1UDII

Nucleotide mimicry in the crystal structure of the uracil-dna glycosylase-uracil glycosylase inhibitor protein complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
83
structure length
83
Chain Sequence
b'TNLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URACIL-DNA GLYCOSYLASE
publication title Nucleotide mimicry in the crystal structure of the uracil-DNA glycosylase-uracil glycosylase inhibitor protein complex.
pubmed doi rcsb
molecule tags Hydrolase/inhibitor
total genus 15
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 1995-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 1udiI00
1UUGB 2J8XB 2UGIA 1LQMB 1UGIA 2ZHXB 2UUGC 1LQGC 1EUIC 1UDII 1UGHI 4LYLB
chains in the Genus database with same CATH superfamily
3X3YA 2CFGA 1KSIA 3WODG 3F7XA 4I5QA 4WYKB 2Z7AA 1BNIA 1BSEA 1E3RA 1YJN3 2STDA 3DGYA 4L8OA 3X3XA 3ZG0A 1UI8A 2CH9A 3FZWA 2HMMB 1GY7A 1JRQA 5EQLA 4CDLA 1VQP3 4WHAA 1JN5A 1W01A 4JF8A 3SEDA 2XR8B 3VSYA 1Q40A 2ML5A 1Y4KA 3CC43 1A67A 1GD3A 1TRQA 1O7WB 1YHQ3 2WOHA 4HYZA 1HKXA 3SVAA 3QRDA 4HM0B 1FGOA 2UX0A 5FW5A 2BIRA 1W2ZA 2CIUA 2H0HA 3G16A 4HAAA 1BRKA 2RFRA 1W2B2 3SOAA 3UJMA 2YX9A 1SIHA 3LZAA 3RNTA 1W02A 1BSAA 1CEWI 5KP3A 2CFWA 1Q7HA 2F98A 3T8NA 2GEXA 1D6ZA 1UDII 1LNHA 4HM8B 1ROAA 5KP1A 1MWUA 2GBXB 1JB4A 3RGRA 2AAEA 4LGQA 1BRJA 2XGLA 1Q7Y4 2KF3A 1I2EA 1Q864 3S5CA 3KSED 5G2GA 1B27A 3S29A 3CD63 1FA3A 3HOHA 3FG4A 1RRHA 3UNLA 1VQ93 2RCDA 2WOFA 3MHEA 2OTJ3 4N6TA 2KCDA 2JQ5A 1DE3A 4RZMA 4NPBA 2XGNA 2Z77A 1BNFA 3OW22 1ASKA 3ECFA 2IYJA 1Q9EA 1SJWA 3LMLA 3WHOA 1FW7A 1SARA 4X2OA 5M19A 5RNTA 1IVWA 4RNTA 1BSCA 3NXJA 4EBGA 3U1WA 3CXC2 1I2GA 3WOEB 4LZIA 5CLKA 3E99A 1S723 3OV4A 3KIIA 2RBIA 2F5WA 3FF0A 4RNZA 4AKZA 1QAFA 3HI7A 1BNRA 2W56A 4R9LA 1NB3I 1X1UA 3K63A 3LT8A 1IDPA 2I9WA 3CCS3 1NO3A 3BIRA 1YGEA 2K3DA 3F40A 3F7SA 3OWUA 4ILFA 4X2HA 3RDEA 4BU4A 4K61A 3FLJA 3DUKA 3B7CA 5DREA 3KE7A 3N54B 1RRLA 1BRIA 3A76A 3CC73 3ALAA 1OHOA 1V57A 1RDSA 4J5KA 3T8UA 1BVIA 1FGMA 1BRGA 2IUKA 1QJGA 1GYBA 1TP6A 3H51A 4STDA 1L5GB 4BL3A 4OVMA 1J2BA 4ZM8A 5IG4A 1EQKA 4DKIA 3LH4A 3HIIA 3AGOA 4BTWA 2KRTA 3BLZA 2XSOB 3NM2A 3FF2A 1US1A 2XFTA 