1UDII

Nucleotide mimicry in the crystal structure of the uracil-dna glycosylase-uracil glycosylase inhibitor protein complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
83
structure length
83
Chain Sequence
TNLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nucleotide mimicry in the crystal structure of the uracil-DNA glycosylase-uracil glycosylase inhibitor protein complex.
pubmed doi rcsb
molecule tags Hydrolase/inhibitor
molecule keywords URACIL-DNA GLYCOSYLASE
total genus 15
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 1995-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 1udiI00
1UGHI 2UGIA 1UGIA 1LQMB 1LQGC 2J8XB 2UUGC 1EUIC 4LYLB 1UUGB 2ZHXB 1UDII
chains in the Genus database with same CATH superfamily
4BU4A 2XH9A 1U5OA 3EHCA 3FF0A 1DMQA 1YNVX 4L8OA 5IG4A 4IIAA 4N6TA 4AKYA 1LNIA 5AYRB 1BVIA 4LSOA 3DGLA 3MG2A 4LMIA 1RHLA 4BIRA 1D6UA 3QK9A 2P0XA 1B2UA 1UCJA 3FF2A 1CQSA 2CX0A 2P09A 1OHOA 2AADA 2RFRA 4HM3B 3RDEA 3S67A 3NV0B 3KIIA 3JVCA 2RBIA 4FCZA 4XDVA 1J2BA 3SVAA 2KXGA 3CD63 1JN5A 4WP5A 1YIJ3 1FUTA 3B8LA 3PCRA 1FGRA 1RTUA 4HAAA 3EB8A 2KAAA 4CJNA 2KCDA 1JKGA 1ISKA 2F5MA 1LQMB 1OGZA 1BSAA 3CCR3 2W2CA 1BIRA 3BNBA 5CXOA 1O7MB 1I70A 3KSPA 3K5TA 1PY3A 2C11A 3I563 3SYUA 3BNEA 3AMOA 1AVLA 5AIGA 3FLJA 3FG3A 3CCJ3 1IT8A 2IMJA 5ELUA 1LOXA 4HM0B 3N8BA 2I9WA 1VQO3 4XDWA 1EQKA 1SJWA 2CFKA 1VQ83 1STDA 1UGHI 5AIFA 3KCHA 1UI8A 1RJOA 2ML6A 1RGCA 5BU4A 1BRJA 2B1XB 5KP1A 1RNBA 4MMZB 4G1MB 1NB3I 3CPW2 1JKGB 1R4YA 1UGIA 6STDA 1BNGA 1B20A 2CFWA 1OF5A 2E2VA 3I553 2WOFA 3WMDA 2OCTA 2WO0A 1JNQA 1QMAA 1LVNA 2BIRA 1ZS7A 3D5IA 5LC7A 2QEX3 3LYGA 1RN1A 1OCVA 3G0KA 3LTCA 1WQLB 2CH9A 1LQGC 4EYCA 2F99A 5IF6A 3CMA3 3SX1A 3WA2X 3CCM3 1C54A 2HMOB 2K54A 3FCSB 5IERA 4U13A 1B2SA 2WGQA 1GYBA 4HZBB 4RNZA 4N6V0 2P0MA 4TX4A 1HZ1A 1IV7A 3BLZA 3DUKA 1YGEA 4HM5B 3LXUX 4KFEA 3BIRA 3DH2A 1A90A 4MJDA 4OUQA 1IT7A 1DETA 4NREA 3IMAB 1E3VA 1Q814 1T5YA 4NHFA 4O02B 1RGFA 3NBJA 2MF7A 3CME3 1B2MA 1JB2A 1ROAA 2D42A 2YFJB 2CC3A 2Y74A 2E2TA 1RSNA 3EJVA 1GMQA 1K734 1OACA 1NWWA 4KFFA 1YJ93 1T3BA 1TFOA 3OX9A 4FMDA 2ML5A 4OK0A 2HOHA 5JPPA 5JBSA 1JZOA 3X3YA 