2IXJA 2IVJA 1CAWA 3WW1A 2B45X 1RC6A 5FZKA 3P5BA 1COV2 2AUYA 2DU1A 4YM0A 1VBC3 3BUCA 2J1VA 2XOMA 3CO2A 3LE0A 1PGL1 1C1FA 3E5UA 1ODMA 4ITCA 2RS53 1PGW1 1S2EA 1FMD2 3MBWA 5DAVA 5FOBB 4HT1T 4COYA 5JSPA 2ZX1A 2BDRA 1UCXA 2JDUA 3WG2A 2ENRA 1DQ1A 3I2IA 3BVCA 4YW4A 5IUQA 2QQVA 1AJKA 2GU9A 2VVEA 3H42B 3PL0A 4XBQA 1ZBA1 5BY5A 4M0HA 4FP2A 3WHTA 4DRRA 3G6JB 1VP6A 1U5XA 3P3PA 4A3XA 2O0OA 2ZX2A 2WINB 3T08A 1R64A 3B93A 3DYOA 1EV12 2P3KA 5H9SA 5ABJB 2N7GA 2AH2A 2RHPA 3UV9A 2ZMLA 3KSCA 1VBB2 5LEJA 1V6LA 5CKMA 1ULGA 3AC0A 2Y6LA 2YC4A 3A22A 3J8F2 2P3IA 4GH4A 1H4GA 2D7FA 2DCKA 1ONAA 2WN3A 3POFA 3H8RA 1EY2A 1OF3A 3H1MA 5L19A 5L73A 2O8OA 3OF1A 1REFA 3GJBA 2XUMA 5FCCA 3D6EA 3KT1A 1WLTA 1FI2A 3OPTA 2F4LA 2HWC3 3HQXA 5FPAA 1UKRA 2DUPA 4UW6A 3O12A 1H8TB 4JZRA 2IXHA 2YGMA 3W5NA 4XFAA 2VGDA 4RQPB 3SQOA 2UY8A 3ZYIB 2RR12 2BBAA 2V5DA 3J26N 4XBLA 4JRLA 1CZSA 2PHRA 2D97A 4K8FA 4Q8LA 3T2PA 5JSOA 5D21A 1DLCA 1FMD1 3WUDA 3ETPA 1WGPA 1DGWX 1XSRA 4P9WA 3C7GA 1W9FA 2JE8A 4NN0A 5C71A 4J6GA 4NHYA 4FCAA 3DXTA 1ZRFA 1FV2A 2NYYA 5ABJC 2WL1A 1U12A 1JOPA 1UZVA 1HJFA 4P00B 2XVLA 5KHKA 2GC0A 4BQ3A 4EN7B 4XURA 5DABA 2DVBA 4XTPA 3W20A 4MGSA 3BTZA 5I0RA 2GNMA 1OMIA 2WSUA 1CD3G 1EV11 5DQ0A 3OUIA 4YZ3A 2BFUS 4PIYA 3Q8CA 1UYYA 3I2JA 3PDQA 2BNNA 2Z5WA 3FBMA 3P3NA 5L9RA 1XNKA 3S7IA 2ZMNA 4LBNA 4QHBA 3ZXAC 1APNA 5A3MA 4OLLA 1H8TC 3V0BB 3V0AB 1F5JA 4RQPC 1BQPA 3D0SA 1GP5A 4COZA 4ARYA 3LPFA 1OUSA 3MUZ1 1H6YA 5IVBA 3UT0A 5FZ0A 4EN6B 1LOGA 4JQRA 5ABJA 5HCAA 4XJ9A 4O9EA 5EHDA 2C1FA 3ACGA 2FDKA 5EZWA 2KA3A 1O8PA 1GICA 4IE4A 1ZRDA 1HXS2 5DAWA 1D2SA 3UYJA 1YHFA 3L2HA 4MADA 4G4FA 4A7KA 4XCBA 4D0QA 1JHNA 5DAQA 1AR62 2MNGA 3HT2A 4YGCA 5FYHA 1W90A 1Q8PA 4N7UA 4Q2FA 2X09A 4LHSA 2R073 2VZ1A 3NWKA 4BXFA 1JHJA 1LRHA 4A7YA 1C5HA 4AR2A 5CYYA 3AYAA 4XC9A 4MXWB 3K4ZA 1W6QB 4FO9A 1GNYA 1GOFA 2JEMA 3WG4A 3KGZA 2E32A 2JDKA 3U0ZA 4QX2A 1UY2A 3IIAA 1H8TA 5DMYA 3EHKA 4LBMA 5I0DA 1W6OB 3MO4A 4XACA 4CU7A 1W6NA 5FMDA 3OJBA 2CWMA 4P9YA 1RUH2 1SACA 2OZ6A 1YJKA 1CONA 2RM21 4GA9A 4YARA 5ERLA 1J83A 2LTNA 4HN0A 3ZMOA 