1UDII

Nucleotide mimicry in the crystal structure of the uracil-dna glycosylase-uracil glycosylase inhibitor protein complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
83
structure length
83
Chain Sequence
TNLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nucleotide mimicry in the crystal structure of the uracil-DNA glycosylase-uracil glycosylase inhibitor protein complex.
pubmed doi rcsb
molecule tags Hydrolase/inhibitor
molecule keywords URACIL-DNA GLYCOSYLASE
total genus 15
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 1995-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 1udiI00
1LQGC 1UUGB 1UDII 1LQMB 2ZHXB 1EUIC 1UGHI 2J8XB 2UUGC 1UGIA 4LYLB 2UGIA
chains in the Genus database with same CATH superfamily
3DY5A 1JB5A 4N6V0 1N8R4 2E2UA 1OCVA 3V92A 3AGNA 3CD63 3ZFZA 5DREA 1JN5B 2FNQA 1RCKA 2GU3A 3GZXB 4HM5B 5EQLA 2C11A 4FMDA 1S723 4FR9A 1V74A 3STDA 1YHQ3 1A67A 2CFKA 1RTUA 1MGRA 4G1MB 1G96A 4XBXA 2P05A 5JPPA 1MNLA 4MMXB 1EUIC 3LMLA 1TJDA 5HOHA 1IVXA 1RHLA 1W2ZA 2XFSA 1SIIA 1VQ63 1I2FA 1RN1A 1RGAA 2B24B 5IEOA 1ASKA 1BU4A 1BNIA 1Q42A 3CCM3 4GL6A 1FGTA 2K3DA 3FZWA 1JKGA 1OHPA 2E2VA 2Z76A 3AGOA 5CK6A 1RNTA 1W00A 1GOYA 3BIRA 4NREA 1GMRA 1KD14 1Z1SA 3GZYB 3SVAA 1GMQA 2IMJA 2PNCA 1VQL3 3D79A 2UX0A 4R9KA 5CXOA 1RKYA 1VQ93 2RFRA 4FCMA 3FF2A 4PEJA 1NWWA 1LNHA 5EEOA 2CX1A 3FG4A 3E99A 3DXOA 1BSAA 1BNJA 1M1XB 3CC43 1R4CA 1NJI4 3N8BA 3GSPA 2P38A 4LEHA 1BRKA 1VQ73 1IV7A 3CNXA 1ZGXA 3EBTA 3S29A 1K8A4 1CYVA 4X2HA 4EV2A 3FGYA 3L0RA 1RLSA 1ISKA 3SOYA 3EE1A 1T2IA 3EJVA 1GMPA 2BMQB 3FKAA 1Q814 1Q7Y4 2XSHB 4LYLB 2OQEA 3NM7A 1SPUA 1W02A 2WGOA 1FGRA 1RGCA 1RSNA 3FLJA 5D82A 2H0IA 3KSPA 1RCLA 3KFQC 3RNTA 4N6MA 2UGIA 5D83A 1A90A 3DGLA 1BRHA 3HX8A 1SQWA 1STFI 3DMCA 1RGFA 3DGOA 3JUOA 3PS8A 1HKXA 4BIRA 1JB2A 3EX9A 4KFDA 1QMAA 1UCKA 4RZMA 3FH1A 1YJ93 1BNSA 1T5YA 3A76A 3FG3A 1K9M4 1US1A 1GD3A 5JPUA 3X42A 4JRFA 3DZLA 4H61A 5KP3A 3LOYA 3G713 1IQXA 3N9HA 2W9PA 2HMKB 4L7KA 4R1KA 1IT8A 4HAAA 4CCVA 1FUTA 9RNTA 4O02B 2HMNB 1AQZA 2W9QA 3NBRA 2OCTA 3LH4A 3MPHA 4U13A 3EBYA 3CC73 1BUQA 1DETA 2E2TA 4AEQA 2HMJB 5IG4A 1NB3I 1TRPA 3KN4A 2D1WA 