1UDAA

Structure of udp-galactose-4-epimerase complexed with udp-4-deoxy-4-fluoro-alpha-d-galactose
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
338
structure length
338
Chain Sequence
b'MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSSATVYGDNPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-GALACTOSE-4-EPIMERASE
publication title Structural analysis of UDP-sugar binding to UDP-galactose 4-epimerase from Escherichia coli.
pubmed doi rcsb
molecule tags Isomerase
total genus 132
structure length 338
sequence length 338
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 1997-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1udaA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1udaA01
1QLHA 4E5NA 1EBFA 4IINA 4IY1A 5IXYA 4TZKA 4UVGA 3DB2A 4ZN6A 1K5HA 4K28A 4HY3A 4EJMA 1ZIDA 2O7QA 4YCAA 3AUSA 3OA0A 2R00A 3KYCB 1YB5A 2NQTA 1HEUA 2PK3A 4PVDA 5JSFA 4XB1A 4YJFB 1ADBA 4U5QA 3RUEA 1LRJA 1XU9A 4W82A 3H9EO 3UF0A 3S2GA 1J6UA 1JQBA 4BNUA 3QVSA 2DC1A 4J7XA 2YDYA 4P4NA 1ZEMA 2P5YA 1U5AA 3R6DA 1M66A 1A72A 3TZCA 1GU7A 4XDYA 1HKUA 4HFJA 2W4QA 4ALJA 3PQFA 3RUCA 4YQZA 1H94A 1Y7TA 2VN8A 4IMPA 4PFJA 4A26A 3VPXA 1T1SA 4JN6B 3H3FA 1N8KA 4PG6A 3IAHA 3FBTA 4BUCA 1I32A 4K9DA 1R37A 2GNAA 1OC4A 1V8BA 3TOZA 6LDHA 4PRKA 3ZWOA 7ADHA 3V1YA 5IZCA 5EIOA 2A35A 2OL4A 2D2IA 4K1LA 4XGIA 1GYRA 1YVEI 2FR0A 4CLEA 3D3EA 4UVDA 3S2FA 2BELA 3F3SA 3IS3A 3W4KA 5HRUA 4RORA 4CJXA 5F1OA 1FJHA 1E7WA 1NHWA 4MVJH 3Q2KA 4JJIA 4NNJA 4QECA 3QVWA 4Z9FA 1YQXA 5G0SA 4BKUA 4MJLA 2IEBA 3JQGA 3MCVA 1MG5A 3ENNA 4R1UA 1MFPA 5JC8A 2DTEA 3OFSA 1JVBA 4G2NA 1Z82A 4Q3BA 1LSJA 5J23A 4CLHA 4FGWA 2J5RA 2W8ZA 5EERA 2GDZA 2BI7A 3ETEA 3WQRA 1Y81A 1DXYA 3KSUA 4AL4A 1LXCA 4BMVA 2AE1A 3H5AA 3FNGA 1YJQA 1EVYA 5ICSA 1DIAA 3FWNA 4IMRA 4GKBA 4WLUA 1BMDA 3FTNA 4C7KA 2VHXA 2B37A 3B6ZA 3DTYA 1UZNA 1YJ8A 3KYDA 1BTOA 3NT4A 1Y1PA 3PQDA 3ZHXA 4FDAA 4KQXA 3HDQA 4P4LA 2HMSA 4YJHA 3RJ5A 3SXPA 3JTMA 4QO7A 5A9TA 1D1SA 1X15A 5TJHA 1J0XO 3GG9A 5CEFA 2ZKLA 4GX2A 3DQPA 3JQFA 5JCJA 3H2SA 3ZDFA 5JMPA 2J5QA 4KWIA 5JY6A 1H6AA 1VL6A 2IXAA 4WCFB 3DAPA 5IDXA 2CUKA 4OIMA 4CQLA 4NFHA 4ZGWA 3JQ6A 5T5QA 3NEPX 2GASA 2X9NA 1XCBA 2JJYA 1U7HA 3MEQA 1GUZA 1SB8A 3ITKA 3NJ8A 1BDBA 4D44A 1IOLA 5MDHA 1XLTA 3OECA 5DULA 3A28A 3GUYA 1N9GB 1C0KA 1MP0A 3PYLA 4DXHA 1ZW1A 4RDIA 4LGVA 3I9OA 3OJ0A 1K6JA 3ABIA 3JQ7A 2VHZA 3HQ4O 1FDVA 4PLHA 1ZSNA 3JQDA 4CV3A 2NM0A 4J90A 3OIGA 4CQMD 2C5EA 2HKIA 4KUEA 1PU2A 1W6UA 2O3JA 5EQFA 4BO2A 5I7FA 4XDZA 2FPPA 2WD7B 4IDFA 2GN4A 1ZKMA 2WYWA 3PJFA 3Q0EA 4MO2A 1KVTA 4LSWA 1ZCJA 3PYXA 2H9IA 2VZ0A 1NFFA 3I9JA 3ZU3A 3BTOA 3UH1A 4RVDA 3UCFA 2C7VA 1AXEA 3WLFA 1P44A 4G65A 1K2WA 4CUJA 4EJ6A 3WXBA 4M55A 2DUWA 1EVJA 4CLOA 1U7TA 4DBVO 5I9NA 4NG5A 1X7GA 1O8CA 2Z1NA 4N5LA 4ZQEA 3LSYA 5I8ZA 4S3MA 2D0IA 3D5TA 4YAIA 4CMEA 3LT0A 4D45A 3C7DB 4TKMA 2A92A 4B7CA 2Y1FA 2Y1CA 5L7YA 1CIVA 2B69A 3ZWBA 3PWZA 1EUDA 3HFSA 3IC5A 5EL0A 1MLDA 3GNTA 1PR3A 1P9LA 3PHIA 4TRRA 4UEOA 4BGIA 1BVUA 2X0IA 5A3VA 3AUTA 3EHEA 3ANLA 3F5SA 2OP0A 2YUTA 2NVUB 2Q46A 1TB4A 4TRJA 1ADGA 1PL8A 3A06A 1DOHA 3RBZA 2C2YA 3W8DA 2PWZA 4OXYA 3JYOA 1H9BA 4WCDA 3UXYA 1Q1NA 1LDYA 1UDBA 2ZYDA 1EFLA 2WDZA 3ETDA 4IDCA 4E5KA 3WS7A 4NFYA 1B3BA 3DAFA 5TJ9A 3GZNB 5JDIC 2VOJA 2OHXA 2OP1A 1PZHA 4E30A 4EBFA 4L9RA 1UXKA 2BH9A 3EMKA 5H83A 2YYYA 4IXWA 2PZLA 4XGKA 3F4BA 4B3HA 1C0LA 3RC9A 3GT0A 1AGNA 1ISJA 2I9PA 1GQ2A 3I52A 5B37A 3WGYA 2NLOA 3G1UA 1QORA 1U2DA 3I5MA 4IUYA 4MIYA 2FR8A 5KJFA 1P0CA 2GD1O 1X14A 4NBWA 5MGBA 4C4OA 2JAHA 5TC4A 5JE8A 3S55A 1Z7BA 1AXGA 3GPDG 4GSLA 4WLFA 2YQ4A 1RM5A 1LBEA 3HUDA 5EJ2A 4RJTA 5BSGA 5DBIA 4Y8VA 4U0JA 2G5CA 1A27A 2WEKA 3IJPA 4GWGA 2I76A 4KWHA 3A1NA 1PJTA 1Y8RA 5G2OA 1XKQA 3WG9A 3C8MA 1OFGA 4JJFA 1YGYA 3AM4A 2P4QA 1BW9A 3TZKA 2C29D 1SB9A 5DOZA 4KUHA 4ROSA 3M1LA 1LLQA 1PS8A 2RH8A 1ZSYA 3DWFA 1LRKA 3KEQA 1B16A 3RUIA 1C0IA 4PCVA 4QT0A 1YH3A 4JBGA 4PLWA 4E6PA 5ADHA 1ZO8A 5A9RA 1QR6A 2B0JA 4IDDA 5HS4A 1C0PA 3DBHA 4OO3A 3I4FA 3NKLA 4HFMA 1E1NA 2O23A 3DBVO 4IDBA 1SCUA 3BXXA 3KZVA 1KOLA 2VWHA 1Q7GA 1LC0A 1PEDA 1C1DB 5G0VA 4J49A 3C7AA 4U8GA 4JIGA 1Q7CA 5IG2A 2NU8A 3S8MA 3U49A 1D4FA 2VUTA 5BR7A 2FR1A 2JHFA 3GR6A 1B14A 4M86A 4BNVA 1CJCA 4EDFA 3P2OA 4RVFA 4MP3A 1VL0A 1KBZA 1HSZA 1LU9A 3I4CA 5DCWA 2OZPA 1ZFNA 2LDBA 2I3GA 5KCZA 5JCJD 1I3MA 3GFBA 3BZUA 3INTA 3ON5A 2QRKA 3GPIA 1HF3A 2D1YA 4YAEA 2HCTA 3VOSA 1OI7A 1JN0A 3ZHYA 1QRRA 5JDCC 2EKQA 1H5QA 3TSCA 4IIUA 4R68A 5TGDA 1QYVA 1XEAA 4BMNA 1OOEA 5JAQA 1ADFA 3QWFA 4R5MA 4NIMA 3DBLB 2DPGA 2AQKA 2ZCUA 2E37A 3PJDA 1U8XX 4NJMA 2CFCA 3GNQA 3TJRA 1C14A 3GVCA 4L75A 1IZ0A 1H0KA 4AJIA 3HDHA 2CMDA 2PY6A 3GG2A 3UCXA 3VPSA 1PGQA 4EITA 1YBVA 4ALLA 4PG8A 4FFRA 1JWBB 4F3YA 4W6ZA 4XQ9A 1K89A 2GZ3A 3BTUA 3C1AA 1GEGA 3JQ8A 5CDTA 3QVXA 3S2IA 4HBGA 2J3KA 3MJCA 4S1VA 5L45A 4OMUA 3BA1A 2ZYGA 1LSOA 3L6DA 1ORRA 3BHJA 1UXHA 4FFLA 3SEFA 2VWGA 1DIRA 3RU9A 3D3WA 1LLUA 1SNYA 3O4RA 2VTDA 4AICA 4GX0A 4WPGA 3ZWNA 1ULUA 2Q1WA 2GZ2A 3P19A 1D8AA 4CMGA 2H1SA 3H4VA 4YAGA 3K2EA 4A0SA 2G17A 4JP2A 3PFWO 4YRAA 1YONA 1VSVA 3GA0A 2WMDA 4CM5A 3SLGA 3CUKA 1U3VA 2P68A 