1UECA

Crystal structure of autoinhibited form of tandem sh3 domain of p47phox
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
180
structure length
177
Chain Sequence
b'ILQTYRAIADYEKSEMALSTGDVVEVVEKSESGWWFCQMKAKRGWIPASFLEPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYLQKSGQDVSQAQRQIKRGAPPRRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFLQQRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil cytosol factor 1
molecule tags Signaling protein
source organism Homo sapiens
publication title A molecular mechanism for autoinhibition of the tandem SH3 domains of p47phox, the regulatory subunit of the phagocyte NADPH oxidase
pubmed doi rcsb
total genus 39
structure length 177
sequence length 180
ec nomenclature
pdb deposition date 2003-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF16621 NECFESHC SH3 terminal domain of 2nd SH3 on Neutrophil cytosol factor 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1uecA02
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1uecA01
2ESWA 1LCKA 4LNPA 1HJDA 2EYYA 3I5RA 2I0NA 3I9QA 1QCFA 5L23A 1SPKA 2YT6A 2EYXA 4AG1C 3NGPA 2RMOA 3PVLA 1S1NA 2HSPA 4JJBA 4ORZA 3LH5A 1CSKA 2GGRA 1I1JA 2KXDA 3NHNA 2FO0A 2RQWA 4GBQA 1AEYA 3VS4A 3A98A 2BZXA 1AVZC 3NPFA 5IH2A 2C0OA 4X1VA 1ZLMA 1U5SA 4EIKA 1JO8A 1MV3A 2GTOA 4DEXA 2VWFA 1M8MA 2KBTA 2RQRA 4HVVA 5FWCA 2O9SA 1QKWA 1BBZA 1AWJA 2OJ2A 3SHWA 4J9IA 2D1XA 3VS0A 2DRMA 2LP5A 1QWEA 2EGEA 2MIOA 1RLQC 1QLYA 4AG2C 2C0TA 1ZUYA 2YUOA 2D8HA 1WYXA 3NMZC 2J05A 2P4RA 1X27A 1K0SA 2EYZA 2ROLA 3VRYA 1AZGB 2DF6A 2V1QA 2EKHA 1UFFA 2XMFA 1OOTA 2YUQA 1AOJA 2NWMA 1PNJA 1YCSB 1JU5C 1Z9QA 1G2BA 2LNHB 4OMNA 1PRMC 3EG0A 1WXUA 4Z89A 2C0IA 3EG3A 2AK5A 4FSSA 4R0KA 2LQWA 3REBB 2ECZA 5I11A 1SHFA 1UTIA 2LQNA 1UHFA 2QDLA 3CQTA 1W1FA 1FYNA 1HD3A 2DA9A 2K6DA 1NG2A 2PTKA 2ABLA 1Z9ZA 2HBWA 1E7OA 5HCKA 1AWXA 1EFNA 1I0CA 1E6HA 2JS2A 1NEBA 2F2VA 1MV0B 2LMJA 3UATA 2KNBB 2B86A 1BU1A 2O9VA 1HSQA 2SEMA 2OI3A 1UJ0A 4RTTA 2ED0A 1X6GA 5IHKA 1BB9A 2AKLA 1KSWA 1OPLA 1VYUA 1NM7A 1SHGA 2CDTA 1M3CA 2L3PA 3UF4A 2K7AA 1WXBA 1KFZA 1K4US 2PNIA 3QWYA 2KROA 2RF0A 4AFZC 2DX1A 4JPBW 2LJ3A 2CUDA 2L2PA 4Z8AA 4JJDA 1RLPC 2KR3A 1AD5A 1IO6A 1KJWA 2KYBA 4F16A 1WX6A 2J7IA 1A0NB 2A28A 4WCIA 1G83A 1UE9A 2DL7A 1N5ZA 1K1ZA 1B07A 3KFVA 1GCPA 4E6RA 4LUEA 2RQUA 2EW3A 1PRLC 2YDLA 4J9DA 2FPEA 2DBMA 2FRWA 2JS0A 1GL5A 3C0CA 1PKSA 2CSQA 5IXBA 1YWOA 2D0NA 1UG1A 1H92A 2F2WA 2E5KA 1GBRA 2L3QA 1U06A 2DRKA 4AFUC 4RTZA 1NLPC 4JZ4A 3VS3A 1UJYA 4Y92A 1H8KA 1E6GA 2DVJA 3QWXX 2FEIA 2M0YA 1GFCA 1OEBA 3VRZA 4RUGA 3GBQA 2EQIA 2CUBA 2JM9A 5I22A 2X3XD 1AWWA 1X2QA 1U3OA 1NYGA 1UUEA 3IQLA 4OMPA 3RBBB 2DL4A 1X43A 2MCNA 2LZ6B 1MUZA 4LUDA 4CC7A 1TUCA 5FWBA 4KRTA 1QWFA 4GLMA 1J3TA 4CC4B 2CH4A 2RN8A 1OPKA 1UGVA 1YWPA 1AWOA 1JXMA 2D8JA 4J9EA 3UA6A 1M3BA 1NYFA 1SRLA 2BZ8A 2KE9A 2KGTA 1ABOA 1W6XA 4J9GA 3H0FA 3VS5A 1M27C 2RNAA 2G6FX 3I5SA 4LE9A 4RTXA 1T3LA 2M51A 3EG1A 2JMCA 2DL5A 3TVTA 4AFQC 2J6OA 1GRIA 1SRMA 1V1CA 1RI9A 2O2OA 1WIEA 3M0SA 1PKTA 1T3SA 2DL8A 1GFDA 2H8HA 1T0JA 5GJVB 4D8DA 2ROTA 1ZUKA 2CT3A 1KIKA 3H0HA 4K11A 2JM8A 4CC2A 3M0UA 5IXFA 1AZEA 2YUPA 4J9FA 4OMMA 2L0AA 1RUWA 1YP5A 2K3BA 2EPDA 2J06A 4QT7A 1H3HA 4Z88A 3SEMA 2KEAA 3REAB 3EHRA 2W10A 2J6FA 3PE0A 4OMOA 2YSQA 1OV3A 2CH4W 1XOVA 2JT4A 2HEQA 1VYTA 1ZX6A 2DLPA 4J9HA 3EGUA 2PZ1A 2EYWA 3M0TA 1SSHA 1WI7A 4IIMA 4CC3A 1PWTA 2FPDA 3H0IA 2FG0A 2GQIA 1NLOC 2A36A 2BTTA 1M3AA 2JW4A 4D8KA 4F17A 2FRYA 2HCKA 2RQVA 1GCQA 3TSZA 1PHTA 1BK2A 2ED1A 2DNUA 4RTWA 2CREA 2DMOA 2X3WD 1YN8A 1WFWA 4HXJA 5IHIA 1YNZA 1VA7A 4OMQA 1JEGA 1UDLA 2OAWA 2F2XA 2DBKA 3FJ5A 1W70A 1GCQC 4A63B 1ARKA 2NUZA 2KXCA 1JQQA 2AKKA 1UECA 4J9BA 1X6BA 2EVRA 3EHQA 4DEYA 1TUDA 2FPFA 2VKNA 1X69A 4OMLA 3M0QA 2YUNA 1K9AA 2KT8A 2V1RA 1CKBA 3O5ZA 1WDXA 2KRSA 1Y0MA 2AZSA 1ZUUA 5ECAA 4RTVA 2DILA 2DYBA 3TSWA 1UHCA 4LN2A 2AZVA 3M0PA 2K2MA 2KRNA 2ENMA 4HVWA 4F14A 1WXTA 3EG2A 4IIOA 3PVQA 5GJWB 1ZSGA 1X2KA 1ZBJA 2MOXA 5IHNA 2GTJA 1ABQA 1VYVA 1GBQA 3VS6A 2JTEA 2JXBA 2A08A 2EGCA 2K79A 2SRCA 2O88A 2W0ZA 1I07A 2IIMA 4RTUA 1JXOA 1M30A 1CKAA 1WLPB 4AFSC 4M4ZA 1SEMA 2DM1A 3THKA 1WA7A 4HVUA 1K76A 3H41A 2KT1A 3M0RA 2HDAA 4ZNXA 3I35A 2L3SA 2LJ1A 2CT4A 5EC7A 3R6NA 2LCSA 3VS1A 2CSIA 2RPNA 2RQTA 3UA7A 2K9GA 1B3QA 1NEGA 4HCKA 2GBQA 4ESRA 3U23A 3ULRB 1K0XA 3VS2A 2EGAA 2KRMA 4JZ3A 3ZL7C 1TG0A 2DL3A 2EBPA 2A37A 1T0HA 4RTYA 1Y57A 2KYMA 2LX7A 2GNCA 2LJ0A 1QKXA 2BZYA 2O31A 3JV3A 3RNJA 2JMAA 2DE0X 2J6KA 4JJCA 4J9CA 3VS7A 2VVKA 1FMKA 5FW9A 2DJQA
chains in the Genus database with same CATH superfamily
2PVDB 3CCEQ 4LNPA 3MCAB 3I5RA 5L23A 2YT6A 1V29B 4AG1C 2PQWA 3VUBA 4EMKC 3HFNA 4Y28E 3CC4A 4Q5WA 3I55Q 4JJBA 4ORZA 4KH1B 1ZSZB 2GGRA 2JZ2A 3JCMd 2XG8D 3ZBDA 2FO0A 3TEEA 2DXUA 4OP0A 3KBGA 4E7IA 3VV0A 1YBYA 1AVZC 2C0OA 5CKBA 2RJDA 2YLBA 4FW2A 4B9WA 5GANg 2RQRA 2CP5A 5GAOp 1QKWA 1BBZA 3H8ZA 3GLXA 4NOYA 3SHWA 2E5QA 4OGCA 4J9IA 2NUPA 1R77A 3JCMJ 2DTOA 1BIBA 3JB9F 4YTLA 4ZN3A 4F04B 4LD9K 5GAMf 1KQ2A 1R0BG 4LDUA 3EGDB 5LJ3e 4IUVA 3NMZC 1RACB 2P4RA 1K0SA 2DJZA 4XK8E 1B34B 2EYZA 1NJIU 3G6EA 1YIJA 4DBRA 5KE2A 3M59A 2D6FA 1PNJA 4JS5A 1K73U 2RHXA 1OZ2A 1JBMA 1PRMC 2K3XA 3EG0A 3RKXA 1WXUA 2A3LA 2C0IA 3EG3A 2HKNA 4R0KA 3V8JA 3T9NA 3CCLT 4JS4A 2ECZA 5I11A 3SWNA 3CCVA 4BE2A 4BB7A 5KH6A 5DY9A 1FYNA 4M7AA 5FRMA 4FM4B 2X4WA 3QUIA 2ABLA 4A54A 1E7OA 1Q82R 3CCMA 1E6HA 4ELZC 4DOWA 1MGQA 2XIDA 4HCCA 2HL5C 1RABB 4C0DB 4M7DG 4RTTA 2Y4YA 3SWNC 1BB9A 4QVZA 2HKQB 1K8AR 2QQRA 3E19A 1SHGA 2B8AA 1M3CA 5LJ5e 2K7AA 3FJPA 1K4US 3QWYA 1QVPA 2RF0A 2JTFA 3J80E 2CUDA 2GFAA 3CMEQ 2E70A 1RLPC 1AD5A 4EPCA 3N5BB 2XI9A 2RD1A 4CI0C 1QCNA 1GCPA 1KC8U 2EW3A 2RH2A 2DBMA 2FRWA 2Z0WA 1YHQA 4FT2A 2JOYA 4D6WA 4OB2B 4J8OA 2E5KA 3GF5A 3VS3A 1UJYA 1H8KA 5FU6C 3UT1A 1ZA1B 1WQWA 3QWXX 2DVJA 2RM4A 5GAN7 2BE9B 1TH7A 3VRZA 3GIBA 4IUUA 4RUGA 1OZ3A 3JCMf 2IVWA 2DFUA 5I22A 3S6WA 1X2QA 3PTAA 3CMET 2CS7A 3G1JA 3IQLA 2ZPHB 2CKKA 4M7DF 2DVEA 3RIRA 3CC4Q 3EFRA 5I2MA 3M4GA 1D1BA 4CC4B 2CH4A 4C8QD 3CCEA 2EIFA 4II1A 4J9EA 3UA6A 4R55A 1NYFA 3A8MB 2BZ8A 2KGTA 5GMKi 4BDZA 2YRVA 2LNVA 1W6XA 2OTLA 4XTVA 4X9DA 3PGGA 1S72Q 4NL2A 1WJRA 3EG1A 2DL5A 4M78D 4AT1B 4AFQC 1G3TA 2J6OA 5IN1A 