1UDAA

Structure of udp-galactose-4-epimerase complexed with udp-4-deoxy-4-fluoro-alpha-d-galactose
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
338
structure length
338
Chain Sequence
MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSSATVYGDNPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of UDP-sugar binding to UDP-galactose 4-epimerase from Escherichia coli.
pubmed doi rcsb
molecule tags Isomerase
molecule keywords UDP-GALACTOSE-4-EPIMERASE
total genus 132
structure length 338
sequence length 338
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 1997-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1udaA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1udaA01
3GZNA 4YYZA 4B4UA 3PQDA 2VHXA 3QWIA 1YB4A 2JHFA 4R9RA 1N9GB 3KB6A 4IMRA 1ZK4A 2HMWA 1DJNA 4W9NC 2CY0A 2FHSA 3PLNA 1XHLA 3SLGA 1NYTA 3WWZA 4BB6A 5JO0A 3ZWMA 4IDEA 4CMHA 5JCXA 3E5MA 4RLHA 1NHWA 2ZB4A 3RU7A 1T2EA 2DKNA 3DC2A 3ROKA 2HJSA 1A7KA 1R4MA 1C0KA 2O3TA 1B14A 3OA0A 3WQQA 1DFHA 4L8VA 2FPIA 3Q1LA 4IDFA 1E92A 1N8KA 3JYOA 1HYGA 4RVFA 1FMCA 1PJ3A 1TT5B 3F4LA 4BNWA 1M76A 5C3MA 4DC0A 2EJVA 1UXGA 1NQ5A 1GTMA 2EF1A 2Z95A 2Z1MA 1NASA 1PGOA 3PHHA 2D1YA 4KUHA 4HFJA 1X14A 4PLHA 4J49A 1DLJA 4YRDA 4D43A 5L45A 2A9FA 3OM9A 1ISIA 4D46A 1I2BA 2X5OA 3DHNA 2JJYA 1ADBA 3W8EA 2YDXA 4HX5A 1XDWA 4E32A 1EUDA 2ZATA 4JNKA 1Y81A 1ZJZA 4FD3A 2GDZA 4BNIA 3BMOB 3JQ6A 4GL4A 3ZZNA 7MDHA 1NR7A 3IP1A 4YQZA 3DBHB 3LLSA 5I7EA 1PTJA 3G3EA 2PD6A 1OAAA 3NGLA 2GNAA 1MFZA 1LDYA 1LSUA 3DZKA 1WDKA 4AJ1A 2V7PA 1GYPA 4BB5A 2I76A 2C20A 2G5CA 2WE8A 5G2OA 1Y1PA 1T4DA 2AE1A 4BNTA 1SEVA 3E48A 1B2LA 1D4FA 3NDJA 3DZFA 3VKUA 3QJ5A 4E5YA 4CJXA 3OSUA 3GDGA 3CXRA 1PZFA 2O48X 3HJAA 1RPNA 4A5OA 4N5MA 4XYEA 1HL3A 3D64A 5C5IA 3GGOA 1DO8A 1UUFA 4J7UA 1GCUA 5F5NA 3ABIA 3U4DA 4A7PA 1VL6A 3RUAA 4R3NA 2B5WA 4RZIA 2A94A 4G2NA 4NBRA 4JQCA 4FFRA 1DC5A 1Q0LA 4ZQFA 3JQ9A 4OXYA 3AWDA 4B4VA 3KZVA 1K2WA 3RKUA 2J3IA 3QWHA 4YRAA 2ZYGA 3K31A 1K5HA 3RFXA 4G81A 1LLQA 1I36A 1YQXA 1HLDA 1TLTA 1U7TA 1RWBA 3DL2A 3ROMA 4AJKA 3OF2A 1K6JA 5ADHA 1C1DB 4FSHA 2HUNA 3LDHA 4LVUA 4U5QA 4K6FA 4BGVA 3TQHA 2HLPA 2AQIA 5MDHA 3KSUA 2WYUA 4BNGA 1Z74A 4AICA 2C54A 1ADCA 5G4KB 1PJ2A 1K6IA 1ENPA 3RBXA 2Y68A 3MWEB 1B8UA 3NT5A 1WDMA 3QE3A 4BNUA 4YT4A 2B83A 5KVVA 1PIWA 2Q49A 4J9UE 1DXYA 3TJRA 1NAHA 2C5EA 4EJ6A 1LLCA 4CV0A 4U7WA 1PU2A 3PP8A 3ASUA 3FRJA 4UREA 5IXYA 1CQIA 5F1PA 2VUTA 3JD4A 4MIYA 2PD4A 3WNQA 1CYDA 3TOZA 3HZZA 2VYNA 1C1DA 3PVZA 2V6MA 3BHJA 2JKVA 2Q1UA 5JCJD 2UV8A 2EGGA 2WJPA 5TJHA 2EG9A 9LDBA 3CKYA 3RC1A 4O59O 1WZEA 3I5MA 3ZCXA 1P1KA 1ISMA 4PLZA 4UVGA 3OICA 1RJWA 3C3XA 1NPYA 4LVCA 4E6PA 3BHMA 3OEWA 5C7LO 2BGLA 1BGVA 4ZICA 1LRLA 1B15A 1BW9B 3WSWA 2OOSA 4FIZA 1N1GA 2PR2A 3ZNOA 5I7VA 3N7UA 2VWHA 1R66A 1WXDA 1H9AA 3PDJA 3PZBA 3ZU2A 1LSJA 4FJ2A 1PJ4A 2BF7A 4JJIA 3QA9A 1W73A 4JX8A 1KVRA 3NTRA 4CLRB 3ZV3A 3RC9A 4PZCA 4JK3A 3IUPA 2UYYA 4HFRA 5KJ1A 1JU9A 3NKLA 4CL8A 3A1NA 1EFKA 1HDZA 1U5CA 1U3VA 3D7LA 1YONA 5KVQA 5LDGA 4XD2A 1Y9EA 4RF3A 3IOYA 5AXBA 3INRA 3ETGA 1C14A 4HADA 5JYDA 1YOVB 5F21A 1Q1NA 1U3UA 1Z7EA 3WJ7A 3VPSA 4J4BA 3GUYA 3EMKA 4R1NA 4XYLA 2I5PO 5G0WA 3GZ4A 4GBJA 1DIAA 3FNEA 4OM8A 1QYVA 1T1RA 5IDQA 5CG1A 2D5CA 4N7RA 3OJEA 1HDCA 4FBGA 1PJBA 2BGKA 5FFFA 3P5SA 6LDHA 1ZMOA 3DTTA 3W1VA 4H16A 1W6UA 4QO8A 4RDIA 4ZRMA 5G0SA 2DT5A 2BI8A 2J8ZA 4XGNA 2GF2A 2OMEA 1XQ6A 4YR9A 3BMQA 4F6CA 3BMNA 3E5RA 2EGHA 3NT2A 1R0SA 2OFPA 4YT2A 4XYMA 2E48A 1LQUA 3NTOA 4WASA 3WYCA 5IDWA 4CQMB 4NJMA 4I5DA 4CR8A 1HDGO 2FZEA 2GASA 2VWGA 4RPHA 4CMJA 1ISHA 3LSYA 3QV1A 3IKTA 4UULA 3AUUA 4E2YA 2P5UA 4NH4A 2X9NA 3UN1A 2W2LA 3RFTA 3VH3A 5A03A 1O5IA 4KTVE 1GU7A 5IN4A 1PWZA 1T24A 3GY0A 2W2LD 3FWZA 4RCVA 5DBGA 1DSSG 3V2HA 5KNLA 1TXGA 4ZQGA 4WOKA 5T57A 1ZEMA 4YRBA 5GMOA 3WG9A 1N1EA 3G0OA 3VC7A 1CWUA 3UCXA 3L0DA 3P2YA 2B4TO 2WMDA 5KJFA 3S2IA 4XGIA 4EDFA 2I3GA 1CRWG 2ZB8A 3E1KA 3M1LA 2DU8A 4LGVA 4C7JA 4L9RA 2E49A 2CF6A 3CZRA 3DAGA 3LT4A 4WLFA 4WCDA 4NJMB 4RQUA 1YJ8A 4I5GA 1GQ2A 1VKOA 4MVJD 1GEGA 4HXYA 3DTYA 3S2EA 4WECA 4E13A 1JLLA 5AVOA 3KBOA 2P5YA 1XU7A 3FTPA 1PL8A 1SEPA 4CM4A 2VN8A 5JAZA 1LC3A 4KP7A 3TFOA 4UUNA 3JD0A 3I9JA 1F12A 2FOIA 1UAGA 2NTNA 1ZEJA 4RF5A 5U4QA 4DVJA 3H3JA 1JAXA 3DHYA 3HG7A 4W99A 3K9QO 4ND1A 2C5AA 3P19A 3VOSA 1MG5A 3WGZA 1ARZA 1IOLA 1VI2A 4KDFA 3NRCA 1IPFA 1F06A 1GADO 5EERA 5IF3A 3E9MA 3S2GA 2O3QA 4X54A 2C07A 2ZK7A 3EC7A 1UZMA 1BVUA 4NFSA 1GV1A 1YBVA 3GHHA 4NBUA 3GC6A 4EEZA 1W4ZA 2CUKA 3U0BA 1NPDA 1P3DA 2C29D 2H1SA 1HKUA 3OA2A 4WK6A 3HDYA 2SCUA 5TF4A 4WLEA 4DL9A 1JKIA 4GSKA 4P8RA 2VT3A 1YB1A 2WSBA 4QO7A 1ISJA 4D3DA 3ZV5A 1I5RA 3PFFA 3VPHA 4CLEA 1PS0A 3U4HA 1M75A 3AOEC 1ADFA 4ONEA 2VT2A 3PWKA 1T2CA 4JJGA 1QRRA 3IKVA 4YJHA 5T8KC 1JDJA 1E3WB 5TX7A 3Q6IA 1R12A 2DQ4A 4J90A 3KEOA 3ZU5A 2J3JA 1UZNA 4U0JA 4PZEA 5G4LA 1VJ1A 4QXMA 5G0VA 1I01A 3GG2A 2V6BA 2D3TA 2Q1TA 3AU8A 1ZSVA 2O3SA 3WGYA 2Q99A 2X9GA 3BMOA 2BD0A 2J3KA 2O2YA 4NMHA 1AHIA 2X0RA 2GGSA 4NJOA 5DULA 4PCVA 4CQLA 2Q46A 1PX0A 3PJGA 1K6XA 4I1IA 3DFUA 4PLVA 4B3JA 3CE6A 3IJPA 4A0SA 3I4CA 3VH4A 4KUEA 3WNVA 3U3XA 2IXBA 1QORA 