1UDZA

Isoleucyl-trna synthetase editing domain
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
179
structure length
179
Chain Sequence
PSVYVRFPLKEPKKLGLEKASLLIWTTTPWTLPGNVAAAVHPEYTYAAFQVGDEALILEEGLGRKLLGEGTPVLKTFPGKALEGLPYTPPYPQALEKGYFVVLADYVSQEDGTGIVHQAPAFGAEDLETARVYGLPLLKTVDEEGKLLVEPFKGLYFREANRAILRDLRGRGFLFKEES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of the CP1 domain from Thermus thermophilus isoleucyl-tRNA synthetase and its complex with L-valine.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ligase
molecule keywords Isoleucyl-tRNA synthetase
total genus 51
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 6.1.1.5: Isoleucine--tRNA ligase.
pdb deposition date 2003-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.740.10 Alpha Beta Alpha-Beta Complex Isoleucyl-tRNA Synthetase; domain 2 Valyl/Leucyl/Isoleucyl-tRNA synthetase, editing domain 1udzA00
5AGRA 1WNZA 1IVSA 1WNYA 3PZ5A 1WK9A 1ILEA 3O0AA 1WKBA 1WK8A 3PZ6A 5AGTA 1GAXA 4K47A 5AGHA 2BYTA 3ZGZA 2WFEA 1H3NA 2AJHA 4AS1A 2AJIA 1QU2A 3PZ0A 1WZ2A 3ZJVA 3ZJTA 4ARIA 2BTEA 1OBHA 4K48A 3ZJUA 5AGIA 1UDZA 1WKAA 2WFDA 5AGSA 4CQNA 1JZSA 2V0GA 2WFGA 1QU3A 2AJGA 1UE0A 4ARCA 5AGJA 1FFYA 1OBCA 4AQ7A 1JZQA 2V0CA
chains in the Genus database with same CATH superfamily
5AGRA 1WNZA 1IVSA 1WNYA 3PZ5A 1WK9A 1ILEA 3O0AA 1WKBA 1WK8A 3PZ6A 5AGTA 1GAXA 4K47A 5AGHA 2BYTA 3ZGZA 2WFEA 1H3NA 2AJHA 4AS1A 2AJIA 1QU2A 3PZ0A 1WZ2A 3ZJVA 3ZJTA 4ARIA 2BTEA 1OBHA 4K48A 3ZJUA 5AGIA 1UDZA 1WKAA 2WFDA 5AGSA 4CQNA 1JZSA 2V0GA 2WFGA 1QU3A 2AJGA 1UE0A 4ARCA 5AGJA 1FFYA 1OBCA 4AQ7A 1JZQA 2V0CA
chains in the Genus database with same CATH topology
5AGRA 1WNZA 1IVSA 1WNYA 3PZ5A 1WK9A 1ILEA 3O0AA 1WKBA 1WK8A 3PZ6A 5AGTA 1GAXA 4K47A 5AGHA 2BYTA 3ZGZA 2WFEA 1H3NA 2AJHA 4AS1A 2AJIA 1QU2A 3PZ0A 1WZ2A 3ZJVA 3ZJTA 4ARIA 2BTEA 1OBHA 4K48A 3ZJUA 5AGIA 1UDZA 1WKAA 2WFDA 5AGSA 4CQNA 1JZSA 2V0GA 2WFGA 1QU3A 2AJGA 1UE0A 4ARCA 5AGJA 1FFYA 1OBCA 4AQ7A 1JZQA 2V0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AGR A;  1WNZ A;  1IVS A;  1WNY A;  3PZ5 A;  1WK9 A;  1ILE A;  3O0A A;  1WKB A;  1WK8 A;  3PZ6 A;  5AGT A;  1GAX A;  4K47 A;  5AGH A;  2BYT A;  3ZGZ A;  2WFE A;  1H3N A;  2AJH A;  4AS1 A;  2AJI A;  1QU2 A;  3PZ0 A;  1WZ2 A;  3ZJV A;  3ZJT A;  4ARI A;  2BTE A;  1OBH A;  4K48 A;  3ZJU A;  5AGI A;  1UDZ A;  1WKA A;  2WFD A;  5AGS A;  4CQN A;  1JZS A;  2V0G A;  2WFG A;  1QU3 A;  2AJG A;  1UE0 A;  4ARC A;  5AGJ A;  1FFY A;  1OBC A;  4AQ7 A;  1JZQ A;  2V0C A; 
#chains in the Genus database with same CATH topology
 5AGR A;  1WNZ A;  1IVS A;  1WNY A;  3PZ5 A;  1WK9 A;  1ILE A;  3O0A A;  1WKB A;  1WK8 A;  3PZ6 A;  5AGT A;  1GAX A;  4K47 A;  5AGH A;  2BYT A;  3ZGZ A;  2WFE A;  1H3N A;  2AJH A;  4AS1 A;  2AJI A;  1QU2 A;  3PZ0 A;  1WZ2 A;  3ZJV A;  3ZJT A;  4ARI A;  2BTE A;  1OBH A;  4K48 A;  3ZJU A;  5AGI A;  1UDZ A;  1WKA A;  2WFD A;  5AGS A;  4CQN A;  1JZS A;  2V0G A;  2WFG A;  1QU3 A;  2AJG A;  1UE0 A;  4ARC A;  5AGJ A;  1FFY A;  1OBC A;  4AQ7 A;  1JZQ A;  2V0C A; 
#chains in the Genus database with same CATH homology
 5AGR A;  1WNZ A;  1IVS A;  1WNY A;  3PZ5 A;  1WK9 A;  1ILE A;  3O0A A;  1WKB A;  1WK8 A;  3PZ6 A;  5AGT A;  1GAX A;  4K47 A;  5AGH A;  2BYT A;  3ZGZ A;  2WFE A;  1H3N A;  2AJH A;  4AS1 A;  2AJI A;  1QU2 A;  3PZ0 A;  1WZ2 A;  3ZJV A;  3ZJT A;  4ARI A;  2BTE A;  1OBH A;  4K48 A;  3ZJU A;  5AGI A;  1UDZ A;  1WKA A;  2WFD A;  5AGS A;  4CQN A;  1JZS A;  2V0G A;  2WFG A;  1QU3 A;  2AJG A;  1UE0 A;  4ARC A;  5AGJ A;  1FFY A;  1OBC A;  4AQ7 A;  1JZQ A;  2V0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...