1UECA

Crystal structure of autoinhibited form of tandem sh3 domain of p47phox
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
180
structure length
177
Chain Sequence
ILQTYRAIADYEKSEMALSTGDVVEVVEKSESGWWFCQMKAKRGWIPASFLEPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYLQKSGQDVSQAQRQIKRGAPPRRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFLQQRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A molecular mechanism for autoinhibition of the tandem SH3 domains of p47phox, the regulatory subunit of the phagocyte NADPH oxidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Neutrophil cytosol factor 1
total genus 39
structure length 177
sequence length 180
ec nomenclature
pdb deposition date 2003-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF16621 NECFESHC SH3 terminal domain of 2nd SH3 on Neutrophil cytosol factor 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1uecA02
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1uecA01
2DMOA 1G2BA 1CSKA 3UA6A 1Z9ZA 3GBQA 1SRMA 4EIKA 2DRKA 4Z89A 1RI9A 4ORZA 2XMFA 4F14A 2FG0A 2DA9A 2JMCA 1UUEA 2JMAA 4J9FA 3VS6A 2LP5A 3TSWA 3I35A 2RF0A 1K1ZA 1M3BA 1SEMA 1SRLA 4JPBW 1UG1A 2CH4W 2KEAA 3TVTA 1PNJA 2LQNA 2F2XA 3UF4A 1PRLC 1XOVA 1K0SA 4CC3A 2AKKA 2KXCA 1TUDA 3I9QA 4Y92A 1PKSA 2FO0A 3I5RA 2V1RA 1U06A 2GBQA 1BU1A 2MIOA 1UE9A 2HCKA 5FWBA 1JU5C 1IO6A 1UDLA 3M0TA 1W1FA 2GTJA 2C0IA 2NWMA 2FPDA 2YUPA 4D8KA 2DL7A 2DJQA 4E6RA 1OPKA 1M27C 1T0HA 2DL5A 1WIEA 1UFFA 1NM7A 1RUWA 2DX1A 4J9DA 1CKAA 2LCSA 2RMOA 2LX7A 2CUDA 3H0IA 1PHTA 2CT4A 4M4ZA 2JXBA 3REBB 2CDTA 4RTZA 1AEYA 3M0UA 3O5ZA 4F17A 1EFNA 3NPFA 5IHIA 5IXBA 2LQWA 1M3AA 2BTTA 2L3QA 2E5KA 2OAWA 1X27A 2PTKA 2J7IA 3PVLA 2DL3A 2VKNA 2EGCA 3THKA 4DEXA 1WDXA 4LUDA 1X69A 3VS4A 1AWOA 1I1JA 5FWCA 1MV3A 4DEYA 1HD3A 2JM9A 5GJVB 4RTWA 2GQIA 3EHQA 2FRWA 2KXDA 3KFVA 5I22A 4JJCA 2LJ0A 2HBWA 