4J0FA 3DBVO 4RLSA 2OXIA 3DZJA 3MJCA 3QW2A 5TRTA 4QTZA 5COBA 5JCJA 2DLDA 4XKJA 4IQ8A 4S3MA 2PZKA 3SBOA 1TVEA 3U49A 2AXQA 1GPDG 2AA3A 3BTVA 5CDUA 1LLUA 3GA0A 1U5AA 4FB5A 4TVOA 3ONEA 1GPJA 3G1UA 4BKUA 5L7WA 2GN8A 4JLWA 4RJTA 2PNFA 3B1JA 1VLLA 3KLMX 3TFQA 1IUKA 4XYBA 3VHRA 1HEUA 2OL4A 5L7YA 4BIIA 5K9ZA 1MXHA 4DYDA 1ZNQO 1LDMA 1HE4A 3I4FA 1MC4A 3VZPA 3AY6A 1C3VA 5K0ZA 4OYRA 1EVIA 5J23A 1M67A 4YA6A 2A35A 5EJ2A 5K6AA 5TQVA 3WFIA 3FI9A 2GYYA 4R1TA 1EQUA 1HE2A 4MKRA 1EK5A 5BT9A 4QSMA 4RL6A 3KV3O 3EVTA 4J3FA 4OKIA 2AMFA 2HK8A 4YACA 2GO1A 2POQX 2W2KB 3W6ZA 4J4HA 3EGOA 5KIAA 3I9OA 4J43A 4MVJG 4BKRA 3BTSA 2Y66A 3ZWVA 1GZ3A 1X0VA 4GAEA 3EDMA 1I0ZA 1KC1A 3TDKA 5A9TA 1LUAA 2QX7A 1ZMTA 3O9ZA 3F6YA 4Z3KA 1IB6A 4WCFA 1DHRA 3MJEA 4PG6A 4Q3AA 5L4LA 3JQFC 3B1FA 2YQ5A 3KYBA 2DUUA 1V3UA 1K0UA 3DBRA 3ORFA 4BO4A 4IJUA 2CVZA 3K92A 3K73O 4JJFA 3WWYA 1DBVO 2EIHA 2PH3A 4TZKA 2DPGA 3RASA 4DQVA 3DMTC 5DDIP 1FDVA 2XF8A 3AUSA 2Y05A 4K28A 1UP6A 5HTOA 2IYPA 1A71A 1B26A 3K8ZA 3PQFA 4DXHA 3WGIA 4PRLA 1B8PA 1XU9A 4E30A 4G5HA 1DAPA 2PY6A 5A04A 4DMLA 3C1TA 5JPIA 4PLGA 2VZ0A 1M6HA 4ZA2A 5FF9A 4FR5A 4NFYA 4NI5A 3RUCA 7ADHA 1O94A 1E1MA 2NVWA 4ILKA 3RSHA 2FSSA 3RQSA 1AHHA 1R0KA 4F45A 5JW6A 4FC7A 1EBUA 2HMUA 2WD8A 4L74A 1UAYA 4ALJA 5KTKA 3L9WA 4BO2A 3G79A 4XX0A 1WAMA 3IP3A 3LF2A 2AE2A 2E37A 4M8SA 1H6BA 3FD8A 2EP5A 4YEDA 1HXHA 1VL0A 1A9YA 2TMDA 4RF2A 1NR1A 2PH5A 1Q0HA 5A05A 4GLLA 3A06A 2NLOA 3IS3A 4JP3A 4CQLB 4PLFA 4BNNA 3Q2IA 3H5AA 1Z73A 1IZ9A 1PSDA 4Q9NA 1MX3A 1KIFA 1YDWA 1U3TA 5KCZA 4CLDA 3ITDA 1I2ZA 4MVJA 5B12A 3OJ0A 5TC4A 1TEHA 3W4KA 4IM7A 4BKOA 3ZWCA 2IZ1A 1XLTA 2ZTLA 3PIDA 4XRGA 3BMCA 1NVTA 1R0LA 1IHYA 3OFSA 3PFWO 1X13A 3FHLA 2NU7A 1BWSA 1HDRA 3WGQA 2FR0A 4P4LA 4WLOA 2QQ5A 4BMVA 1UZLA 2NU6A 1CJCA 4Q39A 1KEWA 1P9LA 2EKQA 2YV1A 3PXXA 8LDHA 3KUXA 2Y1FA 3C1AA 4OO3A 2Q1SA 1SOWA 4FQ8A 1YL5A 1MFPA 2DBZA 4MVJI 4Y6RA 4KMSA 1WVGA 1P31A 1EDOA 4UAGA 3RUFA 5F1KA 5L53A 2XOXA 4CMKA 3FPLA 2NSDA 4IMPA 2HRBA 3RUDA 5JY6A 1T26A 4Y6PA 1BSVA 2Q2QA 1MA0A 4L4XA 2DUWA 3E18A 3F4BA 1Z45A 3FBTA 3LC2O 5BQFA 4YJGB 4FFMA 3PJEA 3ROQA 1W0CA 3AOGA 1WMAA 3CIFA 4GKBA 4IXWA 4CMAA 4XR9A 1LBEA 4EW6A 4RDHA 3JYLA 4UUPA 3ZN2A 4BQRA 2ILTA 3BXXA 4M54A 1DIRA 1B3RA 3GRKA 5JDIC 5A02A 4Z3DA 1SNYA 2W98A 3KM0A 5T64A 1YBAA 4IDBA 4UVIA 5JAQA 2YV3A 4XJSA 1V9LA 1IHXA 1TI7A 3WXBA 3QWFA 4XDZA 2R2GA 3WTBA 2FR1A 1IE3A 4GQAA 4LRSB 1WMBA 5TSDA 3OJOA 3RIHA 1UXHA 4ZVVA 3E9QA 2ZB7A 3W4IA 4CM3A 5ER6A 1PL6A 2B35A 2DVMA 2HSDA 3OJFA 4YAIA 1IY8A 4DPLA 3FSRA 2EHDA 5JSFA 2AG5A 1QV7A 4I5EA 4OHUA 2Q4BA 3IAHA 4MKZA 3GUCA 1U28A 4ZHSA 1EQ2A 2VWQA 1AXGA 1SB9A 5G4KA 1D8AA 4BKQA 2H6EA 4CQMA 1DFGA 3RBZA 3D5TA 1BDBA 1LTHR 2RCYA 4OSOA 5DOVA 1K3TA 5IAAA 3ZHYA 3MJ4A 3JYPA 1LRKA 5JMPA 4BVAA 5KJCA 4EEXA 5KKAA 1E0DA 2JD1A 2ZQZA 4XQEA 1P1RA 3PYMA 3RI3A 3GT0A 1EUZA 5BSEA 1HETA 3RUEA 5H82A 5CEEA 3PHLA 4FOSA 3RVDA 3W8FA 3F5SA 4ND4A 1S7CA 4EJMA 2PFGA 3GDFA 2P4QA 4BO7A 3EK2A 2D2IA 3FNFA 3GFGA 4JROA 4Y9DA 5BR7A 3ULKA 4LMPA 3SJ7A 5T5QA 1MV8A 2QW8A 1ZUD1 1KBZA 3B20A 4IGEA 4XZ3A 1NNUA 2YDYA 3DQPA 1DFIA 4YQYA 1YB5A 3AOEA 3RJ9A 1HSOA 4R4JA 3VVCA 4CR7A 3MTGA 2PZJA 1JTVA 3C7CB 4KWHA 2OHXA 4M86A 2H63A 4AJIA 4YWJA 1DPGA 3LF1A 2Y0CA 1E3SA 2AEMA 2YYYA 3WSVA 4BKPA 3KTDA 3HADA 5ICSA 3JD3A 1KC3A 1HZZA 1ZBQA 4Z9FA 4A26A 4HBGA 1VJTA 3ANLA 3EVNA 1YL6A 3CMMA 1UXKA 1Y5MA 4JXKA 5AYVA 5DOZA 4NU6A 1GCOA 4NFHA 1SB8A 4KZPA 3EY4A 1DJQA 1VPDA 5H83A 1HRDA 3AI2A 4IQ0A 2HQ1A 1NVMB 3I83A 4JIGA 4YCAA 1LDBA 2VCYA 3DONA 3ADOA 3OBBA 3GHYA 3VKVA 1HDOA 4BQPA 4ZJUA 2C0CA 3AI1A 2JHGA 3MJTA 4L4SA 2J6IA 1VRWA 1EMDA 1T2FA 5CDYA 1E7WA 4LSMA 3MCVA 3GR6A 4B8ZA 4OOFA 1EVYA 3D0OA 3C85A 3JQ7A 1MB4A 1I3NA 5EESA 5FEUA 1KS9A 1O89A 4CMBA 1CETA 3UHAA 1HT0A 1ZIDA 5BNTA 1JQBA 2BFAA 3JQDA 1UJMA 3JQGA 4ZRNA 5IZCA 3BMQB 2DBVO 3GDOA 3JQGB 2YJZA 2WYVA 4DWVA 4K9DA 3JYNA 3ICCA 5DCYA 3E82A 2ZCVA 3HE3A 3ZWPA 3ZGYA 1EVJA 1QLHA 1A27A 1CDOA 4UEOA 1DB3A 3ONFA 1KEUA 3SVTA 4ZGWA 1WNTA 1E6EA 4JCOA 1TT5A 1DAOA 1E3WA 4BGEA 1LDEA 4Q3CA 4E4YA 2ZTVA 3L9XA 2CNBA 3UGKA 3DZBA 2ET6A 1VJ0A 3L6EA 3WYEA 3UFXA 5CEJA 1Y7TA 1QKIA 1WDLA 3RJ5A 3GEMA 1YS4A 3H3FA 4ALMA 2VYVA 4U0KA 5HA5A 2DTDA 4XQ9A 4E12A 3QRWA 5G0UA 1NXQA 2W4QA 1PZEA 3D4PA 3ENNA 2ZIZA 1RM5A 2BHLA 2ZYAA 3H4VA 4KQXA 3W8DA 2X22A 3KEQA 3E8XA 4MVJP 1KEVA 4E2ZA 5THQA 3E6AA 1NQAO 3GQVA 1ZXLA 1WWKA 4FFPA 3U4CA 3BTOA 3WS7A 3RUHA 4ALLA 1Y6JA 1I30A 3CPSA 3F46A 4XJTA 3ROPA 2QHXA 2QRKA 3SLKA 1OC2A 4IZHA 2PTGA 1ZW1A 1E3LA 1JVBA 3L4BC 4AJJA 2E82A 1PWXA 3WGHA 4ND3A 4U6QA 4IPTA 3U9LA 3DAFA 2WYWA 4PLTA 2IEBA 3TZKA 1ISFA 4FGSA 5T67A 2BFOA 5MGBA 1L1FA 4R1SA 4TRNA 4HFMA 2WDZA 3GF4A 5B4UA 4C7KA 4EYEA 3Q2KA 4Z0PA 4LN1A 3ZNQA 4DMMA 5IZ4A 1P33A 5DT9A 5KVCA 1YDEA 1ZVMA 2DFVA 2Q2WA 4IQGA 4AJPA 1FXSA 3ENKA 1I3MA 1QYWA 3INGA 2RH8A 1SO8A 3IUSA 2O3UA 3NV9A 3DBHA 1BMDA 1U4OA 2PV7A 2W8ZA 3AY7A 3WDSA 2HU2A 1DC6A 3HN2A 4L76A 2I65A 4RO0A 4IY1A 1VE9A 2UUPA 4GWGA 4FCCA 3WGGA 4IJWA 2GN9A 4NK5A 2ZTUA 2Y1OA 3L6DA 1PZHA 3EAGA 3QSGA 1HLPA 1F8GA 1Y8QA 1DRWA 2EW8A 2QIOA 2NU8A 5C37A 1SPXA 4DIFA 3ASVA 1CIVA 3WFJA 4BO9A 2O50A 2ZJ0A 4ITUA 4MPDA 