4EWDA 1DQ5A 2XR4A 4MYEA 4BPZA 1LENA 2C0ZA 4Y20B 5DAPA 4GKYA 3MIGA 4MGKE 2ZAAA 4Q4V1 4Z82A 4YVWB 1D4M2 1OURA 5JOWA 2R063 4AI2A 2E9QA 3SLIA 3FZ3A 3OG2A 1TG7A 4EWAA 3TB0A 1DF0A 3LWCA 1VPHA 4GWIA 5JIAA 2DVAA 4LIUA 4UT5A 4D6SA 5K0UB 4FFIA 4P5HA 1PVC2 5KXDA 2XDVA 4XYXA 2ZHLA 1A78A 1GQPA 2Q1FA 2A73B 3JB4C 5J98B 4IE5A 5J1XA 5A3TA 4XF3A 5C5UA 2WZR3 4DIQA 5IVEA 3POSA 5FYIA 2BOJA 1UY3A 3H0OA 5AC91 1JZ5A 1V9U2 2BVBA 2WNUA 4QXBA 3V0AA 4JKKA 4QGLA 5BNQA 3GZAA 2W5FA 2ZGOA 4IGOA 5I91A 5KC5A 4CVUA 3SXWA 1IS4A 4FPCA 4QB1A 3RNSA 3H7JA 4GWJA 1MACA 3QH7A 1PO22 4IW3A 2VUJA 1W39A 4M4PA 4FT8A 4DPNA 1NG0A 2LRPA 5FUNA 3GZTB 4DQAA 4UW3A 5IJRA 3GDBA 3VZLA 2EXHA 3VL8A 1RUH1 5FMBA 1S0GA 3VZJA 3H7YA 1HB1A 1OA2A 3SEEA 3WZ1A 4E2GA 4YNIA 5HXMA 1POQA 2VOKA 1WCUA 2P2KA 1F2NA 4WM8B 5K0UC 1VBE3 1YQ2A 4GWNA 1DU3D 2YROA 3CF6E 1AR73 1JN2P 1NAEA 5FY9A 2OQ7A 4ATFA 1SMVA 2B9VA 1W8UA 5H9RA 3WP5A 2Q4SA 3ZMNA 1D4M1 3B5LB 1KDKA 1F31A 3BIWE 1GLHA 2RDRA 2VZPA 1H1AA 2RS11 4JDNA 4MHUA 4IEWA 5IVVA 3EXUA 1JUHA 4F3JA 3GF6A 1Q8SA 3CJIB 3NQHA 3J7NA 2K46A 2HWF3 1PIV1 2VBDA 5FV3A 2Y6KA 5FBJA 4G9SB 4KG8A 2LM3A 4XPVA 3B01A 3QACA 4Y5Z0 1I9RA 5LBFA 3KVBA 1LEDA 5CU1A 5H9QA 2FCTA 2I07B 3K77A 4OFGA 4YVWA 5TSWA 3W9AA 5F3CA 5JAXA 5A80A 2XBO1 3I7DA 4JX0A 3MW2A 4IEXA 5IATA 2CDPA 3WF2A 2B39A 1G9BA 5IYYA 3J7HA 4AHWA 1BBT3 3UJQA 3FLTA 4NRMA 3T4HB 4CU9A 1O3RA 1R1ZA 4QPIC 3HAGA 1SCSA 1RUF3 4WM8C 2ZTNA 4BQ1A 5A7QA 3E5XA 4TN7A 2CGNA 4IDZA 1UU6A 1HQLA 3FUOA 2VQTA 1RJ7A 1W9WA 1X9PA 4S2FA 3ZKYA 1WZXA 3ES1A 1UNBA 3ZFEB 1ZRCA 5LATA 2P3JA 3SKVA 1GQHA 2YB7A 2HEVF 4YVSA 5F2SA 3VHPA 1GKBA 3CJIC 1GZ9A 4UW4A 4XDPA 2HYXA 1MQTA 4Y4YA 4Q4W2 4K9SA 3DEMA 1ND2B 1EAH2 5FZEA 1RUD3 2VCMA 2AGSA 4CCKA 2V72A 1W28A 4AAXA 5CVRA 1LOCA 1SCRA 4Y1XA 5GZEA 5GALA 3GGLA 4KU7A 2R1DA 3WOGA 5A6ZA 1QJU2 1N1VA 4K3UA 4QKNA 1VMHA 5DUVA 2WZPP 1J58A 1XOYA 4YLZA 2QJVA 1DZRA 2KD7A 3S30A 3WF1A 2K0GA 3HQRA 3ZKUA 4XZUG 1TNRA 4AG4A 4SBVA 3VZMA 2ID4A 4AHYA 3BTAA 1QQP1 4RS5B 2XHKA 2WDBA 1BXHA 1AL22 4P9GA 2XUEA 5G05L 4AVVA 4DMIA 4D6RA 3FE5A 1QNYA 3ZFEC 