1WMOA 1UI7A 1BOXA 1TUHA 2F4YA 3ZFZA 3KE7A 1MNLA 4N6MA 1FUWA 3G6E3 4HVNA 1RGGA 2BHMA 1BRSA 3DGYA 1N8R4 3CCL3 3CPOA 1BANA 1M1XB 2OQEA 3JUNA 1KSIA 4BTXA 1TIJA 3NHXA 1KWIA 1W6GA 2STDA 1JB5A 3MG1A 1CH0A 1VZZA 1OHPA 5AYSC 5CF2A 1DVCA 3X42A 3F14A 2UX0A 1BGSA 3CU3A 4RZMA 1BUQA 2L4VA 4BL3A 2H0HA 2BT3A 3T8UA 3U1WA 2KF3A 1BU4A 1UUVB 1X1WA 2XR8B 3KKGA 4KT3B 3IPTA 1Q7Y4 3DXOA 4OVMA 2F86B 3WOEB 3OWSA 3NX0A 1GD3A 3JUMA 2ZA4A 4RNTA 2YX9A 1RGKA 3URPA 5M19A 1UUGB 2XFTA 4N6OB 3OV4A 1UCLA 2GEXA 3D5GA 4WHAA 3GRDA 4HKVB 2W56A 4HYZA 1W00A 3A76A 2CFGA 1KQS2 4JRFA 1AVKA 4GL6A 3SOYA 2GXFA 4MEIA 1W7CA 2F5WA 2CG1A 4IPBA 3UL5A 1D6ZA 1I0VA 1IDPA 3CXC2 4H61A 1MGRA 3GWRA 3FKAA 2CK3H 4LGQA 5IG5A 1FGTA 2P38A 3VGNA 2BO9B 2LYXA 3B4PA 3F8HA 3RGRA 1GMRA 3EQQB 4LYLB 1BNSA 7RNTA 2K0MA 1FUSA 5FGOA 3F7XA 1WTHA 1FGQA 3CCQ3 3EX9A 2ZDJA 1GY5A 1RNTA 1BSEA 5AI1A 3V99A 4EV2A 1QALA 1OF5B 2HMMB 3HK4A 6RNTA 1Q9EA 4CPKA 3N54B 2JQ5A 1ULIB 1BRIA 1F8NA 1UW1A 1BNEA 4XBTA 2MC8A 5CK6A 1BSDA 3UL6A 1MWRA 3VSYA 1N5HA 3LT9A 1QJGA 4DKIA 4EV5A 3Q90A 1JN5B 4J9AA 3H3HA 1BNJA 1RCLA 3GAXA 4HM6B 1Q42A 5KP3A 1QVF2 2Z7AA 3CNMA 1YGWA 2GSPA 3X41A 1VQ73 4R1KA 5IG0A 1DMNA 2CIUA 3T8NA 2R41A 1EA2A 1W6CA 1YIT3 1N9EA 4CDLA 4HJLB 3FZWA 3OWUA 2PNCA 4HM4B 2QGUA 2BMRB 1PYLA 3AHWA 2W6JH 3D9RA 1Q40A 2K3DA 1TRQA 1MGWA 1IU7A 1GOUA 1I8VA 3SEDA 4O2HA 2OOVC 2D1WA 3NV0A 1BRGA 7STDA 4K1VA 5M1AA 3Q1CA 3U97A 3CCV3 2RCDA 3HOHA 4KVHA 1IV9A 3F40A 9RNTA 5BXQA 1N5PA 1IQYA 1AY7A 3NBBA 1QVG2 1IVXA 2LQVA 1EEJA 1OGXA 2XGLA 3A5EA 4K61A 1YJW3 3Q3FA 2CWTA 2KRTA 1EG9B 2PZVA 4STDA 3BU4A 3H51A 4O3VA 4L8PA 3NBRA 5BIRA 1HU9A 1KD14 4J5KA 1DMMA 3FGYA 1YHQ3 1C7HA 1TRPA 1A2PA 5HGRA 2IYJA 1LNHA 5STDA 3EBYA 5FW5A 1K28A 3PYJA 4N6NB 1FW7A 4BTWA 2IA7A 2J8XB 2BMQB 3G16A 3GZRA 2M7OA 1IQ8A 1W2B2 4IT7A 2H0IA 3B7CA 3CCU3 3S29A 1TP6A 1BRHA 2Y73A 3DY5A 4GSPA 1VQ53 3RGAA 3X40A 2Z77A 3K63A 4HBRA 1Q824 2RNTA 1RKYA 1RN4A 4KZ1A 3N9HA 3EC9A 3KSED 1I3FA 2L1SA 1N9JA 3GZBA 4FMBA 1T2HA 4ORLA 5AIHA 2QA43 2KF6A 3UB1A 3J7Yd 2HMNB 3I0YA 3D79A 1TU5A 2W03A 4EXRA 3DM8A 3JUQA 4XB5A 1NNVA 4RNYA 5A0OB 1I2GA 1M904 2OTL3 4N6LA 5AEUB 5D83A 2ZL8A 1I3IA 3V98A 2Z76A 4R80A 3O8YA 