4KGZB 2P0KA 2M9UA 2YRCA 3OYMA 3JB9D 5KYXB 1QW1A 5FROA 1SKUB 4MZPA 2ROTA 1KIKA 1Q81R 1KQ1A 5CQXA 4E7HA 1WJQA 1RUWA 3WVEB 3UDCA 1OU8A 4FSXA 1WHGA 3NTIA 4Z88A 3Q1JA 3M54A 2KAFA 3EHRA 3DKMA 2RHIA 2J6FA 3OSSC 5CKDA 3VKIA 4IUPA 4PL6A 2LCCA 2CH4W 4PJOA 2HNIA 2FVUA 2HEQA 3MHXA 3FC3A 3EAEA 2DLPA 4FYWB 1UEBA 3M57A 4C5EA 3EGUA 3GOXA 3M0TA 4IIMA 4WTOB 5HK0A 1JJ2S 2YHTA 5KCHA 1PWTA 2FPDA 3H0IA 5GAMd 2BTTA 1K9MC 4E47A 3C12A 1M3AA 2FRYA 1EX4A 5FU6B 2QEXQ 1VQ4A 4PJMA 1KG1A 3QXEB 2FHDA 5J26A 2HAXA 3HKSA 2ED1A 3CCRQ 2DNUA 2OTJA 2X3WD 1YN8A 3TREA 5GAN2 3OW2A 4J5YA 2L8DA 1YI2Q 3QO3A 1OU9A 2DBKA 1OX8A 4JUVA 1W70A 2V8IA 4HA8A 1GCQC 4QKUA 3S3NA 2NUZA 2QDYB 2KXCA 4FYXB 3E1SA 1KD1C 2XD0A 4C8QB 2LRQA 3A5ZB 2K2VA 3CCRA 1Q82C 5D6WA 4E7SA 1X6BA 3OYHA 1TXQA 3EHQA 3QJ6A 2E3IA 3L2RA 3JCMb 4C92B 4FYYB 3M0QA 2YUNA 2RJEA 1K9AA 4KGXB 2V1RA 5LJ3j 1RAAB 1D3BB 1WDXA 2ZGWA 1I4K1 3A8GB 4N0AA 1M90U 4LN2A 5GMKj 3M0PA 4C0DC 4A4GA 2ENMA 1WXTA 3JCMc 1W4SA 3PVQA 2Y90A 5GAMg 1QVFS 3QG1A 2HQXA 3V8KA 1VYVA 3LWHA 2DEUA 3HP9A 3L42A 1I8FA 4MZMA 2MPXC 4PJOB 3URGA 4KGVB 4FL6A 4ANJA 1SEMA 2LC4A 1MNDA 3THKA 1VQPQ 2PUKB 1WA7A 3L2ZA 3I55T 4ZNXA 3H41A 1MHNA 2HDAA 3M0RA 3I35A 2L3SA 5EG2A 1ZSZA 4PJOD 2EQUA 2DIGA 1MMAA 4JRIA 4HCKA 4ESRA 1K0XA 2E10A 3R6OA 2QGGA 1TG0A 1AT1B 4RTYA 1Q86U 2X4YA 2OTLQ 4C5HA 5KYYB 2LX7A 1QKXA 2JMAA 3CCQQ 4N4GA 3L2UA 4QW2A 4J9CA 3VS7A 1OYXA 3QKJA 2DJQA 2ESWA 2BIVA 2EYYA 3BDUA 4NL3A 2I0NA 2JJ9A 2NYSA 1WJSA 2EYXA 1VQ9A 3PVLA 2HSPA 2WSCE 3LH5A 1CSKA 1I1JA 1SG5A 3SD4A 2RQWA 2QASA 2K5LA 3JSCA 1M2VB 4ZTFA 1OULA 4E7ZA 4EIKA 2FL7A 2PU9B 4ATOA 4XU1A 2VWFA 2KBTA 4HVVA 2CP2A 2EKOA 5FWCA 1G8XA 1KQSP 3ER0A 5KYWB 4C92D 1YJWT 4M7AB 2DRMA 2D0QB 2NUPB 2X4XA 1MNEA 2QA4T 4JRKA 2DPPB 2GFUA 2Y4XA 4OGEA 2LVMA 1VQ8T 3CD6T 2D8HA 2ZPIB 1TUGB 2E6ZA 5LJ5g 1X27A 3D7SB 2M16A 2EQKA 2ROLA 3CBPA 3M53A 3DB3A 2DF6A 1UFFA 2KY9A 2NWMA 5CAIA 3HRTA 3RERA 1G2BA 2LNHB 5CIUA 1IZ6A 4OMNA 2DK3A 3EFOB 1YI2T 1WNLA 4EMKA 4DA4A 1HXDA 4A4EA 1O9SA 3OS0A 1U1TA 4M7DA 4N4IA 3RMSA 1W1FA 3X25B 3VYHB 1HD3A 2NUTA 3TCJA 4TVRA 2K6DA 2WSEE 3H6ZA 3G4SQ 5KYWA 2KSSA 2K5IA 2LMJA 1BCOA 2E12A 1ACMB 1BU1A 3EGXB 3G7ZA 1HSQA 2PUOB 3CCMQ 3JCMe 5C6SA 2OI3A 2DETA 4ZTJA 1VQ9T 1X6GA 1ZSZC 2AKLA 2QG9B 1YIJT 3V7RA 3CC7Q 3LGLA 3M5AA 1Y07A 4FU6A 3EG9A 2RK1A 4AMCA 3UF4A 4PJOE 5FU7B 2PNIA 2KROA 3LX7A 4AFZC 2DX1A 2MMPA 2L2PA 3CC2A 4JJDA 4M75A 2WACA 8AT1B 5DM7R 4C92C 1QP2A 4F16A 4FCYA 2J7IA 3QSUA 1JB0E 1UE9A 4L6V5 3P8HA 1YHQQ 4GY5A 2COZA 1O75A 2YDLA 2FPEA 1NBEB 1GL5A 1PKSA 5IT9E 1M2OA 4B6MA 1WHHA 2XDDA 1UG1A 1H92A 3M56A 2F2WA 4JJNK 4ZGJB 4M78F 1Q7YU 3PIPA 2DRKA 1RAIB 2FZCB 1S72T 4Y92A 2F5KA 1BCMA 1PD0A 1GFCA 1NPPA 1OEBA 8ATCB 3ZEHA 2ZCFB 4HKEA 2EQIA 3ASKA 4PJOG 1AWWA 5AYFA 2M0OA 3RBBB 2DL4A 4J7FA 3BDLA 2MCNA 1IGQA 2QTXA 1MUZA 1W2BS 2CZ0B 3G4SA 2RB6A 5GANd 4KRTA 4ELYC 1N6AA 1J3TA 5IAYA 2RI5A 3JB9J 2RN8A 1OPKA 5A0GA 1KQSS 1AWOA 3NTKA 4HCZA 4L5GA 2E41A 1SRLA 3OW2P 3CPFA 5FRNA 4LDVA 2DEQA 4J9GA 4BE1A 3MEUA 1VQOT 3MO8A 4F7UE 4M7DD 1Y7XA 2VGMA 1SRMA 1V1CA 4B9XA 5HY6A 1RI9A 4EDUA 3S3MA 2QA4Q 1WIEA 3RR6A 4C8QF 4XAXB 1X6OA 4PJOC 3GPLA 3OYAA 2OTJT 1GFDA 2H8HA 5GJVB 5LL6S 4D8DA 1ZUKA 2EJFA 5LJ3f 2YUPA 2RO0A 1KC8C 2R5AA 2RI3A 1YP5A 1VQ8Q 4M78G 3CD6Q 2J06A 2X4JA 4J6XA 1M90C 3CCET 3SEMA 3OYNA 4OMOA 2YSQA 3CBMA 2YXYA 4C0GA 4M77C 3TU4K 2RI2A 1K9MU 2JT4A 2OTLT 3OY9A 1VYTA 4A4KA 2MYSA 5CKFA 3DB4A 4V2SA 2IG0A 4JDSA 1K8AC 3A8OB 4HCBA 3RESA 1VQMT 3G4ST 2JW4A 2RJFA 2QQSA 4F17A 2EAYA 1KHIA 2E6NA 1PHTA 2E4HA 1D1CA 1WHJA 1TSFA 5IHIA 1HYOA 4OMQA 1JEGA 6AT1B 3CCJQ 4C8QG 3SWNB 2IPOB 2F2XA 4C5GA 3FJ5A 3V8LA 1W2BA 2DZ9A 4A63B 2P84A 2CP7A 3LH0A 1VQPA 3MPUB 3CC7T 4A4HA 4M77E 3META 3WVDB 2AKKA 3CCUA 1KQSA 3CEYA 4J9BA 3VU3C 3JAME 1D0ZA 3FB9A 2EVRA 1LVKA 4BD3A 1TUDA 2LQKA 2VKNA 4OMLA 1WHLA 1B34A 2AIRB 5KYNA 1Y71A 3QBYA 4FIBA 3O5ZA 1OX9A 4KUIA 4IUQA 1LNXA 4BY6B 5L8RE 2P4TA 1MMDA 2KRNA 4LD6A 3A8LB 1KC8R 5GAOr 4RMOA 1FMVA 5GJWB 1ZSGA 1X2KA 3OYYA 3MEWA 1D0YA 2MOXA 3UWNA 2GTJA 5FLXE 2QXFA 1GBQA 3VS6A 2JTEA 1GXIE 1XNIA 2W0ZA 1XQHA 3G6ET 4RTUA 1I5LA 1M4ZA 1FMWA 5D7UA 1VQNT 1FXXA 4AFSC 5J3BA 2QYZA 1RAEB 5KE3A 4HVUA 1VQMA 2LT1A 4PFPA 1VQKT 1X75C 5CVIA 2LCSA 3VS1A 1VQ7T 2RPNA 1PD1A 3JCMh 1B3QA 1NEGA 2GBQA 5KYUB 1U8RA 3VS2A 2RK2A 2EGAA 3DLLA 2KRMA 2H3EB 4E7KA 2DL3A 2LX9A 2EBPA 2A37A 3G71T 2JVVA 1VQ4Q 4M78C 4KUDK 1T0HA 3LLRA 2NLUA 3LGFA 4RCCA 2JN0A 2GNCA 5D6YA 2O31A 3JV3A 2VYTA 4KT0E 2KVQG 2LT4A 5GMKe 4JJCA 2VVKA 5FW9A 1YITQ 2HBPA 3X26B 1LCKA 1U1SA 4M75D 4X34A 3CCUT 1QVFA 1SPKA 1M90R 2QTVA 4FW1A 4PLLA 2RMOA 5GAN4 1LJOA 2FYKA 1VQ6Q 2DTHA 2KXDA 4GBQA 3GP8A 1H3ZA 3L2QA 1IGUA 3BE3A 3VS4A 3ME9A 1D1AA 5IH2A 3EH2A 1MV3A 1M8MA 3A1PA 2O9SA 1PCXA 2OJ2A 2COYA 4MMKA 3VS0A 1G3WA 3JCMP 2QAZA 1QWEA 1Q86R 4AG2C 2LDMA 4M78E 3OYLA 1WYXA 3AHUA 2J05A 3V7SA 3CCUQ 3VRYA 3OYDA 3OSVA 1W2BP 1PC0A 4QVDA 3QIIA 1VQNA 3M58A 1AOJA 3L2WA 3OA6A 3MP1A 1Z9QA 4O5VA 5GAOm 4XTYA 3CCJA 2EJGA 3MP6A 1KHCA 1KK7A 2X51A 4Z89A 5GMKl 4ME7A 2LQWA 3REBB 3OYBA 1SSFA 5KYUA 3PMTA 3CCSQ 9ATCB 2LQNA 3CQTA 4C92E 1NJIC 3AT1B 2LTOA 4RG2A 3TQ7P 3J7AF 5GANj 5C0MA 1RI0A 1V76A 2PTKA 2HBWA 1AWXA 3I56A 1N27A 1RL2A 2EQMA 2KNBB 2K4YA 2B86A 4F7UG 1C0MA 5CKHA 4HT9A 2SEMA 1BIAA 4M7DE 2CP6A 2ED0A 2GCXA 5IHKA 2PVOB 1NM7A 2CDTA 1BKBA 4KULA 2L3PA 1N8RC 1WXBA 3CCSA 3EG9B 4F7UA 4VUBA 4ZN1A 4JPBW 4QVCA 1N9SA 2BE7D 2DD5A 2K57A 2VC8A 3QDFA 4OMFB 3RKYA 4C92G 4M78A 5GANf 1IO6A 3C4SA 2KYBA 1VQ5T 1WX6A 1G83A 2QK0A 2DL7A 2QQAA 4ZGEB 1QQJA 1M2VA 4LUEA 2F69A 2RQUA 3CC2Q 4J9DA 2JS0A 2JUFA 3C0CA 5CK9A 1Y96A 2CSQA 2JNGA 3QZ9B 1YWOA 4P5NA 3OS2A 2D0NA 2D9TA 4PJNA 3V7CA 2L3QA 1U06A 4AFUC 3RMQA 4Y91A 2KK4A 1P92A 1F1BB 2FEIA 3GBQA 1M8VA 2A7YA 2JM9A 4PNOA 1U3OA 1JJ2A 1UUEA 2ZPGB 4OMPA 2LZ6B 2DXCA 2F1LA 4LUDA 1TUCA 1UGRB 3C95A 4XU2A 1VQ4T 4GLMA 3CC2T 5GAN3 3CCMT 5LJ3h 5A2QE 1UGVA 1YWPA 1N9RA 1C6VX 1JXMA 2D8JA 1PSEA 2BKDN 1IRXA 2CZ7B 4M77G 1QVGS 1TOVA 4C8QC 1ABOA 4E7LA 3H0FA 1LOJA 4NS5A 3VS5A 1Q7YR 1M27C 2X9HA 2O01E 2PVGB 4FT4A 4C8QE 2G6FX 4LE9A 1VQ6T 2RHYA 2DXBA 2M51A 3CCRT 2JMCA 1YIJQ 1RADB 1PKTA 3LW5E 2L3RA 1VQMQ 3EGDA 4IUTA 4M75F 4PJJA 5GMKm 2RHZA 4BY6C 1T0JA 3JB9G 5GAOn 3G6EQ 4LDXA 4M78B 4XQ3A 5I21A 2JM8A 4CC2A 