2XMLA 3KCCA 2WUHA 3U75A 2CAVA 1W9YA 3GXUA 3F2ZA 5A33B 4LBOA 4YZ2A 5GLZA 1SQ4A 4Q0SA 4BZ4A 2FMYA 3CJIA 4FPEA 4PI0A 2ZXQA 2YC0A 4O9GA 1RTVA 1FT9A 3T2OA 4NIHA 5IHRA 3VKLA 3ZFGB 1I1EA 1LECA 1ND2C 2H6CA 2MPFA 5FREA 4NJ4A 1JMUB 1W6PB 1H2MA 3LAGA 1RXGA 2YYOA 4GMP3 2BNMA 2WSVA 4UWDA 4Q26A 4CP9B 4AFMA 3H8XA 3RWKX 2H0BA 2ILMA 4KU8A 5C4WA 4Z07A 1UW8A 4LBQB 4OQ9A 2ZKNA 3MIFA 4N43B 1EAH1 3R4DB 1NCRB 1JYVA 1W9TA 1EUUA 3ILFA 1H9WA 4P9LA 4BDVB 3MEPA 2Q8DA 4RS5C 3UJOA 4DUXA 2ETEA 1AYM3 1ZNPA 2VQ0A 2DUQA 4DY5A 5FPLA 4PT6A 3VKOA 2WYFA 1V9U3 4XFIA 2EAKA 1ULDA 3DPRA 2CHHA 1D0HA 2VCBA 3VBUB 3IDEA 3M70A 1MZ6A 2A1XA 2DWRA 4JTOA 5GLUA 3I2DA 4XABA 4AI8A 3RMYA 1K12A 5KHGA 4MO3M 3AFKA 1DGRN 1S0EA 2VW1A 2X5IB 4YZ1A 1PMHX 2WWUA 3PJYA 2B7YA 4Y22A 2R1BA 3ZXLA 5LK7B 5I0SA 1I6XA 2WO1A 3ACHA 2YG0A 4HOOA 3USUB 1O5LA 1OF4A 2JWPA 5FXWA 5FZ3A 2Y26A 3WCRA 3WP4A 2PA7A 2WLPA 1UPSA 5KXBA 5T52A 3LEGA 4E2SA 3K48A 4FPJA 4O61A 4I3PA 5IAXA 3K3OA 2DBIA 5EYXA 2DUOA 2XLAA 4N43C 1HX6A 4RS5A 4CEWA 5KXEA 3BTXA 4KH9A 3KD4A 1NCRC 1S0FA 2HYKA 3AZWA 2F4PA 2D3SA 2WZEA 5CFCC 1XJAA 4RN5A 3IN9A 4YSFA 5J09A 1A3KA 4I02A 4K21A 3WDVA 5GZDA 2JDMA 5EP9A 1NQDA 2CGOA 4NVPA 3WLUA 4IQPA 5A3NA 1PMJX 3VBUC 2PAKA 1XYPA 1UD1A 4UF0A 5FPZA 2WNVA 1TME1 1NLQA 3MZHA 4LIVA 2CY6A 2JENA 1D2QA 1UO9A 3ZFGA 2PLV2 1NUKA 4WM7A 5HI0A 4MH0E 5JMOA 3S57A 2X5IC 5A7SA 3WUCA 2MEV3 4YW6A 1OPMA 2HKXA 2VXJA 2HWB2 4TSVA 3O1TA 3HMYA 2Y8KA 3WT3A 4K7JA 1UOFA 1GNHA 1RUI1 1VAMA 2WYSA 3N35A 1RUG2 1NKGA 2P17A 4QXCA 3SC7X 3AM2A 3RQ0A 5FZBA 2WA3A 2A3YA 1XYNA 2IFRA 5A7PA 1RUE1 4BA6A 2PMWB 1WW5A 1QDOA 2VMEA 1G9AA 4FVVA 2HBUA 1VMFA 2ET7A 3UGHA 2WS92 4XW3A 2E53A 1CX4A 1ZM1A 2JB4A 3NO8A 3RFRA 4DXSA 4D8MA 3ACIA 1S1AA 1S55A 1T6GC 1UZ0A 3IPVB 4QM9A 4X8NA 1O3TA 5EFUA 1NLRA 1XNTA 4A3ZA 1LGBA 2W1QA 4L99A 5GLVA 2CNAA 4V2WA 1XE0A 4CCEA 2E33A 4Q4W3 1HQNA 4OHXA 1C57A 1WMDA 3LEKA 1RVF2 1W2UA 3ITQA 5LRRA 5CKNA 2BEOA 3V65A 3AYCA 1QDCA 4YG3A 1BMV2 4R4XA 3UKNA 4AW7A 5HPOA 1JXNA 4PBPA 4UAPA 1OQ1A 5KHJA 3BOWA 4IV1B 1AXKA 4AWDA 1K5MB 3THTA 3N36A 4B7KA 1IG3A 2BU9A 3AMHA 3MFAA 3ZYJB 1LNSA 1WKYA 1UU4A 2X8KA 3MPPG 4IEPA 1VBD3 4MGZE 4UFIA 1VBC2 2WQZC 4OVEA 5J96B 3ILNA 4CDQB 2DVDA 4QX5A 3A21A 4JHTA 4MX3A 4Y5SA 1KJLA 2RS52 5FBZA 3VD7A 4ZS3A 1O8SA 2DBNA