4OOEA 2ZTLA 2EJVA 1E6EA 4O59O 1IPEA 1IHYA 1M67A 2P9EA 4YXFA 2QG4A 1GADO 4DLBA 2HMUA 3ANNA 1DAPA 1PGNA 4OH1A 4UUNA 2B83A 1UZMA 3PXXA 1Y8QB 4BO7A 1ULSA 1CWUA 2C2XA 1HE5A 4FFMA 4FFPA 4XRGA 4AJHA 3L9WA 5HA5A 1FK8A 3OETA 4PLCA 3U0BA 4RPKA 5CDUA 4K6FA 1HLPA 4E33A 1NR7A 4MVJE 4EYEA 2YV2A 3BHMA 4B4WA 5BSFA 2B4QA 2FP4A 3SX2A 1PS0A 4MINA 4OSPA 5C7LO 3K96A 3OBBA 4DUPA 4QQRA 3Q1LA 3CIFA 3RCBA 4CMBA 1VM6A 2P2SA 4IM7A 2TMGA 2FOIA 4J91A 5C7OO 2AW5A 3ZU2A 3I3OA 1E7RA 1CETA 5BSEA 3WX0A 3BTSA 3DHYA 2JHGA 3FSRA 4I5FA 1GUFA 1I24A 3IL2A 7MDHA 3GVPA 2HDHA 1UAYA 2VYNA 5K9ZA 1IZ9A 4DREA 4Y67A 4CM8A 5TQVA 1B0AA 3OEWA 4KP7A 1R0LA 1YDWA 3BMQA 3L6EA 2BF7A 1HDGO 2I6TA 1GV1A 4CMJA 3IP1A 2C5AA 3NGLA 2PKQO 3H9QA 2NUAA 1O95A 1UP7A 5TT1A 3RUDA 1CQIA 5G4LA 1Y5MA 4XQCA 5LDGA 4Q3AA 2W90A 2J5KA 4DIOA 3DZJA 1YWGO 1VLLA 3VZSA 2A94A 3OQ6A 3U4CA 1I3LA 5KJCA 2C82A 5A4DA 5I9MA 3D64A 3B20A 3NYWA 4R51A 1B15A 1X0XA 3DFUA 1D1TA 1E3WA 1ID1A 3GQVA 4BO8A 4BNHA 1BWSA 2IXBA 4CLDA 3EDMA 3BIOA 4R1SA 1VJ0A 5JAZA 2YV1A 3U4IA 2BGMA 4J3FA 5L7TA 2BI8A 2HMTA 3GY0A 1I30A 3RROA 2UDPA 2B5VA 4HWKA 4N5MA 3VH4A 1ISFA 4J1SA 1S6YA 1DB3A 1BXGB 1GZ6A 4Q3DA 5JCXA 3C1OA 4BGUA 3WNQA 2VWQA 3GH3A 4CMIA 3DL2A 2WYUA 5TF4A 2P5UA 2ZB7A 2X5JO 3NAQA 4MKRA 1EMDA 4R9SA 1NBOA 2AEJA 2DKNA 4DL9A 5T57A 3WOHA 1LQUA 2EXXA 5FI5A 3ITDA 3ROQA 2EIHA 2NVWA 1B26A 1R4NB 4JROA 3ZHBA 3QSGA 2EGHA 5BT9A 1DRVA 4RLHA 4A7PA 1MV8A 3IP3A 3GDGA 2VNAA 5AXBA 4BNLA 4INAA 4AJPA 2BFAA 3KM0A 1XWFA 3OIFA 4BHTA 4CR8A 2FWMX 2W2KB 1UXIA 4EEXA 1N7HA 1Q2XA 4OGWA 4WLOA 5JDIA 5A06A 1GTMA 1XU7A 3PHHA 2GO1A 4OJNA 3TRIA 3E5RA 2PA3A 3NV9A 4FJ2A 4WOKA 4CM6A 1JAYA 2YHIB 3UCEA 5A04A 4PLPA 3ZWAA 3ASUA 3G0OA 1I3NA 2O7SA 5IFLA 5KKCA 4EZBA 3K5PA 3DOCA 4XYEA 3WBFA 1JTVA 5KKAA 3G49A 2E82A 3FCOA 4BB6A 4YB8A 1YB4A 4PG5A 4UVIA 4Z0TA 1E7SA 1QV6A 2JKVA 4XQGA 2EF1A 2DM6A 4FW8A 3ICCA 3B70A 1WW8A 2QYSA 1AHIA 1E3LA 2D3TA 1HE3A 2UAGA 2HK8A 2FN7A 2VRCA 5KJEA 2BFMA 2CF5A 1JA9A 4E4YA 1PX0A 2FMUA 3JQAA 4YQYA 2G76A 1VSUA 3DZGA 1KC1A 3LT1A 1W4ZA 2VCYA 4XIJA 4F46A 3EVNA 1P1KA 5FF9A 5TLSA 1U3TA 3QRWA 4AJKA 1MXFA 3TN7A 4A73A 3I9MA 2Q2QA 1DSSG 2X5OA 2DFDA 4OM8A 5ES3A 4QTZA 1ENOA 4O63O 3H65A 3WQQA 2B5WA 4EUHA 4FFOA 5F21A 4BNJA 1X1EA 3KOUA 4II2A 4BKRA 4X54A 1W8DA 4KTVE 2GF2A 1NHGA 2HK9A 3KB6A 2BGLA 4I1IA 3H3JA 3FNHA 2DQ4A 3PYMA 4Q3CA 2NU6A 2WE8A 3MJ4A 4Q39A 8ADHA 4GMFA 4NBTA 4BNFA 5JFOA 1GCOA 3UFXA 5U9CA 2Q3EA 3KSDO 4R41A 4P8RA 2IDZA 4FJ1A 5KVCA 3MJEA 3MJSA 4RVUA 1H9AA 3RD5A 1FF9A 4Y98A 3WJ7A 3L9XA 2PD4A 1A9ZA 5TSDA 1ZMTA 1PJCA 2PR2A 1EDOA 3IUSA 2V6FA 1HDXA 3GAFA 1KVRA 3L77A 3E9NA 5GY7A 4W9NC 1P33A 2DFVA 4IQGA 3WMXA 3ZV3A 2YZ7A 1SOWA 4M8SA 5COAA 3L4SO 5JDCA 5CHEA 1JAXA 1KC3A 2C59A 4B8ZA 1X0VA 3DOJA 1I5RA 4XYGA 5L4SA 4GAEA 1EFKA 1KERA 2X0RA 3DMYA 3Q9NA 3EGOA 3FTPA 1KVUA 2PD6A 4EGFA 4FIZA 1ZUD1 1A5ZA 4DLAA 2LDXA 3IJRA 1LLCA 1LEHA 2RIRA 4CQMB 2HMWA 4K26A 4U6SA 2ZK7A 3DBRA 3RC7A 5JC1A 3IKTA 1NPYA 2CSUA 1HXHA 4BO1A 5A9SA 4CPDA 5A5EA 1A71A 1BHSA 1SZJG 2D4AA 1QYWA 4Z0PA 3LLVA 3O8QB 2AG5A 3PZBA 3Q9UA 4LK3A 1C1XA 2JFHA 3ZV4A 4BNYA 4YDRA 3FRJA 1KVQA 4XWYA 4I5GA 2HRZA 1WXDA 1GYQA 4JLWA 1KEPA 1DDOA 3EYWA 5ENDA 4D3FA 4GX5A 4FOSA 4XR4A 2GUGA 2VHWA 1WMAA 5L9AA 1KEVA 4UVHA 1GZ3A 3E82A 1WAMA 5DP1A 2W2LD 1ONPA 1ZZEA 2H63A 1BSVA 3E03A 3EVTA 1GQQA 2PZJA 1RYEA 3KTDA 1HTBA 1N2SA 3GC6A 4B7UA 1R0SA 4UUOA 2XF8A 5EMHA 3D7LA 1PL7A 3DMTC 3VDRA 3U62A 4CUZA 2V7PA 2X0JA 3QLJA 1L1FA 4DC1A 4D46A 3RBVA 4BNXA 5A05A 2EW8A 4R01A 5BNFA 5K6AC 3ZV5A 2NU7A 4B7XA 3WGTA 5JW6A 4YACA 1DFHA 2GPTA 5FFFA 4JX8A 1Z45A 1QV7A 3QVOA 4LRSB 1YL6A 1YO6A 5THQA 3JYLA 4XEHA 3GVHA 4D3DA 3PFFA 4AJ4A 2JAPA 5GMOA 1EVIA 1SMKA 2EWMA 3U9LA 3O26A 3F6YA 1E5QA 4NHEA 3PHGA 1GPDG 4NI5A 5DBGA 5F3RA 3HADA 3G17A 3JQEA 2I5PO 1ISMA 1HRDA 3I83A 4ND5A 5I7VA 1DC4A 3NGXA 1P1IA 3QJ5A 1P1FA 1IUKA 2XAAA 1A9YA 4RZHA 1ZK1A 1YOVA 2GZ1A 2OORA 4W99A 3GGGA 3NTOA 4H7PA 3RVDA 2AQ8A 4DYDA 5A1TA 5FEUA 1T2AA 4YRBA 4M89A 3KO8A 2RHCA 1P74A 1HWYA 3VH2A 2Q1SA 4ONEA 1F12A 4ZVVA 4ALKA 1I3KA 1U2GA 3DZFA 3INRA 2O50A 4GI2A 4XYLA 4NZ9A 2VRCD 1KVSA 3GGOA 3TQHA 2FSVA 3NT5A 4NPCA 3FD8A 1I01A 4HP8A 4R3WA 2X9VA 3WYEA 2D5CA 3JQAD 1RM4A 3JQGB 1LLDA 3C1TA 3W8EA 2FZWA 3ETGA 3G3EA 3SJ7A 3KSZO 3VTFA 1NVMB 3B1FA 3LU1A 4CM4B 4JBHA 1ZSVA 5HM8A 4GBJA 3AM5A 4JJGA 4MVJG 4RVSA 3FR8A 1ZJZA 3DAGA 4MPDA 5B4TA 4IJKA 1E7MA 1M76A 3WMWA 4DQXA 2B4TO 4CUKA 4R1NA 5B4VA 4L4XA 2BKAA 1NP3A 4IDGA 4NU6A 3N58A 1O5IA 1RJWA 3KYDB 1U4OA 1B8UA 1HSOA 3D1LA 3N74A 5ITVA 1VE9A 4YJHB 4HKTA 3QWHA 3PLNA 1NWHA 3OA2A 4DTIA 1ZK3A 1ONNA 1P77A 1WNTA 4FSHA 2ZTVA 4TSKA 2QX7A 4BV9A 1TEHA 2YW9A 3VAZA 1VJ1A 2P9GA 4R4JA 1NFQA 3D0OA 4WLVA 3WLEA 4BKOA 1R4MA 5EPOA 3T7CA 2X8LA 5CFZA 3PP8A 4CQLB 1E1LA 2Y05A 4BNKA 1K0UA 3FF4A 3FPLA 1SPXA 3GRPA 4I8XA 3RC1A 2VT3A 3DZBA 3ENKA 4MIOA 1OAAA 3DXFA 2NSDA 2I66A 2VQ3A 2Y0EA 2EP7A 6ADHA 4F6CA 1ISIA 4AG3A 4BKQA 4FC7A 2VNSA 3RIHA 1YB1A 2RHRA 4YWJA 1LDMA 3IMFA 1T4DA 1ZXBA 2XXJA 2VUSA 4YPOA 2G82A 2GN8A 3GOHA 4CLXA 1NAIA 3MJTA 4WOJA 1DC5A 1M75A 1ARZA 1HYEA 4GPD1 4TZTA 4EUFA 1X13A 4CV2A 2PKQP 4LN1A 3CH6A 3CINA 3WQSB 3ZNOA 3RC2A 2QZ9A 