3M0UA 5IXFA 1AZEA 4J9FA 1M1KR 2MAMA 4R56A 2L0AA 4C0FA 2E65A 3E2UA 1YHQT 2FB7A 2CZ1B 4QT7A 3CC7A 2KEAA 3REAB 2W10A 3X24B 5GAN6 1VQ7Q 3F70A 3JCMV 5J39A 1N8RU 5LJ5h 5HK3A 3P8DA 1ZX6A 1RAHB 1MMNA 3VUZA 4J9HA 2PZ1A 3NTHA 2EYWA 4JRQA 4M77A 3EFSA 4CC3A 1IHWA 2FG0A 3I55A 4RG8A 2XDBA 1NZ9A 5GAOl 1KD1R 4D8KA 5GANh 1VIFA 1N8RR 1WHKA 1BK2A 3JCMg 2M02A 4RTWA 1NPRA 4LDWA 2DMOA 1UGPB 4HXJA 5GAMj 1VA7A 2CZ6B 3HL8A 5LJ5d 2QEXT 2L89A 3CCLQ 5DLOA 5GANe 4M75E 5KCOA 3KXTA 4J6WA 3LYIA 1K9MR 1G3YA 1JRIA 1VQNQ 2KMTA 1D0XA 5FU7C 2RHUA 2VASA 1D3BA 2ZPFB 1JQQA 1UECA 1VQKA 3RKWA 1K73C 1I5OB 3LWIA 3DLMA 4DEYA 1VQLT 3QYHB 1X69A 3MJXA 1M1KU 5CCAA 1YJ9T 2CP0A 4C8QA 3OYIA 3CPWS 3SDZA 1CKBA 2K5FA 2CP3A 2MF2A 4FYVB 2AZSA 1ZUUA 4RTVA 2DILA 4OB3B 2DYBA 1OQKA 3TSWA 3HTRA 2AZVA 3PMIA 1DJ7B 4F14A 3HRUA 3EG2A 1YJWA 4IIOA 5CQYA 3VJPA 2QQBA 4M75C 5IHNA 1VQ9Q 1AHJB 1BI2A 4XTZA 2MI6A 1VQ8A 3CD6A 1QVGP 1Y96B 2EGCA 1PM3A 2SRCA 2GF7A 2O88A 1SF9A 2V8KA 3FDRA 4M7DC 5KYXA 1TS9A 2FZKB 3GNFB 3EH1A 2VGNA 3CCQA 5LJ3d 4BE0A 4M4ZA 1VQPT 4N4HA 2RJCA 3HSBA 1K76A 1OI1A 1WGSA 4OVAA 1YI2A 3UA7A 2K9GA 5LJ3g 5GAN5 2V8JA 4WF2A 3FEOA 1K73R 4QQDA 2O4XA 3BFMA 4DOVA 3JCMW 4JZ3A 4A53A 2ZAEA 2QEXA 3E9FA 1Y57A 2KYMA 4LXCA 5LJ5j 2LJ0A 2BZYA 4E2FB 2E3HA 2ATCB 1HK9A 2DE0X 1LPLA 4LDYA 2J6KA 2G3RA 2KDSA 5GAOq 1FMKA 4OF1A 4C5IA 2BUDA 4EMHA 2CGHA 1HJDA 3CBOA 3I9QA 1QCFA 3NGPA 3HHTB 5DLQE 1IB8A 1M1FA 1S1NA 4MMLA 1VQLA 1XJWB 5I2SA 1YJ9A 3CCVT 3NHNA 4XTUA 1X01A 3CXCP 1AEYA 3JB9H 4DBFA 1UB4A 2R5MA 3A98A 2BZXA 1I81A 3CMAA 3INZA 3JCMX 2P0PA 3NPFA 4X1VA 1ZLMA 1U5SA 1JO8A 5HKCA 2GTOA 4DEXA 1ZQ1A 3OYGA 1VQ7A 3PFSA 3PT9A 1AWJA 1IXDA 1QVFP 4XU3A 2D1XA 2LP5A 5M9OA 1D09B 2R57A 3OB9A 2R58A 2EGEA 2MIOA 1RLQC 1QLYA 4PJLA 4BI4A 4C0ZA 2C0TA 1ZUYA 2YUOA 5GAMe 4M7AG 2JTMA 3G71A 3HFOA 2WSFE 4C92A 1AZGB 2V1QA 2EKHA 2XMFA 3KUFA 1OOTA 2YUQA 4BACA 4M7AF 1QP3A 1M1KC 1YCSB 1JU5C 2VXFA 1YJNA 1B7TA 2AT1B 3FIFA 3SFMA 1S72A 2QGFB 2AK5A 4FSSA 3RDVA 4F7UF 2OTJQ 5GAN8 1SHFA 2F5TX 4QQ6A 1UTIA 1IHVA 2KQWA 1UHFA 2QDLA 4XU0A 1VQ5Q 3X28B 2DA9A 3QJYA 1RAFB 2I2LA 4L59A 3UPUA 4MDWA 1NG2A 4PK4A 1Z9ZA 5A0LA 4F7UB 5HCKA 3M4YA 4RKUE 1EFNA 3H9NA 3O8VA 1BI1A 4IURA 1I0CA 2JS2A 1NEBA 2F2VA 4M7DB 1YITT 1MV0B 3UATA 2DIQA 4JLIA 3OBWA 4M7AE 2EJ9A 4EMKB 2O9VA 4HT8A 1UJ0A 4DQ2A 3QYGB 4RCBA 2HQEA 4KBMB 1KSWA 5CKEA 2XKOC 1OPLA 1VYUA 3X20B 3EGXA 1BI0A 2C06A 3HRSA 3CMAT 1KFZA 2DD4A 2M1HA 4PFOA 3SB2A 2LJ3A 3JRZA 4Z8AA 2DZCA 3BY7A 1WQ7A 2KR3A 1KJWA 5GAMh 1A0NB 2DERA 2A28A 4WCIA 1N5ZA 1NE8A 2YLCA 3OQ5A 1K1ZA 2DYIA 1B07A 3MEVA 1FX7A 3KFVA 4E6RA 2QA4A 1PRLC 3L1AA 3NFCA 4M75B 4DBHA 5IXBA 3OS1A 2A0FB 2HD0A 3OMCA 4ZGDB 3I56T 2KI7A 3VYGA 2COWA 1GBRA 1WHMA 2MK5A 5D6XA 4RTZA 1NLPC 4JZ4A 2XDPA 2EYQA 1Q81U 1E6GA 3M9QA 4PKCC 4A4FA 2M0YA 4QQGA 2LCLA 1WPYA 5LJ5f 4M77F 2CUBA 1ZHIA 4Z02A 2X3XD 1NYGA 3OYKA 1X43A 1Q7YC 2L5QA 3CCST 1TTHB 4CC7A 5GMKh 1PG5B 5FWBA 1QWFA 4J83A 3WXMB 4M77B 3OYJA 4DBQA 4OB1B 2DTIA 1VQ5A 1YITA 4CRIA 3I56Q 4GLKA 1M3BA 1QCOA 2KE9A 4JLGA 2DO3A 2FZGB 2LQ8A 3JCMQ 2XICA 2OAUA 2ZPEB 2DKGA 3QZ5B 2RNAA 2RA2A 3MP8A 3I5SA 1YJNQ 3OYFA 4RTXA 1T3LA 2EQJA 7AT1B 3TVTA 1GRIA 4O6JA 4MZTA 4PLIA 2O2OA 1NJIR 1Q82U 3M0SA 4E7JA 1T3SA 2DL8A 1RAGB 3CMEA 1BYMA 2CT3A 1TU0B 3QPHA 3H0HA 4K11A 3ZFJA 3G71Q 1Q95G 4OMMA 4M7AD 2YRDA 2K3BA 2EPDA 2HSEB 3CMAQ 1H3HA 3FRNA 3OS5A 3CPWP 3PE0A 4X9CA 2HMAA 1QMCA 2DXTA 3P8BB 1OV3A 1MMGA 2XK0A 1QVGA 1XOVA 2AHJB 2CYZB 5AT1B 1YCYA 2NUTB 1Q81C 2VXEA 1SSHA 1WI7A 1YJ9Q 1VQ6A 4KH0B 1R0CB 3BW1A 1VQLQ 2GQIA 1R8OB 1ZBXA 2VB6A 1NLOC 2A36A 2DAQA 4JRPA 3OBYA 4J7IA 4PJOF 2HCKA 2EFIA 3C94A 2RQVA 2EWNA 4OB0B 2ZPBB 3CCVQ 1GCQA 2HZYA 3TSZA 3M55A 3OW2S 2OX7A 4N0AC 4BI8B 4BDYA 2CREA 5CO7A 4M77D 1WFWA 1YNZA 4XTXA 3J81E 1UDLA 2OAWA 4PFZA 4XTWA 4EMGA 1WZOA 1YFNA 2QQ9A 2YWWA 1UGQB 2VUBA 1ARKA 3CCQT 1EZZB 1VQOA 4BI3A 1K8AU 5A0DA 3OMGA 3OYCA 2X35A 3CC4T 1VUBA 3HPWA 2FPFA 3MEAA 1FWZA 3FLGA 1KD1U 3QDRB 4UC4A 5KYYA 2KT8A 4J6YA 2KRSA 1Y0MA 1PSFA 5ECAA 2E1HA 1UHCA 1H641 4M75G 2K2MA 1Q86C 2HQHA 2K3YA 3OYEA 4HVWA 3CXCA 3JB9I 1JJ2P 1YJWQ 1ZBJA 1C1AA 3EFOA 1ABQA 3CPWA 2JXBA 2O4XB 2A08A 2K79A 1EIFA 1I07A 2IIMA 1VQKQ 1JXOA 1M30A 3PIOA 1M1GA 1M5Q1 3RUXA 1CKAA 1WLPB 1G5VA 3S3OA 3MKDA 2DM1A 1VQOQ 1UGSB 3GNGA 3PNWC 2VV5A 3CCJT 1ZA2B 4BUGA 2KT1A 1G3SA 3CXCS 2H3JA 2LJ1A 2XHCA 2CT4A 1BI3A 5EC7A 3R6NA 3E9GA 1VOMA 3QHSA 2CSIA 5CR2A 1TWBA 3CCLA 2RQTA 2QI2A 2E64A 1XTDA 2GQVA 3U23A 3ULRB 1VIEA 3L2VA 3A8HB 2P0QA 2HL3A 3ZL7C 2V26A 4IKFA 4M7AC 2MWOA 2MWPA 2XU8A 4MDXA 3RNJA 1IREB 4C92F 1YJNT 2ZZDA 1M9SA
chains in the Genus database with same CATH topology
2ESWA 1LCKA 4LNPA 1HJDA 2EYYA 3I5RA 2I0NA 3I9QA 1QCFA 5L23A 1SPKA 2YT6A 2EYXA 4AG1C 3NGPA 2RMOA 3PVLA 1S1NA 2HSPA 4JJBA 4ORZA 3LH5A 1CSKA 2GGRA 1I1JA 2KXDA 3NHNA 2FO0A 2RQWA 4GBQA 1AEYA 3VS4A 3A98A 2BZXA 1AVZC 3NPFA 5IH2A 2C0OA 4X1VA 1ZLMA 1U5SA 4EIKA 1JO8A 1MV3A 2GTOA 4DEXA 2VWFA 1M8MA 2KBTA 2RQRA 4HVVA 5FWCA 2O9SA 1QKWA 1BBZA 1AWJA 2OJ2A 3SHWA 4J9IA 2D1XA 3VS0A 2DRMA 2LP5A 1QWEA 2EGEA 2MIOA 1RLQC 1QLYA 4AG2C 2C0TA 1ZUYA 2YUOA 2D8HA 1WYXA 3NMZC 2J05A 2P4RA 1X27A 1K0SA 2EYZA 2ROLA 3VRYA 1AZGB 2DF6A 2V1QA 2EKHA 1UFFA 2XMFA 1OOTA 2YUQA 1AOJA 2NWMA 1PNJA 1YCSB 1JU5C 1Z9QA 1G2BA 2LNHB 4OMNA 1PRMC 3EG0A 1WXUA 4Z89A 2C0IA 3EG3A 2AK5A 4FSSA 4R0KA 2LQWA 3REBB 2ECZA 5I11A 1SHFA 1UTIA 2LQNA 1UHFA 2QDLA 3CQTA 1W1FA 1FYNA 1HD3A 2DA9A 2K6DA 1NG2A 2PTKA 2ABLA 1Z9ZA 2HBWA 1E7OA 5HCKA 1AWXA 1EFNA 1I0CA 1E6HA 2JS2A 1NEBA 2F2VA 1MV0B 2LMJA 3UATA 2KNBB 2B86A 1BU1A 2O9VA 1HSQA 2SEMA 2OI3A 1UJ0A 4RTTA 2ED0A 1X6GA 5IHKA 1BB9A 2AKLA 1KSWA 1OPLA 1VYUA 1NM7A 1SHGA 2CDTA 1M3CA 2L3PA 3UF4A 2K7AA 1WXBA 1KFZA 1K4US 2PNIA 3QWYA 2KROA 2RF0A 4AFZC 2DX1A 4JPBW 2LJ3A 2CUDA 2L2PA 4Z8AA 4JJDA 1RLPC 2KR3A 1AD5A 1IO6A 1KJWA 2KYBA 4F16A 1WX6A 2J7IA 1A0NB 2A28A 4WCIA 1G83A 1UE9A 2DL7A 1N5ZA 1K1ZA 1B07A 3KFVA 1GCPA 4E6RA 4LUEA 2RQUA 2EW3A 1PRLC 2YDLA 4J9DA 2FPEA 2DBMA 2FRWA 2JS0A 1GL5A 3C0CA 1PKSA 2CSQA 5IXBA 1YWOA 2D0NA 1UG1A 1H92A 2F2WA 2E5KA 1GBRA 2L3QA 1U06A 2DRKA 4AFUC 4RTZA 1NLPC 4JZ4A 3VS3A 1UJYA 4Y92A 1H8KA 1E6GA 2DVJA 3QWXX 2FEIA 2M0YA 1GFCA 1OEBA 3VRZA 4RUGA 3GBQA 2EQIA 2CUBA 2JM9A 5I22A 2X3XD 1AWWA 1X2QA 1U3OA 1NYGA 1UUEA 