5RNTA 1QAKA 3G713 1YI23 1OUNA 4RBNA 1NDOB 4HM2B 4LZIA 2W9QA 3WHOA 4ZM8A 1EKMA 3ZG0A 5HOHA 1RGLA 8CHOA 1S5AA 1W6YA 1G96A 3AGOA 3X3ZA 1FGOA 1T2IA 1O7GB 1UCKA 3F9SA 3KFQC 2YFLB 1K9M4 3UJMA 1VQK3 4ILFA 1L5GB 3TDGA 5EEOA 1GD4A 4XBXA 4PEJA 2GU3A 1PU4A 1YVSA 1YJN3 3LT8A 1VQN3 2OWPA 4BL2A 1A67A 2F98A 1BSCA 1B2ZA 4N3VA 4FCJA 1JB4A 1NO3A 1RCKA 1ZGXA 1BNFA 1UDII 1AQZA 3CC43 2WOHA 1K41A 2RSXA 1RN7A 3OW22 3LMLA 3K0ZA 1SPUA 1W01A 1M1K4 2CW9A 4I4KA 3MKIA 3FH1A 5EQLA 3SXXA 2F56A 1VQ93 3NM2A 1RGAA 1O7NB 3K7CA 1BRKA 3MWZA 1GS3A 3NQYA 1ROVA 3RNTA 1JZDA 2ZHXB 1DE3A 3EBTA 1G0TA 2O3OA 1O7HB 2SBLA 3FSDA 1IVVA 1GY7A 3S5CA 1VQQA 2V1LA 4MMXB 1STFI 1RGHA 2B24B 2Q07A 3QRDA 1MOLA 3NQZA 1X1XA 4N6UA 1LOVA 3MHEA 5CF1A 1LRAA 2GBXB 2KF5A 3D4AA 1ULJB 3DZLA 3F8XA 3OXAA 3VF1A 4MMYB 1HKXA 1BUJA 1WNHA 2FXTA 3SLUA 4R9KA 1SIIA 1WMPA 1JRQA 2XSHB 4Q53A 3MSOA 4JF8A 3G4S3 1GY6A 1NJI4 2GU1A 1I2FA 1B21A 1VQ43 2E2UA 1JBTA 4R4KA 5TGNA 2KF4A 3IJEB 1W5ZA 2XFSA 5JPUA 1NB5I 2XSOB 1VQ63 2P05A 3AMOB 3FG4A 1YVBI 4NPBA 4HM1B 5ELJA 1JJ22 4EW5A 1RMSA 3JUOA 1BNIA 4HM8B 1CYVA 1U8CB 1W2ZA 2CWVA 3F7SA 2CFLA 2GEYA 4GB5A 3ZG5A 5IW9A 3LH4A 3Q2PA 2IUKA 3PGBA 2A15A 1UCIA 1US1A 3B4OA 2RGQA 3WR2A 1WMNA 3X3XA 2BU4A 2CHCA 5BVBA 4XBYA 3PXMA 1BRNL 3HIIA 4WFOA 3STDA 3DGMA 3HX8A 3LTBA 4X2HA 4WYKA 3KZTA 1W02A 3EE1A 2H0GA 1UUWB 3E99A 5G1LA 1Q864 1BAOA 1FZUA 1Q7HA 4GHOA 3EN1B 1R4CA 4AEQA 3AGNA 1VQM3 1A2VA 1QAFA 2XEPA 3CC23 1B27A 1BSBA 1FGMA 2HMLB 1V74A 2CWUA 2GBWB 3LZAA 4J5GA 1LOYA 1OHSA 4HM7B 5IEOA 4KFDA 4XM4A 1ASKA 3S27A 3SOAA 3CCE3 3MG3A 1HYFA 1LOWA 1IVWA 1V58A 2R4IA 4I5QA 2Z6BA 2OTJ3 2XF3A 3NUVA 5I97A 5EVHA 1GOYA 3K9MC 1SQWA 1MWTA 1OH0A 2W56B 5G1KA 1JBRA 1GOVA 2HMKB 1X1UA 5M18A 2HMJB 3DGOA 3ECFA 4O8SA 5AEWB 5D81A 3ALAA 3EF8A 1B2XA 1TFKA 4FMAA 3DMCA 7GSPA 3EN8A 5LC6A 2XGNA 3WOFB 1A2KA 1PFPA 1MWUA 3GZXB 1JV2B 2WGOA 4EBGA 3CCS3 1Z1SA 2W0QA 2C10A 4WYKB 5AIIA 4K90B 1AV4A 2W9PA 3MYTA 2IUJA 1CYUA 1O7PB 4AKZA 1GSPA 3S28A 4L7KA 3M8CA 4FMCA 5IEPA 1BNRA 5IG3A 2FGTA 2IY2A 3HIGA 4HOHA 3WDGB 2CFDA 3OWYA 1IYYA 4FR9A 1B3SA 3NXJA 4QWTA 2JDIH 5DREA 3HI7A 2SARA 3NM7A 8RNTA 3LOYA 3UNLA 1G02A 1GMPA 1V57A 1MWSA 3V92A 3ER7A 