1UDZA

Isoleucyl-trna synthetase editing domain
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
179
structure length
179
Chain Sequence
b'PSVYVRFPLKEPKKLGLEKASLLIWTTTPWTLPGNVAAAVHPEYTYAAFQVGDEALILEEGLGRKLLGEGTPVLKTFPGKALEGLPYTPPYPQALEKGYFVVLADYVSQEDGTGIVHQAPAFGAEDLETARVYGLPLLKTVDEEGKLLVEPFKGLYFREANRAILRDLRGRGFLFKEES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Isoleucyl-tRNA synthetase
publication title Crystal structures of the CP1 domain from Thermus thermophilus isoleucyl-tRNA synthetase and its complex with L-valine.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ligase
total genus 51
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 6.1.1.5: Isoleucine--tRNA ligase.
pdb deposition date 2003-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.740.10 Alpha Beta Alpha-Beta Complex Isoleucyl-tRNA Synthetase; domain 2 Valyl/Leucyl/Isoleucyl-tRNA synthetase, editing domain 1udzA00
1WNZA 1WNYA 1IVSA 5AGHA 1OBHA 2WFDA 5AGIA 3ZJVA 2BTEA 5AGRA 2AJGA 2V0GA 4ARCA 1UE0A 1ILEA 4K47A 1H3NA 2BYTA 1WKBA 4ARIA 1JZQA 3PZ0A 4K48A 5AGJA 2AJIA 3PZ5A 4AS1A 5AGTA 1WK9A 1WKAA 5AGSA 1WZ2A 3ZJUA 2WFGA 2V0CA 4CQNA 1FFYA 3ZGZA 2WFEA 1OBCA 3O0AA 2AJHA 1QU2A 1QU3A 1UDZA 4AQ7A 3PZ6A 1GAXA 1JZSA 1WK8A 3ZJTA
chains in the Genus database with same CATH superfamily
1WNZA 1WNYA 1IVSA 5AGHA 1OBHA 2WFDA 5AGIA 3ZJVA 2BTEA 5AGRA 2AJGA 2V0GA 4ARCA 1UE0A 1ILEA 4K47A 1H3NA 2BYTA 1WKBA 4ARIA 1JZQA 3PZ0A 4K48A 5AGJA 2AJIA 3PZ5A 4AS1A 5AGTA 1WK9A 1WKAA 5AGSA 1WZ2A 3ZJUA 2WFGA 2V0CA 4CQNA 1FFYA 3ZGZA 2WFEA 1OBCA 3O0AA 2AJHA 1QU2A 1QU3A 1UDZA 4AQ7A 3PZ6A 1GAXA 1JZSA 1WK8A 3ZJTA
chains in the Genus database with same CATH topology
1WNZA 1WNYA 1IVSA 5AGHA 1OBHA 2WFDA 5AGIA 3ZJVA 2BTEA 5AGRA 2AJGA 2V0GA 4ARCA 1UE0A 1ILEA 4K47A 1H3NA 2BYTA 1WKBA 4ARIA 1JZQA 3PZ0A 4K48A 5AGJA 2AJIA 3PZ5A 4AS1A 5AGTA 1WK9A 1WKAA 5AGSA 1WZ2A 3ZJUA 2WFGA 2V0CA 4CQNA 1FFYA 3ZGZA 2WFEA 1OBCA 3O0AA 2AJHA 1QU2A 1QU3A 1UDZA 4AQ7A 3PZ6A 1GAXA 1JZSA 1WK8A 3ZJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WNZ A;  1WNY A;  1IVS A;  5AGH A;  1OBH A;  2WFD A;  5AGI A;  3ZJV A;  2BTE A;  5AGR A;  2AJG A;  2V0G A;  4ARC A;  1UE0 A;  1ILE A;  4K47 A;  1H3N A;  2BYT A;  1WKB A;  4ARI A;  1JZQ A;  3PZ0 A;  4K48 A;  5AGJ A;  2AJI A;  3PZ5 A;  4AS1 A;  5AGT A;  1WK9 A;  1WKA A;  5AGS A;  1WZ2 A;  3ZJU A;  2WFG A;  2V0C A;  4CQN A;  1FFY A;  3ZGZ A;  2WFE A;  1OBC A;  3O0A A;  2AJH A;  1QU2 A;  1QU3 A;  1UDZ A;  4AQ7 A;  3PZ6 A;  1GAX A;  1JZS A;  1WK8 A;  3ZJT A; 
#chains in the Genus database with same CATH topology
 1WNZ A;  1WNY A;  1IVS A;  5AGH A;  1OBH A;  2WFD A;  5AGI A;  3ZJV A;  2BTE A;  5AGR A;  2AJG A;  2V0G A;  4ARC A;  1UE0 A;  1ILE A;  4K47 A;  1H3N A;  2BYT A;  1WKB A;  4ARI A;  1JZQ A;  3PZ0 A;  4K48 A;  5AGJ A;  2AJI A;  3PZ5 A;  4AS1 A;  5AGT A;  1WK9 A;  1WKA A;  5AGS A;  1WZ2 A;  3ZJU A;  2WFG A;  2V0C A;  4CQN A;  1FFY A;  3ZGZ A;  2WFE A;  1OBC A;  3O0A A;  2AJH A;  1QU2 A;  1QU3 A;  1UDZ A;  4AQ7 A;  3PZ6 A;  1GAX A;  1JZS A;  1WK8 A;  3ZJT A; 
#chains in the Genus database with same CATH homology
 1WNZ A;  1WNY A;  1IVS A;  5AGH A;  1OBH A;  2WFD A;  5AGI A;  3ZJV A;  2BTE A;  5AGR A;  2AJG A;  2V0G A;  4ARC A;  1UE0 A;  1ILE A;  4K47 A;  1H3N A;  2BYT A;  1WKB A;  4ARI A;  1JZQ A;  3PZ0 A;  4K48 A;  5AGJ A;  2AJI A;  3PZ5 A;  4AS1 A;  5AGT A;  1WK9 A;  1WKA A;  5AGS A;  1WZ2 A;  3ZJU A;  2WFG A;  2V0C A;  4CQN A;  1FFY A;  3ZGZ A;  2WFE A;  1OBC A;  3O0A A;  2AJH A;  1QU2 A;  1QU3 A;  1UDZ A;  4AQ7 A;  3PZ6 A;  1GAX A;  1JZS A;  1WK8 A;  3ZJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...