1RNTA 1FYSA 1RTUA 4N6V0 3LYGA 3B4OA 1GD4A 1T2HA 1MOLA 1DMMA 2KF4A 1TTOA 1LOWA 3AMOB 4R4KA 5AEWB 4EYCA 2XF3A 1MNLA 4BTYA 3URPA 2D1WA 3GAXA 3GWRA 3PCSA 1O7GB 5A0OB 3NHXA 4G1MB 3CCJ3 4TX4A 1UCIA 2IA7A 8CHOA 2F56A 2BMQB 3JVCA 1UGIA 1VQ43 1CYUA 1N5HA 3HX8A 2P09A 3S27A 2GSPA 3BU4A 5AIFA 7STDA 1N9JA 1VQK3 5D83A 1FZUA 2W6JH 1E97A 2YFLB 4NHFA 3O8YA 1TFKA 1IU7A 1I3IA 2RSXA 1RNBA 3CCL3 1EKMA 2H0GA 4FMBA 3X40A 5CF2A 3MSOA 1C54A 4WYKA 3DY5A 1OHSA 4GHOA 5AEUB 1RCLA 2RGQA 3SYUA 3STDA 3SOYA 2KAAA 2QGUA 2OOVC 4H61A 1MWRA 3KKGA 3PYJA 2QA43 3HIGA 1VQN3 2FXTA 3DMCA 2CC3A 1B2ZA 5GSPA 2CG0A 1DETA 1TUHA 3CU3A 4FCMA 4IT7A 4EV2A 1VQ73 4GB5A 1I2FA 2O3OA 1BNSA 1QALA 6GSPA 2CFLA 1WMOA 3CCE3 3DZLA 4IPBA 3HK4A 1LOVA 2C11A 3AGNA 2K54A 3EHCA 1X1YA 3F14A 3WA3A 3DGMA 1AY7A 1YVSA 2XH9A 1RLSA 2CWTA 1DYUA 3CCR3 2WO0A 2IMJA 3K0ZA 3SLUA 4HVNA 5BU4A 5BXQA 4J5GA 4BIRA 1O7NB 4GL6A 1YIT3 1GY6A 1B2MA 5HOHA 2BO9B 3EBYA 3ZFZA 2QEX3 2K0MA 1RGLA 1M9GA 1R4YA 2CWUA 4FCZA 1F8NA 4HM6B 5AYSC 2B1XB 2INXA 2YFIB 3I563 3X3ZA 2BU4A 1JNQA 3NUVA 2Z6BA 4ORLA 1IV7A 1JBSA 1RSNA 3CCM3 4HZ9B 1MWSA 3AHSA 3B8LA 4OK0A 1UCJA 3WA2X 1B2UA 1ULJB 3HZPA 4BTXA 2CWVA 2WGQA 3VGNA 5JPUA 1KQS2 1DVCA 3FGYA 1M1K4 5LC7A 2SBLA 1X1XA 1W6YA 2CFKA 1RGAA 4NREA 1EEJA 4WFOA 1VQL3 2W04A 3N9HA 3BNEA 3CCQ3 2OOVA 1N8QA 4LYLB 2FGTA 3KN4A 4XDVA 1I8VA 2ZHXB 4KZ1A 5IEOA 3MWZA 1ZX2A 3K9MC 2MC8A 2J8XB 1B2SA 2HMKB 3GRDA 2XRXB 4HOHA 3I0YA 5STDA 1KWIA 3ZG5A 2M7OA 1PU4A 1IT7A 1OGXA 5M18A 3KCHA 1RGCA 3NBRA 1M1XB 5LC6A 5IERA 1JN5B 4EW5A 5IF6A 3X41A 1R4CA 4MMXB 3MPHA 3EC9A 2OCTA 2W9PA 1QMAA 1FUWA 1Q40B 5EEOA 4CJNA 4FMDA 4N6NB 3U97A 1WTHA 6STDA 4HM1B 1U8CB 1G02A 3JUOA 1JB2A 1SQWA 5G1KA 1YIJ3 1NB5I 1B20A 1LRAA 4CPKA 2XFSA 1D6YA 1BGSA 1NDOB 1SPUA 1WNHA 2SARA 3BNDA 1C7HA 3F9SA 3PCRA 4KT3B 3F8HA 3ROBA 1K41A 4XB5A 4O02B 1FGTA 1JZDA 1AV4A 5CK6A 2F86B 4MMYB 5AIGA 1A2PA 2XEPA 1BANA 4BL2A 3G6E3 3D5IA 1Q42A 2D42A 3AMOA 5AYRB 4H3UA 1IQ8A 1ZS7A 1ZGXA 4N6MA 1MGRA 3NM7A 1FUTA 5IG5A 3DGNA 1BUJA 2HMOB 2KF5A 3JUPA 3CCU3 3BNCA 1OCVA 1VQQA 2LYXA 3DH2A 3FCSB 2P0MA 3V99A 3DM8A 1JJ22 4L7KA 1GOUA 1AQZA 1YVBI 2FNQA 1AR0A 3DXOA 3IJEB 2BHMA 1EUIC 1IVVA 3Q90A 