1IQXA 1D6YA 3DGNA 3PZWA 2CX1A 1M9GA 4HZ9B 4WWUC 1E97A 1S723 3CC73 3FG1A 3BB9A 3HZPA 1LXEA 3WA3A 1W4NA 1I0XA 3KN4A 4H3UA 1OPYA 1X1YA 4X2OA 1Q40B 1RRLA 3T0UA 1K8A4 5CLKA 1EUIC 1NU3A 1N8QA 1SIHA 2INXA 3BNCA 2QIYA 3LTAA 4CCVA 2C4BA 5DRVA 1ZX2A 4LEHA 1VQL3 2BMOB 1TJDA 3JUPA 5G2GA 1AR0A 2OOVA 2CG0A 1FA3A 3AHSA 1RLSA 3LTDA 3WODG 1VQP3 4FCMA 4BTYA 5IENA 1Y4KA 1KC84 5GSPA 3ROBA 1ZO2A 2O9UX 2AAEA 2XRXB 3GSPA 1SARA 1I2EA 2UUGC 3MPHA 2W04A 4EC6A 6GSPA 2OQEC 3G8ZA 4K1UA 1TTOA 3PCSA 1DYUA 1RDSA 3BNDA 5KP4A 3GZYB 1JBSA 3PS8A 2CKFB 1RGEA 3CNXA 1RRHA 1E3RA 1O7WB 4R9LA 1CEWI 5D82A 2UGIA 2FNQA 1FYSA 4J8TA 1IK3A 2YFIB 2BNGA 1DVDA 3L0RA 3D3LA 1IVUA
chains in the Genus database with same CATH topology
1UGHI 2UGIA 1UGIA 1LQMB 1LQGC 2J8XB 2UUGC 1EUIC 4LYLB 1UUGB 2ZHXB 1UDII
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGH I;  2UGI A;  1UGI A;  1LQM B;  1LQG C;  2J8X B;  2UUG C;  1EUI C;  4LYL B;  1UUG B;  2ZHX B;  1UDI I; 
#chains in the Genus database with same CATH topology
 4BU4 A;  2XH9 A;  1U5O A;  3EHC A;  3FF0 A;  1DMQ A;  1YNV X;  4L8O A;  5IG4 A;  4IIA A;  4N6T A;  4AKY A;  1LNI A;  5AYR B;  1BVI A;  4LSO A;  3DGL A;  3MG2 A;  4LMI A;  1RHL A;  4BIR A;  1D6U A;  3QK9 A;  2P0X A;  1B2U A;  1UCJ A;  3FF2 A;  1CQS A;  2CX0 A;  2P09 A;  1OHO A;  2AAD A;  2RFR A;  4HM3 B;  3RDE A;  3S67 A;  3NV0 B;  3KII A;  3JVC A;  2RBI A;  4FCZ A;  4XDV A;  1J2B A;  3SVA A;  2KXG A;  3CD6 3;  1JN5 A;  4WP5 A;  1YIJ 3;  1FUT A;  3B8L A;  3PCR A;  1FGR A;  1RTU A;  4HAA A;  3EB8 A;  2KAA A;  4CJN A;  2KCD A;  1JKG A;  1ISK A;  2F5M A;  1LQM B;  1OGZ A;  1BSA A;  3CCR 3;  2W2C A;  1BIR A;  3BNB A;  5CXO A;  1O7M B;  1I70 A;  3KSP A;  3K5T A;  1PY3 A;  2C11 A;  3I56 3;  3SYU A;  3BNE A;  3AMO A;  1AVL A;  5AIG A;  3FLJ A;  3FG3 A;  3CCJ 3;  1IT8 A;  2IMJ A;  5ELU A;  1LOX A;  4HM0 B;  3N8B A;  2I9W A;  1VQO 3;  4XDW A;  1EQK A;  1SJW A;  2CFK A;  1VQ8 3;  1STD A;  1UGH I;  5AIF A;  3KCH A;  1UI8 A;  1RJO A;  2ML6 A;  1RGC A;  5BU4 A;  1BRJ A;  2B1X B;  5KP1 A;  1RNB A;  4MMZ B;  4G1M B;  1NB3 I;  3CPW 2;  1JKG B;  1R4Y A;  1UGI A;  6STD A;  1BNG A;  1B20 