4BNZA 1LLDA 4DA9A 4HV4A 3K2EA 1J4AA 2Y0DA 4BNFA 3E03A 3PQEA 1EEHA 1CQJA 3WYBA 2O2SA 4ROSA 1H6DA 4YAEA 3GRPA 5DCWA 2OO5A 4KTTE 1QYDA 4A73A 5DCUA 3W4JA 1G0OA 5JS6A 1H9BA 3HHPA 3JQCA 4ND5A 2VHWA 1N5DA 1YO6A 2IRWA 1PGNA 4RV9A 1SBYA 1Q2XA 2R00C 1ULUA 1EFLA 2BMAA 3VVBA 2VRCA 3WQSB 4B3IA 2I3AA 3WMXA 5A3JA 5U9CA 3OIDA 1WLYA 3ZHBA 1XIVA 4GMFA 1WPQA 3WX0A 2Y67A 3DMTA 1HTBA 4J1QA 2X58A 4W4TA 2Z1NA 1GUYA 2X7HA 4B7CA 2UUOA 3FBGA 3TZ6A 4D3FA 3CEAA 2NNLD 5HS4A 3GVIA 2DBQA 1U7HA 3QP9A 1HDXA 2Q4EA 3CSDA 4ZQBA 4KOAA 4BNLA 3T4XA 4RF4A 3CINA 4TROA 4OIMA 5HRUA 4GGPA 4J2OA 2PA3A 1PJTA 1DRVA 1DRUA 1BVRA 1RM4A 1NFQA 4BNMA 3IL2A 4E33A 1NVGA 5TT1A 1OZAA 4BNJA 2EWMA 4CM8A 1ENZA 5JAIA 2VUSA 3JQAA 4W82A 3VH2A 3WBFA 3JQAB 4CUZA 3RCBA 3Q11A 1TT7A 2X0NA 3ZWOA 5FI3A 3BMCB 2IYOA 3NTQA 4O63O 4XCVA 1GDHA 2DM6A 4R68A 3DOCA 2VOEA 4YJFA 4DQUA 4RPLA 1ZCJA 2D0IA 1DIBA 2CDBA 3GEGA 4ZU3A 4E21A 1E6WA 3DZGA 5IXSA 5L4NA 1YBMA 4YJHB 1BXZA 3V1YA 2AQ8A 4I5FA 4R51A 5HWSA 1DC4A 3KRTA 3DBLA 3Q9NA 3MJVA 1R4NA 3NJ8A 4W7IA 1PGQA 3UAGA 4CM9D 3ANMA 3GGPA 5A5EA 5DP2A 2O7QA 2VTDA 4PLYA 3V8BA 4CUJA 4GI2A 3HWRA 3FF4A 1PR3A 2PKRA 4HNGA 3M6IA 1JVSA 2B5VA 2FN7A 4WCFB 5I9NA 1QYCA 4Q3BA 4BO6A 4EJ0A 1PZGA 2Q1WA 1KY5A 2OP1A 3KO8A 3T7CA 3GVCA 3FNHA 5B37A 4CLOA 1XEAA 4H7PA 1G1AA 2JD0A 2JCYA 4NBWA 5I9MA 1PS9A 1ZO8A 2ZQYA 3GPIA 1BXGB 1A7AA 2JCXA 1B8VA 3GFBA 3D1LA 3WICA 2LDXA 4INAA 4CUKA 1IPEA 4QT0A 3UF0A 2VWPA 4ND2A 2FPPA 2HKIA 3ZNPA 4OOEA 4N54A 1FDSA 2DFDA 3ZWWA 3H2SA 4MVJM 3JQFA 5IG2A 2FZWA 3HQ4O 2I66A 1MLDA 2HCTA 1JWBB 3GPDG 4D7AA 3VZRA 3VDQA 4P4GA 3ZU4A 1B0AA 1EZ4A 3AK4A 1ONOA 3LC7O 1E7YA 5AXAA 5EPOA 1DLIA 3RBVA 4Y67A 1YL7A 2QYSA 5CAEA 1QG6A 5C7IO 4HP8A 1O6ZA 4U8GA 4DC1A 1H0KA 3C24A 3EHEA 3ON5A 2UAGA 1DEHA 5JDIA 1YE3A 3LC1O 4GKVA 3TL3A 1O9BA 3K2BA 3ZV6A 5KJ6A 1OC4A 4CMEC 1D7OA 2NVBA 2ZB3A 3ZWYA 2E6UX 2CSUA 1Q7CA 5GZ3A 1HYEA 3X2EA 1A72A 1A4IA 4BV8A 1L7DA 3C7AA 2PGLA 2AG8A 2EV9A 4MVJH 4RVUA 3NYWA 3OQ1A 4TRMA 1NQTA 2QZ9A 1GYQA 4B7XA 3OH8A 2NWQA 4OGWA 4N5LA 5ENVA 5LC1A 3NEPX 1B16A 5I7SA 3H9GA 3HB5X 2X23A 3ZU3A 3CMCO 1CF2O 3VDRA 4Q3EA 3JV7A 3GMDA 4DIOA 3C8MA 1ZH8A 4WLUA 3F1LA 1NFRA 4Z9XA 4N5NA 5I8ZA 3PHJA 4LCEA 3U5TA 1P0FA 4MP6A 4JBGA 5B4TA 1GEEA 5TLSA 4J1SA 3R6DA 4PFJA 4OXNA 4GGOA 3QHAA 4B7UA 2NTVA 5CDTA 4GX0A 1L7EA 2GD1O 3HNPA 1ENYA 1PJLA 3RU9A 2Y99A 3RKRA 1J5PA 4NBVA 5IN5A 3JCZA 3VH1A 3ST7A 4D45A 2QG4A 5LDHA 3SX2A 1P1IA 5B4VA 3JQ8B 2CZCA 4IDDA 4CLXA 3WB9A 5EMHA 1V3TA 4OKNA 3H65A 5JO9A 1ZSNA 3TN7A 1N7GA 1XA0A 1LC0A 5JFOA 5KOIA 4QFDA 2C7GA 1Q0QA 4WE3A 1E7SA 4WLVA 2JFGA 2FPGA 3BAZA 4PIVA 1GUZA 3H6KA 3QQPA 4QEDA 2EKLA 4ID9A 2XXJA 1ID1A 1KYQA 3AY3A 4NK4A 4WEOA 4YAGA 4DRYA 1Q7GA 2VYVD 1EBFA 4UUMA 5CPFA 2DC1A 2X86A 1NX6A 3MWDB 3KETA 2BLLA 5TT0A 3PEFA 4EI2A 3JQBA 1ZK0A 3A9WA 4XR4A 2HDHA 4FDAA 4DQXA 4MVJE 1R6DA 2HK7A 2PKQP 2RHRA 5TIIA 3RUIA 2X8LA 2IE0A 1FJHA 5BSGA 3I6QA 3OEYA 4YXFA 3OECA 3H9EO 2B37A 4Q3DA 1QLJA 4RVSA 5IDYA 4JGBA 2EXXA 1ZSYA 3OJLA 1PEDA 3K30A 3DZHA 3LK7A 4J1TA 2NADA 3H5RA 1BXKA 4XA8A 2RAFA 2P4HX 2JD2A 4WUVA 1P77A 1E7QA 1SCUA 4OH1A 2C7VA 5TGDA 4CPDA 3DHEA 2CDCA 3ZDFA 4GH5A 4YDRA 4CM7A 1E7MA 4AJNA 3IMFA 2E4AA 3GN1A 1S6YA 3VTZA 1DIHA 4YVFA 2I6TA 1DDOA 3D3WB 5CDGA 1GQQA 4LMRA 1CEQA 4M87A 1HE5A 4JP2A 4K1LA 1F8FA 4NQZA 2EEZA 3GH3A 1E77A 1BG6A 4IUYA 1LEHA 1YGYA 3UVEA 4DPMA 1F14A 3DBLB 1UDAA 3FR7A 3PYLA 3QVTA 1E7RA 5COAA 3TZCA 1D1SA 3LVFO 2BFMA 1Y8QB 2RHCA 2QRLA 4ALKA 1XSEA 2O3JA 3ZWNA 3KYDB 2X5KO 4BHTA 3AM3A 4YTEA 3KYCA 1LQTA 1P45A 3PTZA 3GK3A 3O26A 4IIUA 2R6JA 4RPGA 1E1LA 1DOHA 3T4EA 2CF5A 4D41A 1V6AA 1ULSA 4GWKA 1KERA 1SOVA 1LRJA 3C1OA 3T7EA 1E1NA 4J2HA 2XAAA 2PKQO 1Y8RB 4A27A 2CMDA 1EUCA 3H9QA 3WLEA 2YFHA 1T1SA 4XEHA 1JW9B 4I9HA 2DPHA 4I9UA 4QQRA 5K6AC 2ZYDA 3QVSA 2PZLA 5AOVA 4KWIA 1IULA 5FYDA 2D8AA 4TRJA 1W8DA 3RAJA 3OQ6A 2YY7A 2GRAA 1ENOA 2CVOA 1X1TA 2A92A 2JL1A 1JN0A 3F9IA 2VZ8A 4HFNA 4Y6SA 3IDSA 2G17A 2EP7A 4XB1A 1OFGA 3U09A 1NWHA 4KQWA 1X0XA 1MUUA 5CG2A 2GZ3A 3K96A 4J1NA 4II2A 2F00A 3PDUA 4MVJF 1LDNA 1P1JA 1PGPA 4R1UA 5C7OO 1GD1O 4ZD6A 2OBYA 4WKGA 1C0LA 4OQZA 4WCFC 1YXMA 2Q50A 3DAPA 3KOUA 1RKXA 1RM0A 3MJSA 3FTNA 4L0QA 1G0NA 3VTFA 2VHVA 5AQ1A 3ETEA 1XGKA 3JD1A 3KLPX 4BO0A 4DBZA 4NU5A 3HSKA 1UXJA 1BDMA 3KHUA 5EN4A 5KJEA 1U8FO 2P2SA 3BA1A 4CM8B 3TWOA 3OP4A 3ZI0A 4J16A 5ES3A 4WNIA 1NHGA 3MOGA 4GX5A 4QFCA 1U9JA 1O8CA 1GYRA 4XQCA 2BFPA 3EZYA 1H2BA 4PG7A 5GZ6A 3AM5A 3UOGA 4B4OA 3QY9A 1IYZA 4YAJA 2HMSA 5JDCA 3S2FA 5LCXA 3FCOA 4E5KA 4AJHA 4A10A 1XWFA 4RVDA 3LLVA 1EVZA 3LU1A 4AL4A 3GG9A 3D4NA 4DGSA 1QP8A 1Y8RA 3MTJA 3AJRA 4IIVA 4UEKA 2OORA 5IZCC 3WR5A 1PS8A 1M2WA 3WGTA 1RYDA 4HKTA 4QECA 1X15A 4IZIA 1I32A 2NV6A 2JAPA 3ZWAA 4AJ2A 4WLNA 4CM9A 2IXAA 1D3AA 2PGDA 3I52A 3ITKA 4TWRA 1ZK1A 3TRIA 1M66A 2AEJA 5TNXA 1NWCA 2VZ9A 1LA2A 2VHZA 2NUAA 2P91A 2FR8A 5B1YA 5IJZA 3I9KA 4O6VA 3V1TC 4MO2A 2Q2VA 4E5NA 4CM1A 5FWNA 4FC6A 4E3ZA 4R69A 1V0JA 5L7TA 2RIRA 2GSDA 3V1UA 2YZ7A 1T2DA 3O8QB 2GERA 4JN6B 3H2ZA 4S1VA 1E3IA 1EK6A 1MP0A 2AW5A 1AUPA 3HN7A 3JQAD 4BV9A 3JYQA 4CLHA 1O0SA 2X0IA 3TSCA 4IJVA 1VSUA 3R3SA 1HYHA 3E9NA 2W90A 3DB2A 3GAFA 