chains in the Genus database with same CATH topology
3MF6A 4IEZA 1IHMA 2EXIA 3M3QA 1Y7BA 3ASIA 3GZUC 2UY9A 3VZOA 2UU8A 3ACLA 1S0CA 4ZXKA 3RS6A 4Z2WA 4WZCA 3ENRA 1UIKA 2H6BA 1NA1B 1ZZ7A 4B4RA 1I3HA 3PVOA 3FWEA 3OCPA 4AFCA 4K1YA 4K6BA 1VJ2A 1GQGA 3FBYA 3O7OA 1QH6A 3O0WA 1LGNA 4AXOA 4IV1C 1UPIA 3MW4A 5EV7A 1K5MC 3RG0A 4LA2A 3V56A 4I0BA 1BMV1 4Q4Y3 1LOAA 1XNBA 3ZN6A 1C8NA 4CDQC 5E89A 5FO9B 4BMEA 5JPNB 5E8AA 1C3HA 3S7EA 1RUOA 1XE7A 1XRUA 4AEMA 4Q8KA 1ZZ8A 2AZ5A 2HWC2 2VPVA 2P37A 2GNTA 4FPGA 4AVTA 1REDA 2OVUA 1DYKA 3W59A 2A75A 2NLRA 1G9DA 1ENQA 3U10A 4CDXB 1VBC1 3B7MA 4JDOA 2D5FA 2AYHA 2R041 2RS51 3LSEA 5DZFA 4PJYA 5F1RA 1OA3A 4UW5A 1W0OA 1WLWA 4AHXA 4PBOA 4EV0A 2KXLA 5DZGA 5J3UA 2GC1A 1NA1C 4LUMA 1HRV3 4R9DA 3ZXGA 3LOBA 1LR5A 2ZZQA 4F83A 1K5MA 1CAWB 2GMEA 1LCLA 1FPN3 5CB7A 2JKBA 5F6LB 1O7FA 5B2GB 4ATEA 3VBHA 2BPA2 3AXDA 1D0GA 1AXYA 4CDQA 1KITA 1QJX3 3ZSLA 1IKQA 4R4ZA 2D44A 1KD7A 1QJY3 3DUIA 1ENSA 3WDTA 4CDXC 1ASJ3 2E7TA 1L3JA 4Q0QA 3M4FA 2PTMA 4YZ4A 1SLAA 2D6KA 2DVGA 1EPZA 2HWC1 1X50A 3DL3A 4Q1PA 2FZ1A 1CJPA 2VNGA 4COUA 3N7MA 4YM3A 3JD71 4GIQA 4IV3C 1PZ9A 2OZJA 3AMNA 1RMU1 3ELNA 4WVWA 3HIFA 4CEWA 1DIWA 4GH4B 1OOPB 2R072 2RMU3 2F6BA 3OY8A 1G8WA 3SH4A 3U07A 1WBLA 2QUOA 1OLQA 4IEOA 4Q29A 4YGEA 4L97A 2ZA9A 4R9BA 3JCIA 1YJLA 1NLSA 3A0NA 3GBWA 1KFXL 5GM0A 4NR1A 2XJQA 4CDXA 1QF3A 1OQEA 2XKPA 4PDWB 3O0XA 4WZFA 1UX6A 2IXCA 3CL1A 1IOAA 4HN1A 2HWE1 3N7LA 3EBRA 2UWBA 1YFUA 3AB0A 1Z0HA 1HW5A 2JE7A 4NWVA 2R062 4RGAA 3GHNA 4E4DX 1R1A3 1FOD3 1LU2A 3FFQA 4AI0A 4LLFA 5CA6A 4GH4C 3ZIXA 1OOPC 3U4XA 4HK9A 4OUSA 4M0NA 3LCPA 1LKNA 2DTWA 3M3OA 3ZYGA 2WZR2 1VRH3 1PO13 2R6QA 1DQ6A 4F7ZA 2IXLA 2BGCA 3VZNA 1R093 2R071 5BNPA 4RR3A 1H4HA 4C1WA 2PHWA 4QPGA 4PDWC 4C0BA 4OUMA 4MV2A 1IZ3A 1R083 1QH7A 5BNOA 2QDNA 4YZ5A 1O3SA 1GR3A 1Q56A 1IS3A 2Z79A 1OOPA 3D0JA 1DQ4A 3N7JA 