2K3BA 1SPKA 4ESRA 2L3PA 1JXOA 1SHFA 2FEIA 2GNCA 1GBRA 1NG2A 1E6GA 2RQRA 1M8MA 2YDLA 2DNUA 2L2PA 1H92A 1UHCA 1AZEA 2YT6A 1SSHA 2LZ6B 4J9GA 3VS3A 4CC7A 3ULRB 2A36A 1QKWA 4AFQC 4ZNXA 1I0CA 2O9SA 2K9GA 4LN2A 5I11A 1AWXA 3VRYA 4OMQA 3REAB 2MOXA 4QT7A 3EHRA 1X2KA 2W10A 2X3WD 1ARKA 1HSQA 1T3LA 2EQIA 1WI7A 3SEMA 2KT8A 1VYTA 3M0PA 4RTVA 5IHKA 1BK2A 2RQVA 5EC7A 1VYVA 2CT3A 1G83A 2EYXA 3M0RA 3VS0A 1E7OA 1X2QA 3NMZC 2ABLA 2VWFA 1Y57A 1QCFA 2KT1A 1NYGA 2SRCA 1E6HA 4RUGA 1AWJA 1SHGA 3EG1A 2J6OA 2RQWA 1M30A 1TG0A 1X6GA 2D1XA 1GCQA 1OEBA 2YUOA 2DL4A 1WFWA 2KNBB 1UTIA 4JJBA 5IXFA 2H8HA 3EG2A 2KROA 1GFDA 1T0JA 1X43A 2GGRA 3M0QA 1WXUA 4K11A 4HVVA 1MV0B 2ESWA 1BBZA 2DYBA 1GFCA 3RNJA 1S1NA 2LMJA 2C0OA 1YP5A 2YUQA 3ZL7C 3U23A 1J3TA 2AKLA 1MUZA 4OMNA 2BZ8A 5GJWB 1AZGB 1WA7A 2F2WA 3VS2A 3JV3A 2V1QA 2LJ1A 3CQTA 2EYZA 3VS5A 1VA7A 2KYMA 1U5SA 1UHFA 3VS7A 4J9IA 4J9EA 2FRYA 3UA7A 1A0NB 2J05A 3M0SA 4CC2A 3NHNA 2EYYA 4IIMA 3H41A 2LNHB 4D8DA 4AFZC 2EBPA 2ECZA 2L0AA 2HDAA 2J06A 1N5ZA 3VRZA 1CKBA 5IH2A 2DBKA 1VYUA 1QWFA 2KYBA 2EYWA 2RPNA 2O31A 4RTTA 1K9AA 1UJ0A 1T3SA 2BZXA 2QDLA 3QWXX 2M0YA 4GBQA 2EKHA 2O88A 2FPEA 2HSPA 2D8HA 2C0TA 1ZBJA 1FYNA 1GCPA 4A63B 2YSQA 5ECAA 2DM1A 2B86A 2KRNA 2JM8A 2K79A 4X1VA 1NEBA 1KIKA 2JS2A 2BZYA 2ROLA 2I0NA 1OOTA 1H8KA 1WX6A 3UATA 4JJDA 1I07A 2F2VA 3EG0A 1OPLA 3H0HA 3A98A 2AK5A 2CH4A 1X6BA 2GTOA 2D0NA 2DE0X 1V1CA 1ZX6A 4WCIA 4OMMA 2FPFA 1OV3A 1RLQC 2OI3A 2DRMA 2EVRA 1AWWA 2CREA 4LE9A 1AD5A 1B07A 1NLOC 2RNAA 2AZSA 1ABQA 1M3CA 2PNIA 2J6FA 5HCKA 2P4RA 1NEGA 2K2MA 2CSQA 2DLPA 1UECA 2W0ZA 4FSSA 2JT4A 2AZVA 4HVUA 3VS1A 2IIMA 4J9CA 1YN8A 2M51A 2EPDA 2MCNA 2KGTA 1JEGA 1YNZA 2D8JA 2JS0A 4OMPA 2O2OA 2KR3A 2X3XD 1WXTA 4AG1C 2EW3A 4AG2C 1TUCA 1HJDA 2CSIA 1PKTA 1ZUUA 5L23A 1PWTA 1JO8A 1Y0MA 2KE9A 1AOJA 1YCSB 2RN8A 2SEMA 4Z8AA 2DL8A 3RBBB 4J9HA 1ZSGA 2NUZA 4Z88A 2DVJA 4CC4B 4AFUC 1UGVA 1WYXA 2A08A 