4KZ1A 1UUVB 1IQYA 1OH0A 2OWPA 2XGLA 4XBYA 3S5CA 5AYRB 6STDA 1I2EA 5TGNA 1B20A 2AADA 3ROBA 1A2KA 1SARA 5CF2A 1WMPA 3OX9A 3J7Yd 2V1LA 1B2MA 3ALAA 2KF4A 3F8HA 4ORLA 1IDPA 5BVBA 3DGYA 1LQMB 1BRJA 1RRLA 2YFLB 5G1LA 4EYCA 2BU4A 2XRXB 3F8XA 1RGLA 4HM6B 2UUGC 5KP4A 2QGUA 3KE7A 4K61A 4Q53A 3X3ZA 3LXUX 3LTBA 1ROVA 2F86B 3F14A 1O7GB 1RRHA 2IA7A 4HZBB 1AV4A 1E3RA 4K1UA 1FZUA 1I2GA 3NUVA 4HM8B 5M18A 1EG9B 2BNGA 2CWVA 1DMMA 2F98A 3PYJA 1N5PA 1R4YA 4N3VA 1KWIA 3QRDA 1OGZA 1BOXA 3DM8A 4HM0B 2MF7A 4N6NB 4NHFA 3F7SA 1GOVA 5IERA 1K41A 3CCE3 3HIGA 1EA2A 1HZ1A 2KF5A 1TTOA 2XEPA 2RGQA 1U8CB 3FG1A 1GS3A 1GD4A 5G2GA 1LOVA 3NV0A 2Z6BA 1JN5A 3UNLA 1MWTA 1FGQA 3D3LA 4GB5A 4EV5A 4QWTA 4EC6A 1HYFA 1X1YA 3K7CA 3JUPA 3WDGB 4ZM8A 2OTL3 1B21A 4LMIA 3Q1CA 2RBIA 1KSIA 3CCL3 1B2SA 1L5GB 3CNMA 3KIIA 4EW5A 4BL3A 1TUHA 2Q07A 3HZPA 4O8SA 1YJW3 1AY7A 2STDA 2GBXB 1NNVA 1WMNA 5BU4A 1B2ZA 3UJMA 3KSED 1IT7A 1I8VA 4FMCA 3WA3A 1JKGB 3MKIA 4LGQA 1IQ8A 1GY7A 3HK4A 4BTWA 1TIJA 4MJDA 1IVUA 1O7HB 4OUQA 4XBTA 1MWRA 1EKMA 1E3VA 1EEJA 3U1WA 3OWYA 5LC6A 1QVG2 4HVNA 8RNTA 4GHOA 4WP5A 4O2HA 1PYLA 4HJLB 1YI23 1UUWB 1DVCA 1RNBA 3DUKA 1YGEA 1ROAA 4KFFA 3X41A 1YIT3 1VQQA 2GXFA 1MGWA 1GY5A 2HOHA 3DGMA 1T2HA 2FXTA 2C10A 3M8CA 3WODG 3KZTA 1D6ZA 5ELUA 1F8NA 6RNTA 1B27A 3CCQ3 1C54A 2QIYA 4RNYA 2SARA 4XDWA 4K90B 1W6YA 1TRQA 3OWUA 1YJN3 2CFWA 1OHSA 1RMSA 3T0UA 1W5ZA 1AR0A 1BIRA 1BRSA 1ZS7A 4N6LA 3D5GA 2A15A 2R41A 3JUMA 2CIUA 1W4NA 2H0HA 4HM7B 1S5AA 1UI7A 3MG2A 3MHEA 1VQN3 1AVLA 2INXA 4TX4A 5JBSA 1DYUA 3SXXA 2IYJA 2W04A 1STDA 3S27A 2JDIH 4R9LA 2WOFA 3FF0A 4RBNA 1LOXA 3BNEA 3F7XA 4HBRA 4XB5A 5STDA 1DE3A 1K28A 4LZIA 1NDOB 1W6CA 3D4AA 1B2XA 1BANA 1B2UA 1RJOA 2P0XA 2JQ5A 5EVHA 3X40A 3NX0A 3UL6A 1YNVX 1BNFA 3N54B 1RGHA 2M7OA 5AIHA 1TU5A 1Q824 1JBTA 1IYYA 2W6JH 2Y74A 4EXRA 2BMOB 5ELJA 1CH0A 1UDII 3SYUA 4WHAA 3NQYA 3AHSA 2BT3A 3PCSA 4WYKB 2QEX3 2KF6A 3K63A 4IT7A 1IK3A 1UGIA 1LNIA 3LT9A 1A2VA 2W03A 1LOYA 2ML6A 1V58A 3FSDA 3LT8A 4FMAA 3S67A 3I563 2BIRA 2XSOB 1LRAA 3CCJ3 1QAKA 3KKGA 5AIGA 1LVNA 3IJEB 3CME3 1FGMA 2AAEA 1LOWA 1BSDA 3LZAA 2BMRB 3CCS3 3CCR3 1CEWI 7RNTA 1VQ43 3EC9A 4DKIA 1I3FA 1CQSA 2F5MA 2Z77A 