4J1WA 3LKJA 4K1ZA 5CAZA 1VBE2 2BQPA 3RI9A 1OI6A 1AR72 3SHRA 1SLBA 4GQ7A 3LA7A 5FOJB 1TE1B 2E51A 1U5IA 3TN91 4XJUA 1HRI3 4W6YA 1C1LA 4INDA 5BNNA 2HWD3 3QBQA 1HDKA 1W6NB 4DINB 3PLQA 1COV1 1FATA 1QXJA 2XPJA 1SFYA 3H1WA 2DCZA 4CP1A 1BEV3 3KT7A 3PTYA 1DG6A 1VBA3 4PDWA 2HWF2 3QLQA 3UKVA 2DF7A 5CG9A 3A0KA 4HVOA 3NKGA 2KM2A 1H30A 1JYIA 1OA4A 3R4UA 2OA2A 3D8CA 2RE9A 3WP6A 3N7KA 5CG8A 2GC2A 3VBFA 1VB4A 4N9IA 4GXLA 3R6SA 2EAAA 1ZX5A 1BBT2 2Q0AA 3WHUA 1G86A 1GNZA 4HMZA 4Q4X3 1RUF2 4TWTA 2OUHA 1DZQA 2BNOA 4LO6B 1VBB1 4DNYA 3RYKA 2QQPA 1O4YA 4BCUA 2CAUA 3J8F1 4R9CA 2DTYA 5T5OA 5I8YA 2WNUB 2PHLA 5JLVA 1RINA 4ORFA 4IEUA 2D93A 2ZMKA 2CTVA 3VLBB 2YHJA 4CDWB 3MIEA 1Q8QA 3LA3A 4W6WA 1QXPA 4SLIA 4IERA 3RJ2X 3D82A 1RUD2 3W58A 5JCTA 1SLTA 1NOVA 3MLLA 4MGIE 2ZHNA 2RR11 1BJQA 3PVEA 2EVXA 2R16A 3LSDA 3MLKA 1ALYA 2O1QA 2UYAA 1QOOA 1A6CA 2Z42A 4UBHA 4RA0A 1LHOA 4HKWA 1FNYA 1QHDA 3A4UA 2VG9A 3LZZA 3ME2A 4EN9B 1VALA 1LHVA 2W0XA 2WNUC 3NAPA 1S0JA 1RUF1 1ZA4A 3IDCB 2ZGLA 3AZVA 4OZXA 4CDWC 1KS4A 1CESA 4UXAA 1V6MA 1VIWB 5DZEA 5ACA3 2VY0A 4BM8A 2ZX3A 4GWMA 3S0MA 2VNOA 3KT4A 1PNFA 4I3GA 3EQEA 1SLLA 4BE3A 1WCSA 5JDBA 3GBFA 4ES8A 1S0DA 1RUD1 1Z7S3 3M7AA 2A71A 1HXS1 1WUVA 1WMFA 1AYM2 3MIDA 3ZN5A 1VLNA 5EWSA 1AR61 3IM0A 1POV0 4ZU5A 3RSJA 4CYDA 1SBDA 4NPRA 4S2GA 2ZBJA 4N7IA 2PAEA 2B5HA 4YVSB 4AE2A 5LRSA 3BCWA 3GHMA 1ND3A 1W0PA 3VKNA 1QY4A 4B29A 4CDWA 5GZCA 1MQTB 3KLSA 3J4UH 3MYXA 3JBG3 2CGPA 2WKKA 5CFDB 1LGCA 1RL3A 1PZ8A 3ZSJA 3APBA 4AHZA 4YVWC 4FPYA 2Q5TA 2GMMA 2FZ2A 3ST7A 4YGDA 2GSYA 1HKDA 4HPKA 1PK6A 3BB6A 2VNRA 4HBNA 4PF5A 4GB33 4FPHA 4LR4A 2PHTA 2QE3A 2WLQA 4JAAA 1CGPA 4HVRA 3RYPA 2ZGKA 3G7DA 1DQ0A 4BYYA 4LBKA 1KJRA 1YFYA 1PVC1 2XB6C 1VAKA 2XH6A 1WCKA 4C0HA 4YVSC 1AVBA 2WT1A 1VB2A 2VOWA 1AYN3 1Q5OA 2PQQA 4GULA 1MQTC 2VXRA 4XZPA 1AR83 1WLCA 5JOYA 2IXIA 1AJOA 4H3WA 2X29A 1TMF3 2BUKA 3KCXA 4JDMA 2MEV2 4KG0A 3ZXDA 1V9U1 5CFDC 3AX4A 5I8TA 2VH9A 4XEZA 1MVEA 5GJ6A 4RHV3 3M8LA 2CL2A 5C4WB 1BVP1 2DYCA 3BALA 1YI7A 2Q8OA 1PO21 5T50A 3AKQA 2JJ6A 4XHXA 4JRAA 3ZDSA 1F5FA 1YIPA 