1Z9QA 2DILA 3TSZA 1B3QA 2ROTA 1WXBA 1GL5A 2YUNA 2A28A 1KJWA 1AVZC 3EGUA 4AFSC 3LH5A 4KRTA 1LCKA 2KRSA 4F16A 1W70A 2K7AA 3C0CA 2KBTA 4RTYA 2RQTA 2L3SA 2ENMA 3FJ5A 2DBMA 2KRMA 1GCQC 4HXJA 1H3HA 1BB9A 2HEQA 1PRMC 3IQLA 2G6FX 3QWYA 4J9BA 1NYFA 4JZ3A 4RTXA 1YWPA 1QWEA 4GLMA 1GBQA 1K0XA 1KSWA 2EGAA 3EG3A 1WLPB 2J6KA 2K6DA 1QKXA 1JQQA 3SHWA 1U3OA 1RLPC 2CUBA 1ZUYA 4IIOA 2A37A 4RTUA 3R6NA 1K4US 3PE0A 5IHNA 1W6XA 2PZ1A 2RQUA 2VVKA 3PVQA 1QLYA 3I5SA 3H0FA 2DF6A 2EGEA 4LNPA 1ZLMA 2ED0A 4OMLA 2LJ3A 4R0KA 4LUEA 5FW9A 1KFZA 1ABOA 1NLPC 2OJ2A 4HCKA 1GRIA 1YWOA 2ED1A 2JTEA 2O9VA 4JZ4A 4HVWA 1JXMA 1FMKA 1K76A 1UJYA 2JW4A 1ZUKA 3NGPA 4OMOA
chains in the Genus database with same CATH superfamily
4CI0C 1Z9ZA 5FLXE 2RI5A 3QXEB 1M2VA 4E7IA 1M4ZA 4ZTJA 1ACMB 2KI7A 4ZN3A 1VQOA 3VS6A 4A4GA 3TSWA 3G71A 3CC7T 1BI2A 2E5QA 1UG1A 2KEAA 1FXXA 2WACA 1XOVA 2I2LA 2VV5A 3I9QA 3RMQA 2NUTA 2YLCA 1PKSA 3QHSA 2QI2A 1G3TA 4IUVA 2X35A 3ASKA 1M8VA 1BU1A 1B7TA 1JU5C 2CP7A 5GAOn 2HAXA 5GAMf 1IHWA 2C0IA 4M75G 3FEOA 1D0ZA 2YUPA 1WZOA 5I21A 3V7CA 1JB0E 1M90U 5M9OA 3DB4A 2DZ9A 1BI0A 2F5KA 1WIEA 3EFSA 4J9DA 1JJ2A 1VQ5A 2RMOA 2RI3A 3QYGB 3H0IA 2JXBA 4RTZA 4X9CA 3PMTA 5CR2A 3RKWA 4O5VA 5IHIA 5FRNA 4BB7A 1YFNA 1VQKA 2ZPIB 4DEXA 1WDXA 3MKDA 1KQSP 4E7ZA 1Q7YR 3FLGA 2V8JA 3OYHA 3CD6Q 3CCST 2P0QA 3CCJT 1IZ6A 1R0CB 3X26B 3UPUA 1QVGS 3EHQA 2FRWA 1QMCA 2KXDA 2YRDA 3SB2A 4N4GA 4C8QG 3KUFA 4N4HA 2K3BA 5LJ5d 3GOXA 2FYKA 1RL2A 4ESRA 2R5AA 2BIVA 3CCQQ 4RMOA 2GNCA 2QQSA 2VASA 4KUDK 4C0DB 3I55T 2WSEE 3CCLT 1H92A 1AZEA 4J9GA 4J7FA 4VUBA 3VS3A 3NTHA 1N6AA 2QEXQ 4AFQC 2LQ8A 2QQAA 4E7JA 1S72A 2E12A 1AWXA 3N5BB 3VRYA 4F7UG 4OMQA 2MOXA 4DBHA 3CD6A 4BI8B 3EHRA 1X2KA 3Q1JA 1HSQA 1OULA 3EH1A 2KQWA 4M7AD 4PJOB 3OMGA 1AT1B 1G83A 1RI0A 3G4ST 3E2UA 4J5YA 1N8RU 3TU4K 3MHXA 2KT1A 1E6HA 4RUGA 1N8RR 2CP2A 1Q86U 3EG1A 2J6OA 2RQWA 1RAEB 4FL6A 1OEBA 1I4K1 2YUOA 1KQ1A 