1MGWA 1RN7A 3EE1A 2Z76A 9RNTA 1W6GA 3CME3 1GMQA 1EA2A 1PY3A 1STDA 2OQEC 3GZBA 1RGEA 3GZRA 3OWSA 1RGGA 1OUNA 2ZL8A 1LQMB 2CW9A 3LTAA 1LOYA 3T0UA 2BT3A 1N8R4 1DMNA 1LOXA 3EQQB 1CH0A 1BRSA 1T5YA 1U5OA 1UCKA 2ZA4A 1Q814 1YGWA 3LOYA 2W2CA 3OXAA 1G0TA 1B2XA 1G96A 1IYYA 4EXRA 3D5GA 3D79A 1KC84 4HM2B 1BIRA 2WGOA 3CPOA 1VQ53 1IQXA 2P05A 3TDGA 1W7CA 5D82A 2PNCA 8RNTA 4XDWA 1HZ1A 2IUJA 2GU1A 4FMCA 1O7HB 2OTL3 3WR2A 1O7PB 1FGQA 1W5ZA 4K1VA 1RN4A 1JBRA 3CPW2 4PEJA 3NQZA 1LXEA 2ML6A 4N3VA 1GOYA 3V92A 4HM4B 1OF5B 2P0XA 1PFPA 4KFEA 4N6UA 1QVF2 1BNJA 5ELJA 3GZXB 3EJVA 1K28A 1IK3A 5BIRA 3UL5A 1KD14 1E3VA 1UCLA 3NX0A 1ROVA 4HBRA 1BUQA 1OPYA 2OWPA 3IPTA 1JZOA 3BB9A 2BMRB 1K8A4 1UUWB 2GU3A 3VF1A 3G8ZA 3EN1B 1GY5A 1W00A 2OQEA 1D6UA 1WMPA 1LQGC 3NV0B 1DVDA 2KF6A 1IVXA 3PXMA 2GBWB 1BAOA 1OHPA 1QVG2 2B24B 7RNTA 1ISKA 1RGKA 4N6LA 1TU5A 3S67A 1TJDA 7GSPA 3KZTA 4LSOA 1LNIA 1OH0A 3LTBA 4RBNA 3MG3A 1I3FA 2BNGA 2KXGA 1W6CA 2CX1A 4XBXA 2HMLB 4LEHA 1I70A 2CX0A 3JUQA 4XM4A 1A2VA 5BVBA 1K734 4GSPA 3PS8A 3X42A 4JRFA 4CCVA 1JKGB 3GZYB 3FG3A 4XBYA 2LQVA 3CNXA 4QWTA 1RCKA 4HKVB 2R4IA 3RGAA 2E2TA 1AVLA 2W0QA 1UUGB 1Q824 1BRHA 3NBJA 4R80A 1IQYA 1GMRA 1N5PA 1UW1A 3Q2PA 1RHLA 2CK3H 1BRNL 2E2UA 4Q53A 3V98A 4RNYA 3SX1A 3FKAA 3DGOA 4K1UA 3LTCA 1M904 4LMIA 5M1AA 3LTDA 1PYLA 3MG2A 2Q07A 2F99A 1A2KA 1JV2B 2XSHB 5AI1A 1EG9B 3D4AA 4MMZB 5EVHA 1IT8A 3FSDA 2C4BA 1STFI 1B3SA 3S28A 2W9QA 3B4PA 3G0KA 1RKYA 1VQ83 1B21A 3IMAB 1RGFA 3WMDA 4FR9A 5AIIA 3N8BA 1OACA 4AKYA 3L0RA 3PGBA 5G1LA 3EX9A 4IIAA 1O7MB 1YI23 5DRVA 1NNVA 3G713 1W4NA 4U13A 3EB8A 4HZBB 6RNTA 3FH1A 1WMNA 2RNTA 3QK9A 2L4VA 1TFOA 2C10A 2O9UX 4WWUC 1WQLB 3MYTA 2UGIA 4FMAA 4R1KA 1VZZA 3LT9A 2UUGC 4WP5A 1NJI4 2E2VA 3CMA3 1VQ63 5IW9A 2JDIH 1GS3A 1VQO3 3SXXA 2BMOB 3EF8A 2MF7A 1S5AA 1BNGA 4KFDA 4XBTA 1GMPA 3CNMA 5D81A 2W03A 4R9KA 3Q1CA 1NWWA 1RJOA 5IG3A 1VQM3 2CKFB 1TRPA 1RMSA 2IY2A 2HMJB 2YFJB 3ER7A 3D9RA 3H3HA 4MEIA 5TGNA 1UI7A 1ZO2A 1YJ93 1GOVA 1OF5A 1X1WA 3NQYA 1HU9A 2R41A 4HJLB 4O8SA 3KSPA 2A15A 1AVKA 4O2HA 1IVUA 3BNBA 1HYFA 1GSPA 5JBSA 1T3BA 2W56B 1JB5A 2P38A 1SIIA 1K9M4 3DGLA 1N9EA 4N6OB 1JBTA 2PZVA 3K7CA 1CYVA 4I4KA 