A;  2CFW A;  1OF5 A;  2E2V A;  3I55 3;  2WOF A;  3WMD A;  2OCT A;  2WO0 A;  1JNQ A;  1QMA A;  1LVN A;  2BIR A;  1ZS7 A;  3D5I A;  5LC7 A;  2QEX 3;  3LYG A;  1RN1 A;  1OCV A;  3G0K A;  3LTC A;  1WQL B;  2CH9 A;  1LQG C;  4EYC A;  2F99 A;  5IF6 A;  3CMA 3;  3SX1 A;  3WA2 X;  3CCM 3;  1C54 A;  2HMO B;  2K54 A;  3FCS B;  5IER A;  4U13 A;  1B2S A;  2WGQ A;  1GYB A;  4HZB B;  4RNZ A;  4N6V 0;  2P0M A;  4TX4 A;  1HZ1 A;  1IV7 A;  3BLZ A;  3DUK A;  1YGE A;  4HM5 B;  3LXU X;  4KFE A;  3BIR A;  3DH2 A;  1A90 A;  4MJD A;  4OUQ A;  1IT7 A;  1DET A;  4NRE A;  3IMA B;  1E3V A;  1Q81 4;  1T5Y A;  4NHF A;  4O02 B;  1RGF A;  3NBJ A;  2MF7 A;  3CME 3;  1B2M A;  1JB2 A;  1ROA A;  2D42 A;  2YFJ B;  2CC3 A;  2Y74 A;  2E2T A;  1RSN A;  3EJV A;  1GMQ A;  1K73 4;  1OAC A;  1NWW A;  4KFF A;  1YJ9 3;  1T3B A;  1TFO A;  3OX9 A;  4FMD A;  2ML5 A;  4OK0 A;  2HOH A;  5JPP A;  5JBS A;  1JZO A;  3X3Y A;  1WMO A;  1UI7 A;  1BOX A;  1TUH A;  2F4Y A;  3ZFZ A;  3KE7 A;  1MNL A;  4N6M A;  1FUW A;  3G6E 3;  4HVN A;  1RGG A;  2BHM A;  1BRS A;  3DGY A;  1N8R 4;  3CCL 3;  3CPO A;  1BAN A;  1M1X B;  2OQE A;  3JUN A;  1KSI A;  4BTX A;  1TIJ A;  3NHX A;  1KWI A;  1W6G A;  2STD A;  1JB5 A;  3MG1 A;  1CH0 A;  1VZZ A;  1OHP A;  5AYS C;  5CF2 A;  1DVC A;  3X42 A;  3F14 A;  2UX0 A;  1BGS A;  3CU3 A;  4RZM A;  1BUQ A;  2L4V A;  4BL3 A;  2H0H A;  2BT3 A;  3T8U A;  3U1W A;  2KF3 A;  1BU4 A;  1UUV B;  1X1W A;  2XR8 B;  3KKG A;  4KT3 B;  3IPT A;  1Q7Y 4;  3DXO A;  4OVM A;  2F86 B;  3WOE B;  3OWS A;  3NX0 A;  1GD3 A;  3JUM A;  2ZA4 A;  4RNT A;  2YX9 A;  1RGK A;  3URP A;  5M19 A;  1UUG B;  2XFT A;  4N6O B;  3OV4 A;  1UCL A;  2GEX A;  3D5G A;  4WHA A;  3GRD A;  4HKV B;  2W56 A;  4HYZ A;  1W00 A;  3A76 A;  2CFG A;  1KQS 2;  4JRF A;  1AVK A;  4GL6 A;  3SOY A;  2GXF A;  4MEI A;  1W7C A;  2F5W A;  2CG1 A;  4IPB A;  3UL5 A;  1D6Z A;  1I0V A;  1IDP A;  3CXC 2;  4H61 A;  1MGR A;  3GWR A;  3FKA A;  2CK3 H;  4LGQ A;  5IG5 A;  1FGT A;  2P38 A;  3VGN A;  2BO9 B;  2LYX A;  3B4P A;  3F8H A;  3RGR A;  1GMR A;  3EQQ B;  4LYL B;  1BNS A;  7RNT A;  2K0M A;  1FUS A;  5FGO A;  3F7X A;  1WTH A;  1FGQ A;  3CCQ 3;  3EX9 A;  2ZDJ A;  1GY5 A;  1RNT A;  1BSE A;  5AI1 A;  3V99 A;  4EV2 A;  1QAL A;  1OF5 B;  2HMM B;  3HK4 A;  6RNT A;  1Q9E A;  4CPK A;  3N54 B;  2JQ5 A;  1ULI B;  1BRI A;  1F8N A;  1UW1 A;  1BNE A;  4XBT A;  2MC8 A;  5CK6 A;  1BSD A;  3UL6 A;  1MWR A;  3VSY A;  1N5H A;  3LT9 A;  1QJG A;  4DKI A;  4EV5 A;  3Q90 A;  1JN5 B;  4J9A A;  3H3H A;  1BNJ A;  1RCL A;  3GAX A;  4HM6 B;  1Q42 A;  5KP3 A;  1QVF 2;  2Z7A A;  3CNM A;  1YGW A;  2GSP A;  3X41 A;  1VQ7 3;  4R1K A;  5IG0 A;  1DMN A;  2CIU A;  3T8N A;  2R41 A;  1EA2 A;  1W6C A;  1YIT 3;  1N9E A;  4CDL A;  4HJL B;  3FZW A;  3OWU A;  2PNC A;  4HM4 B;  2QGU A;  2BMR B;  1PYL A;  3AHW A;  2W6J H;  3D9R A;  1Q40 A;  2K3D A;  1TRQ A;  1MGW A;  1IU7 A;  1GOU A;  1I8V A;  3SED A;  4O2H A;  2OOV C;  2D1W A;  3NV0 A;  1BRG A;  7STD A;  4K1V A;  5M1A A;  3Q1C A;  3U97 A;  3CCV 3;  2RCD A;  3HOH A;  4KVH A;  1IV9 A;  3F40 A;  9RNT A;  5BXQ A;  1N5P A;  1IQY A;  1AY7 A;  3NBB A;  1QVG 2;  1IVX A;  2LQV A;  1EEJ A;  1OGX A;  2XGL A;  3A5E A;  4K61 A;  1YJW 3;  3Q3F A;  2CWT A;  2KRT A;  1EG9 B;  2PZV A;  4STD A;  3BU4 A;  3H51 A;  4O3V A;  4L8P A;  3NBR A;  5BIR A;  1HU9 A;  1KD1 4;  4J5K A;  1DMM A;  3FGY A;  1YHQ 3;  1C7H A;  1TRP A;  1A2P A;  5HGR A;  2IYJ A;  1LNH A;  5STD A;  3EBY A;  5FW5 A;  1K28 A;  3PYJ A;  4N6N B;  1FW7 A;  4BTW A;  2IA7 A;  2J8X B;  2BMQ B;  3G16 A;  3GZR A;  2M7O A;  1IQ8 A;  1W2B 2;  4IT7 A;  2H0I A;  3B7C A;  3CCU 3;  3S29 A;  1TP6 A;  1BRH A;  2Y73 A;  3DY5 A;  4GSP A;  1VQ5 3;  3RGA A;  3X40 A;  2Z77 A;  3K63 A;  4HBR A;  1Q82 4;  2RNT A;  1RKY A;  1RN4 A;  4KZ1 A;  3N9H A;  3EC9 A;  3KSE D;  1I3F A;  2L1S A;  1N9J A;  3GZB A;  4FMB A;  1T2H A;  4ORL A;  5AIH A;  2QA4 3;  2KF6 A;  3UB1 A;  3J7Y d;  2HMN B;  3I0Y A;  3D79 A;  1TU5 A;  2W03 A;  4EXR A;  3DM8 A;  3JUQ A;  4XB5 A;  1NNV A;  4RNY A;  5A0O B;  1I2G A;  1M90 4;  2OTL 3;  4N6L A;  5AEU B;  5D83 A;  2ZL8 A;  1I3I A;  3V98 A;  2Z76 A;  4R80 A;  3O8Y A;  5RNT A;  1QAK A;  3G71 3;  1YI2 3;  1OUN A;  4RBN A;  1NDO B;  4HM2 B;  4LZI A;  2W9Q A;  3WHO A;  4ZM8 A;  1EKM A;  3ZG0 A;  5HOH A;  1RGL