4M7AE 4JJBA 5IXFA 3CBPA 1RAAB 1GFDA 4ZGJB 3LGLA 1T0JA 2GGRA 2K5IA 3JCMh 2YHTA 2ESWA 2VYTA 3CC4Q 1TH7A 1WJQA 3I56Q 3QPHA 5GMKl 3RNJA 1G3YA 5J3BA 4DBFA 1YP5A 5KYWA 3O8VA 5DY9A 4OMNA 2BZ8A 2CP6A 3OS0A 1AZGB 4F04B 3FRNA 4IUUA 3M4YA 1LJOA 1VIEA 1KK7A 1WGSA 1VQLQ 3X24B 3L2RA 2LCCA 2KYMA 1TU0B 1PD1A 4MMKA 4IUQA 5D6XA 1A0NB 1MHNA 1NE8A 2R5MA 4F7UF 3CMAA 1SSFA 5LJ3g 3NHNA 2C06A 4L6V5 3H41A 3OYGA 4D8DA 4ZGEB 4F7UA 4DBQA 3EGXB 5IH2A 1C1AA 3KBGA 2RPNA 2Z0WA 5GAMg 4XU3A 2BZXA 2NLUA 2FPEA 1QVPA 4PJNA 5GAN8 1G5VA 1VQ8A 1D3BB 3MP8A 4A54A 3OS1A 3SDZA 3LGFA 2JS2A 2ROLA 1OOTA 4B6MA 3EGDB 1M1KU 5D7UA 2YRCA 2F2VA 2XKOC 4XAXB 5GAMh 3L2VA 4MZTA 4A4FA 2GTOA 2D0NA 2DE0X 5AYFA 1OV3A 2K3YA 2DXTA 2CREA 4A4EA 1WHHA 3HL8A 1NJIR 3INZA 2XDDA 1I5OB 1M3CA 3GNFB 4QVDA 2VUBA 1XNIA 2DLPA 2AIRB 3ZBDA 3WVDB 1XQHA 5CIUA 4C0ZA 5GAN4 2EFIA 2IPOB 1R0BG 2BE9B 1WQWA 3QBYA 4QVCA 3L2WA 2IG0A 3CMET 5DLQE 3GIBA 2Y90A 2EPDA 4MMLA 4A4HA 1JEGA 3CCVQ 1Q86C 1D0YA 1YNZA 1D1CA 1Y96B 4OMPA 2KR3A 3X20B 2QG9B 2PUKB 4LDXA 4AG1C 1K8AU 1HJDA 3QJ6A 1JO8A 2FZCB 1Y0MA 3OQ5A 5GAOr 3JCMf 2RA2A 4AFUC 1WYXA 2X9HA 1Z9QA 1VQ6Q 2ZGWA 2RHXA 4OB1B 1WXBA 2RO0A 4C8QF 4XTYA 2A28A 3QSUA 3EGUA 2RI2A 3SWNA 3CCQA 2FZGB 1R77A 3S3NA 1YJ9Q 3VUZA 4AFSC 3LH5A 4F16A 3C0CA 4RTYA 1W2BA 4PJMA 4BD3A 3FJ5A 1VQ5Q 3BDLA 2OTJT 4F7UE 1GCQC 3ME9A 2HEQA 4JZ3A 3QWYA 1BYMA 1QWEA 3LWHA 1KC8C 3M59A 4M77B 5LJ5g 2HQXA 1C0MA 1U3OA 1ZUYA 4EMKC 4C8QB 3OY9A 2E10A 1VQOQ 5IHNA 4OB0B 3RKYA 2RQUA 3A1PA 4DA4A 5FU6B 1QLYA 2EQMA 4XU1A 4Y28E 1X75C 3V8LA 4OMLA 5FW9A 1KFZA 2LT4A 2OJ2A 1VQPT 1G3SA 5GMKe 4MDXA 2OTLQ 4AMCA 1GRIA 1YWOA 3CCUA 4WTOB 3TQ7P 1JXMA 2COZA 4MZMA 4DOVA 1LNXA 3I55A 2XIDA 1Y71A 5FU7C 1QVFA 2PUOB 4PJOA 4M77E 1CSKA 2P0KA 3GBQA 1M1FA 5LJ3e 3JCMc 3CC7A 3G71T 2QEXA 1MGQA 3I55Q 2FG0A 2DA9A 2ZPFB 1WHLA 3EG9A 5GANg 2JMAA 1G8XA 4J9FA 4M7DE 2LP5A 1N8RC 4C92D 3OYIA 2LQNA 2MMPA 2F2XA 1EIFA 