2F5MA 4J9AA 3LXUX 1FGRA 4MJDA 4O3VA 2GXFA 4EV5A 2CHCA 3CCV3 2AADA 3FG1A 1I0VA 4HM3B 2Y74A 5IG0A 3OX9A 5FGOA 1FUSA 1RGHA 2GEYA 3NV0A 5I97A 4OUQA 4L8PA 2F4YA 3M8CA 1BNEA 4J8TA 3PZWA 3WOFB 5CF1A 1NU3A 5HGRA 1Z1SA 1V58A 3UB1A 1ULIB 3UL6A 3JUMA 1T2IA 3G4S3 1OGZA 1V74A 1LVNA 2HOHA 2L1SA 3OWYA 1TIJA 3F8XA 3AHWA 2H0IA 3K5TA 5AIHA 5IENA 4K90B 3J7Yd 1BSBA 1CQSA 3JUNA 3MG1A 3CC23 3I553 2CFDA 4HM7B 1YNVX 5KP4A 5IEPA 2HMNB 1UGHI 3D3LA 4AEQA 3A5EA 1I0XA 4KVHA 1BU4A 1JKGA 2QIYA 3KFQC 3EN8A 5CXOA 5JPPA 3MKIA 3NBBA 1YJW3 3WDGB 4EC6A 1BOXA 1IV9A 1QAKA 4KFFA 2V1LA 1MWTA 1BSDA 2Y73A 1RN1A 1UUVB 3Q3FA 2CG1A 5ELUA 4HM5B 1A90A 4FCJA 3GSPA 3EBTA 1DMQA 2ZDJA
chains in the Genus database with same CATH topology
1UUGB 2J8XB 2UGIA 1LQMB 1UGIA 2ZHXB 2UUGC 1LQGC 1EUIC 1UDII 1UGHI 4LYLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UUG B;  2J8X B;  2UGI A;  1LQM B;  1UGI A;  2ZHX B;  2UUG C;  1LQG C;  1EUI C;  1UDI I;  1UGH I;  4LYL B; 
#chains in the Genus database with same CATH topology
 3X3Y A;  2CFG A;  1KSI A;  3WOD G;  3F7X A;  4I5Q A;  4WYK B;  2Z7A A;  1BNI A;  1BSE A;  1E3R A;  1YJN 3;  2STD A;  3DGY A;  4L8O A;  3X3X A;  3ZG0 A;  1UI8 A;  2CH9 A;  3FZW A;  2HMM B;  1GY7 A;  1JRQ A;  5EQL A;  4CDL A;  1VQP 3;  4WHA A;  1JN5 A;  1W01 A;  4JF8 A;  3SED A;  2XR8 B;  3VSY A;  1Q40 A;  2ML5 A;  1Y4K A;  3CC4 3;  1A67 A;  1GD3 A;  1TRQ A;  1O7W B;  1YHQ 3;  2WOH A;  4HYZ A;  1HKX A;  3SVA A;  3QRD A;  4HM0 B;  1FGO A;  2UX0 A;  5FW5 A;  2BIR A;  1W2Z A;  2CIU A;  2H0H A;  3G16 A;  4HAA A;  1BRK A;  2RFR A;  1W2B 2;  3SOA A;  3UJM A;  2YX9 A;  1SIH A;  3LZA A;  3RNT A;  1W02 A;  1BSA A;  1CEW I;  5KP3 A;  2CFW A;  1Q7H A;  2F98 A;  3T8N A;  2GEX A;  1D6Z A;  1UDI I;  1LNH A;  4HM8 B;  1ROA A;  5KP1 A;  1MWU A;  2GBX B;  1JB4 A;  3RGR A;  2AAE A;  4LGQ A;  1BRJ A;  2XGL A;  1Q7Y 4;  2KF3 A;  1I2E A;  1Q86 4;  3S5C A;  3KSE D;  5G2G A;  1B27 A;  3S29 A;  3CD6 3;  1FA3 A;  3HOH A;  3FG4 A;  1RRH A;  3UNL A;  1VQ9 3;  2RCD A;  2WOF A;  3MHE A;  2OTJ 3;  4N6T A;  2KCD A;  2JQ5 A;  1DE3 A;  4RZM A;  4NPB A;  2XGN A;  2Z77 A;  1BNF A;  3OW2 2;  1ASK A;  3ECF