5BSHA 2QRJA 1HSZA 1X1EA 1PL7A 1I24A 3AFNA 1H6CA 2GUGA 4K6CA 4PLCA 4KDEA 4F6LA 3BMNB 3R0IA 4PVCA 3EYWA 3ANNA 3UXYA 4DTIA 2CFCA 2EW2A 4GX1A 2YHUA 3RFVA 3ZWBA 1A5ZA 2FMUA 3AI3A 3DR3A 4CV3A 2X0JA 4DREA 2OBNA 5H81A 1BTOA 5HS6A 1QMGA 4WGGA 1GQYA 2OGUA 3NX4A 4BO8A 2P9CA 4CMEA 4TZTA 5ITVA 3GVHA 3F47A 3VAZA 4U6SA 4E5MA 3DFZA 2Y93A 1PQUA 4CM4B 3AFMA 1HF3A 5A9SB 4RGBA 1JAYA 4PRKA 3IQDB 2FRDA 5GZ1A 4DIBA 3MEQA 5G0TA 4D3SA 3BZUA 1DIGA 1MC5A 1P1FA 4F46A 2RBEA 2Q45A 3ZWXA 1VKNA 3PLRA 3DBRB 3ZNNA 1E1KA 4XGKA 4CMIB 1PQPA 2IZZA 4BGIA 2YV2A 3HDHA 4GPD1 5CEFA 5EL0A 1QR6A 2GCGA 2J5QA 3LT2A 3TNLA 2G1UA 4CLRA 4FFOA 4CMCA 3U62A 1FDUA 4R41A 3WLFA 4EUEA 4XWYA 2W2KA 3DEYX 3HFGA 4ZQEA 2VRBA 3PWZA 4P4NA 2VQ3A 3AM4A 3V2UA 3OHSX 3DMYA 1BRMA 2O7SA 3ZV4A 1F0YA 2FY8A 2RH4A 2NTJA 4AJ4A 3C7DB 4XQGA 1JWAB 1Y9AA 1SZJG 3PZRA 5L95A 3DOOA 4YAKA 2B36A 4H3VA 1ZJYA 1XCBA 3ADPA 4TQGA 4OSPA 4WEQA 5U1PA 4E31A 3FWNA 4YBZA 5EINA 3TL2A 1VSVA 4CMIA 4H15A 1SMKA 2YHIA 4RZHA 1QYXA 3N58A 4J9VA 3RC2A 1ONNA 2Y0EA 3LZ6A 1AE1A 4XYGA 2DAPA 3L4BA 5ER9A 1T2AA 3S55A 1GV0A 2G0TA 1QXSA 4GLOA 9LDTA 4PN3A 3PJFA 4EZBA 1X7DA 4BNVA 1ORRA 1UH5A 2WD7B 3KYCB 2Y1CA 1IL0A 2GZ1A 2C2YA 5F1OA 3NDIA 2AHRA 2NACA 4DBVO 3A14A 3CZMA 2WE7A 3PK0A 4TKLA 5ENDA 2NVUB 4FS3A 2IODA 4IS2A 2D5AA 4ZQHA 3NAQA 1YRLA 4BNXA 3ZHZA 4CL3A 3TOXA 3HDJA 2YW9A 1KETA 1VM6A 2CVQA 2X4GA 3GVPA 1A9ZA 3Q3CA 2V65A 2O3RA 1DC3A 3KXDA 3P7MA 1YWGO 2JCVA 1YJQA 4ESOA 1NQOA 5ILOA 4TMFA 4BNYA 2Z5LA 1UDBA 3GNTA 2B0JA 5I8WA 5ICMA 5L4SA 3GNQA 1J49A 4W6ZA 4LK3A 5CHEA 3INTA 4IXTA 4NDNE 4DLBA 4PLPA 3VPGA 4PG8A 4DLLA 3H5NA 3I6IA 3L07A 2A4KA 3WBBA 2DTXA 4EUHA 1LSOA 1I3LA 2HMVA 4ZN6A 1I8TA 2VNAA 1YQDA 3UICA 4B3HA 1ZZEA 4URFA 4CV1A 5I7FA 4CLOB 2B4RO 3QIVA 2BRUA 5A4DA 2ZJ1A 4TVBA 1K89A 4Y8VA 4MJLA 1FK8A 3Q0EA 4CODB 3WTCA 2NQ8A 5L40A 1SC6A 4FFNA 3KYDA 2PK3A 4MDHA 3L6OO 2HRZA 2ZTMA 4NHEA 4RORA 2PD3A 2R00A 4NZ9A 1XG5A 1LU9A 3ZW9A 5IFLA 4RVGA 3RD5A 1U1IA 2BH9A 1E3JA 4WJZA 2BELA 3PRJA 2C2XA 4EBFA 1J6UA 3G1TA 1ADGA 1LDGA 1LNQA 2G76A 3D3WA 4XIJA 1E3EA 4OXKA 4IINA 4A2CA 2Y1DA 4EITA 5A06A 2NVUA 1P1HA 1GAEO 3M2TA 2VYND 4CM6A 3HB4X 1N92A 2H5LA 4NBTA 1J0XO 3JQBC 1C0IA 1M6WA 2FP4A 4M55A 5T6BA 1MG0A 4FJ1A 4Z0TA 3SEFA 4RPJA 3JTMA 3D3EA 4PG4A 3M1AA 1XELA 2PWZA 3BHIA 3MOIA 2Y1EA 2PLAA 4HUJA 4CR6A 4D42A 2C59A 4BGUA 3EZLA 2GLXA 4FJ0A 4Z0HO 3A4VA 1KVTA 4OJNA 4LISA 3O03A 1D1TA 1Z75A 2EJWA 3I3OA 3P2OA 4DYVA 3NT4A 4MINA 4AJLA 4UEJA 2QYTA 2VTEA 4FOOA 2GPTA 3F5QA 2J5KA 5DP1A 3GVXA 2B4QA 4BMSA 5A1TA 3LQFA 1C0PA 3BTUA 3SC4A 1PJSA 1U2DA 1U8XX 4FW8A 3LT1A 5A3VA 3GZNB 1XR3A 4LW8A 1P44A 2VOJA 4R5MA 2AQHA 4M49A 4CV2A 5KVSA 2CDAA 2LDBA 3KSDO 3ETDA 4YJDA 2DBRA 3QVXA 3NGXA 5KKCA 1F17A 1OOEA 4N18A 3CTMA 3PGJA 3R3JA 1ZK2A 2P9EA 4FFLA 4LCJA 8ADHA 3TZQA 1JKFA 2V6FA 4YJFB 2WD7A 1E5LA 4HWKA 4AG3A 1LI4A 4O5OA 5TJ9A 3OETA 3GN2A 1RYEA 3RC7A 2XPCA 4PZDA 3ICPA 4WOJA 3O38A 4XDYA 1FDWA 1Z7BA 5F5LA 5JC1A 2IZ0A 3R1IA 1NP3A 1V35A 4Y98A 1MXFA 1Z6ZA 2P9GA 2HAEA 5A9SA 4YB8A 3S1LA 1LXCA 4LSWA 6ADHA 1QV6A 4FGWA 3VZQA 4AVYA 1I10A 4IBOA 4BOYA 1TA4A 5GY7A 4O1MA 5JNLA 3H8VA 4BS9A 3GMSA 3SJUA 4D79A 4M89A 3GAZA 3WOHA 1RM3A 3WIDA 4RPKA 1YOVA 4KUGA 2WM3A 2HMTA 2G82A 1BW9A 3GEDA 4GSLA 1R4MB 5DBIA 5IDXA 4RVHA 1ZK3A 4IS3A 3OIGA 1T4BA 3BYZA 5JY1A 1E5QA 4XIYA 3A28A 4TSKA 4W9NA 3MZ0A 3D5QA 2GN6A 4JBIA 1PR9A 2VNSA 1WW8A 2ZCUA 2F1KA 1X7GA 4P38A 1GL3A 4BO3A 1H94A 4AJOA 1ML3A 4WPGA 1EE2A 1Z82A 1KOLA 1VC2A 1R37A 4B79A 1PJQA 1ZFNA 4P22A 1B3BA 5I9LA 2JAHA 5EQFA 3SC6A 1I33A 1YKFA 3FNGA 1XKQA 3D4OA 3S8MA 4PGFA 1EDZA 2J3HA 4XB2A 4ALIA 1GY8A 3NUGA 4OMUA 2EERA 1ZKMA 1V8BA 1PGJA 4I8XA 3B6ZA 2WWRA 1YH3A 3H7AA 4RQTA 3H9UA 2Q3EA 3L77A 4LRTB 3UW3A 3DWFA 2O4CA 1KVQA 1JA9A 2UDPA 3KVOA 1E6UA 1BXGA 3QVWA 5F3RA 4YJGA 3I9NA 3H9JA 2VHYA 2BKAA 2HJRA 2YFQA 3OMLA 1U2GA 1WZIA 4CMGA 1EE9A 3PPIA 2AQKA 2GN4A 3U4IA 4NPCA 2IDZA 2P68A 3IIEA 1NFFA 5DN9A 1PJCA 1XYGA 4IDAA 4I08A 4TRRA 3AU9A 3I1JA 2X5JO 4CM5A 2TMGA 4NG5A 1NTOA 2JFFA 4WNCA 4Q3NA 1U3WA 3K5PA 3L4SO 3WJAA 4R16A 1R15A 4DPKA 4BO5A 3ONDA 4UVHA 2B69A 4B8WA 4AFNA 1O95A 2YUTA 3COSA 2ZKLA 4PLWA 4Z9YA 4GVXA 1B7GO 4MP3A 4UUOA 4OL9A 1VL8A 1H6AA 3GNSA 4F3YA 1HE3A 1N2SA 5EQDA 4IGFA 2UVDA 3F1KA 3WGOA 4GVLA 4O0LA 5T8KA 4OAQA 4E2XA 3WIEA 3IJRA 1C1XB 2X6TA 1H5QA 1A4UA 4GMGA 3EUWA 1AN9A 4II3A 1LJ8A 3ZH2A 2C82A 4K26A 1BHSA 3X2FA 3LYLA 4XRRA 1NPTO 1OI7A 4D0SA 1DHTA 3QVOA 3UCEA 1P74A 2NU9A 4CQMD 3AUAA 1GZ4A 4AJEA 4L73A 1YVEI 5KWEA 5JMWA 3JSAA 3KSZO 4BUCA 1R4NB 3JQEA 3DOJA 4MOWA 3VPXA 1HZJA 5JYEA 2PZMA 5BNIA 5THKA 2HO5A 1NAIA 4W7HA 4JBHA 1ONPA 3RROA 1KVUA 3UUWA 1CERA 3UKOA 1P0CA 1KVSA 3B70A 3V5NA 3PGXA 3FPCA 3NJ4A 3HDQA 4R01A 4DUPA 3Q9UA 4G65A 3QWBA 1I3KA 2JFHA 4HNHA 4MIEA 3UH1A 4YPOA 4QUKA 5JBIA 4J0EA 3GOHA 4FPXA 1NBOA 1U4SA 2BGMA 3G49A 2OZPA 1H2HA 3ZW8A 3GLQA 4BO1A 4MKXA 3PJDA 3JD2A 2D4AA 3OIFA 4UVDA 2I99A 5DF1A 3F3SA 4YT8A 3VZSA 1G6KA 4GX2A 1T25A 3RWBA 2YHIB 3I23A 4NR0A 3DZIA 5HBRA 2O23A 3JQ7B 4BNHA 2IEDA 1KY4A 2NQTA 2QZZA 1YQGA 1PQWA 3LT0A 1XQ1A 4Z6KA 1FF9A 2X9VA 4J7CA 5JE8A 3B1KA 1LSSA 5DBFA 5CFZA 2BI7A 1Y5RA 4EUFA 5ILGA 1GUFA 5L3ZA 4EGFA 2Y1GA 1N9GA 4BNKA 2WEKA 1UR5A 4B4WA 5COQA 4ALNA 1C1XA 1AGNA 4R5HA 5CP8A 4C4OA 3OQBA 3ZHXA 4TKMA 1GFSA 3IC5A 5CPBA 3G17A 5JLAA 2NM0A 4E0BA 4YT5A 1QSGA 2EKPA 5L9AA 5FI5A 3NDRA 1R16A 4E5PA 3CH6A 1I2CA 3TF5A 3QLJA 3N74A 3TPCA 4NNJA 2XXBA 3BIOA 4D44A 1FDTA 4IDCA 3GGGA 1UDCA 1TB4A 3JQ9C 5ITWA 4HY3A 1OBFO 3V2GA 4E2WA 2O4UX 4BL5A 2VRCD 3PWSA 3O8QA 4NIMA 1AXEA 4IJKA 4R9SA 4FN4A 4L4RA 3FN4A 1SAYA 5JXWA 1KEPA 2OP0A 2FSVA 1LX6A 4J6FA 3AW9A 3STHA 1V3VA 1WP4A 1HWYA 3WMWA 1X7HA 4J4TA 2HK9A 4DLAA 4I9NA 2VUUA 4IDGA 3PHGA 1N7HA 3VPFA 1ISGA 2GZ2A 3DXFA 5CDSA 5TS3A 3DO5A 3WQRA 5JAMA 3K6JA 4OQYA 4R3WA 2FWMX 5L51A 1JKJA 2OUIA 2H9IA 3I9LA 4PG5A 3PYXA 2CD9A 5EIOA 5AXDA 5AXCA 4D0RA 4PVDA 4BMNA 3SXPA 1UP7A 5HM8A 1MGOA 2I67A 2J5RA 2WTBA 2YQ4A 1Q7BA 1GZ6A 1UP4A 4J7XA 3HUDA 2D59A 1H93A 3EW7A 3M2PA 1UXIA 3PIIA 5A5FA 3I9MA 1IZ0A 4UVEA 2V6GA 3PI7A 2I9PA 3JQ8A 1GR0A 1HDYA 4QX6A 5A9RA 2GR9A 1ZXBA 3FR8A 3TZHA 4MP8A 5JDCC 4MIOA 2AEFA 3QWAA 1NM5A 2X1HA 5BNFA 3AUTA 5DNAA 5DZSA 2PGJA 4A03A 3UCFA 3PHIA 2DTEA 4M1QA 1OMOA 5JC8A 3HFSA 3DDNA 3O4RA 3W6UA 4L75A 5BSFA 4J91A 3CUKA 4R54A
chains in the Genus database with same CATH superfamily
1BGXT 3VSDA 2VHXA 1HPLA 4HS9A 2V9PA 2QGFA 4JC4A 3AZQA 4OJTA 2JHFA 1N9GB 3NBFA 4UARA 4J0IA 4IMRA 5FHRA 1ZK4A 4A8HA 2XHEA 3LPLA 3RRJA 1CUAA 3NB0A 3AEKA 3IQFA 3IHWA 1VSTA 5KPJA 1N5LA 3H2JA 1EESA 2Q5JA 5AM3A 2P11A 3MRVA 5BP7A 1Y1LA 2WYIA 5HR5A 5JARA 2XA1A 3UC9A 5IUKC 1AGYA 3ZDXB 1L5SA 1AK1A 1R4MA 2FR8C 1VOTA 3WQQA 4BMDA 1P39A 1ZMXA 4L8VA 1KKMA 2PX0A 4H7EA 3Q1LA 1DZ3A 2GPSA 3SHTA 4OI4A 4X5OA 3S68A 1CJVC 1KRWA 2ZIUB 1MVOA 1YA4A 1E92A 3JYOA 3ND7A 4LZPA 4NZYA 1U7UA 4GRDA 4M0EA 1QIFA 3Q3JB 1TT5B 4BQNA 5C3MA 3G2JA 2EJVA 1R27A 3PC7A 5ALZA 5IS2A 2EF1A 3PLAE 4YPVA 2ZSKA 2Z1MA 3PS9A 1H5UA 1NASA 3F6EX 4OUDB 3KWFA 3PHHA 4UHJA 1CVIA 4P54A 2Z8YM 4HDOB 4UOZA 4ZV4A 4X00A 4D43A 1ISIA 2YWEA 3I1IA 2LWIA 2FE4A 1I2BA 2JS7A 2X5OA 1C3OA 2B25A 4NE2A 3W8EA 1C2TA 4BP3A 5BWOA 1UQTA 5GP1A 1W36D 4HX5A 1XDWA 1W76A 3JQQA 4WFQA 3UAOA 4YCLA 2GDZA 4BNIA 1D6JA 1JKXA 5HCNA 2C4KA 4YQZA 1WHTB 4ZOQI 3TJZA 4PHCA 5I7EA 3G3EA 3RC8A 1FYEA 3NGLA 3JASA 2GNAA 1JR6A 3U2QA 1LDYA 2ROQA 4QJIA 3DZKA 1RLUA 5G3YA 5IHXA 1D6NA 3I6BA 4B6RA 4BB5A 2J3QA 2C20A 2G5CA 3R3VA 4GOLD 1E2GA 2HFKA 2UUBB 2PMCA 3P9CA 3BK2A 2OV1A 1Y1PA 3LBNA 3IHTA 3M1YA 5AMXA 3TD9A 1L9KA 1IMJA 1SEVA 1E9AA 1ZICA 1B2LA 1UJ5A 3N2EA 3TW4A 4AD8A 4TQUS 5AVXA 2C4HA 2O2EA 2XEXA 4A6DA 4EHHA 4E5YA 4FEGA 3CXRA 1PZFA 3M6FA 3HJAA 1B42A 1HL3A 4H6PA 2UZ1A 4RW0A 4NV3A 5BN5B 4GHWA 1PR1A 1IZYA 1FX1A 5FADA 2OPBA 2EX1A 4Q7MB 1JFSA 3DO8A 3PGVA 5ALUA 5F5NA 3U4DA 1MEEA 1CUIA 4R3NA 5JQGF 1A9PA 1CZUA 3NVDA 3FTCA 3CX6A 2A94A 2QUZA 4Y2VA 3C4VA 3TEFA 2CL7X 3OT4A 1DC5A 1Q0LA 5GVRA 1EXMA 3IDFA 4OXYA 1ZG3A 6PFKA 4KSCA 2YZKA 3QLVC 1LBIA 2ZS9A 3RKUA 1UBUS 4DV5B 1JG3A 2BAGA 2ZYGA 3K31A 1AXRA 3COVA 1XQVA 3DL2A 1U7TA 1RWBA 3KVVA 3QPWA 4MAMA 4FUTA 3VO1A 1UIMA 3QUBA 4HYYA 3A26A 4MRSA 5HK8A 4A2QA 2NIPA 5ED0A 4U5QA 4TS1A 2G08A 3IDAA 5MDHA 2OXFA 3KSUA 1G3IA 4HH4A 3N0VA 2ZIXB 1MT3A 2Q8PA 4IV8A 4CTJA 4LY9A 1TGVA 4ARSA 1ENPA 2PPVA 2CJWB 3RBXA 4DR1B 3QKSA 3NT5A 1OB2A 1E9CA 4Q9JA 5KVVA 1MOZA 2OEPA 1MX5A 2Q49A 3O8BA 2IYLD 4J9UE 4YN3A 2I55A 3T3HA 2C5EA 2ZI4A 2UYHA 2P6MA 1XAJA 5DH9A 4CV0A 2GCIA 2DH6A 2R5FA 1IY9A 3PP8A 3VHQA 3DNPA 4O25A 5LA6F 2VJAA 4DLWA 5C4MA 5IXYA 5CW2A 1P9RA 5LOVB 2JFYA 3JALA 2JIZA 2IYEA 2WICA 3TKAA 1C1DA 4IV0A 4TV9A 1WOYA 1L4NA 1KZ1A 2Q1UA 3U1BA 2WFMA 3I8SA 1L5ZA 3KJQA 4XUGB 5TJHA 1I3OA 1N7JA 3O73A 5KWJA 2EG9A 1Y42X 3CKYA 3OPXA 2C4NA 4HNAB 4MWOA 9LDBA 4YRZA 1ECFA 3ZCXA 1NKSA 1P1KA 2QK4A 4GNKA 3RYHB 2JIDA 2V97A 2FV8A 4ZZ0A 3C3XA 4NWIA 5ESWA 4DEVA 3UGJA 3QLTA 3BE4A 7GPBA 3ZTTA 4UQLA 1RYBA 5KHLB 3VNVA 3OEWA 1F2TA 1OFTA 4US0R 2OYSA 1Y1RA 2BGLA 4ZICA 2QQ0A 1LRLA 1YIOA 3DSRA 1B15A 2JCGA 4OF4A 4HGZA 3QTBA 2IPAB 3WSWA 4DNPA 2V4UA 1KMCA 1JPJA 3ZNOA 3DA8A 1XMSA 2VWHA 1ODSA 3MFYA 2WM8A 3D2CA 2CE2X 3OFJA 4DE5A 1P5FA 1YS1X 2B98A 4BQIA 2QENA 1HDIA 4LRUA 4MS1B 2PU7A 2BF7A 3HK2A 3B12A 4D92A 3L6UA 1JHYA 3R6LA 1QRAA 1ZA1A 4ZVTA 4HVAA 3DXXA 1TMYA 4KPUA 1P7CA 2ZUTA 4DLTA 2NZJA 4I66A 5KJ1A 3A1NA 3PXAA 3UV3A 3A1CA 1EFKA 1HDZA 1HOXA 3D7LA 4B3DA 1M0EA 3ZLAA 5EHNA 3BMXA 1R00A 2ZU6A 3OO0A 4RF3A 4CL0A 2X4IA 4LZWA 1MH1A 3N8GA 5KTTA 1JJ7A 3RHTA 3U4QB 3T6KA 4AG5A 1Q1NA 3MXTA 1KDZA 1A9SA 1U3UA 1W85B 3PA8A 3HDVA 4ZVQA 3GUYA 4I46A 2BY4A 3SNHA 2P3QA 3EMKA 4AUEA 2AG1A 2RGNC 4ZK2A 2PSHA 2JASA 5G0WA 3A6KA 4XYLA 2ONYA 4TQAA 3GZ4A 4GOKA 1T9HA 1T1RA 4D0GA 3SYMA 4MB6A 1OFUX 3ILYA 2D5CA 1AT1A 1RYNA 3I2GA 4DMFA 3DB1A 4N7RA 1GZ7A 1MGPA 1HDCA 2V7WA 3OJEA 2C57A 4FBGA 1PJBA 4MI1A 3FCCA 5LIRA 2X2PA 2CXPA 4YMUA 3VPCA 2H8GA 5AUOB 3IR5A 5CFOA 1G5RA 1O95C 1VJCA 3FCUB 1QPGA 1GGMA 1DOAA 4GOMD 4QO8A 1IFXA 4ZRMA 3RT9A 4PY2A 5D5QA 1E9EA 4O4HF 4PZPA 5FNZA 2J8ZA 3B2QA 2K6GA 4R2WA 4X94A 4YR9A 2C7PA 5K99A 3NT2A 4IX9A 3O91A 1J5XA 3AB3A 4GP7A 5EMJA 1FUKA 3HKCA 2I7TA 3SS9X 2BHSA 1LQUA 1ECPA 1NXXA 3G9XA 3PCXA 4WASA 4MHOA 1P7ZA 2XWPA 4XXHA 5U4XA 4CQMB 4OQEA 3O83A 2GASA 4DXAA 4BKMA 4CMJA 4ZZ1A 1ISHA 3LSYA 1X7YB 2O8NA 2XE6A 1MZPA 1TTQB 