5F5NA 1AUPA 5CEJA 5L51A 4J1NA 1E6WA 3MOIA 1LDEA 4OYRA 1OBFO 3TL2A 3I23A 3R0IA 2X1HA 3BAZA 2JFGA 4KZPA 2YFHA 3B1KA 2CVQA 4YJGA 4DBZA 4BNTA 4TRMA 4RGBA 4Z9YA 1DIHA 1Y5RA 3F9IA 4ITUA 1DLIA 5IXSA 1Z74A 3I9NA 4BO0A 4HNGA 5ILGA 4B79A 1DFIA 4D7AA 1KEWA 3QQPA 3UVEA 1PGPA 1PGOA 1A7AA 3RFTA 3VC7A 2DLDA 4Q3NA 4CLOB 1LSSA 4WLNA 5BSHA 2OMEA 3VKVA 1E6UA 2DBQA 3V2HA 4R9RA 4MVJF 1MB4A 1E5LA 1E0DA 1NYTA 1QXSA 3ZWPA 3OJEA 1PZGA 3UICA 4HV4A 4WEQA 1ZBQA 1XHLA 3F47A 1PS9A 3QP9A 3HHPA 3P5SA 4D42A 4MVJA 1G1AA 5ENVA 1T2DA 5K0ZA 3H5RA 3AJRA 2J3HA 2OBNA 3KUXA 5KJ1A 1YL7A 1NFRA 3CKYA 1J49A 3MWEB 4NR0A 4FS3A 1B3RA 4OKIA 1KY5A 1PQPA 1EK6A 1N7GA 1SO8A 1TT5A 3ZW8A 5KOIA 3KETA 3GMSA 5JLAA 3BMCA 4E5PA 4MOWA 4IQ8A 2DBVO 5CDGA 1P45A 1CEQA 3DFZA 3DZIA 2BFPA 4W9NA 4UREA 1HETA 4DPLA 3ZH2A 2X23A 1GY8A 3TL3A 5AXDA 2O4UX 3DDNA 5GZ6A 1B2LA 1V6AA 4GGPA 4R5HA 1IY8A 4YYZA 2CVOA 1HLDA 4CODB 1DHTA 3MJVA 1UH5A 1I0ZA 4ZU3A 4LMPA 4RPJA 5C7IO 3AY3A 3NRCA 3WYCA 1TLTA 1KY4A 2Z1MA 4I5EA 4B4OA 4PZDA 2VHYA 3JCZA 4BQRA 3VDQA 3LK7A 4J2HA 4LCEA 1XSEA 3UAGA 2IEDA 5JS6A 3OJLA 4YT5A 4QSMA 4BO4A 1W73A 3ZNNA 2QHXA 3KLMX 2JL1A 3QW2A 5ER6A 3R1IA 1KEUA 1UXGA 5IDWA 5IZ4A 2IYPA 5G4KA 5THKA 4BKPA 1QP8A 3HNPA 5L3ZA 1Y8RB 1ZVMA 4O1MA 4I5DA 1I2BA 2V6MA 5KNLA 2WSBA 5TT0A 2HSDA 4E21A 4H15A 1BVRA 2CDCA 4J9VA 4NH4A 1BW9B 1GPJA 4CLRA 1P1RA 3BYZA 3TPCA 1OZAA 4A5OA 3K31A 2HQ1A 4JNKA 2ZYAA 1E3SA 1BXZA 5COQA 4J43A 4XA8A 1YL5A 2A4KA 3HB4X 3WWZA 4PZCA 4AFNA 2CY0A 2Y1OA 2O4CA 1I8TA 4BVAA 3WFIA 4WCFC 1QYXA 4U6QA 5IDQA 3SC4A 3FNEA 3OJFA 4M1QA 3ICPA 2ZB8A 3CMCO 3DBHB 4BQPA 3FBGA 5HWSA 1LUAA 4XJSA 1F06A 3KBOA 1LJ8A 4ID9A 3DMTA 3H9JA 1PIWA 3LC2O 2HAEA 3LVFO 3EZYA 4GQAA 3INGA 1RPNA 2X0NA 3LC1O 4MKXA 4E2ZA 1G0NA 1XELA 5L4LA 4C7JA 5K6AA 1JW9B 3RFXA 3MWDB 3PTZA 2EG9A 4PG7A 3STHA 2DU8A 4B3IA 4YAKA 5A02A 3PHLA 3KV3O 1R12A 3O03A 4XZ3A 4RLSA 5IDYA 1K3TA 2RCYA 1CQJA 5ER9A 1H6BA 5A03A 4NK5A 5JO9A 3RWBA 3IDSA 2O3UA 3KXDA 2ZATA 3P7MA 3PIIA 3TZ6A 4YRDA 4XIYA 4MVJM 1LNQA 4AJOA 3PI7A 4M87A 3AI2A 2YDXA 4AJNA 5H81A 1BGVA 4OQZA 4GL4A 2DTXA 3LYLA 3WSWA 5ILOA 1P3DA 3FI9A 1YKFA 2IZ1A 4KUGA 1YE3A 4P38A 5F5LA 4E2XA 2X6TA 5ITWA 4NJMB 2DBZA 2BMAA 3E48A 5AYVA 2VHVA 1KYQA 1G0OA 1XGKA 5C37A 1F17A 2HO5A 1IB6A 5IF3A 4J0FA 4UUPA 3QY9A 1Z7EA 5CAEA 4BO6A 3JQ8B 1DRUA 2E4AA 3EZLA 3PGXA 3RKUA 2EERA 2I65A 4DLLA 4Z0HO 1GD1O 1KS9A 1NR1A 2WWRA 3WIDA 3A9WA 4O5OA 1EDZA 4KDEA 1P1JA 4J0EA 4W7HA 3D3WB 1GDHA 1J4AA 4XGNA 1D7OA 2YFQA 2VT2A 3Q2IA 1ONOA 4GX1A 4WNCA 1ML3A 4XQEA 3UN1A 3CE6A 2X4GA 3VZPA 5AXAA 4CM7A 4EEZA 2Q2VA 3EAGA 1ZH8A 3GVXA 3MTGA 2BD0A 1TA4A 4ND1A 1CYDA 2NNLD 3CZMA 4AJEA 1PGJA 4Z9XA 5KWEA 3WGGA 4DPMA 3AOEA 2AEMA 4PG4A 4DQVA 3PWKA 4TWRA 3RKRA 1I33A 1WLYA 3JD1A 3MOGA 3V8BA 1DIBA 5JBIA 4J6FA 4ZJUA 2X58A 1LTHR 2A9FA 1JLLA 4RCVA 1LI4A 1EUZA 3AU9A 5G0WA 2BGKA 1Q0LA 4BIIA 3C3XA 1HDCA 4IS3A 1N5DA 3PEFA 4HFRA 2NACA 2PFGA 3WGOA 2HU2A 5CEEA 1U3WA 3IKVA 3E8XA 2PV7A 3PQEA 4IBOA 1MX3A 1V3UA 3RQSA 2NVBA 5LC1A 3GMDA 4EUEA 2POQX 2O48X 4EI2A 5I7EA 3BMNA 3FNFA 3DR3A 4YAJA 4D41A 4MVJD 4FOOA 4IGFA 4RDHA 2PKRA 1JDJA 1K6IA 3IQDB 3BMOB 4RZIA 1DRWA 5AXCA 2C54A 2NTNA 4M54A 4A2CA 4YT4A 2R2GA 1HE4A 4J1QA 1LDGA 5G0UA 3NUGA 2Y68A 3I6QA 3RJ9A 2OBYA 4MVJP 1T25A 3ZWXA 3ZNPA 1AN9A 2BFOA 4NBVA 4I08A 3ZU5A 3HN7A 1DEHA 4TVOA 4H3VA 4E32A 4GWKA 4J4HA 1PTJA 3V2UA 2ZB4A 4FR5A 4J7UA 4KQWA 3NTQA 4BNZA 5B12A 2G0TA 2X5KO 4NQZA 3SLKA 4L74A 3DONA 3AU8A 3DZKA 4TVBA 4IZHA 4D43A 1O94A 4CM8B 1IE3A 3QE3A 4U0KA 4N7RA 4TMFA 3BMQB 3ZWMA 4DYVA 2DUUA 2O2SA 4F45A 4YR9A 1U28A 3JYNA 5AQ1A 2NTJA 1SEVA 5KVSA 4NU5A 1X7DA 4XYMA 1LX6A 3PK0A 1NPDA 5DCUA 4J1TA 4KDFA 3KYCA 1SOVA 1SAYA 1E3WB 1DFGA 3PJGA 2Q1UA 2CF6A 1LDBA 5I7SA 4YJFA 1MG0A 3FPCA 3AK4A 4I9NA 4I9HA 4AJLA 5KIAA 4MKZA 3ZW9A 5KVQA 3UW3A 1T2CA 4YT8A 3GRKA 3L0DA 3VH1A 1ZNQO 2FY8A 1DLJA 3F1KA 3C7CB 2YQ5A 3ZCXA 1EE9A 4WNIA 1UDAA 5DP2A 4BO5A 4ZA2A 3SBOA 2Y99A 4CMIB 3VH3A 4PN3A 2CDBA 2X22A 4AJ2A 4E13A 3DOOA 3LLSA 2ZQZA 1F0YA 2OO5A 1HZJA 3V1TC 4CV0A 3ROMA 1BG6A 1GUYA 4FC6A 4MP6A 4Y6SA 1PWXA 2E6UX 1N1GA 4KTTE 4YT2A 5JNLA 1TI7A 3GGPA 1GR0A 1NASA 4XJTA 3VPHA 1D3AA 4E31A 3W6UA 4L4SA 1A4IA 1EE2A 3JQ9C 5IN5A 1B7GO 3PGJA 4J7CA 2RH4A 3OIDA 3QWBA 1LSUA 1H2HA 3WR5A 1EZ4A 1HT0A 1ZXLA 1PZFA 2GN6A 3RAJA 3O9ZA 4D79A 1A7KA 1F14A 5JO0A 1DO8A 2V65A 3HG7A 1C3VA 5AOVA 2WD8A 4PLZA 3TOXA 4L0QA 3VPFA 1ADCA 3DHNA 4PLFA 3JYQA 1WZEA 4LCJA 5DF1A 5G0TA 4QO8A 1T4BA 2V6BA 3M2PA 3E9MA 4JGBA 3PHJA 1GAEO 4ZQGA 1M2WA 4FB5A 2NU9A 4OKNA 1TXGA 4TQGA 3JQAB 3GHYA 4U7WA 1R16A 4IZIA 1YQDA 4RPLA 3U4DA 4CM3A 4ALNA 2ZQYA 1I2CA 2ILTA 2AQHA 2AE2A 2G1UA 4ZQHA 3ZWVA 1PJSA 2NQ8A 1UXJA 3GVIA 1U4SA 3S1LA 3RUAA 3WIEA 4E5MA 4IJVA 4Q3EA 3VPGA 4ALIA 2VRBA 3H6KA 3QA9A 2NV6A 5C3MA 3H5NA 4GKVA 5DCYA 3OEYA 1YBAA 4NBUA 3E18A 2VYND 3CMMA 3FR7A 1XYGA 1XIVA 2R6JA 1B8PA 1ZMOA 2PGJA 4GLLA 2DTDA 2Y0DA 1SEPA 4WCFA 4WKGA 3WWYA 3ZWCA 3I6IA 3WJAA 5LDHA 1UZLA 4I9UA 4JQCA 1P0FA 1LDNA 1VKOA 4IS2A 9LDBA 2IODA 3I9KA 4J4TA 4ZRMA 1Q7BA 1MFZA 3WGZA 4GMGA 1GEEA 2B36A 3EC7A 5CG2A 1NX6A 3FN4A 3FWZA 4RPHA 1N9GA 1E1MA 1M6HA 3CSDA 3A14A 4WK6A 1E7YA 2JD2A 1BDMA 