A;  2IYJ A;  1Q9E A;  1SJW A;  3LML A;  3WHO A;  1FW7 A;  1SAR A;  4X2O A;  5M19 A;  5RNT A;  1IVW A;  4RNT A;  1BSC A;  3NXJ A;  4EBG A;  3U1W A;  3CXC 2;  1I2G A;  3WOE B;  4LZI A;  5CLK A;  3E99 A;  1S72 3;  3OV4 A;  3KII A;  2RBI A;  2F5W A;  3FF0 A;  4RNZ A;  4AKZ A;  1QAF A;  3HI7 A;  1BNR A;  2W56 A;  4R9L A;  1NB3 I;  1X1U A;  3K63 A;  3LT8 A;  1IDP A;  2I9W A;  3CCS 3;  1NO3 A;  3BIR A;  1YGE A;  2K3D A;  3F40 A;  3F7S A;  3OWU A;  4ILF A;  4X2H A;  3RDE A;  4BU4 A;  4K61 A;  3FLJ A;  3DUK A;  3B7C A;  5DRE A;  3KE7 A;  3N54 B;  1RRL A;  1BRI A;  3A76 A;  3CC7 3;  3ALA A;  1OHO A;  1V57 A;  1RDS A;  4J5K A;  3T8U A;  1BVI A;  1FGM A;  1BRG A;  2IUK A;  1QJG A;  1GYB A;  1TP6 A;  3H51 A;  4STD A;  1L5G B;  4BL3 A;  4OVM A;  1J2B A;  4ZM8 A;  5IG4 A;  1EQK A;  4DKI A;  3LH4 A;  3HII A;  3AGO A;  4BTW A;  2KRT A;  3BLZ A;  2XSO B;  3NM2 A;  3FF2 A;  1US1 A;  2XFT A;  1RNT A;  1FYS A;  1RTU A;  4N6V 0;  3LYG A;  3B4O A;  1GD4 A;  1T2H A;  1MOL A;  1DMM A;  2KF4 A;  1TTO A;  1LOW A;  3AMO B;  4R4K A;  5AEW B;  4EYC A;  2XF3 A;  1MNL A;  4BTY A;  3URP A;  2D1W A;  3GAX A;  3GWR A;  3PCS A;  1O7G B;  5A0O B;  3NHX A;  4G1M B;  3CCJ 3;  4TX4 A;  1UCI A;  2IA7 A;  8CHO A;  2F56 A;  2BMQ B;  3JVC A;  1UGI A;  1VQ4 3;  1CYU A;  1N5H A;  3HX8 A;  2P09 A;  3S27 A;  2GSP A;  3BU4 A;  5AIF A;  7STD A;  1N9J A;  1VQK 3;  5D83 A;  1FZU A;  2W6J H;  1E97 A;  2YFL B;  4NHF A;  3O8Y A;  1TFK A;  1IU7 A;  1I3I A;  2RSX A;  1RNB A;  3CCL 3;  1EKM A;  2H0G A;  4FMB A;  3X40 A;  5CF2 A;  3MSO A;  1C54 A;  4WYK A;  3DY5 A;  1OHS A;  4GHO A;  5AEU B;  1RCL A;  2RGQ A;  3SYU A;  3STD A;  3SOY A;  2KAA A;  2QGU A;  2OOV C;  4H61 A;  1MWR A;  3KKG A;  3PYJ A;  2QA4 3;  3HIG A;  1VQN 3;  2FXT A;  3DMC A;  2CC3 A;  1B2Z A;  5GSP A;  2CG0 A;  1DET A;  1TUH A;  3CU3 A;  4FCM A;  4IT7 A;  4EV2 A;  1VQ7 3;  4GB5 A;  1I2F A;  2O3O A;  1BNS A;  1QAL A;  6GSP A;  2CFL A;  1WMO A;  3CCE 3;  3DZL A;  4IPB A;  3HK4 A;  1LOV A;  2C11 A;  3AGN A;  2K54 A;  3EHC A;  1X1Y A;  3F14 A;  3WA3 A;  3DGM A;  1AY7 A;  1YVS A;  2XH9 A;  1RLS A;  2CWT A;  1DYU A;  3CCR 