A;  8CHO A;  1S5A A;  1W6Y A;  1G96 A;  3AGO A;  3X3Z A;  1FGO A;  1T2I A;  1O7G B;  1UCK A;  3F9S A;  3KFQ C;  2YFL B;  1K9M 4;  3UJM A;  1VQK 3;  4ILF A;  1L5G B;  3TDG A;  5EEO A;  1GD4 A;  4XBX A;  4PEJ A;  2GU3 A;  1PU4 A;  1YVS A;  1YJN 3;  3LT8 A;  1VQN 3;  2OWP A;  4BL2 A;  1A67 A;  2F98 A;  1BSC A;  1B2Z A;  4N3V A;  4FCJ A;  1JB4 A;  1NO3 A;  1RCK A;  1ZGX A;  1BNF A;  1UDI I;  1AQZ A;  3CC4 3;  2WOH A;  1K41 A;  2RSX A;  1RN7 A;  3OW2 2;  3LML A;  3K0Z A;  1SPU A;  1W01 A;  1M1K 4;  2CW9 A;  4I4K A;  3MKI A;  3FH1 A;  5EQL A;  3SXX A;  2F56 A;  1VQ9 3;  3NM2 A;  1RGA A;  1O7N B;  3K7C A;  1BRK A;  3MWZ A;  1GS3 A;  3NQY A;  1ROV A;  3RNT A;  1JZD A;  2ZHX B;  1DE3 A;  3EBT A;  1G0T A;  2O3O A;  1O7H B;  2SBL A;  3FSD A;  1IVV A;  1GY7 A;  3S5C A;  1VQQ A;  2V1L A;  4MMX B;  1STF I;  1RGH A;  2B24 B;  2Q07 A;  3QRD A;  1MOL A;  3NQZ A;  1X1X A;  4N6U A;  1LOV A;  3MHE A;  5CF1 A;  1LRA A;  2GBX B;  2KF5 A;  3D4A A;  1ULJ B;  3DZL A;  3F8X A;  3OXA A;  3VF1 A;  4MMY B;  1HKX A;  1BUJ A;  1WNH A;  2FXT A;  3SLU A;  4R9K A;  1SII A;  1WMP A;  1JRQ A;  2XSH B;  4Q53 A;  3MSO A;  4JF8 A;  3G4S 3;  1GY6 A;  1NJI 4;  2GU1 A;  1I2F A;  1B21 A;  1VQ4 3;  2E2U A;  1JBT A;  4R4K A;  5TGN A;  2KF4 A;  3IJE B;  1W5Z A;  2XFS A;  5JPU A;  1NB5 I;  2XSO B;  1VQ6 3;  2P05 A;  3AMO B;  3FG4 A;  1YVB I;  4NPB A;  4HM1 B;  5ELJ A;  1JJ2 2;  4EW5 A;  1RMS A;  3JUO A;  1BNI A;  4HM8 B;  1CYV A;  1U8C B;  1W2Z A;  2CWV A;  3F7S A;  2CFL A;  2GEY A;  4GB5 A;  3ZG5 A;  5IW9 A;  3LH4 A;  3Q2P A;  2IUK A;  3PGB A;  2A15 A;  1UCI A;  1US1 A;  3B4O A;  2RGQ A;  3WR2 A;  1WMN A;  3X3X A;  2BU4 A;  2CHC A;  5BVB A;  4XBY A;  3PXM A;  1BRN L;  3HII A;  4WFO A;  3STD A;  3DGM A;  3HX8 A;  3LTB A;  4X2H A;  4WYK A;  3KZT A;  1W02 A;  3EE1 A;  2H0G A;  1UUW B;  3E99 A;  5G1L A;  1Q86 4;  1BAO A;  1FZU A;  1Q7H A;  4GHO A;  3EN1 B;  1R4C A;  4AEQ A;  3AGN A;  1VQM 3;  1A2V A;  1QAF A;  2XEP A;  3CC2 3;  1B27 A;  1BSB A;  1FGM A;  2HML B;  1V74 A;  2CWU A;  2GBW B;  3LZA A;  4J5G A;  1LOY A;  1OHS A;  4HM7 B;  5IEO A;  4KFD A;  4XM4 A;  1ASK A;  3S27 A;  