3KHUA 2VUUA 1H2BA 3AY7A 4N54A 1V3VA 4IXTA 4XKJA 3JD3A 2AXQA 4ILKA 1PJ4A 2UYYA 4B4VA 3QIVA 3R3JA 2D59A 4FFNA 4DQUA 5DZSA 3DHEA 4IDEA 4H16A 3HFGA 4ZRNA 3ZWYA 4J4BA 2I3AA 1NAHA 4CM4A 2O3RA 2Q4BA 2WD7A 2GYYA 5DDIP 1JKIA 3AWDA 1P31A 1WP4A 5TX7A 3ANMA 3ORFA 4FD3A 3WBBA 2WYVA 4TRNA 3X2FA 8LDHA 2JCYA 1T2EA 4OHUA 4TROA 2Z95A 4OL9A 1U8FO 4QUKA 3ST7A 3PLRA 4YBZA 3ROPA 3DBRB 4BS9A 1PJBA 3LDHA 1YDEA 5A9SB 4QXMA 4L73A 1A4UA 4CMAA 2BLLA 3K92A 3RASA 2O2YA 1C1XB 1DHRA 3ZHZA 1MUUA 2JCVA 4D0RA 5HTOA 2P91A 3ONFA 1DJNA 1R15A 3R3SA 5CG1A 5HS6A 3TWOA 4DC0A 3TNLA 1NQOA 4UEJA 1NXQA 3FHLA 3VVCA 1HDZA 2CD9A 3GLQA 4URFA 1HE2A 5I8WA 3L4BC 4L4RA 2W98A 1XDWA 3OH8A 4HFNA 2EKPA 4GLOA 4M49A 3NT2A 1DJQA 4K6CA 1X1TA 4O6VA 2NVUA 1L7DA 1N92A 2PD3A 3HDYA 3DEYX 4MP8A 1PQWA 1LC3A 4JCOA 2DPHA 2WTBA 4R1TA 1PWZA 3M1AA 1P1HA 2PTGA 1OMOA 1LA2A 4II3A 3E5MA 3W8FA 3HZZA 1E92A 1T2FA 2Y0CA 3AOEC 4KMSA 4OOFA 2BRUA 3EY4A 1MGOA 4N18A 3GZNA 1QYDA 4NBRA 2PNFA 2UV8A 1CRWG 5DBFA 2VYVA 1SC6A 4RPGA 5H82A 5F1PA 4LVUA 5BNTA 3NTRA 2UUPA 2Q45A 4UUMA 4TKLA 5ICMA 5U4QA 3RU7A 4L8VA 3ZGYA 1FXSA 1R6DA 2OOSA 3NJ4A 3EW7A 5FYDA 1UDCA 2Q49A 1PJ3A 5TS3A 3JD4A 1H6CA 2C20A 1ZJYA 1NVGA 4FPXA 1DC6A 5CDSA 1ENZA 3KRTA 1DAOA 4B3JA 4W7IA 3HJAA 4BNMA 2QYTA 5AVOA 4BMSA 3NDIA 5CP8A 2OUIA 3QV1A 4FJ0A 2ZTUA 4R16A 4BO3A 2UVDA 1PL6A 2O3QA 3VTZA 2DBRA 3F1LA 4PIVA 4XCVA 3D5QA 3BHIA 4WJZA 2GSDA 4P4GA 3AFNA 1VJTA 2HJRA 4LVCA 1Z6ZA 1M6WA 2Z5LA 1BRMA 4AVYA 4E3ZA 3I9LA 1YOVB 2Y66A 2QRLA 3UOGA 5FI3A 3N7UA 2EHDA 3T7EA 3UHAA 5I9LA 1V9LA 4O0LA 2QW8A 1Y6JA 1YXMA 2F00A 4ND3A 4OXKA 3T4EA 1O9BA 2P9CA 5GZ3A 4NJOA 3KLPX 3I1JA 3WGQA 2JD0A 4LMRA 1RKXA 2EV9A 2GCGA 2WM3A 4IPTA 3AOGA 1F8FA 1JVSA 1GYPA 4JXKA 4BO9A 3HWRA 4MDHA 3VZQA 4N5NA 5L53A 3IIEA 3JQ7B 4R69A 4YJDA 3UUWA 4W4TA 1E77A 1PJLA 3GHHA 5T8KC 2O3TA 3F5QA 2UUOA 2HJSA 1C1DA 2B35A 3GN1A 3K73O 1HYHA 1DIGA 3TZQA 2PGLA 1WZIA 2DAPA 1UR5A 1L7EA 4FQ8A 2V6GA 2XOXA 2ZTMA 2HLPA 4UAGA 4PLGA 2CDAA 2Y93A 1QYCA 3K8ZA 3RI3A 2VZ9A 1EVZA 2Q50A 4DGSA 5COBA 2AMFA 3D4PA 4FGSA 2PZMA 1VI2A 1NVTA 3GDFA 3NX4A 4E2YA 3GUCA 3K6JA 5EINA 1R0KA 3JQBC 3SC6A 3U4HA 3AM3A 1V3TA 3P2YA 1E1KA 3F46A 1IULA 3WGIA 5JYDA 2J3JA 3TF5A 3DBLA 1CDOA 1GQYA 3JD0A 2JFFA 3U09A 1TT7A 4Z6KA 5JAIA 1YRLA 4RVGA 4RV9A 3OP4A 3V2GA 3WB9A 3GAZA 5T64A 4FCCA 4CM9A 3O38A 2ET6A 1QLJA 1T24A 2PGDA 4YVFA 5L40A 4RF5A 1R4MB 1EQUA 1XA0A 3WGHA 1XQ6A 4DRYA 5FWNA 5A3JA 5TRTA 1ENYA 3JQ9A 4PZEA 4Y6PA 4ZQFA 5L4NA 1LQTA 2X7HA 4A10A 3PWSA 1F8GA 3WYBA 3QVTA 4JK3A 2C7GA 4E0BA 4ALMA 2IZ0A 4WE3A 4FBGA 2QZZA 5DN9A 1NM5A 3H9UA 4NFSA 4WLEA 3H9GA 1X7HA 3PZRA 2ZJ0A 3K30A 3ROKA 2HUNA 3U3XA 3D4OA 2ZB3A 1PQUA 4J9UE 3COSA 1Z75A 3D4NA 4JBIA 3ZNQA 4B4UA 3DC2A 3LF2A 2F1KA 4IJUA 1N1EA 1U3UA 2IYOA 4CL8A 5IJZA 1RM0A 2WJPA 1I2ZA 2Q99A 5BQFA 1O6ZA 1EQ2A 1YBMA 2FRDA 4UULA 3KYBA 2AHRA 2J3IA 2EGGA 4YJGB 1CF2O 1RWBA 2DVMA 4WGGA 4XD2A 1I10A 1NQAO 4CMKA 1Y8QA 4CMHA 1YS4A 1H93A 3EK2A 3C24A 3RBXA 3HB5X 4WECA 2RBEA 5T6BA 3L6OO 3G1TA 5GZ1A 2R00C 1E3JA 1WVGA 4YEDA 1UJMA 5CDYA 3MTJA 2PZKA 1UP6A 2TMDA 1V35A 4OAQA 2AA3A 4RL6A 3TFOA 2P4HX 3ULKA 1E3EA 2I67A 2FPIA 3DTTA 1HL3A 4GH5A 4ND2A 1NQTA 2NADA 3AI3A 5DT9A 2Y1EA 3OICA 4XRRA 1RM3A 4AJ1A 3PDUA 4DWVA 1R66A 2E49A 1FDSA 3IOYA 1ENPA 3G79A 1HZZA 1Y9EA 5CPBA 4RF2A 2D5AA 2SCUA 4XB2A 3CPSA 4A03A 3V1UA 3WFJA 2FSSA 2GLXA 4XYBA 4A27A 1WDMA 2ZJ1A 1XR3A 3PPIA 3IUPA 4JP3A 2VYVD 2NTVA 4YTEA 1QG6A 1Z73A 4R54A 2Q4EA 1T1RA 4Z3KA 3E9QA 1TT5B 1T26A 4RQUA 4HUJA 1GL3A 4NDNE 2NWQA 4PRLA 2HRBA 3TFQA 2H6EA 1KETA 2YY7A 3BMCB 3W4JA 3WICA 5IZCC 1NQ5A 1EUCA 1QMGA 3Q6IA 2AEFA 3RSHA 1PR9A 4IJWA 2AG8A 1TVEA 3LT2A 4FN4A 4BB5A 3GZ4A 1RYDA 5JXWA 2JCXA 3DO5A 2GN9A 1ISHA 4J2OA 1VRWA 3WDSA 5IAAA 2GERA 3QWAA 9LDTA 2C07A 3PDJA 1Y9AA 3Q11A 4B8WA 3ONDA 3W1VA 3H2ZA 3HE3A 3GEGA 1V0JA 2CZCA 1BXKA 5KTKA 2I99A 1GV0A 4Z3DA 1OC2A 2CVZA 4CV1A 2WE7A 2GR9A 4IQ0A 4QFDA 1MXHA 3NDJA 3VZRA 4CR6A 4DMLA 2RAFA 2Q2WA 1YQGA 2FZEA 4RF3A 5F1KA 5G4KB 1QSGA 3PVZA 4LRTB 1EBUA 4G81A 1GZ4A 3LT4A 3ONEA 3PRJA 2PLAA 4IIVA 2D8AA 4RVHA 4UVEA 3JQCA 3S2EA 1BXGA 1NTOA 1LRLA 5BNIA 2XPCA 1CERA 2J8ZA 2QIOA 4CLRB 3BMOA 3KEOA 3L4BA 3M6IA 1VC2A 2C0CA 3JYPA 3X2EA 3JQFC 1R4NA 1MC4A 2IRWA 2YHUA 3ASVA 3NDRA 4E12A 3AUUA 3QHAA 5A5FA 4CR7A 4BNNA 3UGKA 4LSMA 2X9GA 2EW2A 1FDTA 1PJQA 2W2KA 3CTMA 4L76A 2ZCVA 3WTCA 4RF4A 2BHLA 4BNWA 2OXIA 5L7WA 3LQFA 1FMCA 4IGEA 4HXYA 3KVOA 4UEKA 1WDKA 1WPQA 3RFVA 2AQIA 1IPFA 1K6XA 2OFPA 3ADPA 3ZZNA 2YHIA 4BNGA 4D0SA 1UUFA 5JMWA 2IZZA 2H5LA 3JSAA 2Y1GA 3OQBA 4KOAA 4DIBA 3E6AA 3OM9A 3OSUA 3JV7A 4PLYA 1MC5A 1UAGA 2VOEA 3LF1A 1QKIA 4NK4A 1DPGA 1U9JA 4NMHA 3PJEA 1WDLA 4DIFA 3AY6A 5JYEA 3GN2A 4LISA 5L95A 2DT5A 5CPFA 2XXBA 3WTBA 4CM9D 5C5IA 4RQTA 3GF4A 3BTVA 5IN4A 1IYZA 4HX5A 2W2LA 4GSKA 3AFMA 4GGOA 1EK5A 3W4IA 2PH5A 2GGSA 4Q9NA 3B1JA 3HN2A 3H7AA 5DOVA 4P22A 1O89A 3VKUA 4PLTA 3UKOA 3CEAA 4EJ0A 1DBVO 3W6ZA 3T4XA 3LC7O 1VPDA 1JWAB 1ZK2A 1B8VA 4BGVA 4QEDA 5EESA 5KVVA 4AJJA 3GDOA 4G5HA 4BV8A 4GVLA 3RUFA 1AHHA 3K2BA 2EKLA 4PVCA 3ZI0A 3ZU4A 3AW9A 4OSOA 2EP5A 1E3IA 4QFCA 2HMVA 2J6IA 3GEDA 1I36A 4HADA 1NNUA 2Y67A 1IHXA 4CMEC 4QX6A 4XR9A 