4OI2A 3AKPA 5J48A 4OI1A 1I5ZA 1ZREA 1Q8VA 1XU1A 1AHSA 4XQ4A 3DPRB 2Q30A 2I2SA 2GH8A 5BV6A 4HVQA 3NL1A 2MHFA 2RM23 1C5IA 2XJSA 3B3QE 3VBRA 2R0HA 5CFDA 1C4RA 2ZHKA 4Y22B 1YNAA 5AVPA 2LALA 4Q4V3 4XFHA 3TRSB 3R05A 4I0AA 5C4WC 2E6VA 2E7AA 4OULA 2CV6A 2PELA 1NXD1 2WT0A 3NW4A 4D7TA 1Z78A 1O3QA 1VBD2 4D3WA 2TEPA 1YCIA 4AI3A 4D7YA 4HSLA 4I0WB 4B3NA 4AGVA 1ZZCA 3VKMA 4JGZB 3JQWA 5AC93 1YRZA 3DPRC 2JICA 2A3XA 2WNVB 2VOXA 4CEYB 2AENA 5EYYA 4WM7B 1J3PA 1MS8A 3VGIA 1WA4A 4AF9A 3WY6A 3LB9A 1ZZ9A 1CN1A 4KWKA 4AYUA 1YXWA 4AQ2A 3HN1A 5K7PA 1H0BA 2ET1A 3M3IA 1AXZA 2E7QA 4N9HA 3VBOA 2VQAA 4XQDA 1WMEA 4ES9A 3GYDA 2XWJB 4KQ7A 4OHVA 5C8WA 4Q4W1 3HBZA 3ZXEA 3AJYA 3OPZA 3VDDA 5JSRA 3JU9A 3MGUA 4Q4Y2 2ARXA 1QJU1 2ATFA 2R30A 3AFGA 1SLCA 2D3RA 5A32B 4B7EA 3NVCA 4EN8B 1SBEA 2A6XA 2RS13 3FC0A 4JGZC 3IKWA 5IK7A 1KRIA 2ZX4A 4NHMA 1AL21 1CQ9A 2WNVC 4B4PA 4FOYA 3KS7A 1PIV3 4CEYC 1MZFA 3B00A 3ZFGC 2SBAA 4WM7C 4XOGA 1LTEA 3ZX7A 4M3CA 5FAXA 1HRV2 1IPKA 2AREA 1CVNA 3WDUA 2XBO3 2XKOA 4LHKA 3TWIA 5BYNA 2NZ9A 3WX5A 1FPN2 3SISA 3KCYA 3N3HA 1X7NA 4YW1A 3UKTA 1VAVA 1QJX2 5A3LA 4D7SA 1RHI3 1IQAA 4URTA 2YUEA 1ZRRA 1XQNA 4JGZA 4U36A 1QJY2 4XHBA 3B02A 4I01A 4KWJA 2QCSB 2ZGSA 3WQ0A 2XJPA 2VUAA 3WD5A 1HQWA 4CEYA 5BPXA 1ASJ2 2B46X 4MZUA 4RL7A 4AGRA 2NMOA 3ZYPA 3HWJA 2BBVA 1RUC2 4E2QA 3H3ZA 5FDBA 2D40A 2XJRA 3SH5A 5H9PA 4YFWA 1V6KA 2G4IA 1X36A 3FX3A 1CAVA 1U5ZA 4QXKA 3OTFA 3JB8A 4M01A 5FLJA 4FPFA 1C8M3 3PJQA 2TNFA 4R9AA 4MUVA 4Q27A 2RMU2 1X8MA 4R8HA 4XFGA 4XXPA 3ZN6B 2NQYA 1QQP3 5I0TA 4LBLA 3M3CA 1SBFA 5A32A 3JUUA 5L7OB 3AMQA 1LEMA 1RJ8A 3CNAA 1FPN1 3I59A 3WW4A 1MS4A 2ARBA 4META 4AEJA 2XWBB 4LBQD 4QQHA 3VBSA 3SMHA 2RJLA 3AKTA 3NV1A 1QJX1 1OKQA 1TEIA 2VMGA 4LO8A 1ZVFA 3WW3A 1GYKA 1PMIA 2UWCA 3M1HA 4TLFA 4C90A 1QJY1 5KHHA 1MEC3 3C2UA 4M3CE 3NV3A 4BOWA 2BYVE 2W68A 2JECA 3AYEA 4ONUA 2PLV1 1R1A2 3VBHB 1FOD2 4AQTA 4Y26A 4B8EA 3UL2A 4OHYA 2Y38A 2YY1A 2GNDA 2HWB1 5GZGA 4HKOA 2DCYA 4NHKA 1CAXA 3UK9A 1RUG1 4PIXA 1VRH2 1PO12 3QCWA 4HETA 5L7OC 3EJKA 3VKFC 2GNBA 2JXAA 4KBBA 1R092 4DB5A 4AVBA 