3H3HA 1OPYA 2XH9A 3WR2A 3GZRA 3K9MC 3OXAA 2CH9A 3AHWA 1M1K4 1FYSA 1UUGB 1OUNA 1UGHI 2L1SA 1BUJA 3Q90A 3MYTA 3EB8A 4J5GA 1BNGA 1OF5A 2WO0A 4ILFA 5FGOA 3OW22 2K0MA 3B4OA 2CG0A 3NHXA 3MWZA 2IY2A 1I0VA 1CYUA 2C4BA 1TFOA 2K54A 3TDGA 1YGWA 2ZDJA 3BLZA 2IUJA 3HOHA 1OACA 4RNTA 5CF1A 1JJ22 2F5WA 1B3SA 4HOHA 4X2OA 5D81A 1FGOA 1LXEA 3LTDA 4HZ9B 1RGGA 3HI7A 4CPKA 5AEUB 3CXC2 4R4KA 4I4KA 3JVCA 4H3UA 1BSBA 2Y73A 2ZA4A 3CC23 1ULJB 1WNHA 3QK9A 1BAOA 2L4VA 3I553 3D5IA 4KFEA 1I3IA 3AMOB 1G02A 3NQZA 3S28A 3LTAA 1JRQA 1JB4A 2H0GA 1LQGC 2CX0A 1VQ53 1WTHA 5AIIA 2CFGA 1X1XA 4CJNA 2OOVC 2HMOB 3OWSA 1MOLA 3PXMA 4WYKA 1UI8A 3OV4A 1RGKA 1Y4KA 1U5OA 1ULIB 2HMMB 4J8TA 1OGXA 1YVBI 1JV2B 1O7NB 1QJGA 2PZVA 2CKFB 3HIIA 2MC8A 3WOFB 5AIFA 1SIHA 1N5HA 5KP1A 5AEWB 5IG3A 2GEYA 3A5EA 4BTXA 2CC3A 3RDEA 3G0KA 2OQEC 2HMLB 5M1AA 1M9GA 1V57A 1X1WA 3X3YA 2XF3A 3CMA3 1Q9EA 5I97A 4JF8A 3NBJA 1K734 1ZX2A 1TP6A 2CFLA 3PZWA 6GSPA 1NO3A 2LYXA 2GBWB 3G4S3 1RDSA 3EN1B 3EQQB 3CCU3 1X1UA 3G8ZA 2YFIB 3Q3FA 1W01A 3FCSB 4FMBA 1W6GA 3JUQA 3NBBA 3I0YA 1FA3A 1GY6A 4STDA 2RCDA 4MMZB 4HM2B 3G16A 1FUWA 4MEIA 3T8NA 3MSOA 3MG3A 5DRVA 1OF5B 1BSCA 3URPA 3K5TA 1BNRA 2KCDA 2WOHA 2RNTA 1A2PA 4OK0A 1BRGA 3GRDA 1YVSA 5IENA 3CPOA 4IPBA 5FW5A 1IVVA 1BGSA 1OHOA 2J8XB 2O3OA 4L8OA 4BL2A 2XR8B 3T8UA 2R4IA 1Q40B 4I5QA 1JBRA 1EQKA 3ZG0A 1AVKA 3VSYA 4WWUC 4AKZA 1PFPA 3U97A 1YIJ3 1BRIA 4N6OB 1UCLA 2CK3H 1HU9A 3PCRA 1Q40A 1GSPA 4HYZA 2I9WA 1KQS2 1WQLB 1SJWA 1W7CA 1QALA 7GSPA 4FCZA 2LQVA 1D6YA 2GSPA 4L8PA 4WFOA 3SX1A 3ZG5A 2SBLA 1O7WB 1QAFA 1RGEA 2YX9A 2CW9A 2ZHXB 3AMOA 3B8LA 4XDVA 5HGRA 3G6E3 1WMOA 1GYBA 1MWSA 1MWUA 1I70A 3DGNA 2ZL8A 2KAAA 4J9AA 3PGBA 4KT3B 3GAXA 4O3VA 3VGNA 3F9SA 3WOEB 3NV0B 5IEPA 2GEXA 3F40A 2FGTA 2BHMA 2CFDA 1PY3A 3GZBA 1VZZA 2GU1A 2KXGA 2XFTA 1DVDA 2IUKA 3D9RA 3WMDA 2CG1A 3WHOA 5IF6A 1TFKA 5GSPA 1JZDA 4GSPA 2W2CA 1E97A 1IV9A 3B7CA 4N6TA 4BU4A 2QA43 1D6UA 1PU4A 5A0OB 3O8YA 5IW9A 3LTCA 3H51A 5RNTA 3WA2X 2WGQA 3B4PA 3BNBA 3ECFA 1UCJA 2F99A 3X3XA 1UCIA 3BB9A 4IIAA 1N8QA 1N9EA 1O7MB 1I0XA 5BIRA 1BSEA 5CLKA 3JUNA 3V98A 4HM4B 3RGAA 1VQ83 4MMYB 1JNQA 4K1VA 3UB1A 2OTJ3 2O9UX 3SOAA 2D42A 5AYSC 