3IQLA 4OMPA 3RBBB 2DL4A 1X43A 2MCNA 2LZ6B 1MUZA 4LUDA 4CC7A 1TUCA 5FWBA 4KRTA 1QWFA 4GLMA 1J3TA 4CC4B 2CH4A 2RN8A 1OPKA 1UGVA 1YWPA 1AWOA 1JXMA 2D8JA 4J9EA 3UA6A 1M3BA 1NYFA 1SRLA 2BZ8A 2KE9A 2KGTA 1ABOA 1W6XA 4J9GA 3H0FA 3VS5A 1M27C 2RNAA 2G6FX 3I5SA 4LE9A 4RTXA 1T3LA 2M51A 3EG1A 2JMCA 2DL5A 3TVTA 4AFQC 2J6OA 1GRIA 1SRMA 1V1CA 1RI9A 2O2OA 1WIEA 3M0SA 1PKTA 1T3SA 2DL8A 1GFDA 2H8HA 1T0JA 5GJVB 4D8DA 2ROTA 1ZUKA 2CT3A 1KIKA 3H0HA 4K11A 2JM8A 4CC2A 3M0UA 5IXFA 1AZEA 2YUPA 4J9FA 4OMMA 2L0AA 1RUWA 1YP5A 2K3BA 2EPDA 2J06A 4QT7A 1H3HA 4Z88A 3SEMA 2KEAA 3REAB 3EHRA 2W10A 2J6FA 3PE0A 4OMOA 2YSQA 1OV3A 2CH4W 1XOVA 2JT4A 2HEQA 1VYTA 1ZX6A 2DLPA 4J9HA 3EGUA 2PZ1A 2EYWA 3M0TA 1SSHA 1WI7A 4IIMA 4CC3A 1PWTA 2FPDA 3H0IA 2FG0A 2GQIA 1NLOC 2A36A 2BTTA 1M3AA 2JW4A 4D8KA 4F17A 2FRYA 2HCKA 2RQVA 1GCQA 3TSZA 1PHTA 1BK2A 2ED1A 2DNUA 4RTWA 2CREA 2DMOA 2X3WD 1YN8A 1WFWA 4HXJA 5IHIA 1YNZA 1VA7A 4OMQA 1JEGA 1UDLA 2OAWA 2F2XA 2DBKA 3FJ5A 1W70A 1GCQC 4A63B 1ARKA 2NUZA 2KXCA 1JQQA 2AKKA 1UECA 4J9BA 1X6BA 2EVRA 3EHQA 4DEYA 1TUDA 2FPFA 2VKNA 1X69A 4OMLA 3M0QA 2YUNA 1K9AA 2KT8A 2V1RA 1CKBA 3O5ZA 1WDXA 2KRSA 1Y0MA 2AZSA 1ZUUA 5ECAA 4RTVA 2DILA 2DYBA 3TSWA 1UHCA 4LN2A 2AZVA 3M0PA 2K2MA 2KRNA 2ENMA 4HVWA 4F14A 1WXTA 3EG2A 4IIOA 3PVQA 5GJWB 1ZSGA 1X2KA 1ZBJA 2MOXA 5IHNA 2GTJA 1ABQA 1VYVA 1GBQA 3VS6A 2JTEA 2JXBA 2A08A 2EGCA 2K79A 2SRCA 2O88A 2W0ZA 1I07A 2IIMA 4RTUA 1JXOA 1M30A 1CKAA 1WLPB 4AFSC 4M4ZA 1SEMA 2DM1A 3THKA 1WA7A 4HVUA 1K76A 3H41A 2KT1A 3M0RA 2HDAA 4ZNXA 3I35A 2L3SA 2LJ1A 2CT4A 5EC7A 3R6NA 2LCSA 3VS1A 2CSIA 2RPNA 2RQTA 3UA7A 2K9GA 1B3QA 1NEGA 4HCKA 2GBQA 4ESRA 3U23A 3ULRB 1K0XA 3VS2A 2EGAA 2KRMA 4JZ3A 3ZL7C 1TG0A 2DL3A 2EBPA 2A37A 1T0HA 4RTYA 1Y57A 2KYMA 2LX7A 2GNCA 2LJ0A 1QKXA 2BZYA 2O31A 3JV3A 3RNJA 2JMAA 2DE0X 2J6KA 4JJCA 4J9CA 3VS7A 2VVKA 1FMKA 5FW9A 2DJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ESW A;  1LCK A;  4LNP A;  1HJD A;  2EYY A;  3I5R A;  2I0N A;  3I9Q A;  1QCF A;  5L23 A;  1SPK A;  2YT6 A;  2EYX A;  4AG1 C;  3NGP A;  2RMO A;  3PVL A;  1S1N A;  2HSP A;  4JJB A;  4ORZ A;  3LH5 A;  1CSK A;  2GGR A;  1I1J A;  2KXD A;  3NHN A;  2FO0 A;  2RQW A;  4GBQ A;  1AEY A;  3VS4 A;  3A98 A;  2BZX A;  1AVZ C;  3NPF A;  5IH2 A;  2C0O A;  4X1V A;  1ZLM A;  1U5S A;  4EIK A;  1JO8 A;  1MV3 A;  2GTO A;  4DEX A;  2VWF A;  1M8M A;  2KBT A;  2RQR A;  4HVV A;  5FWC A;  2O9S A;  1QKW A;  1BBZ A;  1AWJ A;  2OJ2 A;  3SHW A;  4J9I A;  2D1X A;  3VS0 A;  2DRM A;  2LP5 A;  1QWE A;  2EGE A;  2MIO A;  1RLQ C;  1QLY A;  4AG2 C;  2C0T A;  1ZUY A;  2YUO A;  2D8H A;  1WYX A;  3NMZ C;  2J05 A;  2P4R A;  1X27 A;  1K0S A;  2EYZ A;  2ROL A;  3VRY A;  1AZG B;  2DF6 A;  2V1Q A;  2EKH A;  1UFF A;  2XMF A;  1OOT A;  2YUQ A;  1AOJ A;  2NWM A;  1PNJ A;  1YCS B;  1JU5 C;  1Z9Q A;  1G2B A;  2LNH B;  4OMN A;  1PRM C;  3EG0 A;  1WXU A;  4Z89 A;  2C0I A;  3EG3 A;  2AK5 A;  4FSS A;  4R0K A;  2LQW A;  3REB B;  2ECZ A;  5I11 A;  1SHF A;  1UTI A;  2LQN A;  1UHF A;  2QDL A;  3CQT A;  1W1F A;  1FYN A;  1HD3 A;  2DA9 A;  2K6D A;  1NG2 A;  2PTK A;  2ABL A;  1Z9Z A;  2HBW A;  1E7O A;  5HCK A;  1AWX A;  1EFN A;  1I0C A;  1E6H A;  2JS2 A;  1NEB A;  2F2V A;  1MV0 B;  2LMJ A;  3UAT A;  2KNB B;  2B86 A;  1BU1 A;  2O9V A;  1HSQ A;  2SEM A;  2OI3 A;  1UJ0 A;  4RTT A;  2ED0 A;  1X6G A;  5IHK A;  1BB9 A;  2AKL A;  1KSW A;  1OPL A;  1VYU A;  1NM7 A;  1SHG A;  2CDT A;  1M3C A;  2L3P A;  3UF4 A;  2K7A A;  1WXB A;  1KFZ A;  1K4U S;  2PNI A;  3QWY A;  2KRO A;  2RF0 A;  4AFZ C;  2DX1 A;  4JPB W;  2LJ3 A;  2CUD A;  2L2P A;  4Z8A A;  4JJD A;  1RLP C;  2KR3 A;  1AD5 A;  1IO6 A;  1KJW A;  2KYB A;  4F16 A;  1WX6 A;  2J7I A;  1A0N B;  2A28 A;  4WCI A;  1G83 A;  1UE9 A;  2DL7 A;  1N5Z A;  1K1Z A;  1B07 A;  3KFV A;  1GCP A;  4E6R A;  4LUE A;  2RQU A;  2EW3 A;  1PRL C;  2YDL A;  4J9D A;  2FPE A;  2DBM A;  2FRW A;  2JS0 A;  1GL5 A;  3C0C A;  1PKS A;  2CSQ A;  5IXB A;  1YWO A;  2D0N A;  1UG1 A;  1H92 A;  2F2W A;  2E5K A;  1GBR A;  2L3Q A;  1U06 A;  2DRK A;  4AFU C;  4RTZ A;  1NLP C;  4JZ4 A;  3VS3 A;  1UJY A;  4Y92 A;  1H8K A;  1E6G A;  2DVJ A;  3QWX X;  2FEI A;  2M0Y A;  1GFC A;  1OEB A;  3VRZ A;  4RUG A;  3GBQ A;  2EQI A;  2CUB A;  2JM9 A;  5I22 A;  2X3X D;  1AWW A;  1X2Q A;  1U3O A;  1NYG A;  1UUE A;  3IQL A;  4OMP A;  3RBB B;  2DL4 A;  1X43 A;  2MCN A;  2LZ6 B;  1MUZ A;  4LUD A;  4CC7 A;  1TUC A;  5FWB A;  4KRT A;  1QWF A;  4GLM A;  1J3T A;  4CC4 B;  2CH4 A;  2RN8 A;  1OPK A;  1UGV A;  1YWP A;  1AWO A;  1JXM A;  2D8J A;  4J9E A;  3UA6 A;  1M3B A;  1NYF A;  1SRL A;  2BZ8 A;  2KE9 A;  2KGT A;  1ABO A;  1W6X A;  4J9G A;  3H0F A;  3VS5 A;  1M27 C;  2RNA A;  2G6F X;  3I5S A;  4LE9 A;  4RTX A;  1T3L A;  2M51 A;  3EG1 A;  2JMC A;  2DL5 A;  3TVT A;  4AFQ C;  2J6O A;  1GRI A;  1SRM A;  1V1C A;  1RI9 A;  2O2O A;  1WIE A;  3M0S A;  1PKT A;  1T3S A;  2DL8 A;  1GFD A;  2H8H A;  1T0J A;  5GJV B;  4D8D A;  2ROT A;  1ZUK A;  2CT3 A;  1KIK A;  3H0H A;  4K11 A;  2JM8 A;  4CC2 A;  3M0U A;  5IXF A;  1AZE A;  2YUP A;  4J9F A;  4OMM A;  2L0A A;  1RUW A;  1YP5 A;  2K3B A;  2EPD A;  2J06 A;  4QT7 A;  1H3H A;  4Z88 A;  3SEM A;  2KEA A;  3REA B;  3EHR A;  2W10 A;  2J6F A;  3PE0 A;  4OMO A;  2YSQ A;  1OV3 A;  2CH4 W;  1XOV A;  2JT4 A;  2HEQ A;  1VYT A;  1ZX6 A;  2DLP A;  4J9H A;  3EGU A;  2PZ1 A;  2EYW A;  3M0T A;  1SSH A;  1WI7 A;  4IIM A;  4CC3 A;  1PWT A;  2FPD A;  3H0I A;  2FG0 A;  2GQI A;  1NLO C;  2A36 A;  2BTT A;  1M3A A;  2JW4 A;  4D8K A;  4F17 A;  2FRY A;  2HCK A;  2RQV A;  1GCQ A;  3TSZ A;  1PHT A;  1BK2 A;  2ED1 A;  2DNU A;  4RTW A;  2CRE A;  2DMO A;  2X3W D;  1YN8 A;  1WFW A;  4HXJ A;  5IHI A;  1YNZ A;  1VA7 A;  4OMQ A;  1JEG A;  1UDL A;  2OAW A;  2F2X A;  2DBK A;  3FJ5 A;  1W70 A;  1GCQ C;  4A63 B;  1ARK A;  2NUZ A;  2KXC A;  1JQQ A;  2AKK A;  1UEC A;  4J9B A;  1X6B A;  2EVR A;  3EHQ A;  4DEY A;  1TUD A;  2FPF A;  2VKN A;  1X69 A;  4OML A;  3M0Q A;  2YUN A;  1K9A A;  2KT8 A;  2V1R A;  1CKB A;  3O5Z A;  1WDX A;  2KRS A;  1Y0M A;  2AZS A;  1ZUU A;  5ECA A;  4RTV A;  2DIL A;  2DYB A;  3TSW A;  1UHC A;  4LN2 A;  2AZV A;  3M0P A;  2K2M A;  2KRN A;  2ENM A;  4HVW A;  4F14 A;  1WXT A;  3EG2 A;  4IIO A;  3PVQ A;  5GJW B;  1ZSG A;  1X2K A;  1ZBJ A;  2MOX A;  5IHN A;  2GTJ A;  1ABQ A;  1VYV A;  1GBQ A;  3VS6 A;  2JTE A;  2JXB A;  2A08 A;  2EGC A;  2K79 A;  2SRC A;  2O88 A;  2W0Z A;  1I07 A;  2IIM A;  4RTU A;  1JXO A;  1M30 A;  1CKA A;  1WLP B;  4AFS C;  4M4Z A;  1SEM A;  2DM1 A;  3THK A;  1WA7 A;  4HVU A;  1K76 A;  3H41 A;  2KT1 A;  3M0R A;  2HDA A;  4ZNX A;  3I35 A;  2L3S A;  2LJ1 A;  2CT4 A;  5EC7 A;  3R6N A;  2LCS A;  3VS1 A;  2CSI A;  2RPN A;  2RQT A;  3UA7 A;  2K9G A;  1B3Q A;  1NEG A;  4HCK A;  2GBQ A;  4ESR A;  3U23 A;  3ULR B;  1K0X A;  3VS2 A;  2EGA A;  2KRM A;  4JZ3 A;  3ZL7 C;  1TG0 A;  2DL3 A;  2EBP A;  2A37 A;  1T0H A;  4RTY A;  1Y57 A;  2KYM A;  2LX7 A;  2GNC A;  2LJ0 A;  1QKX A;  2BZY A;  2O31 A;  3JV3 A;  3RNJ A;  2JMA A;  2DE0 X;  2J6K A;  4JJC A;  4J9C A;  3VS7 A;  2VVK A;  1FMK A;  5FW9 A;  2DJQ A; 