4DS0A 2XL7A 3MPBA 4H55A 2RMU1 2R0FA 4PLNA 2WS91 3IT8A 3WQ1A 1IGOA 3ZSKA 3S6PA 5I93A 1DYPA 4FXGB 3PMSA 5D8AB 2JE9A 4X8PA 1NCQB 1J1TA 3DKWA 4JV4A 4YRDA 3ZXJA 4Z92B 2XG3A 3OBTA 4TYSA 3H3UA 4H14A 4RD7A 1BYHA 1R082 4Y1ZA 4CEWB 3SCGA 1S2KA 1RVF1 3DV8A 3AKRA 1GV9A 3OY8B 2FBEA 3VBHC 1YLLA 3AK0A 4MXVA 4FSJA 1XE8A 5BXXA 3H9AA 2ZX0A 4FTSA 5L7OA 1UKGA 4ASMB 4BIOA 1HRI2 4LT5A 1MS1A 4XJ8A 2HWD2 4N90A 1X33A 1NE4A 3TOJA 2H0VA 3VL9A 2VMHA 1BEV2 2Q1ZB 4L8QA 1VBA2 1XYOA 4GKXA 1TME3 2K9ZA 2YXSA 1AX0A 1ULEA 4CDUA 1PO11 2LUWA 3WDWA 5D8AC 5DDJ3 5GZFA 2JG9A 1NCQC 1R091 1QWRA 3D4KA 1JW6A 5FTTC 1U5YA 1RUI3 2GN7A 4E4ZA 5E88A 1RGSA 4CEWC 2CYFA 2D3PA 1S0IA 2RJKA 4Q4X2 4AEDA 2Z69A 1RUE3 1OQDA 4Y1VA 3WINE 1LULA 3B94A 4D94A 4LE4A 2NPIA 3RZZA 4KWLA 2DCTA 4L92A 2A5ZA 5LK5A 3SITA 3MFCA 2A3WA 1AR93 5BNPB 1QXRA 5HXVA 1MS0A 4RR3B 5KXCA 2ZCWA 3ILRA 2XL9A 3V64A 1RUC3 4QPGB 2BFUL 4LLOA 2ZJCA 5D8AA 2RS33 5KWRA 2YV8A 1NCQA 1NYWA 3ZSMA 3NKTA 3ALQA 5JR7B 3CEWA 2ZGTA 5BNOB 1XXNA 2DFBA 1N1SA 3WG1A 1HLCA 2WNEA 4YYOA 3FFZA 4COWA 4XBNA 1OD5A 1LJ7A 1N3OA 5KHIA 3KGLA 1IS6A 3H8UA 5KBFA 4N53B 1QOSA 2YGLA 1PGW2 1RB8G 2OIIA 3VHOA 5BNNB 1OHFA 1BZWA 3PVBB 4ZU4A 2OYZA 5DG2A 1JYCA 5BNPC 5JI7A 1LHUA 4RR3C 4GALA 1H2KA 1UAIA 4XF4A 4IL7A 4ZU7A 4IXLA 1RUJ3 1Y9QA 3AZXA 4QPGC 4I2OA 1EPWA 3AKSA 4JTNA 3KMHA 5ACA2 4FQZA 3VBFB 5HBAA 2DCJA 5BNOC 3H50A 5JPMB 1O4ZA 1Z7S2 4JC1A 4ISRA 1WD3A 5C8CA 1CPMA 1F9KA 1J3QA 5BNNC 5JZGA 4EWEA 2GC3A 1DFQA 4CRQA 1YWKA 1BK1A 2NN8A 3ATGA 1AZDA 1ZBE3 3SCHA 3ZPYA 3TNPB 4RFT0 4XMAA 4PQ9A 1B35A 2YPJA 4NO4A 1MS9A 1POV3 2R043 4M00A 1MZ5A 4Q0VA 3JBG2 4QPYA 1J3RA 3CJXA 4YM1A 4YFZA 1JOJA 2NMNA 4BMBA 1UMZA 1RUNA 3VBFC 1WW7A 1S2BA 4AQSA 1IPJA 1FNZA 2B9UA 4XJZA 1WD4A 3WDYA 4NHLA 4D69A 1H9PA 4GB32 4N53A 1V00A 2XJUA 2ZABA 3MICA 5ACA1 1DZTA 2R061 3MLJA 4KGQA 4IEYA 3RRDA 4WBBA 1QOTA 3THPA 5DG1A 3NAPB 5I0UA 4LHNA 1F8VA 5LEKA 4R52A 4QMAA 1Z7S1 1LODA 1AYN2 2ZAHA 2WQ4A 2WZR1 1PNGA 3PVNA 1AR82 4DFSA 4YM2A 1TMF2 3QD6A 4XTMA 3VV1A 3N4MA 3AZZA 3AMPA 3CU7A 4HANA 4RHV2 1QGLA 1UU5A 2WFF3 3JD73 