5TNXA 5KJ6A 3TDKA 3GNSA 2O3SA 3CZRA 2CNBA 2VZ8A 3AUAA 2FHSA 3JD2A 1JKFA 5T8KA 4D3SA 3A4VA 2YJZA 1NWCA 1WWKA 3SVTA 1FDWA 1WMBA 4ND4A 3WSVA 3SJUA 4ZHSA 3ZN2A 3OF2A 1JU9A 5JY1A 3HDJA 5DNAA 3U5TA 3VVBA 4GVXA 1GCUA 5HBRA 1VL8A 1G6KA 1NPTO 1U5CA 4RO0A 4BOYA 4CL3A 1E7QA 2VWPA 1ZK0A 3TZHA 5LCXA 1PJ2A 2IE0A 2B4RO 1SBYA 1VKNA 5JAMA 1H6DA 1PZEA 3GFGA 4LW8A 1HYGA 2X86A 4OXNA 1XG5A 4DVJA 3PIDA 3M2TA 4OQYA 4ESOA 3GEMA 3JQBA 1KIFA 3OJOA 1W0CA 2QRJA 1FDUA 4YA6A 1AE1A 3OQ1A 4Y9DA 4ZQBA 5B1YA 3H8VA 3BMNB 3OHSX 4ZD6A 2GRAA 4R3NA 4MVJI 2Y1DA 1Q0QA 3AI1A 3EUWA 2QQ5A 4ZICA 4BGEA 1DC3A 3DZHA 4DA9A 4DPKA 4E5YA 4WEOA 3ZV6A 1HDOA 4CMCA 1ZEJA 2JD1A 2E48A 2EJWA 4E2WA 5U1PA 4J16A 3VHRA 4CQMA 2VTEA 4WUVA 4MIEA 2ZIZA 3WNVA 1EEHA 4IDAA 3RUHA 3GK3A 1UP4A 1ZK4A 3HSKA 3O8QA 3V5NA 4F6LA 4XX0A 1XQ1A 2YV3A 3CXRA 3E1KA 5EN4A 4CM1A 5TIIA 2FPGA 2PH3A 4DMMA 5JPIA 3QWIA 3ADOA 1HDYA 1JKJA 2EEZA 4HNHA 3K9QO 4EW6A 1S7CA 3L07A 3C85A 3Q3CA 1J5PA 5T67A 2HK7A 4BNIA 4WASA 5EQDA 3F4LA 4PLVA 1IL0A 2Q1TA 2OGUA 1O0SA 1PSDA 1Q0HA 5B4UA 1HDRA 4PGFA 4Y6RA 4BL5A 1GFSA 3ZWWA 3OMLA 3MZ0A 1MA0A 1U1IA 3LZ6A 1ISGA
chains in the Genus database with same CATH superfamily
1M0WA 5ITSA 2R8YA 4A6XA 4PPQA 5IXYA 1NN5A 4U02A 4AMBA 1U7WA 4MROA 1DX6A 2O7QA 1U9ZA 1SUFA 3WK5A 2CHQA 2R48A 1YB5A 3B60A 1NKSA 4C4XA 1U8AA 1UBTS 5J2TB 3EARA 2I4LA 1KJNA 1TMYA 4BN5A 1LRJA 3C5WP 3SQNA 5LNK1 4BP3A 1H8HD 4W82A 2JLVA 1FP4A 2QBYA 1CUEA 4IXDA 3F73A 4EHLA 5CFRA 1CC1S 1Z06A 4HRAA 2NZ2A 3G89A 4TXMA 4WFJA 2WKSA 1ABBA 3OWXA 4J7XA 2ZUEA 4EHJA 2A9RA 2YDYA 3VR4A 4UNRA 1SKQA 7YASA 4O3MA 4LOHA 1HYQA 3WNZA 4NMWA 5C4IA 2W4QA 4QNRA 2V7VA 3BRQA 3I0NA 1H94A 1QGUB 3SF0A 2DLNA 1Y7TA 4L6CA 4N65A 3FOBA 1ZH4A 1T1SA 4G85A 5BWOA 1YIOA 1E1DA 4PG6A 3ASYA 1ZITA 3IAHA 4EBBA 3FBTA 1RAEA 4FKMA 4FYMA 4OLFA 2GNAA 1V8BA 4JYPA 4FW9A 6LDHA 1G1MA 4AT1A 5GVRA 4GPZA 3V1YA 2ZROA 4KQ1A 4BE9A 3TIIA 2OL4A 5AW9A 3FTDA 4P2GA 5CGQB 2D2IA 3RVLA 1AQ6A 4K1LA 1PCXA 1YVEI 2FR0A 5F76A 1Z6XA 4UVDA 4DCJA 1FDRA 3F3SA 3IS3A 3W4KA 4G1VA 1CUUA 4X9XA 4RORA 2XUDA 3LUJA 2VDWB 1XP5A 3E23A 2F62A 5F1OA 3FOFC 1Q0ZA 1W49A 2YVQA 1X3LA 3QU2A 4O2AF 5ARDA 1WKBA 4I4CA 4C6TA 1J25A 1F7VA 4D4MA 2FSUA 2H9YA 2OZEA 2WYIA 2XUGA 1W0JD 1FRFS 3QVWA 5G0SA 3W7AA 4BKUA 4EK9A 5JC8A 4YGXB 3WBJA 1B76A 4M1WA 4CVNA 2DTEA 3FVQA 1KSFX 2HN9A 5DWVA 2Z9CA 5J23A 1ZVJA 3W2IA 5HIIA 5EERA 3R7WA 2HHCA 3P9PA 2BI7A 2I62A 4NU8X 4RZUA 4JUFA 1EFUA 3AC0A 4X5OA 3WQRA 1J33A 1SD5A 1T1IA 1Y81A 2HU7A 3W7VA 1DXYA 1O08A 2OUKA 3HLYA 3KSUA 1QJCA 4TLLB 3W3AD 4AL4A 1LXCA 2R1TA 1XEWX 5KOJB 2R0QC 5BR1A 1T9HA 2PBFA 1EVYA 4Y1RA 3FWNA 2Z2KA 3OTIA 4F4DA 3DMNA 1JLRA 2DHDA 2HV9A 4TTIA 2B37A 2R25B 3B6ZA 4ZOAA 1Z35A 3FGZA 4OJKA 2IDKA 3DPSA 3QX7A 2JLZA 1NU8A 4RQAA 4C29A 5CVCA 3RJ5A 2X19A 4KAAA 5DBEX 4GBED 1ADJA 4ML3A 1SCIA 4E3WA 5A9TA 4PNEA 1G3MA 1X15A 2WF7A 3ZKAA 3BD8A 4B2PA 1EJ0A 4S1OA 1QHHB 1G5IA 1A2OA 2KS6A 3JQFA 1THTA 3Q40A 5E2BA 1WLSA 3H2SA 3SHTA 4KVZA 3I30X 3VVLA 3AP1A 2A5YB 3F8SA 1ZISA 4BUZA 1AO3A 1PLJA 1CDEA 1VIYA 3D4LA 5DBHX 4DIUA 5A3SA 5IDXA 2G9NA 4RTMA 4JI4B 4CQLA 1N0VC 3WO1A 2QX4A 2EKBA 4BBJA 4JL8A 4PZUA 2J6HA 4B82A 1CZNA 4ENSA 2X9NA 7MHTA 4N7BA 4DR7B 2QI9C 2XMRA 3MEQA 3HWX1 3SZOA 3BQNB 1SB8A 2ZRJA 3ESCA 3B5IA 1Y80A 2B8EA 1BKDR 1TM2A 1Z4NA 1BDBA 4O4JF 1KWGA 2P69A 1NVFA 2ZE7A 3LUFA 4HLQB 1G21A 1NX9A 4UCFA 1XAIA 5BSVA 5LQJA 2OV6A 4KMMA 4Y6QA 1Q15A 2OG1A 3PYLA 2Z3ZA 1IQ0A 1K7FB 1R8YA 1XVIA 1ZW1A 5DO9A 4MO9A 4DXHA 3GLSA 1K6JA 1UPTA 2GFQA 2R6CA 3KKOA 1CUJA 4MR9B 1JA1A 4D02A 3ZDDA 2YMMA 4JJ6A 5FNVB 5BN4A 1VHQA 1FDVA 3RSLA 3WZMA 3JQDA 3JXEA 1NXTA 3O9VA 3D8BA 2WIKA 4NJEA 4KITB 2HKIA 4O3FA 2O3JA 4TUYB 1XTKA 2FF7A 5EQFA 5HZMA 1FQWA 4BO2A 3JX9A 5I7FA 3B5JA 5KYYB 5J63A 2NYVA 5AVYA 4IH9A 1AKWA 4R2MA 4BAGA 2H06A 3LA6A 3MS7A 4DB2A 1ZKMA 2WYWA 3GMTA 1RQRA 1V47A 3CV3A 3Q0EA 3WXMA 4AXXA 2ZZNA 3KL4A 1NFFA 2OV3A 3GT3A 2MYTA 1EK2A 1J0DA 3FFWA 2BGNA 2O0JA 3KDAA 1WCV1 5ALWA 1P44A 3D6FA 4DM7A 3BRWD 2Y0BA 1NXPA 5FAKA 1FFBA 2ZZMA 2UUCB 1JFVA 1IJFA 2GBCA 4FXOA 3OTHA 1A9QA 4R8VA 5AK4A 4ZEXA 3WXBA 3WIUA 1MAAA 5BSTA 4DBVO 2OGSA 2GN1A 5I9NA 2G28A 3TTSA 2CL6X 2NSJA 1ZRMA 4FYYA 1TFUA 5GWXA 4L8YA 4S3MA 1ZUNA 1AQIA 1TZ2A 4LWZA 4EMUA 1KQPA 1P17A 2ZIXA 4M0MA 3LT0A 2CXPA 4D45A 3FOWA 3SVLA 3OFNA 2K2QB 3N2GA 3EZXA 3L1HA 2XZDA 2MYPA 3KVRA 4TKMA 1GIAA 1GT91 4BNDB 3N07A 2YS6A 3DT6A 1BD3A 1XTQA 4MV4A 1YB7A 2CD7A 3D2CA 2VDVE 4UU1A 4TRRA 4D74A 4B7ZA 1F1BA 2BYTA 4M0UA 4RESA 2ZR0A 3LWDA 4A92A 3RJTA 2M98A 1LJLA 2GQ0A 3ANLA 4ZVLA 3L0IB 5JJIA 1GL9B 2YXBA 4LRYA 1KJZA 4D8VA 4NYJQ 2AF4C 1EFDN 1Q74A 3QE2A 4DV1B 1YMUA 1DOHA 1NVWQ 4X3PA 5ALHA 4AUEA 3W8DA 4ZEOA 3EXHA 1JHQA 2PWYA 4D9CA 4X20A 3QVMA 2ZYDA 1OAOC 3K71B 1G4HA 2VYQA 3DAFA 3UK0A 4TT8A 8OHMA 3DTNA 2VATA 2O6HA 1E66A 2GCOA 3DS8A 2H17A 3EXIA 2O8NA 3IQHX 1QM5A 5GGYA 4QULA 2AYXA 1PZHA 2G9RA 4EBFA 5CTAA 1JYFA 1JAHA 2GPBA 1NVUQ 2PA0A 4IXWA 2PZLA 3W90A 3WLNA 5IYZA 3QITA 4B3HA 1G5TA 1RRKA 1K8ZB 1AGNA 1XBTA 3CHYA 3GT0A 5TVGA 3A9TA 5A4FS 1JBKA 1UDWA 2QLMA 2QF7A 2XYHA 4TLMB 1MB3A 2BAGA 2W70A 2IYUA 2H5EA 2FUG6 2D1SA 1AD2A 1KI8A 1QIMA 2FVXA 4Y2HA 5E2IA 1ZNWA 