#chains in the Genus database with same CATH topology
 2PVD B;  3CCE Q;  4LNP A;  3MCA B;  3I5R A;  5L23 A;  2YT6 A;  1V29 B;  4AG1 C;  2PQW A;  3VUB A;  4EMK C;  3HFN A;  4Y28 E;  3CC4 A;  4Q5W A;  3I55 Q;  4JJB A;  4ORZ A;  4KH1 B;  1ZSZ B;  2GGR A;  2JZ2 A;  3JCM d;  2XG8 D;  3ZBD A;  2FO0 A;  3TEE A;  2DXU A;  4OP0 A;  3KBG A;  4E7I A;  3VV0 A;  1YBY A;  1AVZ C;  2C0O A;  5CKB A;  2RJD A;  2YLB A;  4FW2 A;  4B9W A;  5GAN g;  2RQR A;  2CP5 A;  5GAO p;  1QKW A;  1BBZ A;  3H8Z A;  3GLX A;  4NOY A;  3SHW A;  2E5Q A;  4OGC A;  4J9I A;  2NUP A;  1R77 A;  3JCM J;  2DTO A;  1BIB A;  3JB9 F;  4YTL A;  4ZN3 A;  4F04 B;  4LD9 K;  5GAM f;  1KQ2 A;  1R0B G;  4LDU A;  3EGD B;  5LJ3 e;  4IUV A;  3NMZ C;  1RAC B;  2P4R A;  1K0S A;  2DJZ A;  4XK8 E;  1B34 B;  2EYZ A;  1NJI U;  3G6E A;  1YIJ A;  4DBR A;  5KE2 A;  3M59 A;  2D6F A;  1PNJ A;  4JS5 A;  1K73 U;  2RHX A;  1OZ2 A;  1JBM A;  1PRM C;  2K3X A;  3EG0 A;  3RKX A;  1WXU A;  2A3L A;  2C0I A;  3EG3 A;  2HKN A;  4R0K A;  3V8J A;  3T9N A;  3CCL T;  4JS4 A;  2ECZ A;  5I11 A;  3SWN A;  3CCV A;  4BE2 A;  4BB7 A;  5KH6 A;  5DY9 A;  1FYN A;  4M7A A;  5FRM A;  4FM4 B;  2X4W A;  3QUI A;  2ABL A;  4A54 A;  1E7O A;  1Q82 R;  3CCM A;  1E6H A;  4ELZ C;  4DOW A;  1MGQ A;  2XID A;  4HCC A;  2HL5 C;  1RAB B;  4C0D B;  4M7D G;  4RTT A;  2Y4Y A;  3SWN C;  1BB9 A;  4QVZ A;  2HKQ B;  1K8A R;  2QQR A;  3E19 A;  1SHG A;  2B8A A;  1M3C A;  5LJ5 e;  2K7A A;  3FJP A;  1K4U S;  3QWY A;  1QVP A;  2RF0 A;  2JTF A;  3J80 E;  2CUD A;  2GFA A;  3CME Q;  2E70 A;  1RLP C;  1AD5 A;  4EPC A;  3N5B B;  2XI9 A;  2RD1 A;  4CI0 C;  1QCN A;  1GCP A;  1KC8 U;  2EW3 A;  2RH2 A;  2DBM A;  2FRW A;  2Z0W A;  1YHQ A;  4FT2 A;  2JOY A;  4D6W A;  4OB2 B;  4J8O A;  2E5K A;  3GF5 A;  3VS3 A;  1UJY A;  1H8K A;  5FU6 C;  3UT1 A;  1ZA1 B;  1WQW A;  3QWX X;  2DVJ A;  2RM4 A;  5GAN 7;  2BE9 B;  1TH7 A;  3VRZ A;  3GIB A;  4IUU A;  4RUG A;  1OZ3 A;  3JCM f;  2IVW A;  2DFU A;  5I22 A;  3S6W A;  1X2Q A;  3PTA A;  3CME T;  2CS7 A;  3G1J A;  3IQL A;  2ZPH B;  2CKK A;  4M7D F;  2DVE A;  3RIR A;  3CC4 Q;  3EFR A;  5I2M A;  3M4G A;  1D1B A;  4CC4 B;  2CH4 A;  4C8Q D;  3CCE A;  2EIF A;  4II1 A;  4J9E A;  3UA6 A;  4R55 A;  1NYF A;  3A8M B;  2BZ8 A;  2KGT A;  5GMK i;  4BDZ A;  2YRV A;  2LNV A;  1W6X A;  2OTL A;  4XTV A;  4X9D A;  3PGG A;  1S72 Q;  4NL2 A;  1WJR A;  3EG1 A;  2DL5 A;  4M78 D;  4AT1 B;  4AFQ C;  1G3T A;  2J6O A;  5IN1 A;  4KGZ B;  2P0K A;  2M9U A;  2YRC A;  3OYM A;  3JB9 D;  5KYX B;  1QW1 A;  5FRO A;  1SKU B;  4MZP A;  2ROT A;  1KIK A;  1Q81 R;  1KQ1 A;  5CQX A;  4E7H A;  1WJQ A;  1RUW A;  3WVE B;  3UDC A;  1OU8 A;  4FSX A;  1WHG A;  3NTI A;  4Z88 A;  3Q1J A;  3M54 A;  2KAF A;  3EHR A;  3DKM A;  2RHI A;  2J6F A;  3OSS C;  5CKD A;  3VKI A;  4IUP A;  4PL6 A;  2LCC A;  2CH4 W;  4PJO A;  2HNI A;  2FVU A;  2HEQ A;  3MHX A;  3FC3 A;  3EAE A;  2DLP A;  4FYW B;  1UEB A;  3M57 A;  4C5E A;  3EGU A;  3GOX A;  3M0T A;  4IIM A;  4WTO B;  5HK0 A;  1JJ2 S;  2YHT A;  5KCH A;  1PWT A;  2FPD A;  3H0I A;  5GAM d;  2BTT A;  1K9M C;  4E47 A;  3C12 A;  1M3A A;  2FRY A;  1EX4 A;  5FU6 B;  2QEX Q;  1VQ4 A;  4PJM A;  1KG1 A;  3QXE B;  2FHD A;  5J26 A;  2HAX A;  3HKS A;  2ED1 A;  3CCR Q;  2DNU A;  2OTJ A;  2X3W D;  1YN8 A;  3TRE A;  5GAN 2;  3OW2 A;  4J5Y A;  2L8D A;  1YI2 Q;  3QO3 A;  1OU9 A;  2DBK A;  1OX8 A;  4JUV A;  1W70 A;  2V8I A;  4HA8 A;  1GCQ C;  4QKU A;  3S3N A;  2NUZ A;  2QDY B;  2KXC A;  4FYX B;  3E1S A;  1KD1 C;  2XD0 A;  4C8Q B;  2LRQ A;  3A5Z B;  2K2V A;  3CCR A;  1Q82 C;  5D6W A;  4E7S A;  1X6B A;  3OYH A;  1TXQ A;  3EHQ A;  3QJ6 A;  2E3I A;  3L2R A;  3JCM b;  4C92 B;  4FYY B;  3M0Q A;  2YUN A;  2RJE A;  1K9A A;  4KGX B;  2V1R A;  5LJ3 j;  1RAA B;  1D3B B;  1WDX A;  2ZGW A;  1I4K 1;  3A8G B;  4N0A A;  1M90 U;  4LN2 A;  5GMK j;  3M0P A;  4C0D C;  4A4G A;  2ENM A;  1WXT A;  3JCM c;  1W4S A;  3PVQ A;  2Y90 A;  5GAM g;  1QVF S;  3QG1 A;  2HQX A;  3V8K A;  1VYV A;  3LWH A;  2DEU A;  3HP9 A;  3L42 A;  1I8F A;  4MZM A;  2MPX C;  4PJO B;  3URG A;  4KGV B;  4FL6 A;  4ANJ A;  1SEM A;  2LC4 A;  1MND A;  3THK A;  1VQP Q;  2PUK B;  1WA7 A;  3L2Z A;  3I55 T;  4ZNX A;  3H41 A;  1MHN A;  2HDA A;  3M0R A;  3I35 A;  2L3S A;  5EG2 A;  1ZSZ A;  4PJO D;  2EQU A;  2DIG A;  1MMA A;  4JRI A;  4HCK A;  4ESR A;  1K0X A;  2E10 A;  3R6O A;  2QGG A;  1TG0 A;  1AT1 B;  4RTY A;  1Q86 U;  2X4Y A;  2OTL Q;  4C5H A;  5KYY B;  2LX7 A;  1QKX A;  2JMA A;  3CCQ Q;  4N4G A;  3L2U A;  4QW2 A;  4J9C A;  3VS7 A;  1OYX A;  3QKJ A;  2DJQ A;  2ESW A;  2BIV A;  2EYY A;  3BDU A;  4NL3 A;  2I0N A;  2JJ9 A;  2NYS A;  1WJS A;  2EYX A;  1VQ9 A;  3PVL A;  2HSP A;  2WSC E;  3LH5 A;  1CSK A;  1I1J A;  1SG5 A;  3SD4 A;  2RQW A;  2QAS A;  2K5L A;  3JSC A;  1M2V B;  4ZTF A;  1OUL A;  4E7Z A;  4EIK A;  2FL7 A;  2PU9 B;  4ATO A;  4XU1 A;  2VWF A;  2KBT A;  4HVV A;  2CP2 A;  2EKO A;  5FWC A;  1G8X A;  1KQS P;  3ER0 A;  5KYW B;  4C92 D;  1YJW T;  4M7A B;  2DRM A;  2D0Q B;  2NUP B;  2X4X A;  1MNE A;  2QA4 T;  4JRK A;  2DPP B;  2GFU A;  2Y4X A;  4OGE A;  2LVM A;  1VQ8 T;  3CD6 T;  2D8H A;  2ZPI B;  1TUG B;  2E6Z A;  5LJ5 g;  1X27 A;  3D7S B;  2M16 A;  2EQK A;  2ROL A;  3CBP A;  3M53 A;  3DB3 A;  2DF6 A;  1UFF