4AKYA 3UL5A 2KRTA 4HKVB 1NU3A 1RN4A 2W0QA 3NM2A 4RNZA 5AI1A 3V99A 5BXQA 1G0TA 3EHCA 1JZOA 3CPW2 1NB5I 3IPTA 1N9JA 1W2B2 3LYGA 2BO9B 3GWRA 3BNCA 1BNEA 4OVMA 4HM3B 4XM4A 2F4YA 4EBGA 2Z7AA 8CHOA 3IMAB 2YFJB 2OOVA 1VQP3 1BRNL 2W56B 4R80A 1JBSA 1VQK3 3SEDA 2P09A 4NPBA 2B1XB 2CWUA 3NXJA 2RSXA 5M19A 1Q864 4FCJA 1BVIA 1J2BA 3DH2A 1IVWA 1GOUA 2P0MA 4CDLA 2W56A 1T3BA 4N6UA 3EF8A 3SLUA 5IG0A 1IU7A 3CCV3 1VQO3 5IG5A 3BU4A 1DMQA 1Q7HA 2KF3A 4LSOA 3CU3A 1VQM3 1RN7A 3K0ZA 3EN8A 1UW1A 1M904 3BNDA 5G1KA 1FW7A 4HM1B 3ER7A 4J5KA 3Q2PA 2CHCA 2F56A 7STDA 4KVHA 1O7PB 3RGRA 1DMNA 4BTYA 1QVF2 1KC84 2XGNA 3MG1A 2CWTA 2ML5A 1ZO2A 3VF1A 5LC7A 3KCHA 1C7HA 1FUSA
chains in the Genus database with same CATH topology
1LQGC 1UUGB 1UDII 1LQMB 2ZHXB 1EUIC 1UGHI 2J8XB 2UUGC 1UGIA 4LYLB 2UGIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LQG C;  1UUG B;  1UDI I;  1LQM B;  2ZHX B;  1EUI C;  1UGH I;  2J8X B;  2UUG C;  1UGI A;  4LYL B;  2UGI A; 
#chains in the Genus database with same CATH topology
 3DY5 A;  1JB5 A;  4N6V 0;  1N8R 4;  2E2U A;  1OCV A;  3V92 A;  3AGN A;  3CD6 3;  3ZFZ A;  5DRE A;  1JN5 B;  2FNQ A;  1RCK A;  2GU3 A;  3GZX B;  4HM5 B;  5EQL A;  2C11 A;  4FMD A;  1S72 3;  4FR9 A;  1V74 A;  3STD A;  1YHQ 3;  1A67 A;  2CFK A;  1RTU A;  1MGR A;  4G1M B;  1G96 A;  4XBX A;  2P05 A;  5JPP A;  1MNL A;  4MMX B;  1EUI C;  3LML A;  1TJD A;  5HOH A;  1IVX A;  1RHL A;  1W2Z A;  2XFS A;  1SII A;  1VQ6 3;  1I2F A;  1RN1 A;  1RGA A;  2B24 B;  5IEO A;  1ASK A;  1BU4 A;  1BNI A;  1Q42 A;  3CCM 3;  4GL6 A;  1FGT A;  2K3D A;  3FZW A;  1JKG A;  1OHP A;  2E2V A;  2Z76 A;  3AGO A;  5CK6 A;  1RNT A;  1W00 A;  1GOY A;  3BIR A;  4NRE A;  1GMR A;  1KD1 4;  1Z1S A;  3GZY B;  3SVA A;  1GMQ A;  2IMJ A;  2PNC A;  1VQL 3;  3D79 A;  2UX0 A;  4R9K A;  5CXO A;  1RKY A;  1VQ9 3;  2RFR A;  4FCM A;  3FF2 A;  4PEJ A;  1NWW A;  1LNH A;  5EEO A;  2CX1 A;  3FG4 A;  3E99 A;  3DXO A;  1BSA A;  1BNJ A;  1M1X B;  3CC4 3;  1R4C A;  1NJI 4;  3N8B A;  3GSP A;  2P38 A;  4LEH A;  1BRK A;  1VQ7 3;  1IV7 A;  3CNX A;  1ZGX A;  3EBT A;  3S29 A;  1K8A 4;  1CYV A;  4X2H A;  4EV2 A;  3FGY A;  3L0R A;  1RLS