3;  2WO0 A;  2IMJ A;  3K0Z A;  3SLU A;  4HVN A;  5BU4 A;  5BXQ A;  4J5G A;  4BIR A;  1O7N B;  4GL6 A;  1YIT 3;  1GY6 A;  1B2M A;  5HOH A;  2BO9 B;  3EBY A;  3ZFZ A;  2QEX 3;  2K0M A;  1RGL A;  1M9G A;  1R4Y A;  2CWU A;  4FCZ A;  1F8N A;  4HM6 B;  5AYS C;  2B1X B;  2INX A;  2YFI B;  3I56 3;  3X3Z A;  2BU4 A;  1JNQ A;  3NUV A;  2Z6B A;  4ORL A;  1IV7 A;  1JBS A;  1RSN A;  3CCM 3;  4HZ9 B;  1MWS A;  3AHS A;  3B8L A;  4OK0 A;  1UCJ A;  3WA2 X;  1B2U A;  1ULJ B;  3HZP A;  4BTX A;  2CWV A;  2WGQ A;  3VGN A;  5JPU A;  1KQS 2;  1DVC A;  3FGY A;  1M1K 4;  5LC7 A;  2SBL A;  1X1X A;  1W6Y A;  2CFK A;  1RGA A;  4NRE A;  1EEJ A;  4WFO A;  1VQL 3;  2W04 A;  3N9H A;  3BNE A;  3CCQ 3;  2OOV A;  1N8Q A;  4LYL B;  2FGT A;  3KN4 A;  4XDV A;  1I8V A;  2ZHX B;  4KZ1 A;  5IEO A;  3MWZ A;  1ZX2 A;  3K9M C;  2MC8 A;  2J8X B;  1B2S A;  2HMK B;  3GRD A;  2XRX B;  4HOH A;  3I0Y A;  5STD A;  1KWI A;  3ZG5 A;  2M7O A;  1PU4 A;  1IT7 A;  1OGX A;  5M18 A;  3KCH A;  1RGC A;  3NBR A;  1M1X B;  5LC6 A;  5IER A;  1JN5 B;  4EW5 A;  5IF6 A;  3X41 A;  1R4C A;  4MMX B;  3MPH A;  3EC9 A;  2OCT A;  2W9P A;  1QMA A;  1FUW A;  1Q40 B;  5EEO A;  4CJN A;  4FMD A;  4N6N B;  3U97 A;  1WTH A;  6STD A;  4HM1 B;  1U8C B;  1G02 A;  3JUO A;  1JB2 A;  1SQW A;  5G1K A;  1YIJ 3;  1NB5 I;  1B20 A;  1LRA A;  4CPK A;  2XFS A;  1D6Y A;  1BGS A;  1NDO B;  1SPU A;  1WNH A;  2SAR A;  3BND A;  1C7H A;  3F9S A;  3PCR A;  4KT3 B;  3F8H A;  3ROB A;  1K41 A;  4XB5 A;  4O02 B;  1FGT A;  1JZD A;  1AV4 A;  5CK6 A;  2F86 B;  4MMY B;  5AIG A;  1A2P A;  2XEP A;  1BAN A;  4BL2 A;  3G6E 3;  3D5I A;  1Q42 A;  2D42 A;  3AMO A;  5AYR B;  4H3U A;  1IQ8 A;  1ZS7 A;  1ZGX A;  4N6M A;  1MGR A;  3NM7 A;  1FUT A;  5IG5 A;  3DGN A;  1BUJ A;  2HMO B;  2KF5 A;  3JUP A;  3CCU 3;  3BNC A;  1OCV A;  1VQQ A;  2LYX A;  3DH2 A;  3FCS B;  2P0M A;  3V99 A;  3DM8 A;  1JJ2 2;  4L7K A;  1GOU A;  1AQZ A;  1YVB I;  2FNQ A;  1AR0 A;  3DXO A;  3IJE B;  2BHM A;  1EUI C;  1IVV A;  3Q90 A;  1MGW A;  1RN7 A;  3EE1 A;  2Z76 A;  9RNT A;  1W6G A;  3CME 3;  1GMQ A;  1EA2 A;  1PY3 A;  1STD A;  2OQE C;  3GZB A;  1RGE A;  3GZR A;  3OWS