3T2TA 1RMU3 4LE3A 1DGWA 4DY3A 2FQPA 1W6MA 3IBMA 3JBG1 3AP9A 3GBGA 2QFEA 5KC6A 4AFBA 3PMEA 4LO5B 1H1MA 5DXDA 1CIWA 1PZ7A 4XIOA 1AX2A 4BLIA 2IFWA 3NJZA 1VBE1 1ND3B 4OI4A 1EP0A 3NAPC 1AR71 4GB31 4LNVA 2RM22 4UBGA 4EJRA 3WXPA 3AP7A 3QH6A 2P34A 5K9YA 2WFPA 2HWE3 2IC1A 3VHNA 3VUOA 4Q4V2 1LOEA 4XF9A 1KQRA 2HWF1 4HPKB 1PK6B 3ETQA 1AYN1 4QU2A 3IMNA 1Q8OA 1M4WA 2BWAA 5FPXA 4XFFA 1AR81 1XU2A 4BWOA 1TMF1 4E4SA 1N1YA 4A7ZA 2E63A 4C1XA 1BBT1 1H2LA 3OBRA 4RHV1 1UF2C 2OPKA 5F9TA 5AC92 1N3PA 4CTEA 1ZZBA 1CR7A 1ND3C 1ZBA3 4AGGA 5IK4A 4YGBA 1A8DA 1CJDA 1X8EA 2ES3A 3ZSEA 1Q3EA 3NV2A 2XGXA 2VW0A 3WV6A 1O4TA 1O5UA 3OYWB 1ENXA 3MIBA 1PVXA 4LULA 4AVSA 1DHKB 4RQPA 5FQ0B 5BUVA 4LA3A 3FLRA 2VW2A 3U11A 3AP4A 1AF9A 1PK6C 5L36A 1Y43B 2TBVA 1E57A 3OGJA 3B69A 2ZGNA 3TN93 4K20A 3ZXKA 5EJ3A 5HCBA 5IK8A 2D43A 2RS12 1COV3 3EO6A 3MF9A 1VR3A 3FUQA 1NZCA 1BVVA 3VBRB 4IETA 1DLLA 1FMD3 1PIV2 2HEYF 2V73A 4LTAA 4QT6A 3D5OA 1QKQA 3LOIA 3BOPA 2ZGPA 4JGYB 1H8VA 2IXKA 3BODA 4L11A 4MLOA 2XBO2 2A6YA 3NSTA 3V0BA 2V09A 3OD0A 4BH9A 1KS5A 2VVDA 2R32A 5JWPA 3Q9OA 3ZFFB 5CBLA 1LB2A 4EN0A 1EV13 3T1MA 3O0VA 1NY72 3L2YA 4GMP1 1VBB3 2VULA 4AEKA 1RHI2 3TBDA 1XNCA 1G7YA 3H1YA 4XIKA 1YIFA 3J8F3 2GN3A 3KB5A 2XLFA 2ZGMA 4P9IA 2DU0A 4QPIB 2ZHMA 1SFNA 2JX9A 4E9KA 1NQJA 2HEWF 5DUWA 3VBRC 1AYM1 4MXWA 2A6WA 1W6QA 4DOUA 3PHMA 2GDFA 4B4QA 1O91A 3X29B 3MI8A 3T1LA 4G3YC 3OYWA 4K40A 2WA4A 1LOBA 1W6OA 1YUDA 2IZWA 4JGYC 3J9SA 5FQ0A 3E6CC 2C9AA 2RR13 3VBOB 4YG0A 4F8AA 1LOFC 3AZYA 2DFCA 3FJSA 1G6NA 2UURA 1C8M2 3VDDB 4YW2A 3WR0A 3ZFFC 1IKPA 1V6JA 4XJWA 4WVMB 5FMOL 1OFNA 4Y20A 1QQP2 5JOZA 3WG3A 2X53S 4YW3A 3SCFA 3E6BA 4HLTA 2TUNA 3SH3A 1LU1A 3DF0A 1N1TA 4BHPA 5K0UA 2PHXA 5JVVA 4V1PA 1UZYA 1NY71 2GH2A 4JVAA 4LHLA 1RHI1 4CZSA 4Y1UA 1FX5A 5IK5A 2UWAA 4M3CB 3RJRA 4JGYA 1MEC2 3GALA 1M06G 1SEFA 1LOFA 2EXKA 3WDXA 2XVGA 3VBOC 4COVA 5CADA 4I09A 3ZFFA 4W65A 5GLWA 4XQWA 4XILA 3VDDC 5SV8A 2MEV1 2EF6A 2D6NA 2B8MA 3RPQA 4X6RB 1HXS3 3WNXA 2WIIB 3M2MA 1MS3A 4QGNA 3ROUA 2NP0A 5J36A 4XF1A 1AR63 4WV8A 3HT1A 4QPIA 1C8M1 2EXJA