1PRLC 4LD9K 2MPXC 4CC3A 2ZPBB 3MO8A 4B9WA 2PVDB 2FO0A 3OYAA 3L2UA 4N4IA 3PT9A 2GBQA 1Q81R 1UGSB 4V2SA 5D6WA 3VU3C 4WF2A 1IO6A 1ZSZC 3M0TA 3QO3A 1PCXA 3UT1A 4PKCC 4FW1A 3G6EA 1IREB 4QVZA 2E4HA 1RAHB 2ATCB 2FPDA 3OS5A 2DL7A 3TEEA 2DJQA 4Q5WA 2A0FB 1UFFA 1RUWA 1IXDA 1CKAA 2CUDA 4PFZA 4LDVA 3EAEA 3C4SA 3REBB 2XD0A 3QDRB 3M0UA 3QJYA 3NPFA 3LX7A 1M2OA 2BTTA 2E5KA 2OAWA 3FC3A 2HQHA 2PTKA 3PNWC 1OYXA 3S6WA 3PVLA 3JCMW 2DO3A 2VKNA 1QP2A 2FHDA 1KC8R 4LUDA 1TUGB 1UGPB 4QQDA 2KVQG 4OB2B 1U8RA 3QG1A 1MV3A 2L5QA 1HD3A 3C12A 4EDUA 2JM9A 4ZTFA 3TREA 1FWZA 1OQKA 5I22A 5I2MA 3CMAQ 1KG1A 2LJ0A 3I56A 4CRIA 3M55A 2HZYA 4XU0A 1SPKA 4KGZB 2EQJA 1KHCA 1VQNA 1JJ2P 1NG2A 2DEUA 2GCXA 2RJFA 2RQRA 3L2ZA 2DIGA 2YDLA 4XTXA 2XDBA 3QIIA 3HFOA 1SSHA 5KCOA 3P8DA 2A36A 1NZ9A 1QKWA 2O9SA 2K9GA 5I11A 2XDPA 3FB9A 1ARKA 2K5LA 3M53A 1WI7A 3CMEA 3SEMA 2KT8A 2A3LA 1BK2A 2RQVA 3H6ZA 1E7OA 4M78A 4FW2A 1JRIA 3A8OB 2RHIA 3VKIA 4C8QD 4C92E 4KUIA 3CPWP 1Y96A 4M77C 3GPLA 2OTJA 5KE2A 1GCQA 1YJ9A 5FRMA 2DL4A 1NJIU 1WFWA 2NUPA 3JCMJ 2CZ6B 1YITA 3EG2A 3G4SQ 3JB9I 5HY6A 2XK0A 2DXBA 2O4XA 1X43A 3VYHB 3M0QA 2PVOB 3L42A 4MZPA 4RKUE 4K11A 2CGHA 1YJNT 4OB3B 1MV0B 4JLIA 2P0PA 1HK9A 1GFCA 2QQRA 3CCJQ 3U23A 1J3TA 2AKLA 3CC4A 2LVMA 4JDSA 1O9SA 2CP0A 2DXCA 2F2WA 3VS2A 2V1QA 2LJ1A 1KD1C 1QCOA 2EYZA 1RAGB 5EG2A 4KGXB 4JLGA 3VS7A 3RUXA 2XI9A 3JCMV 1SKUB 1MNDA 2BUDA 3H8ZA 3X28B 3EFRA 1D1AA 1NPRA 4HT9A 1IGQA 4CC2A 3HHTB 4C8QA 3JCMd 4IIMA 4M77G 2LNHB 2V8IA 4AFZC 1YBYA 5CCAA 3CBMA 2L0AA 4C0DC 2HDAA 2L3RA 1ZA1B 2YWWA 2DBKA 1KQSS 1VYUA 2KYBA 4PJLA 2EYWA 4M78G 4RTTA 1K9AA 4KH1B 3CPWS 2O88A 3HRSA 1C6VX 2D8HA 1ZBJA 1GCPA 1YITQ 4A63B 2VXEA 3CC4T 2WSCE 5ECAA 3OB9A 2DM1A 4ME7A 2KRNA 2K79A 2OX7A 1VQ4A 3CC2A 1KIKA 4BY6B 2I0NA 3UATA 1H8KA 2DJZA 5LJ3h 4JJDA 1I07A 5GAOp 2EQUA 2AK5A 1M1KR 1Q7YU 2CH4A 3RKXA 1ZX6A 4WCIA 3M56A 2OI3A 1ZA2B 4LE9A 1M9SA 1Q82C 1NLOC 2EYQA 