2CBGA 2DY0A 2JIRA 2VSOA 4HAIA 2IS4A 2G1JA 4NH4A 4TMYA 3UK1A 3EIXA 3RFTA 3ZS8A 5A03A 1IQPA 3CWCA 3CNOA 4OMDA 1PWZA 2W2LD 3FWZA 3QLEA 3QYPA 3DO6A 1M0TA 2Y71A 3F6SA 5C81A 5AVRA 4ZQGA 3I45A 5J2UF 1RXEA 1KWKA 3AJ8A 2R47A 1Z5OA 4X95A 4WQMA 1ESEA 4I1OA 2PGAA 4Y1FA 4YRBA 1CEEA 3G0OA 5HMLA 1ZC3A 2DFTA 3IMCA 3HZHA 3N3AC 4D9IA 4EH1A 1APBA 4RFSA 4YQEA 3L0DA 2ZSBA 2WMDA 3HYLA 3H5TA 1UJ4A 2VQDA 4BPRA 4JP1A 2ZJAA 2I54A 1X19A 3HBMA 3I12A 1GNTA 3MNFA 2E49A 1X7YA 1RWXA 2CF6A 3PFKA 3Q8XB 2RGCA 4COOA 1KK0A 2A1UB 4NL4H 4D98A 5IM5A 4YUYA 5GPBA 4M9RA 1YJ8A 4I5GA 1GQ2A 4MV8A 2PX8A 3ZD8A 3NQ41 3QVGA 1VKOA 2G7ZA 3BICA 3HGMA 4PBTA 5TXGA 4V0MA 2FUNB 4HXYA 2GBFA 4G63A 4WECA 5ELLA 5D87A 1IDOA 2IDJA 4LXGA 4MMXB 4TYMA 2X0DA 3ZZUA 1J9ZA 5FTMA 1XAIA 4KP7A 3BB3A 4P0PB 2FAXA 1W5SA 1XK6A 4XVUA 5I9IA 3JD0A 3D6UA 4RF5A 4OHMA 3H3JA 3PKZA 1JAXA 2DFLA 3ASZA 1PUJA 3CPJB 3KT3A 4P32A 3O2QB 3CG4A 4EKEA 3QKSB 2C5AA 3QVUA 3FRIA 1SWWA 1Z68A 1M2EA 5K3FB 1WY5A 3VOSA 3WGZA 3UOAB 2INGX 3BJRA 3WNZA 4CQJA 2KE5A 4KDFA 2W83A 1L4FA 2QRZA 3G8AA 1JJVA 1XZPA 2GXSA 2XCIA 1F06A 1E4VA 3A70A 2PYIA 2JGNA 4PONA 5EERA 5IF3A 1A8IA 1RYMA 4FYKA 5ANRB 2D1FA 3S2GA 1IWPB 2O3QA 1XCGB 3WO0A 1X2BA 3DGFC 1AS0A 2QP3A 5CGZA 1UZMA 4YV1A 4H0FA 4WKPA 1FFXA 4LA4A 5FLKA 4IV5A 1JILA 2PH1A 1MB2A 1GV1A 3GHHA 1N25A 3ILSA 4OA8A 4EEZA 1W46A 2BDEA 4JYMA 2ZCJA 1W4ZA 4RA9A 3E9CA 3QU9A 3QY0A 2CUKA 1PVOA 4MZXA 4N49A 1NXOA 1XLWA 2C29D 2NPOA 2SBTA 1HKUA 4HMQA 1IK4A 5AD1A 1NG9A 2F3QA 2Q21A 3CIOA 4FOTA 5DBEX 4C22A 2O1SA 3HVRA 4DL9A 2CKMA 1U80A 1X42A 3P0FA 4PGHA 4G3XA 1PFUA 4P8RA 1YB1A 4QQNA 1R6AA 4QIHA 1I5RA 3BCUA 1GGHA 2VF8A 4GFDA 5CCDA 3BDIA 2SKDA 4MGEA 1XNQB 4K03A 3UMVA 3BQNB 1N4AA 3V32A 4EKYA 2NXWA 4ISCA 4U02A 4V0LA 3BDAA 2QAGA 2D2FA 5HCUA 3CW9A 5TX7A 1XTQA 5K4HA 1NW7A 2J3JA 2OCDA 4WN9A 3EIHA 4PZEA 1A96A 4WFKA 1OY1A 2H2AA 4JBLA 2Z6UA 2WDPA 4QXMA 1XRQA 4BB9A 4AZVA 4RZ2A 3GG2A 4KL8S 3TQQA 1DWPA 1I1QB 2PMDA 1OXKB 3REFA 3RFFA 5E3HA 4QWMA 2Q1TA 2QI9F 2R44A 4MUHA 2O3SA 2AT1A 3EGDA 4NYJR 1U0SY 3SN6A 3WGYA 1V1MB 3ZCUA 4GEGA 5BOSA 5HK9A 1SVIA 2CVHA 4NMHA 1AHIA 3CB2A 2GGSA 4JVMA 2QSYA 4NJOA 3T35A 2Q46A 2FEMA 3PJGA 1K6XA 1OLSB 5E6SA 3T3PB 3TW6A 4A0SA 1UC8A 2I2AA 3RS8A 3F6RA 4IDOA 3VH4A 3WNVA 1AMOA 4C7OA 1T0HB 2HL6A 4KMRA 4XVHA 1HV8A 4QJ3A 2RJNA 3NFYA 3OESA 1LCIA 4UZSA 1TZKA 4AMVA 4IJ6A 4QTZA 5COBA 4XKJA 1YR8A 3OQVA 3NM5A 3R9XB 1A5TA 5CDUA 1JLHA 1NKTA 4Y2QA 2P2NA 3ONEA 3TPFA 3UWMA 4M8KA 1LBHA 4YMIA 4EVRA 3IT3A 4UOEA 5L7WA 3L6BA 2PNFA 2XEDA 3UYLA 4OQ4A 3BT7A 2A6PA 4AF7A 4MGIR 5EQJB 2YOGA 1ZBDA 2C2OA 3OO1A 3OPVA 2AJBA 4QBGB 2BGRA 3SJBA 1HE4A 4F56A 3MMPA 1SBZA 1VE5A 1ZAYA 1RXYA 2FEKA 1TF2A 1KF0A 1S2DA 4GI5A 3TYXA 3RYIA 2E5WA 5AKJA 4XIIA 4NV0A 1RDFA 3L06A 4QXAA 1D0SA 2FMIA 1PZXA 4GXTA 3TI7A 3KKLA 2JLQA 2MSLA 3AKEA 1HE2A 4IDHA 4R1TA 5M29A 4KNYA 4QSMA 4ANFA 1CUHA 1FVOA 2GZMA 3BFKA 1C3EA 3IBSA 4O4JF 3TL6A 5MHTA 4RENA 9MHTA 2ZBUA 2AMFA 2G9VA 1EFRA 2GO1A 2WAOA 3EZ7A 4DV7B 4J4HA 1VCOA 3W3AD 4DA6A 1P7WA 4P93A 2RKWA 2JLZA 3QEOA 4N01A 1YZFA 3BTSA 2W71A 3KUUA 5FV7A 4B2PA 1RAFA 2P4EA 3ZWVA 4RM3A 3PNPA 1K5GA 1A7UA 1E8MA 1M54A 3G7SA 4DSOA 1MJGM 3CUEF 1ONBA 3A11A 3EDMA 4K9RA 1IY1A 4PCAA 3TDKA 4YDQA 4JLUA 3O9ZA 1B0PA 3U80A 1IB6A 3GA5A 4QHTA 3TSAA 3ICQB 1ABFA 1DHRA 3MJEA 1W36B 3TE7A 2YQ5A 3U0VA 3EH2A 4ZANA 1AA6A 2IYZA 2QZJA 2QAJA 1K0UA 1C4KA 1E5DA 2RHTA 3EMVA 1OH7A 3L0BA 4PQFA 2PVCA 3IPCA 3JASB 5HQTA 2VUIB 4A1FA 3TXAA 3K92A 2N47A 3C6YA 4IIEA 2B92A 1OIVA 1N3BA 2ZUVA 2PH3A 3DTVA 4PTYA 2FSHA 3DMTC 4YMWA 3FCEA 1FDVA 3TO5A 4FONA 4E51A 3SZOA 4KLCA 1YJ5A 2HBRA 3Q72A 4Z53A 4BY9E 3AUSA 2Y05A 1CQXA 1GZUA 3K15A 3SQNA 1NOJA 2YC4C 4AK9A 4LF7B 1NNI1 1Z2NX 1B26A 5JAOA 5CT8A 1VLHA 4QUDA 4CDMA 4NMXB 3PQFA 1J0AA 4BFLA 2PVPA 1B8PA 3MVEA 3AUYA 2VS1A 1DAPA 3GLVA 4NOJA 2AEEA 1SBHA 4KQ9A 1DG9A 3G8DA 1WHSA 3KYIB 5LYJB 3HPQA 4C08A 1KOGA 2QL9A 3FYCA 1WZCA 4NFYA 4QTUB 2Z2YA 4IHJF 7ADHA 2NVWA 1CUSA 4D9JA 1WBBA 3EFEA 2FSSA 5E1BA 4GBGA 2H54A 4HI0E 5F23A 4LXXA 3QA3E 5JW6A 1D2AA 1GSHA 1PVDA 3PQ4A 3AFHA 1QCYA 2QLFA 4IP0A 3ZBPA 4FZJA 2EIXA 2B1GA 2JGJA 2ZRAA 1IIRA 1TD1A 1ZH4A 2H8KA 2XVMA 3O4GA 4EJFA 4MGZR 4D56A 5KTKA 1XMJA 5H9VA 1JT9A 1HZZC 2HX1A 1ZL2A 5DNCA 5LYJF 1Y3IA 3G79A 1NI4A 2WWXA 4M8SA 5A0VA 4O4IF 1TK2A 4IHJB 4G84A 4XUDA 3A3PA 1RCUA 2WVGA 2BEJA 3FMGA 2YWJA 3OZRA 4RGQA 4ISBA 1A9YA 5CTAA 3EDRA 4RF2A 3NC0C 2PH5A 1NSYA 1Q0HA 1XNJA 1V5WA 3GFPA 3ZVNA 2IXGA 2IYYA 2NLOA 4CQLB 1X1DA 3Q2IA 1MJNA 3ZTWA 4RGVA 1ZH6A 3LXMA 1TD9A 1MX3A 2Z2ZA 1SCAA 3RK0A 2ZI9A 1O0CA 3BJEA 3N87A 3MELA 3LVRE 2EZUA 4WRRA 1CP3A 5B12A 4PWZA 2Q4OA 3OJ0A 4G6ZA 2IP2A 1IOZA 4O4IB 4PS0A 4UPVA 3EXHA 3W4KA 4BKOA 4AUMA 2ZITA 4B9EA 2X8JB 2ZTLA 1U8TA 4TT8A 3O1LA 4Q1CA 1ZUNB 1G3RA 1VFNA 1CUVA 5BW5A 1KMHB 3JU3A 3N59A 2ZT8A 2HNKA 3MRTA 3PU6A 4OK5A 3WGQA 4TKVB 2M9MA 3BS4A 4WLOA 1KYWA 3VV3A 4BMVA 1UZLA 3OZCA 2NU6A 1CJCA 4HDNB 2RH5A 4Q39A 1K8ZB 3A3KA 3NVAA 4LF6B 2YV1A 2ZJ5A 3B7WA 1CQZA 3KUXA 2A58A 3ZQKA 5FBKA 3C1AA 2OB1A 3M83A 1AK9A 1SOWA 2X2OA 5K20A 4HZIA 4DZRA 2P6PA 2P5TB 4FU0A 2VHJA 4MVJI 2DBZA 3INNA 3EQ2A 3ZU6A 2F4VB 1WVGA 1P31A 1EDOA 1OLUA 1Y4SA 