3SOA A;  3CCE 3;  3MG3 A;  1HYF A;  1LOW A;  1IVW A;  1V58 A;  2R4I A;  4I5Q A;  2Z6B A;  2OTJ 3;  2XF3 A;  3NUV A;  5I97 A;  5EVH A;  1GOY A;  3K9M C;  1SQW A;  1MWT A;  1OH0 A;  2W56 B;  5G1K A;  1JBR A;  1GOV A;  2HMK B;  1X1U A;  5M18 A;  2HMJ B;  3DGO A;  3ECF A;  4O8S A;  5AEW B;  5D81 A;  3ALA A;  3EF8 A;  1B2X A;  1TFK A;  4FMA A;  3DMC A;  7GSP A;  3EN8 A;  5LC6 A;  2XGN A;  3WOF B;  1A2K A;  1PFP A;  1MWU A;  3GZX B;  1JV2 B;  2WGO A;  4EBG A;  3CCS 3;  1Z1S A;  2W0Q A;  2C10 A;  4WYK B;  5AII A;  4K90 B;  1AV4 A;  2W9P A;  3MYT A;  2IUJ A;  1CYU A;  1O7P B;  4AKZ A;  1GSP A;  3S28 A;  4L7K A;  3M8C A;  4FMC A;  5IEP A;  1BNR A;  5IG3 A;  2FGT A;  2IY2 A;  3HIG A;  4HOH A;  3WDG B;  2CFD A;  3OWY A;  1IYY A;  4FR9 A;  1B3S A;  3NXJ A;  4QWT A;  2JDI H;  5DRE A;  3HI7 A;  2SAR A;  3NM7 A;  8RNT A;  3LOY A;  3UNL A;  1G02 A;  1GMP A;  1V57 A;  1MWS A;  3V92 A;  3ER7 A;  1IQX A;  1D6Y A;  3DGN A;  3PZW A;  2CX1 A;  1M9G A;  4HZ9 B;  4WWU C;  1E97 A;  1S72 3;  3CC7 3;  3FG1 A;  3BB9 A;  3HZP A;  1LXE A;  3WA3 A;  1W4N A;  1I0X A;  3KN4 A;  4H3U A;  1OPY A;  1X1Y A;  4X2O A;  1Q40 B;  1RRL A;  3T0U A;  1K8A 4;  5CLK A;  1EUI C;  1NU3 A;  1N8Q A;  1SIH A;  2INX A;  3BNC A;  2QIY A;  3LTA A;  4CCV A;  2C4B A;  5DRV A;  1ZX2 A;  4LEH A;  1VQL 3;  2BMO B;  1TJD A;  3JUP A;  5G2G A;  1AR0 A;  2OOV A;  2CG0 A;  1FA3 A;  3AHS A;  1RLS A;  3LTD A;  3WOD G;  1VQP 3;  4FCM A;  4BTY A;  5IEN A;  1Y4K A;  1KC8 4;  5GSP A;  3ROB A;  1ZO2 A;  2O9U X;  2AAE A;  2XRX B;  3GSP A;  1SAR A;  1I2E A;  2UUG C;  3MPH A;  2W04 A;  4EC6 A;  6GSP A;  2OQE C;  3G8Z A;  4K1U A;  1TTO A;  3PCS A;  1DYU A;  1RDS A;  3BND A;  5KP4 A;  3GZY B;  1JBS A;  3PS8 A;  2CKF B;  1RGE A;  3CNX A;  1RRH A;  1E3R A;  1O7W B;  4R9L A;  1CEW I;  5D82 A;  2UGI A;  2FNQ A;  1FYS A;  4J8T A;  1IK3 A;  2YFI B;  2BNG A;  1DVD A;  3L0R A;  3D3L A;  1IVU A; 
#chains in the Genus database with same CATH homology
 1UGH I;  2UGI A;  1UGI A;  1LQM B;  1LQG C;  2J8X B;  2UUG C;  1EUI C;  4LYL B;  1UUG B;  2ZHX B;  1UDI I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...