A;  1RGG A;  1OUN A;  2ZL8 A;  1LQM B;  2CW9 A;  3LTA A;  1LOY A;  3T0U A;  2BT3 A;  1N8R 4;  1DMN A;  1LOX A;  3EQQ B;  1CH0 A;  1BRS A;  1T5Y A;  1U5O A;  1UCK A;  2ZA4 A;  1Q81 4;  1YGW A;  3LOY A;  2W2C A;  3OXA A;  1G0T A;  1B2X A;  1G96 A;  1IYY A;  4EXR A;  3D5G A;  3D79 A;  1KC8 4;  4HM2 B;  1BIR A;  2WGO A;  3CPO A;  1VQ5 3;  1IQX A;  2P05 A;  3TDG A;  1W7C A;  5D82 A;  2PNC A;  8RNT A;  4XDW A;  1HZ1 A;  2IUJ A;  2GU1 A;  4FMC A;  1O7H B;  2OTL 3;  3WR2 A;  1O7P B;  1FGQ A;  1W5Z A;  4K1V A;  1RN4 A;  1JBR A;  3CPW 2;  4PEJ A;  3NQZ A;  1LXE A;  2ML6 A;  4N3V A;  1GOY A;  3V92 A;  4HM4 B;  1OF5 B;  2P0X A;  1PFP A;  4KFE A;  4N6U A;  1QVF 2;  1BNJ A;  5ELJ A;  3GZX B;  3EJV A;  1K28 A;  1IK3 A;  5BIR A;  3UL5 A;  1KD1 4;  1E3V A;  1UCL A;  3NX0 A;  1ROV A;  4HBR A;  1BUQ A;  1OPY A;  2OWP A;  3IPT A;  1JZO A;  3BB9 A;  2BMR B;  1K8A 4;  1UUW B;  2GU3 A;  3VF1 A;  3G8Z A;  3EN1 B;  1GY5 A;  1W00 A;  2OQE A;  1D6U A;  1WMP A;  1LQG C;  3NV0 B;  1DVD A;  2KF6 A;  1IVX A;  3PXM A;  2GBW B;  1BAO A;  1OHP A;  1QVG 2;  2B24 B;  7RNT A;  1ISK A;  1RGK A;  4N6L A;  1TU5 A;  3S67 A;  1TJD A;  7GSP A;  3KZT A;  4LSO A;  1LNI A;  1OH0 A;  3LTB A;  4RBN A;  3MG3 A;  1I3F A;  2BNG A;  2KXG A;  1W6C A;  2CX1 A;  4XBX A;  2HML B;  4LEH A;  1I70 A;  2CX0 A;  3JUQ A;  4XM4 A;  1A2V A;  5BVB A;  1K73 4;  4GSP A;  3PS8 A;  3X42 A;  4JRF A;  4CCV A;  1JKG B;  3GZY B;  3FG3 A;  4XBY A;  2LQV A;  3CNX A;  4QWT A;  1RCK A;  4HKV B;  2R4I A;  3RGA A;  2E2T A;  1AVL A;  2W0Q A;  1UUG B;  1Q82 4;  1BRH A;  3NBJ A;  4R80 A;  1IQY A;  1GMR A;  1N5P A;  1UW1 A;  3Q2P A;  1RHL A;  2CK3 H;  1BRN L;  2E2U A;  4Q53 A;  3V98 A;  4RNY A;  3SX1 A;  3FKA A;  3DGO A;  4K1U A;  3LTC A;  1M90 4;  4LMI A;  5M1A A;  3LTD A;  1PYL A;  3MG2 A;  2Q07 A;  2F99 A;  1A2K A;  1JV2 B;  2XSH B;  5AI1 A;  1EG9 B;  3D4A A;  4MMZ B;  5EVH A;  1IT8 A;  3FSD A;  2C4B A;  1STF I;  1B3S A;  3S28 A;  2W9Q A;  3B4P A;  3G0K A;  1RKY A;  1VQ8 3;  1B21 A;  3IMA B;  1RGF A;  3WMD A;  4FR9 A;  5AII A;  3N8B A;  1OAC A;  4AKY A;  3L0R A;  3PGB A;  5G1L A;  3EX9 A;  4IIA A;  1O7M