3HR8A 3MGGA 5AO9A 3OE5A 3AY0A 4CMKA 5BSRA 1PBTA 2NSDA 3QNMA 1GA6A 4IMPA 1UAAA 1EXNA 2SHKA 3G88A 3EXIA 4WZBE 2O8CB 1BSVA 1TK9A 2HLDD 1MA0A 4JBNA 4P0TA 3CW8X 1HM5A 3VSBA 3LC2O 4MYDA 1FDRA 3WIVA 3H5LA 3Q5DA 3ROQA 1J22A 1W0CA 3L0OA 1QF9A 4Y2YA 3RYCA 1WNFA 3F8WA 5DBHX 4XR9A 1J2RA 3AHJA 1ORTA 2NSJA 4FYVA 5KTPA 2ILTA 3BXXA 3PDIA 1DIRA 1B3RA 2R1TB 1I4EB 3OLYA 2H1VA 5KQLA 1Z5WA 2QT9A 3KM0A 5G1OA 2JDID 3FOZA 5CFRA 3C3MA 5JAQA 2YV3A 2H06A 3SMVA 3OU7A 1OASA 1PSZA 2P69A 2GZSA 4BVBA 1IHXA 2DWPA 1YMVA 3Q9LA 2FR1A 1IE3A 2TMKA 4LRSB 4NBLA 3AB7A 3PPYA 2QQEA 4AUNA 2AKEA 4WY2A 1GQOA 4CM3A 3AF6A 3HRHA 3O1JC 5ER6A 4EG7A 1PL6A 2B35A 1Q92A 2HF9A 2PUEA 2ZRBA 1QBGA 3KQLA 4TWAA 2GJ8A 1QQ5A 2IY7A 3QOXA 5A7GA 1ZM4A 3RRFA 2VT6A 1BOFA 1U5BB 1QV7A 4I5EA 4L2IB 1EK0A 3CBGA 3T0IA 1S2GA 1YHYA 4MKZA 4A0QA 3EXG1 1M5RA 4QZVA 1ZM2A 3PDIB 4MCAA 2H92A 3D7MA 1V8DA 2VWQA 2DSNA 5DHTA 1AXGA 2CGEA 2V7QD 4GPBA 3KSMA 4BKQA 1NVFA 3CNNA 1G6Q1 5SYNA 5IC5A 2RCYA 1W0JD 4ZCSA 2P30A 3HCOA 1K3TA 5HQ3A 5IAAA 5C8YB 2MSCB 3R7WA 4EEXA 3KLNA 3BXHA 3EVDA 1MVNA 5FTJA 1RWPA 2HREA 3EPJA 6REQA 2XRZA 3IVGA 2H2GA 1HETA 3FFBA 5H82A 4FOSA 3IQZA 3OX3A 2FDXA 4AKEA 3M8KA 4UE3S 2PFGA 3KQYA 4F4FA 3GDFA 1UWLA 3H1BA 2P4QA 5K0GA 1FJGB 3FIJA 1JH9A 3W8NA 1U9CA 1X8KA 3U3ZA 5HPYB 4JROA 1FTSA 4ER3A 3Q88A 3U81A 3U56A 1CR0A 5JQGB 4TWBA 4ZRDA 1GKLA 4RH0A 1QF6A 2ECQA 1MV8A 1N36B 2CHVA 1T36A 4W1PA 4MYRA 5KDOA 1TM3E 3B20A 4L3VA 5BOVA 3AL0C 3OM8A 4UNPA 3P94A 3KSAC 2VXOA 4OHKA 1DFIA 1SKBA 1WHTA 2WZDA 4IIGA 1DTSA 1SVSA 1VLVA 3IR7A 4FGZA 4YQYA 3AOEA 3AIKA 2H1OA 5AK3A 5FJJA 2EWVA 2NPFA 3UJAA 4BMYA 1VCMA 3LLMA 4KN6A 1QO0A 2CLMB 3C7CB 2QAGC 4BATA 1LD3A 3LWBA 1XPRA 4Z5XA 4D6PA 2IFTA 3IXQA 1G19A 3B60A 4B85A 2D7CA 4IRUB 3FHTA 2VAXA 1QVZA 1PJAA 3R3XA 1L5LA 1UBNA 2AFHA 1E3SA 2OUKA 4JT8A 1MKYA 1A5BB 3W5VA 1G8MA 1JDPA 1WXXA 3WSVA 2G1AA 4K6OA 1KC3A 1HZZA 1ZBQA 1K66A 2WM9B 3NWJA 5K4AA 4BBJA 1V1RB 4KIUA 4LDQA 3ZBQA 1DWQA 1C9JA 3EVNA 3H7IA 1SUWA 1CZLA 1DQZA 5CLLA 3K0KA 4HNUA 4R8VA 4B44A 4MQ5A 3EY4A 1M2JA 3DV9A 1DV1A 1HRDA 4IQ0A 1NVMB 1AC5A 4F3KA 3W2TA 4JNCA 3ADOA 4WVFA 3GHYA 1HDOA 2HNAA 2OCIA 3K70C 5DV9A 3MJTA 5E95A 4N0MA 1OCEA 5AK4A 3GT4A 13PKA 4QYWA 4L4SA 2DH5A 2JI9A 5H70A 3RH0A 4LSMA 3KKEA 4OOFA 2AMYA 2W00A 3C85A 1JR3D 3M6MD 2W2QA 1MB4A 3IEVA 4BX8A 3GRUA 1CFJA 1VMKA 2HN9A 2Q1YA 1KRHA 1G6HA 2FZLA 2V55B 1O89A 4H1UA 1A50B 1HT0A 2QM8A 1ZIDA 1VA4A 3ZY2A 1GOTA 2BFAA 2GAIA 3JQGA 2PRZA 3H0CA 4ZRNA 4DANA 3BXZA 2GI4A 3O8CA 3L4JA 2YJZA 2D4HA 4LVOA 5DB4A 4E5VA 5KYXB 2PM8A 2PDAA 2Q27A 5JAHA 3WYGA 3EXAA 3EGDB 1V2HE 4Q4CA 1VP9A 2APJA 3HJCA 2VJNA 3DQQA 4GBMA 2ZCVA 4RHTA 4XPIB 3ZHOA 3ZKAA 4YS6A 3M70A 1RLIA 2YMPA 3TR6A 5HX7A 1VMEA 4Q18A 3F78A 3U48A 3UMGA 1QLHA 3CH7A 1A27A 2MMCA 2BGJA 1SIOA 4UCWA 5EPEA 3UAYA 1OYVA 1Z33A 4ZGWA 5C5DA 3SVTA 2JRCA 1KR5A 1MQ8B 4JCOA 1H3FA 3W05A 2WAAA 4E4YA 2ZTVA 5AKEA 5TDHA 2ET6A 1POWA 1G16A 2FZKA 2BFDB 3UEOA 5EJ8A 3WYEA 3O75A 1F2UA 2Q3DA 1PUXA 2E85A 3HJHA 2NXJA 3OTQA 2B9VA 3DDCA 2PT6A 3VR5D 3N2GA 3UHOA 1WDLA 4YNBA 3FAZA 3GEMA 3H3FA 4R7GA 4ALMA 4B35A 3AB8A 3SHQA 5CLIA 2C00A 3ECCA 4L28A 1CS4C 1ZAKA 1G5HA 1JYEA 1SA0B 2CLSA 2PMBA 4G0MA 2QXUA 4RKQA 5JSQA 4LBWA 5G0UA 2PKXA 1NXQA 4DFDA 2W4QA 3D4PA 4RABA 1RM5A 5C34B 2YRWA 1QB8A 4XJVA 2ZYUX 4RA9B 3E8XA 4Q7KA 5BSKA 4U2BA 4FE7A 4NQRA 4B82A 1NQAO 4GOXA 4MW0A 3B9QA 3CSSA 1BIFA 4IOMA 3T7JA 9GPBA 1BU5A 3BTOA 2Z6QA 4ZHQF 4IF6A 5JH7A 1POXA 1YZTA 1Y6JA 4ALLA 3TTTA 2BTQA 2QHXA 4KGZA 4B0OA 5LMZA 2QRKA 3H97A 4JLMA 1OC2A 1GCAA 2I2FA 4BZXA 4V1CB 4Z1OA 2LCFA 3K3PA 5CX4A 3SX4A 3GZJA 4AJJA 4E1BA 4ZYUA 3UA4A 3B6MA 4WK2B 4ARIA 1MNAA 1KJYA 4R1SA 4TRNA 1L1FA 4HFMA 3GF4A 1F9EA 1SZCA 3A1DA 5E9QA 1KSFX 3ZQJA 4EYEA 1DGQA 2HRRA 5HXAA 5CX1B 5DLQC 1EFDN 4DMMA 1QP4A 4KJXA 1M6YA 1P33A 1WO8A 4C88A 2IOFK 4JY7A 2AN9A 4MW6A 3OLZA 2Q2WA 1AH2A 3CR7A 1MOSA 4P0QB 5THXA 5EWMA 2WA1A 1EDBA 5A2QA 3RSSA 2XB8A 2O3UA 3LBIA 4QVKA 4ZU1X 4W5OA 1V4VA 1BMDA 1JSLA 1KORA 1T1EA 1U4OA 3AY7A 4EO4A 3WDSA 2HU2A 2DUMA 3WLOA 3OCYA 1KYTA 2CZQA 2UUPA 2HPHA 3USES 4C0HA 1QDEA 5JADA 2CL6X 1FPQA 1MNQA 3GJ7A 4C1NA 1GPNA 3FPHA 3OEEA 5EXXA 1F51E 2F67A 4OUKX 4C4RA 2KYRA 3SMQA 1HLPA 5BQPA 4HGPA 2UZAA 3VU0A 1NGSA 5IC6A 2GKOA 1CIVA 1AGRA 3G23A 4CCYA 4EVIA 2O50A 2R4TA 3FDJA 2AJCA 1E1RA 4FHGA 4MPDA 1ZS9A 2VPWA 4HV4A 4IRMA 4Q9DA 2Y0DA 2F55A 1EAMA 4BE7B 1XVIA 2J30A 5F7JA 4CN9A 1GRQA 4G1MB 5ALNA 2YRXA 4BX0A 3E7FA 5KTMA 2XBMA 4R2KA 2O59A 5CVUA 4POAA 4QPNA 3OPMA 5DCUA 4U7JA 5ALGA 2IU6A 1G0OA 3BC1A 4EX6A 2GAFA 1C9MA 1J06A 1FFBA 3SFTA 4W5QA 4EDHA 2HLNA 4ND5A 3W6OA 2VHWA 4GMHA 2EZ9A 1E0SA 1YO6A 2CXQA 2A3NA 2CNWD 1XFDA 4RV9A 4Y6GB 1YDFA 4NZOA 4I1PA 4BXOA 2B2XA 1EFLA 2BMAA 2EFCB 4KV7A 3CLSD 3T5GA 3A6DA 1QZZA 3DLAA 5U9CA 1PFVA 2VDRB 3DL0A 3LNTA 4LYFA 3V7YA 3ILVA 2HSEA 5BR4A 5BUQA 2Q41A 3B82A 1ODIA 3AH8A 2G8NA 3V4RA 1HTBA 4W4TA 1RQRA 2G07A 4MR7B 1B41A 2H00A 2ZRDA 4WN3A 1FNMA 1MB9A 2NNLD 3EGWA 2BBWA 3GVIA 3C16C 4M1EA 3FGZA 5MN6A 1ZQ9A 3R9KA 3WL8A 2Y9MB 4B9AA 4C0SA 1N34B 5LP6F 4RELA 5DISB 1U8AA 4RF4A 3IAFA 1J21A 5DI3B 4PYRA 3S0JA 1Z9BA 1Z6TA 4TROA 1R50A 2B20A 4GGPA 4RK6A 1RC1A 3WK8A 1KR2A 