2RNAA 2XHCA 1M5Q1 1M90C 5HCKA 3UDCA 2K2MA 5KYNA 2F69A 2DYIA 4BE0A 4FU6A 3D7SB 4N0AC 4HVUA 1TSFA 4EMGA 3A8LB 3VS1A 5LJ5h 1BKBA 3M4GA 1QQJA 1MMAA 4Y91A 1VQ9A 4LXCA 3OYBA 3CC7Q 2JS0A 4M7AA 1S72T 3JB9F 2HKNA 4E7SA 2X3XD 2ZPEB 4AG2C 1ZUUA 4PJOG 5L23A 1S72Q 5GAMe 4UC4A 5KCHA 1VQ4Q 4M7DB 1MMNA 4YTLA 4PLIA 4ZGDB 1VQNT 1OU8A 2DVJA 1WJSA 4HT8A 5GAMd 5GAN7 1B3QA 1YJNA 1PD0A 1GL5A 2JVVA 4M7AF 1B34B 2OTLT 1VQ7Q 3E19A 4C5GA 1W70A 4E7KA 5GAOq 1VIFA 1M1GA 1RACB 2LT1A 4FYXB 5GAOl 4X9DA 1BB9A 3JSCA 4J9BA 1M2VB 1VQ6T 5GANj 1YWPA 2EAYA 1K0XA 2EGAA 3JCMe 5LJ3j 1JBMA 2RK2A 3JCMb 5I2SA 3OBYA 4JS4A 5GMKm 4RTUA 3R6NA 3PE0A 3GLXA 1OZ2A 1BIAA 1QVGP 2DIQA 1WHJA 1W4SA 3LH0A 3LYIA 3CD6T 2DF6A 2K3XA 3DKMA 4FYVB 2LJ3A 2M16A 1N9SA 3V8JA 3J80E 1ABOA 4M75F 1NJIC 1VQLA 4J6WA 2R57A 4HCKA 5IT9E 1M90R 1QW1A 2E6NA 1K8AC 4JZ4A 2X4JA 5CKHA 3PIPA 1FMKA 3CCMA 2E70A 4C92G 3NTKA 4OMOA 2DMOA 1G2BA 4M77A 1U1TA 5FROA 1X6OA 1SRMA 2DRKA 1BCMA 1RI9A 4Z89A 2QDYB 1I8FA 3CCMQ 3NTIA 4M7AC 2HQEA 2JTFA 2JMCA 1VQOT 1UUEA 3M57A 4J8OA 3MPUB 4BACA 1QP3A 3QDFA 2KAFA 2NUTB 4EMHA 2RF0A 1M3BA 2CS7A 1WNLA 2HBPA 2O01E 3UF4A 1ZSZB 1K9MC 3V7SA 4JRPA 2X4XA 3EFOB 2LRQA 2KXCA 1TUDA 2H3JA 4Y92A 8ATCB 5LJ5e 3I5RA 4HCZA 1VQMT 1YHQQ 2MIOA 1BCOA 7AT1B 2RJEA 3EFOA 3CXCA 1VQPA 2FB7A 3RESA 4M7DF 1Q81U 4D8KA 2MAMA 4E6RA 1OPKA 1M27C 1T0HA 2DL5A 3AHUA 5A0DA 4L5GA 2DX1A 2LCSA 2E64A 3PIOA 1UGQB 2CT4A 3EG9B 1PM3A 1FMVA 2CDTA 3OYCA 1AEYA 1TOVA 1XJWB 4Z02A 1EZZB 3CXCP 5IXBA 4BI4A 3S3OA 4LDWA 2HMAA 2L3QA 3FIFA 3M58A 4BE2A 1LVKA 2KMTA 4KGVB 2CZ0B 2J7IA 2H3EB 1VQMQ 4M7DC 2EGCA 3EH2A 3THKA 1YIJT 2K5FA 1X69A 2DD5A 4HCCA 1I1JA 4C92C 2XU8A 4DEYA 4IURA 1HYOA 2K57A 4M78B 2GQIA 3OSVA 2HNIA 5J26A 4JJCA 3V7RA 2VB6A 1KQ2A 5CQXA 2L3PA 1SHFA 2FEIA 4M7DD 5FU6C 3NFCA 1GBRA 3A8HB 4J6XA 4M75A 5KYXB 5KH6A 1N9RA 1M8MA 2DNUA 4QKUA 1YJWT 1UEBA 3BE3A 3CCUT 2L2PA 2R58A 5CO7A 2YT6A 2LZ6B 4CC7A 