B;  1YI2 3;  5DRV A;  1NNV A;  3G71 3;  1W4N A;  4U13 A;  3EB8 A;  4HZB B;  6RNT A;  3FH1 A;  1WMN A;  2RNT A;  3QK9 A;  2L4V A;  1TFO A;  2C10 A;  2O9U X;  4WWU C;  1WQL B;  3MYT A;  2UGI A;  4FMA A;  4R1K A;  1VZZ A;  3LT9 A;  2UUG C;  4WP5 A;  1NJI 4;  2E2V A;  3CMA 3;  1VQ6 3;  5IW9 A;  2JDI H;  1GS3 A;  1VQO 3;  3SXX A;  2BMO B;  3EF8 A;  2MF7 A;  1S5A A;  1BNG A;  4KFD A;  4XBT A;  1GMP A;  3CNM A;  5D81 A;  2W03 A;  4R9K A;  3Q1C A;  1NWW A;  1RJO A;  5IG3 A;  1VQM 3;  2CKF B;  1TRP A;  1RMS A;  2IY2 A;  2HMJ B;  2YFJ B;  3ER7 A;  3D9R A;  3H3H A;  4MEI A;  5TGN A;  1UI7 A;  1ZO2 A;  1YJ9 3;  1GOV A;  1OF5 A;  1X1W A;  3NQY A;  1HU9 A;  2R41 A;  4HJL B;  4O8S A;  3KSP A;  2A15 A;  1AVK A;  4O2H A;  1IVU A;  3BNB A;  1HYF A;  1GSP A;  5JBS A;  1T3B A;  2W56 B;  1JB5 A;  2P38 A;  1SII A;  1K9M 4;  3DGL A;  1N9E A;  4N6O B;  1JBT A;  2PZV A;  3K7C A;  1CYV A;  4I4K A;  2F5M A;  4J9A A;  3LXU X;  1FGR A;  4MJD A;  4O3V A;  2GXF A;  4EV5 A;  2CHC A;  3CCV 3;  2AAD A;  3FG1 A;  1I0V A;  4HM3 B;  2Y74 A;  5IG0 A;  3OX9 A;  5FGO A;  1FUS A;  1RGH A;  2GEY A;  3NV0 A;  5I97 A;  4OUQ A;  4L8P A;  2F4Y A;  3M8C A;  1BNE A;  4J8T A;  3PZW A;  3WOF B;  5CF1 A;  1NU3 A;  5HGR A;  1Z1S A;  1V58 A;  3UB1 A;  1ULI B;  3UL6 A;  3JUM A;  1T2I A;  3G4S 3;  1OGZ A;  1V74 A;  1LVN A;  2HOH A;  2L1S A;  3OWY A;  1TIJ A;  3F8X A;  3AHW A;  2H0I A;  3K5T A;  5AIH A;  5IEN A;  4K90 B;  3J7Y d;  1BSB A;  1CQS A;  3JUN A;  3MG1 A;  3CC2 3;  3I55 3;  2CFD A;  4HM7 B;  1YNV X;  5KP4 A;  5IEP A;  2HMN B;  1UGH I;  3D3L A;  4AEQ A;  3A5E A;  1I0X A;  4KVH A;  1BU4 A;  1JKG A;  2QIY A;  3KFQ C;  3EN8 A;  5CXO A;  5JPP A;  3MKI A;  3NBB A;  1YJW 3;  3WDG B;  4EC6 A;  1BOX A;  1IV9 A;  1QAK A;  4KFF A;  2V1L A;  1MWT A;  1BSD A;  2Y73 A;  1RN1 A;  1UUV B;  3Q3F A;  2CG1 A;  5ELU A;  4HM5 B;  1A90 A;  4FCJ A;  3GSP A;  3EBT A;  1DMQ A;  2ZDJ A; 
#chains in the Genus database with same CATH homology
 1UUG B;  2J8X B;  2UGI A;  1LQM B;  1UGI A;  2ZHX B;  2UUG C;  1LQG C;  1EUI C;  1UDI I;  1UGH I;  4LYL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...