A;  1ISK A;  3SOY A;  3EE1 A;  1T2I A;  3EJV A;  1GMP A;  2BMQ B;  3FKA A;  1Q81 4;  1Q7Y 4;  2XSH B;  4LYL B;  2OQE A;  3NM7 A;  1SPU A;  1W02 A;  2WGO A;  1FGR A;  1RGC A;  1RSN A;  3FLJ A;  5D82 A;  2H0I A;  3KSP A;  1RCL A;  3KFQ C;  3RNT A;  4N6M A;  2UGI A;  5D83 A;  1A90 A;  3DGL A;  1BRH A;  3HX8 A;  1SQW A;  1STF I;  3DMC A;  1RGF A;  3DGO A;  3JUO A;  3PS8 A;  1HKX A;  4BIR A;  1JB2 A;  3EX9 A;  4KFD A;  1QMA A;  1UCK A;  4RZM A;  3FH1 A;  1YJ9 3;  1BNS A;  1T5Y A;  3A76 A;  3FG3 A;  1K9M 4;  1US1 A;  1GD3 A;  5JPU A;  3X42 A;  4JRF A;  3DZL A;  4H61 A;  5KP3 A;  3LOY A;  3G71 3;  1IQX A;  3N9H A;  2W9P A;  2HMK B;  4L7K A;  4R1K A;  1IT8 A;  4HAA A;  4CCV A;  1FUT A;  9RNT A;  4O02 B;  2HMN B;  1AQZ A;  2W9Q A;  3NBR A;  2OCT A;  3LH4 A;  3MPH A;  4U13 A;  3EBY A;  3CC7 3;  1BUQ A;  1DET A;  2E2T A;  4AEQ A;  2HMJ B;  5IG4 A;  1NB3 I;  1TRP A;  3KN4 A;  2D1W A;  4KZ1 A;  1UUV B;  1IQY A;  1OH0 A;  2OWP A;  2XGL A;  4XBY A;  3S5C A;  5AYR B;  6STD A;  1I2E A;  5TGN A;  1B20 A;  2AAD A;  3ROB A;  1A2K A;  1SAR A;  5CF2 A;  1WMP A;  3OX9 A;  3J7Y d;  2V1L A;  1B2M A;  3ALA A;  2KF4 A;  3F8H A;  4ORL A;  1IDP A;  5BVB A;  3DGY A;  1LQM B;  1BRJ A;  1RRL A;  2YFL B;  5G1L A;  4EYC A;  2BU4 A;  2XRX B;  3F8X A;  1RGL A;  4HM6 B;  2UUG C;  5KP4 A;  2QGU A;  3KE7 A;  4K61 A;  4Q53 A;  3X3Z A;  3LXU X;  3LTB A;  1ROV A;  2F86 B;  3F14 A;  1O7G B;  1RRH A;  2IA7 A;  4HZB B;  1AV4 A;  1E3R A;  4K1U A;  1FZU A;  1I2G A;  3NUV A;  4HM8 B;  5M18 A;  1EG9 B;  2BNG A;  2CWV A;  1DMM A;  2F98 A;  3PYJ A;  1N5P A;  1R4Y A;  4N3V A;  1KWI A;  3QRD A;  1OGZ A;  1BOX A;  3DM8 A;  4HM0 B;  2MF7 A;  4N6N B;  4NHF A;  3F7S A;  1GOV A;  5IER A;  1K41 A;  3CCE 3;  3HIG A;  1EA2 A;  1HZ1 A;  2KF5 A;  1TTO A;  2XEP A;  2RGQ A;  1U8C B;  3FG1 A;  1GS3 A;  1GD4 A;  5G2G A;  1LOV A;  3NV0 A;  2Z6B A;  1JN5 A;  3UNL A;  1MWT A;  1FGQ A;  3D3L A;  4GB5 A;  4EV5 A;  4QWT A;  4EC6 A;  1HYF A;  1X1Y A;  3K7C A;  3JUP A;  3WDG B;  4ZM8 A;  2OTL 3;  1B21 A;  4LMI A;  3Q1C A;  2RBI A;  1KSI A;  3CCL 3;  1B2S A;  1L5G B;  3CNM A;  3KII A;  4EW5 A;  4BL3 