A;  2KY9 A;  2NWM A;  5CAI A;  3HRT A;  3RER A;  1G2B A;  2LNH B;  5CIU A;  1IZ6 A;  4OMN A;  2DK3 A;  3EFO B;  1YI2 T;  1WNL A;  4EMK A;  4DA4 A;  1HXD A;  4A4E A;  1O9S A;  3OS0 A;  1U1T A;  4M7D A;  4N4I A;  3RMS A;  1W1F A;  3X25 B;  3VYH B;  1HD3 A;  2NUT A;  3TCJ A;  4TVR A;  2K6D A;  2WSE E;  3H6Z A;  3G4S Q;  5KYW A;  2KSS A;  2K5I A;  2LMJ A;  1BCO A;  2E12 A;  1ACM B;  1BU1 A;  3EGX B;  3G7Z A;  1HSQ A;  2PUO B;  3CCM Q;  3JCM e;  5C6S A;  2OI3 A;  2DET A;  4ZTJ A;  1VQ9 T;  1X6G A;  1ZSZ C;  2AKL A;  2QG9 B;  1YIJ T;  3V7R A;  3CC7 Q;  3LGL A;  3M5A A;  1Y07 A;  4FU6 A;  3EG9 A;  2RK1 A;  4AMC A;  3UF4 A;  4PJO E;  5FU7 B;  2PNI A;  2KRO A;  3LX7 A;  4AFZ C;  2DX1 A;  2MMP A;  2L2P A;  3CC2 A;  4JJD A;  4M75 A;  2WAC A;  8AT1 B;  5DM7 R;  4C92 C;  1QP2 A;  4F16 A;  4FCY A;  2J7I A;  3QSU A;  1JB0 E;  1UE9 A;  4L6V 5;  3P8H A;  1YHQ Q;  4GY5 A;  2COZ A;  1O75 A;  2YDL A;  2FPE A;  1NBE B;  1GL5 A;  1PKS A;  5IT9 E;  1M2O A;  4B6M A;  1WHH A;  2XDD A;  1UG1 A;  1H92 A;  3M56 A;  2F2W A;  4JJN K;  4ZGJ B;  4M78 F;  1Q7Y U;  3PIP A;  2DRK A;  1RAI B;  2FZC B;  1S72 T;  4Y92 A;  2F5K A;  1BCM A;  1PD0 A;  1GFC A;  1NPP A;  1OEB A;  8ATC B;  3ZEH A;  2ZCF B;  4HKE A;  2EQI A;  3ASK A;  4PJO G;  1AWW A;  5AYF A;  2M0O A;  3RBB B;  2DL4 A;  4J7F A;  3BDL A;  2MCN A;  1IGQ A;  2QTX A;  1MUZ A;  1W2B S;  2CZ0 B;  3G4S A;  2RB6 A;  5GAN d;  4KRT A;  4ELY C;  1N6A A;  1J3T A;  5IAY A;  2RI5 A;  3JB9 J;  2RN8 A;  1OPK A;  5A0G A;  1KQS S;  1AWO A;  3NTK A;  4HCZ A;  4L5G A;  2E41 A;  1SRL A;  3OW2 P;  3CPF A;  5FRN A;  4LDV A;  2DEQ A;  4J9G A;  4BE1 A;  3MEU A;  1VQO T;  3MO8 A;  4F7U E;  4M7D D;  1Y7X A;  2VGM A;  1SRM A;  1V1C A;  4B9X A;  5HY6 A;  1RI9 A;  4EDU A;  3S3M A;  2QA4 Q;  1WIE A;  3RR6 A;  4C8Q F;  4XAX B;  1X6O A;  4PJO C;  3GPL A;  3OYA A;  2OTJ T;  1GFD A;  2H8H A;  5GJV B;  5LL6 S;  4D8D A;  1ZUK A;  2EJF A;  5LJ3 f;  2YUP A;  2RO0 A;  1KC8 C;  2R5A A;  2RI3 A;  1YP5 A;  1VQ8 Q;  4M78 G;  3CD6 Q;  2J06 A;  2X4J A;  4J6X A;  1M90 C;  3CCE T;  3SEM A;  3OYN A;  4OMO A;  2YSQ A;  3CBM A;  2YXY A;  4C0G A;  4M77 C;  3TU4 K;  2RI2 A;  1K9M U;  2JT4 A;  2OTL T;  3OY9 A;  1VYT A;  4A4K A;  2MYS A;  5CKF A;  3DB4 A;  4V2S A;  2IG0 A;  4JDS A;  1K8A C;  3A8O B;  4HCB A;  3RES A;  1VQM T;  3G4S T;  2JW4 A;  2RJF A;  2QQS A;  4F17 A;  2EAY A;  1KHI A;  2E6N A;  1PHT A;  2E4H A;  1D1C A;  1WHJ A;  1TSF A;  5IHI A;  1HYO A;  4OMQ A;  1JEG A;  6AT1 B;  3CCJ Q;  4C8Q G;  3SWN B;  2IPO B;  2F2X A;  4C5G A;  3FJ5 A;  3V8L A;  1W2B A;  2DZ9 A;  4A63 B;  2P84 A;  2CP7 A;  3LH0 A;  1VQP A;  3MPU B;  3CC7 T;  4A4H A;  4M77 E;  3MET A;  3WVD B;  2AKK A;  3CCU A;  1KQS A;  3CEY A;  4J9B A;  3VU3 C;  3JAM E;  1D0Z A;  3FB9 A;  2EVR A;  1LVK A;  4BD3 A;  1TUD A;  2LQK A;  2VKN A;  4OML A;  1WHL A;  1B34 A;  2AIR B;  5KYN A;  1Y71 A;  3QBY A;  4FIB A;  3O5Z A;  1OX9 A;  4KUI A;  4IUQ A;  1LNX A;  4BY6 B;  5L8R E;  2P4T A;  1MMD A;  2KRN A;  4LD6 A;  3A8L B;  1KC8 R;  5GAO r;  4RMO A;  1FMV A;  5GJW B;  1ZSG A;  1X2K A;  3OYY A;  3MEW A;  1D0Y A;  2MOX A;  3UWN A;  2GTJ A;  5FLX E;  2QXF A;  1GBQ A;  3VS6 A;  2JTE A;  1GXI E;  1XNI A;  2W0Z A;  1XQH A;  3G6E T;  4RTU A;  1I5L A;  1M4Z A;  1FMW A;  5D7U A;  1VQN T;  1FXX A;  4AFS C;  5J3B A;  2QYZ A;  1RAE B;  5KE3 A;  4HVU A;  1VQM A;  2LT1 A;  4PFP A;  1VQK T;  1X75 C;  5CVI A;  2LCS A;  3VS1 A;  1VQ7 T;  2RPN A;  1PD1 A;  3JCM h;  1B3Q A;  1NEG A;  2GBQ A;  5KYU B;  1U8R A;  3VS2 A;  2RK2 A;  2EGA A;  3DLL A;  2KRM A;  2H3E B;  4E7K A;  2DL3 A;  2LX9 A;  2EBP A;  2A37 A;  3G71 T;  2JVV A;  1VQ4 Q;  4M78 C;  4KUD K;  1T0H A;  3LLR A;  2NLU A;  3LGF A;  4RCC A;  2JN0 A;  2GNC A;  5D6Y A;  2O31 A;  3JV3 A;  2VYT A;  4KT0 E;  2KVQ G;  2LT4 A;  5GMK e;  4JJC A;  2VVK A;  5FW9 A;  1YIT Q;  2HBP A;  3X26 B;  1LCK A;  1U1S A;  4M75 D;  4X34 A;  3CCU T;  1QVF A;  1SPK A;  1M90 R;  2QTV A;  4FW1 A;  4PLL A;  2RMO A;  5GAN 4;  1LJO A;  2FYK A;  1VQ6 Q;  2DTH A;  2KXD A;  4GBQ A;  3GP8 A;  1H3Z A;  3L2Q A;  1IGU A;  3BE3 A;  3VS4 A;  3ME9 A;  1D1A A;  5IH2 A;  3EH2 A;  1MV3 A;  1M8M A;  3A1P A;  2O9S A;  1PCX A;  2OJ2 A;  2COY A;  4MMK A;  3VS0 A;  1G3W A;  3JCM P;  2QAZ A;  1QWE A;  1Q86 R;  4AG2 C;  2LDM A;  4M78 E;  3OYL A;  1WYX A;  3AHU A;  2J05 A;  3V7S A;  3CCU Q;  3VRY A;  3OYD A;  3OSV A;  1W2B P;  1PC0 A;  4QVD A;  3QII A;  1VQN A;  3M58 A;  1AOJ A;  3L2W A;  3OA6 A;  3MP1 A;  1Z9Q A;  4O5V A;  5GAO m;  4XTY A;  3CCJ A;  2EJG A;  3MP6 A;  1KHC A;  1KK7 A;  2X51 A;  4Z89 A;  5GMK l;  4ME7 A;  2LQW A;  3REB B;  3OYB A;  1SSF A;  5KYU A;  3PMT A;  3CCS Q;  9ATC B;  2LQN A;  3CQT A;  4C92 E;  1NJI C;  3AT1 B;  2LTO A;  4RG2 A;  3TQ7 P;  3J7A F;  5GAN j;  5C0M A;  1RI0 A;  1V76 A;  2PTK A;  2HBW A;  1AWX A;  3I56 A;  1N27 A;  1RL2 A;  2EQM A;  2KNB B;  2K4Y A;  2B86 A;  4F7U G;  1C0M A;  5CKH A;  4HT9 A;  2SEM A;  1BIA A;  4M7D E;  2CP6 A;  2ED0 A;  2GCX A;  5IHK A;  2PVO B;  1NM7 A;  2CDT A;  1BKB A;  4KUL A;  2L3P A;  1N8R C;  1WXB A;  3CCS A;  3EG9 B;  4F7U A;  4VUB A;  4ZN1 A;  4JPB W;  4QVC A;  1N9S A;  2BE7 D;  2DD5 A;  2K57 A;  2VC8 A;  3QDF A;  4OMF B;  3RKY A;  4C92 G;  4M78 A;  5GAN f;  1IO6 A;  3C4S A;  2KYB A;  1VQ5 T;  1WX6 A;  1G83 A;  2QK0 A;  2DL7 A;  2QQA A;  4ZGE B;  1QQJ A;  1M2V A;  4LUE A;  2F69 A;  2RQU A;  3CC2 Q;  4J9D A;  2JS0 A;  2JUF A;  3C0C A;  5CK9 A;  1Y96 A;  2CSQ A;  2JNG A;  3QZ9 B;  1YWO A;  4P5N A;  3OS2 A;  2D0N A;  2D9T A;  4PJN A;  3V7C A;  2L3Q A;  1U06 A;  4AFU C;  3RMQ A;  4Y91 A;  2KK4 A;  1P92 A;  1F1B B;  2FEI A;  3GBQ A;  1M8V A;  2A7Y A;  2JM9 A;  4PNO A;  1U3O A;  1JJ2 A;  1UUE A;  2ZPG B;  4OMP A;  2LZ6 B;  2DXC A;  2F1L A;  4LUD A;  1TUC A;  1UGR B;  3C95 A;  4XU2 A;  1VQ4 T;  4GLM A;  3CC2 T;  5GAN 3;  3CCM T;  5LJ3 h;  5A2Q E;  1UGV A;  1YWP A;  1N9R A;  1C6V X;  1JXM A;  2D8J A;  1PSE A;  2BKD N;  1IRX A;  2CZ7 B;  4M77 G;  1QVG S;  1TOV A;  4C8Q C;  1ABO A;  4E7L A;  3H0F A;  1LOJ A;  4NS5 A;  3VS5 A;  1Q7Y R;  1M27 C;  2X9H A;  2O01 E;  2PVG B;  4FT4 A;  4C8Q E;  2G6F X;  4LE9 