4O6JA 3ULRB 1YI2A 1K8AR 3L1AA 4ZNXA 2HL5C 5L8RE 1I0CA 4LN2A 2MF2A 2JUFA 3REAB 2FVUA 4QT7A 5IAYA 2DTHA 2X3WD 1T3LA 3SFMA 2EQIA 1MMDA 2YRVA 4PLLA 3PGGA 3M0PA 4RTVA 5IHKA 1VYVA 2HL3A 4PNOA 3BFMA 2CT3A 5CKFA 3M0RA 4X34A 1K9MR 3NMZC 1WQ7A 2ABLA 2VWFA 3VJPA 3OA6A 1QCFA 2M02A 1AWJA 3OYLA 5J39A 1Q81C 1VOMA 2A7YA 2OAUA 1M30A 4ZN1A 1TG0A 3RR6A 1G3WA 3CC2Q 4NL2A 4IUTA 1VQ7A 5HK0A 2KNBB 5GAN5 4KBMB 2H8HA 2KROA 2F5TX 1GXIE 3CCQT 2OTLA 4P5NA 1WXUA 6AT1B 5IN1A 3CCVT 2DYBA 3F70A 2QA4A 5KYUA 1SG5A 4JUVA 2DTIA 4PFOA 1S1NA 2LMJA 3MCAB 2C0OA 2RJCA 2G3RA 2DEQA 4C8QC 3BW1A 2YUQA 1YCYA 3M54A 4M77D 5GJWB 5LJ3d 1WA7A 2QA4Q 3JV3A 5LJ3f 3OYFA 2FZKB 3CQTA 1IRXA 4PL6A 5GMKj 3RERA 2GQVA 3CBOA 2RB6A 4J9IA 4J9EA 3UA7A 3H9NA 4XU2A 3DLMA 1PSFA 4HCBA 3JB9J 2RK1A 2CYZB 3M0SA 1LOJA 2JTMA 2EBPA 1UGRB 1BIBA 3CCET 3VRZA 1CKBA 1QCNA 5CKEA 2O31A 1MMGA 1T3SA 2LCLA 2QDLA 1VQKQ 2LQKA 3QWXX 2EKHA 1D09B 3J81E 1RADB 4C0GA 2CZ1B 4RCCA 4TVRA 2X51A 2YSQA 1RABB 2B86A 4X1VA 2EWNA 1NEBA 1V29B 2BZYA 3RIRA 1WX6A 2PU9B 3QUIA 3URGA 3JRZA 4E47A 1MNEA 1JJ2S 3EGXA 3H0HA 3A98A 1KC8U 4M78C 1X6BA 4DBRA 1V1CA 5FU7B 1VQ4T 2FPFA 1RLQC 2EVRA 2EIFA 1Q95G 1WHKA 4R56A 5C0MA 1VQ8T 3HRUA 3MEVA 3P8BB 2PNIA 4L59A 5CKBA 3OYNA 3JCMP 1YIJQ 3CEYA 2CSQA 2W0ZA 2GFUA 2E3IA 4FSSA 4M78D 2JT4A 5KYXA 2AZVA 2CKKA 9ATCB 2DAQA 4XTWA 1K73C 3CCEQ 1RAIB 3CCRT 2IIMA 3OSSC 2LX9A 4ELYC 2MCNA 2KGTA 2DD4A 5GANe 3ER0A 4E7LA 4OP0A 1Q82U 2D0QB 2D6FA 2ZPHB 2DPPB 1B34A 2EW3A 1YI2T 4XTUA 2CSIA 5LL6S 1PKTA 2AT1B 1KD1R 2NUPB 2V26A 3CXCS 2QXFA 4JJNK 2KE9A 2P4TA 2SEMA 1KD1U 4Z8AA 2DL8A 5KE3A 4QQ6A 3RBBB 4J9HA 1ZSGA 5D6YA 4XK8E 4Z88A 1UGVA 2A08A 5CAIA 4FYYB 2EJGA 4OF1A 2GFAA 3CCVA 3CMEQ 2YUNA 1N27A 1WPYA 3I56T 1KJWA 3PMIA 3ZFJA 1AVZC 1YHQA 1K9MU 2EJ9A 3LW5E 4D6WA 4M77F 1YITT 5KYYB 4PJOC 1XTDA 2HD0A 4C8QE 2QYZA 2L3SA 3MJXA 3HSBA 4BI3A 4HXJA 1H3HA 3IQLA 1PRMC 3GP8A 1YIJA 1PG5B 8AT1B 4HKEA 