3GRRA 2N1BA 1U2DA 1YDGA 3I39X 4ISCA 4IUYA 2FR8A 3Q8WA 1P0CA 4WIAA 1X14A 4YN3A 4MDFA 4R1MA 2B7BA 3DVSX 5TC4A 1Z7BA 1JZTA 3DLBA 1AXGA 4UZSA 4X6LA 3O2NA 1NJSA 2ZYHA 3MCUA 1RM5A 3ZX4A 5EJ2A 5BSGA 1DL5A 4LYYA 5DBIA 5H16A 5KYXA 1YI0A 4U0JA 3E81A 1X80B 3IT1A 1PV1A 3DF7A 2QTRA 3A1NA 4NKRA 2ANBA 3OPYI 1XVLA 3WG9A 3C2QA 3C8MA 5KSOA 1FUIA 3H2JA 2W2PA 3UGTA 3AM4A 3ZKWB 4EFLA 2B98A 4OHBA 1UDXA 3II6X 1YHZA 2DQKA 3KDPA 5TMEA 3A26A 5LBTA 2GUWA 4E5VA 3SYRA 2C29D 4XPIB 4RY8A 3DKKA 1JXMA 3M1LA 3IEUA 1LLQA 4KV7A 3WKBA 3EAFA 4A16A 2QTMA 1TQ4A 3AQ4A 1VCIA 1Q1BA 1ZCBA 3DWFA 5F7JA 4Q0MA 3KEQA 1TYAE 2C04A 2HADA 4KODA 3LK6A 4UD2A 3PWTA 4PCVA 4QT0A 4JBGA 4H18A 2H5JA 1HNZB 2D3WA 5F2EA 1OT3A 1QR6A 3EWIA 5J4VA 2AX3A 3C3PA 3IUEA 4ZWNA 1ZIXA 1C0PA 4I19A 4IXNA 2GJAA 721PA 1CUBA 4U4AA 4QVIA 1T4MA 1E1NA 1PSZA 4NYMR 3NVAA 4QLOA 5JJKA 2OGWA 3M5CA 1RBMA 4RKEA 3ZV7A 4LECA 3C3EA 3COYA 1P9RA 1Q7EA 2QAGA 1LC0A 1PEDA 1C1DB 2VAMA 2EARA 3D81A 4WK4B 4J49A 4D4JA 1SKBA 3TJZA 2FZ4A 2ODEA 3U49A 3AY0A 4OBXA 5BR7A 2JHFA 1G7TA 3UPUA 3ZCVA 2AN3A 5JZOA 1SWVA 4DY6A 4PO3X 2FA9A 3OU2A 5CCDA 2C1EA 2B78A 1XQWA 2GRUA 1HSZA 1QH8A 3I4CA 1WXGA 3JZFA 3FDXA 2VT7A 1ZFNA 2P6UA 3AB3A 4KYVA 2EBUA 4EKYA 5KCZA 4BVBA 3B6IA 1GPH1 3LXRA 1F0NA 4S0XA 5CLIA 1A9PA 4RZQA 3VOSA 3JARA 1XEFA 3ZHYA 4U5XA 5DVZA 4CIBA 2ACWA 3NIGB 1G66A 3OCCA 1H5QA 1TU3A 3BKXA 2O0HA 3HYCA 3TSCA 3WAGA 5TGDA 4IYJA 1QYVA 5J59A 3HJUA 2VQEB 2ZBQA 4CT4B 1XFAA 4EY7A 3X44A 1ADFA 3QWFA 4NIMA 5BMVF 1H1LB 3PG5A 2FN9A 2KX7A 3E22A 4NAHA 3TJRA 1CIJA 3PT5A 4GU5A 4MR7A 3ACBA 4AJIA 1IZ0A 4LRXA 4XSHA 3K9LA 1R0WA 3QKTA 1RFLA 3LCRA 4XVRA 4HEA1 5BWCA 1XPUA 1MO2A 5FWXA 4ALLA 2PM8A 1UBLS 1JWBB 2Z04A 3CNEA 4W6ZA 1W88B 4HAXA 3BTUA 4I66A 3C3MA 3BL6A 2RGDA 3BIWA 3NTVA 3QVXA 1DNPA 2R1VB 1AB5A 5C5EA 1NMSA 4MEAA 5ESWA 1FXWF 4GD3Q 3O6VA 4OMUA 2HUPA 3T4UA 3WHKA 3BA1A 2ZYGA 4E1VA 1LSOA 2GYWA 3L6DA 1IBLB 3SEFA 1VA4A 2BEVA 2EBHX 2ZJZA 1IXZA 3RU9A 3OCXA 1LLUA 4HX9A 2BEKA 2SECE 2ISSD 4HB3A 2Y76A 4GX0A 3S7TA 4BLVA 2WHPA 1GNTA 4MVWA 1X7WA 4WPGA 2RGNA 2GZ2A 1E2MA 2CBZA 4J2TA 4CMGA 4C14A 3H4VA 4Q3LA 3IBGA 3QYAA 1UK9A 4LCBA 4A0SA 1Z0DA 1ZD3A 2O1XA 3D6TB 5EVCA 4F12A 3IEIA 1DPFA 1FYFA 1X38A 4YRAA 1B43A 4LHEA 1W44A 4B75A 2YNMC 1UC8A 3KQPA 3U80A 3NHFA 1G2IA 1CZRA 3RVPA 2YFYA 3EDQA 1KARA 1UT6A 4H60A 2EJVA 1E6EA 4OOEA 1FTWA 2WF8A 2PZ8A 3EQ6A 4UKDA 1IBKB 4CCWA 3VR2A 1U8YA 4DLBA 1M72A 2JZOA 3VR6H 5LQDA 3LMKA 1HTTA 1UINA 1XEWY 4NENA 1FP2A 3VZBA 1Q6YA 2DECA 4HL6A 1WUIS 2HF2A 3WLMA 3HCDA 2P0AA 4JT2A 2C2XA 4C7OA 1KJJA 3CX3A 2A5DA 3ETCA 4XRGA 1TAUA 2OYCA 3PXEA 3EGXA 5AI9A 1JFLA 1KYWA 3C87A 3G88A 2G5TA 2JFZA 1FK8A 4N0MA 5HA5A 3ZBUA 2ZUFA 3BIFA 3IFSA 3JPYA 3KT8A 5IK2A 3U0BA 4G3XA 3WNDA 2IKSA 2P9HA 2WT8A 2HBYA 3B9PA 4GXRA 5H3CA 4B34A 5BWNA 3CH5A 4JBYA 1O03A 1SVOA 1SXGA 2CJXA 1SC3A 3OU6A 1IN1A 4B6RA 1D6MA 2ZBEA 1ZONA 2YV2A 3KPJA 4EYEA 4PF1A 3THXA 1T8TA 3QEMB 4B4WA 2XBMA 1GUAA 2A9OA 2G5GX 3CE9A 3I32A 1KZ4A 2B4QA 2FP4A 1BJKA 1KO4A 4OUDA 4P83A 4AK9A 4ZI7A 5KQLA 2W2MA 3EVDA 3QNUA 4DDVA 2B1QA 1VDMA 3FFXA 3K96A 3PRYA 3WK8A 3OBBA 4OHVA 4LZNA 1E1RD 2FSPA 4K8OA 1YTLA 4B31A 2WG1A 4IM7A 2TMGA 5FL7D 5C3UA 1A5SB 4EFKA 3NKFA 1YFJA 2OORC 2OESA 4H4DA 5A5GA 5B1DA 5T6MA 4BJ3A 4YV7A 1RACA 4QYTA 1NVEA 2XB4A 1T4GA 2PBRA 2CGEA 4A6DA 1CEXA 2QRMA 3DHYA 2JHGA 2VAXA 3BE5A 1GUFA 3MT7A 3NP7A 4IEFB 4ZOLF 1WW3A 1Z34A 3A1FA 3RRYA 2YUIA 3IL2A 1V26A 3GVPA 2EW1A 4FNMA 2GBPA 2HDHA 1QANA 2I87A 5TPWA 3VUFA 2VYNA 1EZZA 3BMXA 4B17A 3BF8A 3NZEA 1VCHA 2JGFA 5D7NA 5B6JA 2HDWA 2ZSHA 1J22A 1QZXA 4FLMA 3L6EA 3VNAA 4XH9B 2WA2A 1GCAA 5HIAA 5JARA 4MCJA 2HWKA 3CN7A 2AD1A 3V9AA 3ZBPA 3TLYA 2C5AA 3D6VA 3ZY6A 5HQTA 4JEIA 1KWKA 3DYBA 1KZHA 3RS3A 3IR5A 1S2LA 4XQCA 2XAUA 4MHSA 4DAEA 1J90A 2QSUA 1T36B 1YWGO 2WVHA 3MWKA 3NC0C 2A94A 3NNNA 3MG9A 4PC3A 2Q7XA 4RYLA 3U4CA 1PFKA 3IO3A 4QXQA 3UA3A 2C82A 5A4DA 4QG7A 2RHMA 4L5JA 2VJDA 4WV3A 1X0XA 3BXHA 1E3WA 2IHVA 3WA7A 2ZSIA 4B47A 1ESNA 1JP7A 4QUGA 1RWPA 1BWSA 3DHWC 4DNPA 2IXBA 1J09A 1OFUA 2YZGA 2LW7A 1A8SA 1KH2A 4Q1CA 4Z4GA 1NJGA 2MINA 2FPMA 5JAZA 5MHTA 2M2IA 3ROGA 4HUQB 3ZGXA 4L51A 3DMGA 2WTUA 3HO6A 4ZC8A 2HU5A 3KQVA 4GRIA 1II9A 1DB3A 2I2FA 4IQFA 4N8DA 1OXBB 1KFEB 4B4KA 3GH3A 3ESXA 5TF4A 2P5UA 2V4ZA 1WZNA 2HEIA 2ZB7A 3NAQA 4MAFA 4DCVA 4KR7A 1L8XA 3E35A 4R9SA 2DKNA 1JG2A 3OE7A 1Z0JA 1Y1LA 2RH9B 3K0EA 3L3BA 4LJ7A 1OIVA 5T57A 3WOHA 3N6VA 4CG0A 1LF0A 2NVWA 4Q82A 2C3YA 3UOAB 1L4YA 3OCJA 5JRJA 3ND9A 4C4ZA 1L8AA 5BT9A 1DRVA 4MWSA 5ITZA 2CKDA 1FFEA 1NN0A 3Q87B 2XVYA 3CG0A 5AXBA 4I81A 4GE3A 3VJKA 4AJPA 3KM0A 4J0KA 2C4WA 3DE1X 5IJAA 1A5TA 5GTDA 2FWMX 4IO0A 2W2KB 3EOBI 1IUNA 3DGFC 4EEXA 3HVJA 1Y34E 1M2KA 1GLGA 4WLOA 5CXQA 5TQJA 2OC4A 4B6QA 3TRIA 3E5RA 1VZ3A 1J9EA 2WU0A 3G2HA 1KE2A 2PO5A 1V8ZA 2RJNA 3L79A 4LXUA 3A6GA 2VAVA 2AI1A 3ASUA 1I3NA 1XVUA 2GF9A 2V3VA 4OAPA 1IUOA 2H29A 4ZREA 5CA0A 4DXDA 4AZ0A 2DFPA 2YJGA 2FKAA 1JTVA 1OTYA 2VF8A 4HAVA 5KKAA 2AMJA 4CG2A 3DEHA 4YB8A 1YB4A 4TTRA 5E2AA 5FPTA 4UVIA 2DE0X 2HSEA 4PNZA 2AJLI 3C6XA 5AM3A 3EBPA 4FW8A 2AFVA 5A62A 5CD1A 3ROZA 4ZGBA 2KMLA 3MBIA 1X87A 5LZ2A 3B3AA 5KJEA 2FN7A 2INGX 2QPTA 1C80A 