A;  1VQ6 T;  2RHY A;  2DXB A;  2M51 A;  3CCR T;  2JMC A;  1YIJ Q;  1RAD B;  1PKT A;  3LW5 E;  2L3R A;  1VQM Q;  3EGD A;  4IUT A;  4M75 F;  4PJJ A;  5GMK m;  2RHZ A;  4BY6 C;  1T0J A;  3JB9 G;  5GAO n;  3G6E Q;  4LDX A;  4M78 B;  4XQ3 A;  5I21 A;  2JM8 A;  4CC2 A;  3M0U A;  5IXF A;  1AZE A;  4J9F A;  1M1K R;  2MAM A;  4R56 A;  2L0A A;  4C0F A;  2E65 A;  3E2U A;  1YHQ T;  2FB7 A;  2CZ1 B;  4QT7 A;  3CC7 A;  2KEA A;  3REA B;  2W10 A;  3X24 B;  5GAN 6;  1VQ7 Q;  3F70 A;  3JCM V;  5J39 A;  1N8R U;  5LJ5 h;  5HK3 A;  3P8D A;  1ZX6 A;  1RAH B;  1MMN A;  3VUZ A;  4J9H A;  2PZ1 A;  3NTH A;  2EYW A;  4JRQ A;  4M77 A;  3EFS A;  4CC3 A;  1IHW A;  2FG0 A;  3I55 A;  4RG8 A;  2XDB A;  1NZ9 A;  5GAO l;  1KD1 R;  4D8K A;  5GAN h;  1VIF A;  1N8R R;  1WHK A;  1BK2 A;  3JCM g;  2M02 A;  4RTW A;  1NPR A;  4LDW A;  2DMO A;  1UGP B;  4HXJ A;  5GAM j;  1VA7 A;  2CZ6 B;  3HL8 A;  5LJ5 d;  2QEX T;  2L89 A;  3CCL Q;  5DLO A;  5GAN e;  4M75 E;  5KCO A;  3KXT A;  4J6W A;  3LYI A;  1K9M R;  1G3Y A;  1JRI A;  1VQN Q;  2KMT A;  1D0X A;  5FU7 C;  2RHU A;  2VAS A;  1D3B A;  2ZPF B;  1JQQ A;  1UEC A;  1VQK A;  3RKW A;  1K73 C;  1I5O B;  3LWI A;  3DLM A;  4DEY A;  1VQL T;  3QYH B;  1X69 A;  3MJX A;  1M1K U;  5CCA A;  1YJ9 T;  2CP0 A;  4C8Q A;  3OYI A;  3CPW S;  3SDZ A;  1CKB A;  2K5F A;  2CP3 A;  2MF2 A;  4FYV B;  2AZS A;  1ZUU A;  4RTV A;  2DIL A;  4OB3 B;  2DYB A;  1OQK A;  3TSW A;  3HTR A;  2AZV A;  3PMI A;  1DJ7 B;  4F14 A;  3HRU A;  3EG2 A;  1YJW A;  4IIO A;  5CQY A;  3VJP A;  2QQB A;  4M75 C;  5IHN A;  1VQ9 Q;  1AHJ B;  1BI2 A;  4XTZ A;  2MI6 A;  1VQ8 A;  3CD6 A;  1QVG P;  1Y96 B;  2EGC A;  1PM3 A;  2SRC A;  2GF7 A;  2O88 A;  1SF9 A;  2V8K A;  3FDR A;  4M7D C;  5KYX A;  1TS9 A;  2FZK B;  3GNF B;  3EH1 A;  2VGN A;  3CCQ A;  5LJ3 d;  4BE0 A;  4M4Z A;  1VQP T;  4N4H A;  2RJC A;  3HSB A;  1K76 A;  1OI1 A;  1WGS A;  4OVA A;  1YI2 A;  3UA7 A;  2K9G A;  5LJ3 g;  5GAN 5;  2V8J A;  4WF2 A;  3FEO A;  1K73 R;  4QQD A;  2O4X A;  3BFM A;  4DOV A;  3JCM W;  4JZ3 A;  4A53 A;  2ZAE A;  2QEX A;  3E9F A;  1Y57 A;  2KYM A;  4LXC A;  5LJ5 j;  2LJ0 A;  2BZY A;  4E2F B;  2E3H A;  2ATC B;  1HK9 A;  2DE0 X;  1LPL A;  4LDY A;  2J6K A;  2G3R A;  2KDS A;  5GAO q;  1FMK A;  4OF1 A;  4C5I A;  2BUD A;  4EMH A;  2CGH A;  1HJD A;  3CBO A;  3I9Q A;  1QCF A;  3NGP A;  3HHT B;  5DLQ E;  1IB8 A;  1M1F A;  1S1N A;  4MML A;  1VQL A;  1XJW B;  5I2S A;  1YJ9 A;  3CCV T;  3NHN A;  4XTU A;  1X01 A;  3CXC P;  1AEY A;  3JB9 H;  4DBF A;  1UB4 A;  2R5M A;  3A98 A;  2BZX A;  1I81 A;  3CMA A;  3INZ A;  3JCM X;  2P0P A;  3NPF A;  4X1V A;  1ZLM A;  1U5S A;  1JO8 A;  5HKC A;  2GTO A;  4DEX A;  1ZQ1 A;  3OYG A;  1VQ7 A;  3PFS A;  3PT9 A;  1AWJ A;  1IXD A;  1QVF P;  4XU3 A;  2D1X A;  2LP5 A;  5M9O A;  1D09 B;  2R57 A;  3OB9 A;  2R58 A;  2EGE A;  2MIO A;  1RLQ C;  1QLY A;  4PJL A;  4BI4 A;  4C0Z A;  2C0T A;  1ZUY A;  2YUO A;  5GAM e;  4M7A G;  2JTM A;  3G71 A;  3HFO A;  2WSF E;  4C92 A;  1AZG B;  2V1Q A;  2EKH A;  2XMF A;  3KUF A;  1OOT A;  2YUQ A;  4BAC A;  4M7A F;  1QP3 A;  1M1K C;  1YCS B;  1JU5 C;  2VXF A;  1YJN A;  1B7T A;  2AT1 B;  3FIF A;  3SFM A;  1S72 A;  2QGF B;  2AK5 A;  4FSS A;  3RDV A;  4F7U F;  2OTJ Q;  5GAN 8;  1SHF A;  2F5T X;  4QQ6 A;  1UTI A;  1IHV A;  2KQW A;  1UHF A;  2QDL A;  4XU0 A;  1VQ5 Q;  3X28 B;  2DA9 A;  3QJY A;  1RAF B;  2I2L A;  4L59 A;  3UPU A;  4MDW A;  1NG2 A;  4PK4 A;  1Z9Z A;  5A0L A;  4F7U B;  5HCK A;  3M4Y A;  4RKU E;  1EFN A;  3H9N A;  3O8V A;  1BI1 A;  4IUR A;  1I0C A;  2JS2 A;  1NEB A;  2F2V A;  4M7D B;  1YIT T;  1MV0 B;  3UAT A;  2DIQ A;  4JLI A;  3OBW A;  4M7A E;  2EJ9 A;  4EMK B;  2O9V A;  4HT8 A;  1UJ0 A;  4DQ2 A;  3QYG B;  4RCB A;  2HQE A;  4KBM B;  1KSW A;  5CKE A;  2XKO C;  1OPL A;  1VYU A;  3X20 B;  3EGX A;  1BI0 A;  2C06 A;  3HRS A;  3CMA T;  1KFZ A;  2DD4 A;  2M1H A;  4PFO A;  3SB2 A;  2LJ3 A;  3JRZ A;  4Z8A A;  2DZC A;  3BY7 A;  1WQ7 A;  2KR3 A;  1KJW A;  5GAM h;  1A0N B;  2DER A;  2A28 A;  4WCI A;  1N5Z A;  1NE8 A;  2YLC A;  3OQ5 A;  1K1Z A;  2DYI A;  1B07 A;  3MEV A;  1FX7 A;  3KFV A;  4E6R A;  2QA4 A;  1PRL C;  3L1A A;  3NFC A;  4M75 B;  4DBH A;  5IXB A;  3OS1 A;  2A0F B;  2HD0 A;  3OMC A;  4ZGD B;  3I56 T;  2KI7 A;  3VYG A;  2COW A;  1GBR A;  1WHM A;  2MK5 A;  5D6X A;  4RTZ A;  1NLP C;  4JZ4 A;  2XDP A;  2EYQ A;  1Q81 U;  1E6G A;  3M9Q A;  4PKC C;  4A4F A;  2M0Y A;  4QQG A;  2LCL A;  1WPY A;  5LJ5 f;  4M77 F;  2CUB A;  1ZHI A;  4Z02 A;  2X3X D;  1NYG A;  3OYK A;  1X43 A;  1Q7Y C;  2L5Q A;  3CCS T;  1TTH B;  4CC7 A;  5GMK h;  1PG5 B;  5FWB A;  1QWF A;  4J83 A;  3WXM B;  4M77 B;  3OYJ A;  4DBQ A;  4OB1 B;  2DTI A;  1VQ5 A;  1YIT A;  4CRI A;  3I56 Q;  4GLK A;  1M3B A;  1QCO A;  2KE9 A;  4JLG A;  2DO3 A;  2FZG B;  2LQ8 A;  3JCM Q;  2XIC A;  2OAU A;  2ZPE B;  2DKG A;  3QZ5 B;  2RNA A;  2RA2 A;  3MP8 A;  3I5S A;  1YJN Q;  3OYF A;  4RTX A;  1T3L A;  2EQJ A;  7AT1 B;  3TVT A;  1GRI A;  4O6J A;  4MZT A;  4PLI A;  2O2O A;  1NJI R;  1Q82 U;  3M0S A;  4E7J A;  1T3S A;  2DL8 A;  1RAG B;  3CME A;  1BYM A;  2CT3 A;  1TU0 B;  3QPH A;  3H0H A;  4K11 A;  3ZFJ A;  3G71 Q;  1Q95 G;  4OMM A;  4M7A D;  2YRD A;  2K3B A;  2EPD A;  2HSE B;  3CMA Q;  1H3H A;  3FRN A;  3OS5 A;  3CPW P;  3PE0 A;  4X9C A;  2HMA A;  1QMC A;  2DXT A;  3P8B B;  1OV3 A;  1MMG A;  2XK0 A;  1QVG A;  1XOV A;  2AHJ B;  2CYZ B;  5AT1 B;  1YCY A;  2NUT B;  1Q81 C;  2VXE A;  1SSH A;  1WI7 A;  1YJ9 Q;  1VQ6 A;  4KH0 B;  1R0C B;  3BW1 A;  1VQL Q;  2GQI A;  1R8O B;  1ZBX A;  2VB6 A;  1NLO C;  2A36 A;  2DAQ A;  4JRP A;  3OBY A;  4J7I A;  4PJO F;  2HCK A;  2EFI A;  3C94 A;  2RQV A;  2EWN A;  4OB0 B;  2ZPB B;  3CCV Q;  1GCQ A;  2HZY A;  3TSZ A;  3M55 A;  3OW2 S;  2OX7 A;  4N0A C;  4BI8 B;  4BDY A;  2CRE A;  5CO7 A;  4M77 D;  1WFW A;  1YNZ A;  4XTX A;  3J81 E;  1UDL A;  2OAW A;  4PFZ A;  4XTW A;  4EMG A;  1WZO A;  1YFN A;  2QQ9 A;  2YWW A;  1UGQ B;  2VUB A;  1ARK A;  3CCQ T;  1EZZ B;  1VQO A;  4BI3 A;  1K8A U;  5A0D A;  3OMG A;  3OYC A;  2X35 A;  3CC4 T;  1VUB A;  3HPW A;  2FPF A;  3MEA A;  1FWZ A;  3FLG A;  1KD1 U;  3QDR B;  4UC4 A;  5KYY A;  2KT8 A;  4J6Y A;  2KRS A;  1Y0M A;  1PSF A;  5ECA A;  2E1H A;  1UHC A;  1H64 1;  4M75 G;  2K2M A;  1Q86 C;  2HQH A;  2K3Y A;  3OYE A;  4HVW A;  3CXC A;  3JB9 I;  1JJ2 P;  1YJW Q;  1ZBJ A;  1C1A A;  3EFO A;  1ABQ A;  3CPW A;  2JXB A;  2O4X B;  2A08 A;  2K79 A;  1EIF A;  1I07 A;  2IIM A;  1VQK Q;  1JXO A;  1M30 A;  3PIO A;  1M1G A;  1M5Q 1;  3RUX A;  1CKA A;  1WLP B;  1G5V A;  3S3O A;  3MKD A;  2DM1 A;  1VQO Q;  1UGS B;  3GNG A;  3PNW C;  2VV5 A;  3CCJ T;  1ZA2 B;  4BUG A;  2KT1 A;  1G3S A;  3CXC S;  2H3J A;  2LJ1 A;  2XHC A;  2CT4 A;  1BI3 A;  5EC7 A;  3R6N A;  3E9G A;  1VOM A;  3QHS A;  2CSI A;  5CR2 A;  1TWB A;  3CCL A;  2RQT A;  2QI2 A;  2E64 A;  1XTD A;  2GQV A;  3U23 A;  3ULR B;  1VIE A;  3L2V A;  3A8H B;  2P0Q A;  2HL3 A;  3ZL7 C;  2V26 A;  4IKF A;  4M7A C;  2MWO A;  2MWP A;  2XU8 A;  4MDX A;  3RNJ A;  1IRE B;  4C92 F;  1YJN T;  2ZZD A;  1M9S A; 
#chains in the Genus database with same CATH homology
 2ESW A;  1LCK A;  4LNP A;  1HJD A;  2EYY A;  3I5R A;  2I0N A;  3I9Q A;  1QCF A;  5L23 A;  1SPK A;  2YT6 A;  2EYX A;  4AG1 C;  3NGP A;  2RMO A;  3PVL A;  1S1N A;  2HSP A;  4JJB A;  4ORZ A;  3LH5 A;  1CSK A;  2GGR A;  1I1J A;  2KXD A;  3NHN A;  2FO0 A;  2RQW A;  4GBQ A;  1AEY A;  3VS4 A;  3A98 A;  2BZX A;  1AVZ C;  3NPF A;  5IH2 A;  2C0O A;  4X1V A;  1ZLM A;  1U5S A;  4EIK A;  1JO8 A;  1MV3 A;  2GTO A;  4DEX A;  2VWF A;  1M8M A;  2KBT A;  2RQR A;  4HVV A;  5FWC A;  2O9S A;  1QKW A;  1BBZ A;  1AWJ A;  2OJ2 A;  3SHW A;  4J9I A;  2D1X A;  3VS0 A;  2DRM A;  2LP5 A;  1QWE A;  2EGE A;  2MIO A;  1RLQ C;  1QLY A;  4AG2 C;  2C0T A;  1ZUY A;  2YUO A;  2D8H A;  1WYX A;  3NMZ C;  2J05 A;  2P4R A;  1X27 A;  1K0S A;  2EYZ A;  2ROL A;  3VRY A;  1AZG B;  2DF6 A;  2V1Q A;  2EKH A;  1UFF A;  2XMF A;  1OOT A;  2YUQ A;  1AOJ A;  2NWM A;  1PNJ A;  1YCS B;  1JU5 C;  1Z9Q A;  1G2B A;  2LNH B;  4OMN A;  1PRM C;  3EG0 A;  1WXU A;  4Z89 A;  2C0I A;  3EG3 A;  2AK5 A;  4FSS A;  4R0K A;  2LQW A;  3REB B;  2ECZ A;  5I11 A;  1SHF A;  1UTI A;  2LQN A;  1UHF A;  2QDL A;  3CQT A;  1W1F A;  1FYN A;  1HD3 A;  2DA9 A;  2K6D A;  1NG2 A;  2PTK A;  2ABL A;  1Z9Z A;  2HBW A;  1E7O A;  5HCK A;  1AWX A;  1EFN A;  1I0C A;  1E6H A;  2JS2 A;  1NEB A;  2F2V A;  1MV0 B;  2LMJ A;  3UAT A;  2KNB B;  2B86 A;  1BU1 A;  2O9V A;  1HSQ A;  2SEM A;  2OI3 A;  1UJ0 A;  4RTT A;  2ED0 A;  1X6G A;  5IHK A;  1BB9 A;  2AKL A;  1KSW A;  1OPL A;  1VYU A;  1NM7 A;  1SHG A;  2CDT A;  1M3C A;  2L3P A;  3UF4 A;  2K7A A;  1WXB A;  1KFZ A;  1K4U S;  2PNI A;  3QWY A;  2KRO A;  2RF0 A;  4AFZ C;  2DX1 A;  4JPB W;  2LJ3 A;  2CUD A;  2L2P A;  4Z8A A;  4JJD A;  1RLP C;  2KR3 A;  1AD5 A;  1IO6 A;  1KJW A;  2KYB A;  4F16 A;  1WX6 A;  2J7I A;  1A0N B;  2A28 A;  4WCI A;  1G83 A;  1UE9 A;  2DL7 A;  1N5Z A;  1K1Z A;  1B07 A;  3KFV A;  1GCP A;  4E6R A;  4LUE A;  2RQU A;  2EW3 A;  1PRL C;  2YDL A;  4J9D A;  2FPE A;  2DBM A;  2FRW A;  2JS0 A;  1GL5 A;  3C0C A;  1PKS A;  2CSQ A;  5IXB A;  1YWO A;  2D0N A;  1UG1 A;  1H92 A;  2F2W A;  2E5K A;  1GBR A;  2L3Q A;  1U06 A;  2DRK A;  4AFU C;  4RTZ A;  1NLP C;  4JZ4 A;  3VS3 A;  1UJY A;  4Y92 A;  1H8K A;  1E6G A;  2DVJ A;  3QWX X;  2FEI A;  2M0Y A;  1GFC A;  1OEB A;  3VRZ A;  4RUG A;  3GBQ A;  2EQI A;  2CUB A;  2JM9 A;  5I22 A;  2X3X D;  1AWW A;  1X2Q A;  1U3O A;  1NYG A;  1UUE A;  3IQL A;  4OMP A;  3RBB B;  2DL4 A;  1X43 A;  2MCN A;  2LZ6 B;  1MUZ A;  4LUD A;  4CC7 A;  1TUC A;  5FWB A;  4KRT A;  1QWF A;  4GLM A;  1J3T A;  4CC4 B;  2CH4 A;  2RN8 A;  1OPK A;  1UGV A;  1YWP A;  1AWO A;  1JXM A;  2D8J A;  4J9E A;  3UA6 A;  1M3B A;  1NYF A;  1SRL A;  2BZ8 A;  2KE9 A;  2KGT A;  1ABO A;  1W6X A;  4J9G A;  3H0F A;  3VS5 A;  1M27 C;  2RNA A;  2G6F X;  3I5S A;  4LE9 A;  4RTX A;  1T3L A;  2M51 A;  3EG1 A;  2JMC A;  2DL5 A;  3TVT A;  4AFQ C;  2J6O A;  1GRI A;  1SRM A;  1V1C A;  1RI9 A;  2O2O A;  1WIE A;  3M0S A;  1PKT A;  1T3S A;  2DL8 A;  1GFD A;  2H8H A;  1T0J A;  5GJV B;  4D8D A;  2ROT A;  1ZUK A;  2CT3 A;  1KIK A;  3H0H A;  4K11 A;  2JM8 A;  4CC2 A;  3M0U A;  5IXF A;  1AZE A;  2YUP A;  4J9F A;  4OMM A;  2L0A A;  1RUW A;  1YP5 A;  2K3B A;  2EPD A;  2J06 A;  4QT7 A;  1H3H A;  4Z88 A;  3SEM A;  2KEA A;  3REA B;  3EHR A;  2W10 A;  2J6F A;  3PE0 A;  4OMO A;  2YSQ A;  1OV3 A;  2CH4 W;  1XOV A;  2JT4 A;  2HEQ A;  1VYT A;  1ZX6 A;  2DLP A;  4J9H A;  3EGU A;  2PZ1 A;  2EYW A;  3M0T A;  1SSH A;  1WI7 A;  4IIM A;  4CC3 A;  1PWT A;  2FPD A;  3H0I A;  2FG0 A;  2GQI A;  1NLO C;  2A36 A;  2BTT A;  1M3A A;  2JW4 A;  4D8K A;  4F17 A;  2FRY A;  2HCK A;  2RQV A;  1GCQ A;  3TSZ A;  1PHT A;  1BK2 A;  2ED1 A;  2DNU A;  4RTW A;  2CRE A;  2DMO A;  2X3W D;  1YN8 A;  1WFW A;  4HXJ A;  5IHI A;  1YNZ A;  1VA7 A;  4OMQ A;  1JEG A;  1UDL A;  2OAW A;  2F2X A;  2DBK A;  3FJ5 A;  1W70 A;  1GCQ C;  4A63 B;  1ARK A;  2NUZ A;  2KXC A;  1JQQ A;  2AKK A;  1UEC A;  4J9B A;  1X6B A;  2EVR A;  3EHQ A;  4DEY A;  1TUD A;  2FPF A;  2VKN A;  1X69 A;  4OML A;  3M0Q A;  2YUN A;  1K9A A;  2KT8 A;  2V1R A;  1CKB A;  3O5Z A;  1WDX A;  2KRS A;  1Y0M A;  2AZS A;  1ZUU A;  5ECA A;  4RTV A;  2DIL A;  2DYB A;  3TSW A;  1UHC A;  4LN2 A;  2AZV A;  3M0P A;  2K2M A;  2KRN A;  2ENM A;  4HVW A;  4F14 A;  1WXT A;  3EG2 A;  4IIO A;  3PVQ A;  5GJW B;  1ZSG A;  1X2K A;  1ZBJ A;  2MOX A;  5IHN A;  2GTJ A;  1ABQ A;  1VYV A;  1GBQ A;  3VS6 A;  2JTE A;  2JXB A;  2A08 A;  2EGC A;  2K79 A;  2SRC A;  2O88 A;  2W0Z A;  1I07 A;  2IIM A;  4RTU A;  1JXO A;  1M30 A;  1CKA A;  1WLP B;  4AFS C;  4M4Z A;  1SEM A;  2DM1 A;  3THK A;  1WA7 A;  4HVU A;  1K76 A;  3H41 A;  2KT1 A;  3M0R A;  2HDA A;  4ZNX A;  3I35 A;  2L3S A;  2LJ1 A;  2CT4 A;  5EC7 A;  3R6N A;  2LCS A;  3VS1 A;  2CSI A;  2RPN A;  2RQT A;  3UA7 A;  2K9G A;  1B3Q A;  1NEG A;  4HCK A;  2GBQ A;  4ESR A;  3U23 A;  3ULR B;  1K0X A;  3VS2 A;  2EGA A;  2KRM A;  4JZ3 A;  3ZL7 C;  1TG0 A;  2DL3 A;  2EBP A;  2A37 A;  1T0H A;  4RTY A;  1Y57 A;  2KYM A;  2LX7 A;  2GNC A;  2LJ0 A;  1QKX A;  2BZY A;  2O31 A;  3JV3 A;  3RNJ A;  2JMA A;  2DE0 X;  2J6K A;  4JJC A;  4J9C A;  3VS7 A;  2VVK A;  1FMK A;  5FW9 A;  2DJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...