A;  1TUH A;  2Q07 A;  3HZP A;  4O8S A;  1YJW 3;  1AY7 A;  2STD A;  2GBX B;  1NNV A;  1WMN A;  5BU4 A;  1B2Z A;  3UJM A;  3KSE D;  1IT7 A;  1I8V A;  4FMC A;  3WA3 A;  1JKG B;  3MKI A;  4LGQ A;  1IQ8 A;  1GY7 A;  3HK4 A;  4BTW A;  1TIJ A;  4MJD A;  1IVU A;  1O7H B;  4OUQ A;  4XBT A;  1MWR A;  1EKM A;  1E3V A;  1EEJ A;  3U1W A;  3OWY A;  5LC6 A;  1QVG 2;  4HVN A;  8RNT A;  4GHO A;  4WP5 A;  4O2H A;  1PYL A;  4HJL B;  1YI2 3;  1UUW B;  1DVC A;  1RNB A;  3DUK A;  1YGE A;  1ROA A;  4KFF A;  3X41 A;  1YIT 3;  1VQQ A;  2GXF A;  1MGW A;  1GY5 A;  2HOH A;  3DGM A;  1T2H A;  2FXT A;  2C10 A;  3M8C A;  3WOD G;  3KZT A;  1D6Z A;  5ELU A;  1F8N A;  6RNT A;  1B27 A;  3CCQ 3;  1C54 A;  2QIY A;  4RNY A;  2SAR A;  4XDW A;  4K90 B;  1W6Y A;  1TRQ A;  3OWU A;  1YJN 3;  2CFW A;  1OHS A;  1RMS A;  3T0U A;  1W5Z A;  1AR0 A;  1BIR A;  1BRS A;  1ZS7 A;  4N6L A;  3D5G A;  2A15 A;  2R41 A;  3JUM A;  2CIU A;  1W4N A;  2H0H A;  4HM7 B;  1S5A A;  1UI7 A;  3MG2 A;  3MHE A;  1VQN 3;  1AVL A;  2INX A;  4TX4 A;  5JBS A;  1DYU A;  3SXX A;  2IYJ A;  2W04 A;  1STD A;  3S27 A;  2JDI H;  4R9L A;  2WOF A;  3FF0 A;  4RBN A;  1LOX A;  3BNE A;  3F7X A;  4HBR A;  4XB5 A;  5STD A;  1DE3 A;  1K28 A;  4LZI A;  1NDO B;  1W6C A;  3D4A A;  1B2X A;  1BAN A;  1B2U A;  1RJO A;  2P0X A;  2JQ5 A;  5EVH A;  3X40 A;  3NX0 A;  3UL6 A;  1YNV X;  1BNF A;  3N54 B;  1RGH A;  2M7O A;  5AIH A;  1TU5 A;  1Q82 4;  1JBT A;  1IYY A;  2W6J H;  2Y74 A;  4EXR A;  2BMO B;  5ELJ A;  1CH0 A;  1UDI I;  3SYU A;  4WHA A;  3NQY A;  3AHS A;  2BT3 A;  3PCS A;  4WYK B;  2QEX 3;  2KF6 A;  3K63 A;  4IT7 A;  1IK3 A;  1UGI A;  1LNI A;  3LT9 A;  1A2V A;  2W03 A;  1LOY A;  2ML6 A;  1V58 A;  3FSD A;  3LT8 A;  4FMA A;  3S67 A;  3I56 3;  2BIR A;  2XSO B;  1LRA A;  3CCJ 3;  1QAK A;  3KKG A;  5AIG A;  1LVN A;  3IJE B;  3CME 3;  1FGM A;  2AAE A;  1LOW A;  1BSD A;  3LZA A;  2BMR B;  3CCS 3;  3CCR 3;  1CEW I;  7RNT A;  1VQ4 3;  3EC9 A;  4DKI A;  1I3F A;  1CQS A;  2F5M A;  2Z77 A;  3H3H A;  1OPY A;  2XH9 A;  3WR2 A;  3GZR A;  3K9M C;  3OXA A;  2CH9 A;  3AHW A;  1M1K 4;  1FYS A;  1UUG B;  1OUN A;  1UGH I;  2L1S A;  1BUJ A;  3Q90 A;  3MYT A;  3EB8 A;  4J5G A;  1BNG A;  1OF5 A;  2WO0 A;  4ILF A;  5FGO A;  3OW2 2;  2K0M A;  3B4O A;  2CG0 A;  3NHX A;  3MWZ A;  2IY2 A;  1I0V A;  1CYU A;  2C4B A;  1TFO A;  2K54 A;  3TDG A;  1YGW A;  2ZDJ A;  3BLZ A;  2IUJ A;  3HOH A;  1OAC A;  4RNT A;  5CF1 A;  1JJ2 2;  2F5W A;  1B3S A;  4HOH A;  4X2O A;  5D81 A;  1FGO A;  1LXE A;  3LTD A;  4HZ9 B;  1RGG A;  3HI7 A;  4CPK A;  5AEU B;  3CXC 2;  4R4K A;  4I4K A;  3JVC A;  4H3U A;  1BSB A;  2Y73 A;  2ZA4 A;  3CC2 3;  1ULJ B;  1WNH A;  3QK9 A;  1BAO A;  2L4V A;  3I55 3;  3D5I A;  4KFE A;  1I3I A;  3AMO B;  1G02 A;  3NQZ A;  3S28 A;  3LTA A;  1JRQ A;  1JB4 A;  2H0G A;  1LQG C;  2CX0 A;  1VQ5 3;  1WTH A;  5AII A;  2CFG A;  1X1X A;  4CJN A;  2OOV C;  2HMO B;  3OWS A;  1MOL A;  3PXM A;  4WYK A;  1UI8 A;  3OV4 A;  1RGK A;  1Y4K A;  1U5O A;  1ULI B;  2HMM B;  4J8T A;  1OGX A;  1YVB I;  1JV2 B;  1O7N B;  1QJG A;  2PZV A;  2CKF B;  3HII A;  2MC8 A;  3WOF B;  5AIF A;  1SIH A;  1N5H A;  5KP1 A;  5AEW B;  5IG3 A;  2GEY A;  3A5E A;  4BTX A;  2CC3 A;  3RDE A;  3G0K A;  2OQE C;  2HML B;  5M1A A;  1M9G A;  1V57 A;  1X1W A;  3X3Y A;  2XF3 A;  3CMA 3;  1Q9E A;  5I97 A;  4JF8 A;  3NBJ A;  1K73 4;  1ZX2 A;  1TP6 A;  2CFL A;  3PZW A;  6GSP A;  1NO3 A;  2LYX A;  2GBW B;  3G4S 3;  1RDS A;  3EN1 B;  3EQQ B;  3CCU 3;  1X1U A;  3G8Z A;  2YFI B;  3Q3F A;  1W01 A;  3FCS B;  4FMB A;  1W6G A;  3JUQ A;  3NBB A;  3I0Y A;  1FA3 A;  1GY6 A;  4STD A;  2RCD A;  4MMZ B;  4HM2 B;  3G16 A;  1FUW A;  4MEI A;  3T8N A;  3MSO A;  3MG3 A;  5DRV A;  1OF5 B;  1BSC A;  3URP A;  3K5T A;  1BNR A;  2KCD A;  2WOH A;  2RNT A;  1A2P A;  4OK0 A;  1BRG A;  3GRD A;  1YVS A;  5IEN A;  3CPO A;  4IPB A;  5FW5 A;  1IVV A;  1BGS A;  1OHO A;  2J8X B;  2O3O A;  4L8O A;  4BL2 A;  2XR8 B;  3T8U A;  2R4I A;  1Q40 B;  4I5Q A;  1JBR A;  1EQK A;  3ZG0 A;  1AVK A;  3VSY A;  4WWU C;  4AKZ A;  1PFP A;  3U97 A;  1YIJ 3;  1BRI A;  4N6O B;  1UCL A;  2CK3 H;  1HU9 A;  3PCR A;  1Q40 A;  1GSP A;  4HYZ A;  2I9W A;  1KQS 2;  1WQL B;  1SJW A;  1W7C A;  1QAL A;  7GSP A;  4FCZ A;  2LQV A;  1D6Y A;  2GSP A;  4L8P A;  4WFO A;  3SX1 A;  3ZG5 A;  2SBL