4UNPA 3UY4A 4EGCB 3QLVA 3LY7A 4L28A 1E1CA 4LXXA 4E4YA 4WNAB 1PX0A 2FMUA 1BXRB 2B5OA 2XA1A 4JWTA 1EB9A 4YQYA 2G76A 2VJCA 3CLTC 1VSUA 2AG0A 4XM1A 5ILQA 3LT1A 4ARUA 3G68A 2REQB 2VCYA 1QFMA 4FDUA 5LQCA 2V3CC 3C4VA 5T4FA 2O2DA 5BMOA 5GVSA 3EVNA 2QMUA 3Q41A 1B42A 2GPWA 5C35A 3QRWA 4R1PA 1UBMS 1A95A 1J8QA 2Q2QA 2R47A 5EWMA 1WO8A 1VXOA 1JHPA 1XTZA 1Y6QA 3H05A 3HYNA 1DKPA 2WUVA 3V1MA 1C4KA 2QV0A 4QAQA 4B5LA 2Q3CA 1YZUA 2LNDA 4BXOB 3H65A 2WICA 3P97A 1K27A 4UQOA 1R4AA 5JHHB 1JR3A 2JIRA 4KXUA 2V4MA 1RI3A 5F21A 5BRNA 1X1EA 3AXSA 1TO2E 1IH8A 1V7QA 3V6MA 2VA9A 3VX3A 1WKCA 1Z0UA 4BKRA 5JSZB 1KTIA 1FNMA 2XCLA 4X54A 1W8DA 3B3FA 4NYIR 4G5FA 4E4RA 1QKKA 1KOJA 1SBQA 2BGLA 4TMTA 1XDSA 1L5WA 2DQ4A 4Q3CA 2CUZA 2NU6A 4QYIB 2E5LB 3N2EA 4GMFA 3K0CA 2HJ9A 4MJ7A 4QDZA 5E9AA 1GCOA 2V58A 2XUKA 2V4UA 3KSDO 3GPBA 3EG9A 3SR3A 2ECQA 4JB0A 5KVCA 2WW8A 1G6OA 4RTNA 3THYA 1WB9A 3HU1A 1EP2B 1REQA 3EOZA 3WJ7A 1H2FA 5A6VA 1B6TA 2PD4A 3E3NA 3GUVA 1CNFA 2FH5B 5ERGB 1A9ZA 2BMFA 4YPVA 4Z51A 4XD7D 5TSDA 1ZMTA 1Q0PA 4B6PA 1AKTA 4B84A 2WPNA 2GVZC 2XGJA 3E3LA 1TUIA 1UBJS 1Z6AA 4ES6A 1PVDA 2GNOA 1Y7IA 2XNCA 4MRRA 4ZAWA 4D99A 1YACA 4I2NA 5HW0A 5JYBA 3NM5A 5GY7A 5J2UF 3E53A 4I4TB 3IELA 4IQGA 2I1LA 2AYYA 1SOWA 4MGEA 1DAEA 5JDCA 3HEAA 3KAJA 5CHEA 1JAXA 3OQMA 2EBFX 4P4SA 4B8ZA 1X0VA 1BOFA 4GVPA 1OUMA 1I5RA 1DG3A 1LPNA 2OB2A 4XYGA 2MCFA 1ORIA 1T5BA 3D0RA 3FLAA 2AWNA 3M34A 3U19A 5GIPE 4RBNA 2X0RA 1UWVA 3PC8A 5KYWB 3HRHA 2WK1A 3CWCA 1ZUD1 5D3MB 5AK3A 1A5ZA 4Z9BA 4DLAA 2OD7A 2LDXA 4Z8XA 4L3OA 3H5VA 4AKTA 2BHRA 1DQNA 4BX3A 1P2DA 3CG4A 3NH6A 3RTDA 5EEHA 3FUXA 4GIBA 4DANA 4U6SA 1RYNA 3DBRA 4FE7A 3F6RA 4K8RB 3RC7A 3OM1A 1Z37A 3IKTA 3EBLA 1XTSA 5ALOA 3LSTA 4PNHA 1Z6TA 1BHSA 1J0EA 4UQLA 1GN9A 1QYWA 2GN0A 4JHXA 2MJLA 1ZD8A 2AG5A 2IW1A 4XX1A 1C1XA 1TKCA 4CQJA 4BNYA 1WXHA 4IMJB 3TVYA 1U3FA 3GDHA 4XWYA 3CM0A 3QG1A 1E2NA 3KJXA 4RIFA 4XWWA 3R9XB 2PHZA 5SY6A 3EZ2A 1CQXA 5FOSA 5BOSB 2AN4A 1YMVA 4O4IF 2WF6A 3BIJA 3MB5A 4PYQA 4BFZA 3TTUA 2DZDA 3OUTA 4A2QA 1JXOA 5ELLA 5ENDA 1EWTA 2A0XA 4F91B 3PQ4A 1SG6A 5CT8A 4Y9RA 4GX5A 1MX5A 4AMZA 4YCMA 1WD5A 2GUGA 1O95D 1G8SA 2CNOA 1SOUA 3FM9A 2Y8EA 3AJEA 3DTVB 1MJFA 4U7HA 4RIEA 3MAJA 2W2LD 4GI1A 5BORA 2EX0A 3NHUA 2OC9A 1U2EA 3RVSA 5CX4A 3BDVA 4AZSA 4UXIA 1OLSA 1IAQA 1IWPB 3X43A 5ALVA 4V38A 1UM9A 2XF8A 1SKMA 4J3JA 3D7LA 2XE8A 4JP5A 4U3JA 3DMTC 3U62A 1QRDA 2TECE 2V7PA 3QLJA 3THXB 4KI7A 3RBVA 3E05A 4BNXA 5JH7B 4LA4A 2GXSA 4RZ3A 4PYRA 4R01A 5BNFA 1CBUA 1IY1A 1J8DA 3NM6B 3W6OA 3ZV5A 5CBPB 1NNEA 1FZTA 4ZGGA 2BN4A 3E5HA 5JXGA 5JW6A 2CCJA 3NHWA 1NLMA 2GKSA 4Q1DA 3I1FA 1E79D 3G0CA 3OAAA 1JBEA 2OCLA 1KDRA 4HBZA 5KYKA 3QVOA 1AV6A 1CS0A 2WI8A 4JR1A 3NTUA 1ZOOA 1FBNA 2FYTA 3O7MA 3JYLA 1COWD 3F3YA 3H04A 4I55F 4PICA 4XEHA 2PMEA 4D3DA 4YQFA 3DM5A 2EWMA 1M8JA 4PHHA 5EXXA 3MQ4A 3O26A 1HGXA 1P5ZB 3F6YA 1E5QA 3PHGA 1GPDG 3FUCA 1QK4A 3G17A 4FR0A 2RKOA 4L0CA 5HQ3B 2I5PO 1VG1A 1F8YA 1DKOA 2LUOA 3QLTA 4RX1A 2D2EA 1HRDA 2IPLA 3EHDA 5DLYA 2QDXA 4CKXA 5I7VA 2XTZA 2BJWA 1A2BA 1M33A 1P1FA 2H07A 1YC2A 2IEYA 3DM9B 3EVZA 3IIJA 3OQIB 5H70A 5L8VA 4JNGA 4W99A 3R7BA 1OXVA 3G0GA 2ZBFA 4C0LA 3AFIA 4BV3A 1JX6A 4AKHA 3DH0A 1WW2A 4C6HA 3KO8A 1FUUA 3NMUF 4Z99A 2IOYA 2YZKA 4ZCMA 2H4WA 4CKBB 3RT1A 3WJ2A 7GPBA 3JWEA 3UK2A 2WHQA 3C14C 3PNKA 4ZVVA 5H3HA 4ALKA 1U2GA 2PO7A 3INRA 3OESA 2EZUA 2O50A 3LQYA 1ZA1A 2XNJA 4GI2A 1C50A 1S02A 4HZUA 4GPIB 3G7SA 1U2ZA 4QQFA 5E7IA 1AN0A 5FO0A 2VRCD 2OPHA 3U7JA 5DTQA 1N2XA 3TQHA 5E95A 4R3WA 5DYGA 5C34B 1Q95A 2DWQA 3DUWA 3Q6NA 1OU4A 4Z54A 3AB8A 5HSGA 5J43A 3JQAD 2JVKA 3NBUA 1NATA 3RDPA 3D0KA 2DEUA 3D8UA 4EP1A 3O2QB 2I4IA 1IN7A 4BJ5A 1LLDA 1SBTA 5E4FA 4M8KA 5IT5A 3KQKA 1JYSA 1O54A 4B35A 1RPZA 2NOAA 1JDVA 1RIIA 1P7VA 3ZWDA 1OZ0A 2A0WA 3GLRA 2QMZA 4GUAA 4EG6A 1QIIA 5C8XA 4TWAA 1ZSVA 1QG4A 2ZBDA 3AJ8A 1HKHA 3AM5A 5D87A 5E6SA 3VNSA 4RVSA 1G5PA 1ZJZA 1GILA 1LBTA 4TYWA 5D85A 4BAZA 3QVJA 4IJKA 1E7MA 2P9ZA 3H2GA 2XJ4A 4DQXA 4OYYA 1YZYA 2CLLB 2GZHA 4UE3S 5B4VA 3SEQA 1X7YA 1OREA 2JEZA 1NUQA 4NU6A 1U7XA 3CBGA 1AF4A 4ZTZB 5KQRA 1O5IA 4TKUA 3L92A 4N40A 4XIFA 4Y6GB 3RHTA 2PS0A 3QK7A 1FIUA 2X2FA 4H3SA 3G0BA 3GIWA 1RLMA 3STTA 3V4ZA 1VE9A 4AKEA 4F4HA 5ITVA 4RA6A 1AMOA 3BS4A 3QWHA 2O1SA 1ESZA 1P77A 1DADA 1U8TA 2P9TA 3RIXA 1WP9A 4TSKA 1QRSA 2YW9A 1JV2B 3PFIA 4E12A 1L7VC 3CUYA 4BKOA 4YRMA 4MS3A 1KMQA 3NYRA 4IGIA 3O84A 5EPOA 3T7CA 5CFZA 1E1LA 2JFBA 2Y05A 1O3YA 4BNKA 3GRPA 2B6HA 4GDMA 2ZIEA 5CFOA 1U0EA 1K3UB 1DJPA 1OAAA 4GOMD 2ACVA 4BFLA 2VQ3A 2A0UA 2Y0EA 2EP7A 3A70A 4F6CA 3TAHA 3OKAA 3F2VA 5BYBA 3EW9A 2VNSA 5NULA 2WOOA 3IAS6 3RIHA 5REQB 1JKMA 1LDMA 3FVTA 4LE2A 3IMFA 3EVBA 2QQEA 3KOYA 1CUDA 3UO8B 2QNBA 1ZXBA 1ZJWA 1HI9A 2VUSA 2GN8A 1KBOA 3G2LA 1PTJC 2DUMA 2J5XA 2VJYA 3K5HA 5KMGB 3AP2A 5KZMB 4PNPA 4NDAA 1XF9A 4EUFA 2B1JA 2YBEA 3CUVA 3W78A 4MPTA 4D98A 3V8EA 1EVQA 3HXQA 4DQDA 5SY9A 3ZQKA 2XA9A 1DG1G 4GYKA 4WXPA 3ZNOA 3H8SA 3FSGD 3BILA 2QZ9A 4O29A 4P3XA 4V02A 4C0KA 5JV5A 4JVNA 4J1NA 3KP1A 4UASA 4PZ9A 3X2EA 4UTZA 3P32A 5CURA 2FPPB 1MT3A 4OYRA 3TL2A 1KAEA 2QZPA 3UWOA 2X1HA 4B3CA 4DMRA 5JWHA 3L0OA 2CVQA 2P6MA 1OXSC 4M36A 3FXAA 