1BVRA 1PT8A 2QRPA 4KFCA 1RM4A 4BNMA 4RZUA 4E33A 4OK6A 2WJ3A 3G89A 1OZAA 2O2DA 3T4UA 4BNJA 4O4HA 4CM8A 3B1WA 3EOBI 5KTYA 1HL7A 4JKYA 1ZOLA 3L7CA 4YONB 4W82A 1G8PA 3WBFA 3RCBA 3LOQA 5DEOA 3BJIC 4ZYYA 3OQHA 4JYAB 2YBDA 5FI3A 1FSZA 3KLOA 2QB5A 3ED1A 2QTLA 1AKRA 3FMFA 1TYZA 3KSRA 4IO1A 4QBTA 4DG9A 1GDHA 4JI7B 2DM6A 1QZTA 2AV6A 3P9NA 5JNRA 4DQUA 2VOEA 3M33A 4RPLA 4FIDA 2M98A 1TYBE 3GEGA 3HM2A 2AK3A 1XCLA 4CFZA 2P7HA 2Q6TA 1RFLA 4E21A 4B48A 3PPXA 2XUPA 1VHQA 1ABEA 3N3BC 3HXQA 4G9BA 4YJHB 1CYEA 1XDDA 1RWMA 4R51A 2JFVA 2PUJA 4QPJC 3T41A 3R7FA 3Q9NA 5KSZA 1BDIA 1F4VA 1XP8A 2IUSA 3NJ8A 2WKRA 3T7RA 2JJ1D 2F3PA 2PL9A 1R6UA 4RV5A 5DP2A 1K2VN 3CLUC 3GEBA 4PLYA 1DAMA 4GI2A 1PR3A 2OAP1 4II7A 121PA 1HQKA 1KI8A 2XE8A 5ALKA 3EXEB 2OBXA 3UMMA 3KELA 2UVPB 2XOEA 2VJPA 3MM4A 3WK5A 3V8EA 1JVSA 5KX5A 5FUYA 2FN7A 4YJ3A 2Z5FA 4RU1A 1XJCA 1E8NA 5I9NA 3PX2A 2G7MC 4RHFA 4KKXB 3R44A 2IQ5A 2ZT6A 4Z7QB 1P80A 2OP1A 3C98A 3PUXA 2NP6A 3NHRA 2WQ7A 3WYAA 4A3SA 2ZUSA 3ROGA 4EVSA 4I99A 4M0LA 3WRWA 1EDDA 4Z2YA 4DA7A 1R6VA 1XEAA 2XD4A 4NBWA 2JCYA 3CLTC 1QX4A 2D54A 2R1ZA 1G8SA 3H5WA 3GFBA 5M3BA 4QXQA 4DCUA 4CEHA 5AHRA 5FT9A 1F0PA 4ND2A 1Y7PA 4YO8A 4NENB 4JSYA 5ALLA 5JQGA 2M6RA 3HUTA 2VDKB 4GPZA 5BSVA 1GTG1 1FDSA 4R1PA 5IT9A 3H2SA 4KO2S 4DLSA 1ICEA 3K71B 3JQFA 3U1VA 4C0WA 4FI3C 2I66A 4L8FA 4ZEXA 3ROTA 1YBHA 2JIPA 3KQNA 4CQNA 2Z3VA 4YV2A 3GLIE 5AW4A 4JLBA 5B6JA 1DKOA 4U8HA 3LC7O 2ZFUA 3ZU4A 1ONOA 1PDVA 3D43A 4XWKA 4QU5A 5EPOA 1DLIA 1IY2A 4O4JB 4O33A 3KS9A 1BFUA 4KBFA 4MAAA 4B3TB 1Q83A 3LPCA 1OD6A 1H0KA 2E2WA 3EHEA 4R6XA 3ICWA 3I34X 2UZ0A 4QUAA 2UAGA 1Q7TA 3EQ7A 4G1VA 5JU6A 1DEHA 1UBKS 4D3YA 4MRVA 4X90A 1KYXA 3WRXA 3GPLA 4HYEA 4P3NA 1XTRA 4MWGA 1CXZA 1O9BA 3L05A 2QN2A 3IR6A 3QMMA 1Z0DA 4O4IA 5AJUA 3TM5A 1CCWA 3VNRA 4EX7A 1I2AA 2A67A 2ANBA 2G5TA 4LCBA 1D7OA 1Q74A 1R7RA 4UUQA 4CMEC 3OC0A 2IHJA 2SKCA 1N32B 2MYTA 3QXHA 5HQJA 1WEHA 2BONA 3BRWA 3D0RA 3ZCPA 1HYEA 3X2EA 4HLCA 5JCOA 4DSAA 1O8BA 1QH1B 2GJSA 5JRZA 1U3CA 3HUFA 4RVUA 2BGUA 4K3UA 1X3SA 1SZPA 2OESA 2QZ9A 2DUJA 1GYQA 3F96A 3HB0A 1BEEA 4MQBA 5IEBA 1DQPA 3M4NA 3L8HA 4IIYA 5JD3A 3ZE6A 1RZVA 4OGWA 5ENVA 3BEOA 3NEPX 4BWGA 3FLMA 4ND8A 3KJGA 2X23A 1QMPA 3D3QA 1TMOA 4GBED 2W6PA 1CF2O 4Y18A 4ZTUB 3AUKA 4LZLA 4Q3EA 3GMDA 1M6NA 3LPNA 3M3DA 4YV7A 1ZH8A 5K3OA 3F1LA 4Z9XA 1R6XA 4J07A 3ND5A 4OP3A 5ICCA 1MH9A 1TVKB 3U5TA 2Z58A 1SN7A 3IB3A 1KQFA 5TLSA 4AECA 4J1SA 5FBVB 3JWEA 1XNGA 3SBXA 7REQB 1RBZA 4X8MA 4OXNA 4B7UA 1V96A 1NG1A 2QZSA 3ENVA 3GLIB 3KE8A 5CDTA 1QYRA 2GYWA 4NICA 3K5WA 2GD1O 1EB9A 5FA5A 3TVTA 4ZYWA 1ENYA 4OQDA 1JE1A 5EE3A 5A5VA 4NCAA 3LDAA 4A8JA 4DM3A 4DAOA 5ITZA 5C18A 3IQHX 2BJHA 5I7UA 4DW8A 1J5PA 4TSFA 3PC8C 4M1TA 5JROA 2P9YA 4NBSA 2GCOA 1T5BA 2RFLA 5EJFA 4EECA 3EIQA 4RBNA 4ND6A 1RLOA 5DGTA 1EA5A 2QG4A 3ST7A 2HXGA 1LI7A 4XWOA 2H17A 1M9NA 4WVLA 1P1IA 5IKXA 5B4VA 3JQ8B 2LIPA 1MF7A 1UPUA 5FXMA 2F48A 1Z4KA 1RACA 1V3TA 4HDRB 5EMHA 1RC8A 1IN7A 3FCSB 2FP3A 2IJGX 1YU9A 4PWYA 3O1IC 5A7HA 4OQMA 4CDGA 4OKSA 2BFWA 4F4UA 2JKZA 4EYKA 5CBPB 5KOIA 3FUXA 4QFDA 4WE3A 4RADA 4NZNA 1BDHA 1XRRA 4L15A 5A0FA 3V42A 4RQBA 3I0MA 1YB2A 5AKYA 1YKGA 1S2LA 2EKLA 2XZDA 3AY3A 1AG9A 2YWBA 4ID9A 4NK4A 4OAOA 4PZUA 3RHSA 3RT1A 4D9EA 4DRYA 1I4OA 1GFZA 1O77A 3DVSX 3STTA 2HT1A 3TLEA 2X86A 3IE0A 3M6AA 2BLLA 2O9JA 3L79A 5EFOA 3QLUA 4B0PA 5JBNA 2K5UA 3PEFA 3PR1A 3OTOB 4HXEB 2QRMA 4OGKA 1N5IA 3H8JA 3KPVA 5A5DA 4DQXA 3K7EA 1R6DA 2HK7A 4MVJE 2BUCA 1HYQA 2FOXA 2VCHA 4A2WA 1JHPA 2XT6A 5TIIA 3MS2A 4HVLA 2ZWMA 3CNEA 4B6GA 5KYNA 1CULC 4WERA 4YXFA 2HU5A 3OECA 3SU8A 4PPGA 4B6PA 2B37A 4Q3DA 2G4VA 2GBIA 4JGBA 2VAVA 4H4EA 2WUGA 5E7IA 1H0HA 4RJKA 2XX3A 1QIDA 4GC5A 4PPNA 3TXXA 1LV7A 1R9MA 3BB4A 1JQ3A 1FRFS 4J1TA 4S1NA 2P4HX 2JD2A 3B5IA 2AF3C 1OILA 1E7QA 2WJ6A 4UU0A 4H6XA 3TIGA 1AY0A 3QXJA 5TGDA 3RRMA 3VO9A 3X1DA 1YUMA 2CDCA 2R4UA 4GQIA 3ZDFA 4D57A 4GH5A 2H9AA 4AS2A 5FO0A 3DP9A 1JYFA 5ALVA 1L4MA 3VTZA 4F1WA 1DIHA 1JDBB 3N0RA 3HXOA 3OKCA 4MUJA 3UAXA 1GQQA 5AHXA 3T9FA 4QSHA 2C7OA 1VZ2A 5JAUA 4YLEA 2ZJ2A 1C9NA 3B36A 4IUYA 3B9BA 4EMUA 1GPUA 2KSQA 2ISQA 3DP7A 3TQRA 2W0MA 4HDSB 3DBLB 4FW9A 4C9BA 3K9HA 4YWHA 3OJXA 5LXTA 1Y8ZA 2NN3C 2NO5A 4RQAA 4QBFA 4X1IB 5DTRA 2VTBA 3FR7A 1V7CA 3TZCA 5AI0A 1D1SA 2O2HA 3LVFO 1N2HA 3LQ4A 1A8HA 5CT9A 3CLRC 5A4AA 2BFMA 3FB4A 3JATA 4MQUA 2OHHA 1RLMA 2ZIAA 4KGVA 3W7AA 4ALKA 2O3JA 3MT8A 3R7LA 2CNLA 2X5KO 3ZGXA 4BHTA 1NBWB 2W2MA 2B1IA 2F9MA 1LQTA 2H4JA 3NHFA 2V0GA 4ZALA 4GKAA 2G71A 2DEUA 3HL4A 3COZA 2X5XA 4X92A 4DR6B 5LYYA 3PTZA 4TUYA 4DKJA 3RC3A 4NECA 3O26A 3P0EA 4IIUA 4JI5B 1CY1A 1E1LA 2HB6A 3G2KA 5SY9A 2D6FA 4RFVA 5BVHA 2VJBA 1DCTA 1I4LD 1X8XA 2FPWA 3HCNA 1V41E 5BOSB 1OU4A 2FA9A 3L7AA 5FWAA 1NMYA 2YWGA 3ZR4B 1EUCA 2FG6C 3H9QA 2V1UA 4NOMA 1THMA 3VDNB 4JODA 2YFHA 4UASA 1JW9B 4XEHA 4DQDA 1OLUB 1NN5A 3GAMA 4G1UC 3O95A 2EBWA 4I9HA 4IKOA 4MK4A 1KQPA 4XB6B 5EHQA 3RGGA 4NMLA 1A9XA 1DG3A 3QVSA 5CVJA 3KIPA 1Q12A 3KHTA 1IULA 4KWIA 1QFJA 1YCGA 2Z9BA 2QOEA 2WWVD 3I2IA 4AY6A 3OQ6A 3QBDA 2YY7A 2HGZA 4TXLA 2FCRA 1UWKA 3IIJA 2ON6A 4ERNA 3QFHA 1RHMA 3L5OA 2GN0A 2JL1A 4OQQA 3F9IA 2VZ8A 1N1MA 1YDMA