A;  1O7W B;  1QAF A;  1RGE A;  2YX9 A;  2CW9 A;  2ZHX B;  3AMO A;  3B8L A;  4XDV A;  5HGR A;  3G6E 3;  1WMO A;  1GYB A;  1MWS A;  1MWU A;  1I70 A;  3DGN A;  2ZL8 A;  2KAA A;  4J9A A;  3PGB A;  4KT3 B;  3GAX A;  4O3V A;  3VGN A;  3F9S A;  3WOE B;  3NV0 B;  5IEP A;  2GEX A;  3F40 A;  2FGT A;  2BHM A;  2CFD A;  1PY3 A;  3GZB A;  1VZZ A;  2GU1 A;  2KXG A;  2XFT A;  1DVD A;  2IUK A;  3D9R A;  3WMD A;  2CG1 A;  3WHO A;  5IF6 A;  1TFK A;  5GSP A;  1JZD A;  4GSP A;  2W2C A;  1E97 A;  1IV9 A;  3B7C A;  4N6T A;  4BU4 A;  2QA4 3;  1D6U A;  1PU4 A;  5A0O B;  3O8Y A;  5IW9 A;  3LTC A;  3H51 A;  5RNT A;  3WA2 X;  2WGQ A;  3B4P A;  3BNB A;  3ECF A;  1UCJ A;  2F99 A;  3X3X A;  1UCI A;  3BB9 A;  4IIA A;  1N8Q A;  1N9E A;  1O7M B;  1I0X A;  5BIR A;  1BSE A;  5CLK A;  3JUN A;  3V98 A;  4HM4 B;  3RGA A;  1VQ8 3;  4MMY B;  1JNQ A;  4K1V A;  3UB1 A;  2OTJ 3;  2O9U X;  3SOA A;  2D42 A;  5AYS C;  4AKY A;  3UL5 A;  2KRT A;  4HKV B;  1NU3 A;  1RN4 A;  2W0Q A;  3NM2 A;  4RNZ A;  5AI1 A;  3V99 A;  5BXQ A;  1G0T A;  3EHC A;  1JZO A;  3CPW 2;  1NB5 I;  3IPT A;  1N9J A;  1W2B 2;  3LYG A;  2BO9 B;  3GWR A;  3BNC A;  1BNE A;  4OVM A;  4HM3 B;  4XM4 A;  2F4Y A;  4EBG A;  2Z7A A;  8CHO A;  3IMA B;  2YFJ B;  2OOV A;  1VQP 3;  1BRN L;  2W56 B;  4R80 A;  1JBS A;  1VQK 3;  3SED A;  2P09 A;  4NPB A;  2B1X B;  2CWU A;  3NXJ A;  2RSX A;  5M19 A;  1Q86 4;  4FCJ A;  1BVI A;  1J2B A;  3DH2 A;  1IVW A;  1GOU A;  2P0M A;  4CDL A;  2W56 A;  1T3B A;  4N6U A;  3EF8 A;  3SLU A;  5IG0 A;  1IU7 A;  3CCV 3;  1VQO 3;  5IG5 A;  3BU4 A;  1DMQ A;  1Q7H A;  2KF3 A;  4LSO A;  3CU3 A;  1VQM 3;  1RN7 A;  3K0Z A;  3EN8 A;  1UW1 A;  1M90 4;  3BND A;  5G1K A;  1FW7 A;  4HM1 B;  3ER7 A;  4J5K A;  3Q2P A;  2CHC A;  2F56 A;  7STD A;  4KVH A;  1O7P B;  3RGR A;  1DMN A;  4BTY A;  1QVF 2;  1KC8 4;  2XGN A;  3MG1 A;  2CWT A;  2ML5 A;  1ZO2 A;  3VF1 A;  5LC7 A;  3KCH A;  1C7H A;  1FUS A; 
#chains in the Genus database with same CATH homology
 1LQG C;  1UUG B;  1UDI I;  1LQM B;  2ZHX B;  1EUI C;  1UGH I;  2J8X B;  2UUG C;  1UGI A;  4LYL B;  2UGI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...