3OX1A 1GAJA 3USES 4M0FA 1QE0A 4B85A 4ETNA 3B1YA 3PNSA 3P26A 1L5MA 4G26A 4H7EA 3TOCA 1B0ZA 3A9CA 4U2FA 4BPRA 2BGIA 4X7RA 2J3DA 3UMYA 1YVUA 3HP7A 1QDEA 2IZ7A 1KAOA 3P1JA 1GL6A 5DNEA 4CLOB 3T1YB 4F9TA 3HBFA 3SJCA 2QLJA 2HWUA 3WY9A 5MN5A 2HL6A 2O8DB 2QMEA 4P7GA 1E6UA 2DBQA 1C9DB 5ALRA 5G40A 2ZT7A 1E5LA 1E0DA 1UBOS 3UZUA 4DIEA 3EEIA 1FJ2A 1QXSA 1OR8A 1QC5B 2GHRA 1ZH2A 2HIAA 1SA0B 2ZYIA 3OJEA 4WEQA 5CLQA 3UICA 4OHYA 1XHLA 5EZ6B 5GAJA 1PS9A 3M5PA 4LI0A 1EUDB 1RC0A 3WIBA 3SS8A 1GGKA 2ZUVA 3JVUA 3UV7A 1CR2A 4IKPA 5K0ZA 3KHTA 2C5HA 3AJRA 5JFGA 1W88A 1XQXA 2M6SA 1CT9A 1SUEA 1TQHA 4YMVA 1WXFA 5KJ1A 4FX2A 2H4ZA 2M6LA 1X9IA 3W3AH 3F6PA 1F9AA 2Q1YA 3LY8A 2ZUSA 1KY5A 3ZW8A 4O8ZA 1THGA 5JLAA 3BMCA 4D82A 4MOWA 4G41A 5AI0A 4LIPD 1P4HA 3LY9A 3E58A 1CEQA 3HKEB 2BFPA 2QUAA 4W9NA 1N6LA 1CW2B 2X0KA 3ME5A 4UREA 4LHYA 3BIXA 3JAKA 1E2HA 1GY8A 4HLUA 3RVMA 3UATA 5AXDA 1PK9A 2N3ZA 2O4UX 2WUDA 2W6MA 4X64B 1B2LA 4CNBA 2W2NA 2PKEA 4MGIR 1E89A 5FTJA 4CODB 1Z5NA 1Y1TA 4YJ2B 1IU9A 2RHHA 2BEUA 3PB3A 4TV9A 4KQ9A 1Q22A 2XKBA 3TLXA 2F3SA 4HRXA 3SC2A 3EJWA 1ZINA 1EZ1A 4M0DA 3VDQA 1E59A 1Z5GA 3EGWA 5D5PA 3TBKA 2IEDA 5DHFA 4JI3B 4L07A 5HM6A 3FY4A 3PUYA 1CUGA 4YT5A 4QDTA 3ZW7A 3J81k 4C4TA 4TL8A 3TUZC 3KEGA 3TM4A 3W9UA 3QW2A 4Z49A 3LX5A 3MN1A 2Q0SA 1ESMA 3R1IA 4AD8A 3T7DA 3PC6A 1UMCB 4Q34A 2B94A 5B1SA 4L16A 5IDWA 2IYPA 5IZ4A 1R0CA 2HIHA 5ERYA 1JQAA 3W5CA 1URPA 4RXUA 2J59A 3R0ZA 1IEWA 1Y8RB 4Q18A 3LJKA 1ZVMA 4PYIA 4F3CA 1SUCA 3U2QA 3OZSA 5TPZA 2OFFA 2ZI5A 5D2CA 3FG9A 1KMNA 2WSBA 2XYRA 5TT0A 5JAPA 2XWSA 4XLZA 5KB3A 2QRNA 3IAUA 3K6SB 5DNWA 4J9VA 2HA7A 1RZRA 1BW9B 1JMKC 4B2YA 2VPXA 3BYZA 5KNBD 1BX3A 3VSDA 2X2OA 3KYIB 1BXZA 5COQA 2CBXA 3I2FA 2G9ZA 3CCBA 1EIZA 2YIJA 1BE6A 3AVPA 3ZZMA 4LY3A 5AD1A 1NVVR 4G5GA 2CY0A 4KO1S 1PFQA 3TRDA 3VPAA 4LJSA 4Q24A 2O4CA 4BVAA 4QXAA 4BBAA 4I8IA 1N5OX 4US0R 5AK6A 1VBKA 3MJFA 4FZJA 3FNEA 3OJFA 5AJVB 4QPDA 4K6OA 3CMCO 4BQPA 1UPUA 2FZ5A 2MSNA 3K1TA 3FBGA 3IAAA 2D0OB 3A10A 4V0QA 3OQVA 3H9JA 4ID9A 4XWTA 1L7XA 4HJXA 2QZ4A 2B9VA 4YRKA 2X0NA 2RKBA 2OD2A 3QF4B 3LC1O 4IHJA 4E2ZA 1G0NA 1XELA 1W4RA 1T4CA 2UVPB 3HA5A 3AYZB 4FMCB 2BIFA 1GFWA 2JJ2D 3ABZA 1MQAA 2OB1A 3LFHA 1Y98A 2IYNA 3MWDB 1UKBA 3P2KA 3PHLA 4PG7A 4EA9A 4ERNA 1ECCA 3KV3O 4V39A 5IDYA 1K0FA 4RLSA 3HXMA 3DDWA 4CE6A 1CQJA 3P27A 3TPFA 4WOCA 1I6WA 1VHWA 2YICA 2WMYA 2V7EA 5JO9A 3L02A 4WDRA 4OFZA 5GM2A 1Q21A 1H8ED 3ZDYB 3F5MA 5KSWB 4HVTA 1GQFA 4GEGA 5KVAA 4XIYA 2A4MA 2MMCA 1IBCA 2Z8ZA 2UVQA 4LJLA 2WAXA 1UMKA 1V5IA 3AI2A 4KQGA 4M87A 4M1KA 4MA4A 4LV6A 3JATA 5EIAA 1IEVA 1J39A 1IHDA 5KX5A 4KO2S 2AJCA 3I5UA 2ATVA 1YE3A 1I0LA 5FLYA 2J45A 1QE5A 5F5LA 4FKZA 4JLPA 2IIQA 4M6WA 3IHWA 3CH4B 3KWMA 3N5CA 2EWWA 1VYTA 3R3XA 5FTMA 4NV0A 1ORTA 4CHTA 1JR4A 3LP6A 1G0OA 4G8DA 4D6PA 3Q1KA 3L4JA 2C9BA 1LLFA 2JIMA 1VMAA 3MA0A 4HAOA 4HUQA 3QY9A 4LJ6A 1XCMA 4G5YA 5K8TA 4R7GA 5CLHA 3JQ8B 1D03A 1DRUA 1XZNA 4G84A 3RKUA 2EERA 1GU0A 2BMDA 1CP3A 1NOIA 2I65A 4HWSA 3F2IA 3T34A 1TW2A 4YFVA 1HNWB 1TUBB 1ZD9A 3CZ5A 1JPVA 3D31A 5AQEA 1W87A 2VPYA 1Z7YA 4JA2A 1MW9X 1L5HB 4X7MA 3PT9A 5GQSA 3TD9A 4URXR 4PU0A 3CQ9A 3F90A 4ZFNA 2FJUA 3O7WA 2BFEA 1GDHA 1J4AA 3WLIA 4XGNA 4EVIA 1ONOA 4G23A 4WNCA 3VZPA 4KFRA 2LR0A 3GLFA 1OAKA 3GRAA 4EEZA 1RVDA 2H2AA 2Q2VA 4TKVA 4B3GA 1YU9A 2WYHA 1CR4A 1TA4A 4TYMA 4INOA 3KTAB 4PZ0A 1CYDA 1T8PA 2C7OA 4YO7A 4AJEA 3KB8A 1PGJA 4IF6A 4Z9XA 5KWEA 1DVRA 4C76A 5HKOA 4WESA 4AY6A 4HDCA 3SQWA 4HH0A 2PAAA 4RH3A 1Y8ZA 1GKIA 5JVDF 1Y82A 3QPBA 4D8TA 2C7QA 4CCAA 3SQXA 1WLYA 2Q3DA 3JD1A 4DLNA 4ESVA 1MHTA 2AFIA 4F06A 1DIBA 5JBIA 4AKIA 3OFKA 2YTZA 2O6LA 4BJHB 4J03A 4RCVA 3I5AA 2QKYA 1FC0A 5ICFA 1OWMA 3V80A 4JLAA 4HNVA 2Q0XA 3HCRA 3I2GA 4H2DA 1CZLA 1F51E 1N5DA 2Z0MA 2PFGA 3C5HA 3PEFA 4PGGA 2QQGA 3FPBA 5CEEA 5H4GA 3E8XA 2PV7A 1L5RA 2G36A 2LKCA 5AWFC 2C9YA 3IQXA 3K94A 3SQMA 3UHJA 5BV7A 5JAOA 2HCBA 4BVEA 3ZBTA 4EUEA 5I7EA 2O48X 1TTPB 1SXJB 3EEBA 3BMNA 3LWNA 3DR3A 4O4LF 4A91A 4D81A 4KW7A 2JLAA 4MITA 4RDHA 2F1OA 1XT6A 2WSIA 3WLJA 5IAOA 4G8BA 5CYGA 1JDJA 5J5VA 2YXDA 4QBFA 4JI7B 1I3OA 1DRWA 2WILA 4C2AA 2X7XA 4JOQA 4EWLA 1X8LA 4I1OA 5CXSA 4OIFA 4AC9A 4C21A 5CB4A 2CT8A 1ZHFA 2YWCA 3CX4A 4G0YA 4RFVA 4RU1A 1MCZA 2YMQA 2G1KA 2ZEJA 4X1YA 1GGVA 1WMSA 3QFTA 4M54A 3HUEA 1HE4A 4I4LA 2IY9A 5G0UA 3NUGA 5J40A 2Y68A 3I6QA 1FDIA 3ZVNA 2NN3C 2MSWA 1T5TA 1U0FA 2XCOA 3BJIC 4ECEA 5F7ZA 4QM6A 2ZRIA 1AN9A 1RBQA 3U3RA 1UK6A 1DEHA 5DIFA 3TQCA 1PFGA 4WN3A 1SVKA 1JIXA 2PGNA 2BFBB 4LQDA 4OCZA 1UJ5A 3NPAA 1AQNA 1N77A 2PNJA 3BWCA 4GWKA 3T9FA 2R6ZA 3V2UA 5BUCA 2ZB4A 3VVMA 3WK6A 2IHBA 4F5EA 4UARA 3WJ1A 2YN0A 1W4AA 2GJSA 3L0YA 4NQZA 1U7UA 5FTNA 5IVKA 4G1BA 1IOWA 4L74A 3FGOA 1FUEA 1HLFA 1TTQB 3LQ2A 4OQ4A 3TB4A 5JS1A 3UMCA 2F3PA 4CM8B 3KSBC 1T9KA 2CDNA 3CUTA 3QE3A 4GKAA 1ONSA 4TMFA 3BMQB 2Y27A 3HEMA 1JZQA 1V41E 2ASEA 2GFIA 2DG2A 3ZWMA 4MYTA 2FPRA 5AQ1A 1ZL0A 3FOZA 5LMCA 3CTPA 4DKXA 3I2JA 4J8PA 4EHHA 2X3FA 4R40A 5DHSA 1M2EA 3BXGA 4P92A 4OP2A 2KE5A 4XFJA 4J1TA 2VJBA 1FFDA 1MTOA 4MWOA 1IDN1 3PJGA 2QX6A 1VTKA 5J4HA 3IEVA 5GONB 4RHCA 2XRYA 1KK3A 3T7KA 4YJFA 3W77A 5I7SA 3FPCA 5FIUA 3P9QA 4AJLA 5K01A 4PYMA