4GLMA 2VGNA 3MEUA 1Y7XA 4LDUA 4RG8A 4FSXA 3OW2P 3EG3A 4F7UB 3GF5A 3M5AA 5KYYA 2AHJB 2J6KA 5CQYA 2K6DA 1QKXA 3SHWA 1DJ7B 3JCMX 1RLPC 4IIOA 3G4SA 1QVGA 2A37A 2QQBA 1K4US 3CPWA 2DZCA 4MDWA 1EX4A 5A0GA 1W6XA 2M1HA 2PZ1A 2X4YA 2DTOA 5GAN3 2KDSA 1SF9A 2IVWA 3JAME 3I5SA 2DKGA 1KHIA 2PQWA 2ZZDA 4LNPA 2EGEA 2LTOA 2DETA 3OYYA 3MEAA 2E1HA 1ZLMA 2JN0A 2ED0A 2ZAEA 3SWNC 2RJDA 3JB9G 4FT2A 4EPCA 1PC0A 1Q86R 2JTEA 2NYSA 1VQPQ 4HVWA 3MP6A 2Y4XA 2JW4A 5CKDA 3NGPA 1WJRA 3UA6A 4EIKA 1HXDA 4M7AG 4ORZA 2XMFA 4FM4B 4M78E 4F14A 2HKQB 4J6YA 4JRKA 2KK4A 1FX7A 3OYMA 2E41A 4M75E 4E2FB 3L2QA 1BI3A 2DK3A 3I35A 1K1ZA 1SEMA 1SRLA 4JPBW 4BUGA 2CH4W 3AT1B 4QW2A 3TVTA 1PNJA 4QQGA 3CCSQ 1VQKT 3RDVA 4PFPA 1K0SA 3X25B 3VYGA 5GANf 1KQSA 2AKKA 5GANd 3BY7A 4ANJA 2V1RA 1U06A 1IB8A 1UE9A 2HCKA 5FWBA 1I5LA 2E3HA 3T9NA 5GAOm 1UDLA 1W1FA 2GTJA 2NWMA 4PJJA 4J7IA 3HTRA 3VV0A 3QZ9B 1WHGA 2L89A 2P84A 3OBWA 1NM7A 3WVEB 2LX7A 4M4ZA 1PHTA 3OW2A 4FCYA 4PJOD 2OTJQ 1YI2Q 3O5ZA 4F17A 1EFNA 2PVGB 4LD6A 4C5HA 2CP3A 2LQWA 1M3AA 3HPWA 1TS9A 1X27A 2HSEB 3MEWA 3QZ5B 2VC8A 4R55A 1VQ6A 2DL3A 3LWIA 3LLRA 3VS4A 1AWOA 5FWCA 5GMKi 5GJVB 4RTWA 4PJOE 4J83A 2EQKA 3KFVA 2QEXT 4A53A 2HBWA 1OI1A 1JXOA 1H3ZA 1NBEB 1TXQA 1ZSZA 1H641 3V8KA 2FL7A 2LC4A 3CCMT 4OGEA 1E6GA 4C5EA 4DOWA 5GAN2 4PK4A 4RG2A 1UHCA 3E9FA 1VQLT 2EKOA 3SD4A 3QYHB 4JRIA 4OVAA 2VGMA 1UB4A 5GMKh 1VQ9T 4BY6C 2W10A 5LJ5f 4NL3A 3G6EQ 1VYTA 4OGCA 5DLOA 2LDMA 5EC7A 4M7DA 5C6SA 2EYXA 3SWNB 4NS5A 3VS0A 3OMCA 4GLKA 1X2QA 4M75D 2DFUA 1Y57A 1ZQ1A 2E6ZA 2SRCA 1NYGA 2RH2A 3OYDA 1SHGA 4NOYA 2RHYA 2QTXA 1X6GA 4EMKA 2D1XA 2MYSA 2MI6A 2V8KA 3CPFA 2VXFA 2B8AA 1UTIA 2LNVA 1M1KC 3PTAA 3E1SA 2JZ2A 4A4KA 1U1SA 1YHQT 2COWA 2K2VA 2KSSA 4M75C 5GAN6 3OYKA 1R8OB 3HRTA 3QKJA 4HVVA 1BBZA 3M9QA 2E65A 4M75B 2M9UA 2RHUA 3A8GB 3GNGA 4C5IA 3ZL7C 2CZ7B 1MUZA 2EJFA 5A0LA 4KT0E 5HKCA 4FIBA 3OYEA 4EMKB 3MP1A 5CVIA 1FMWA 1PSEA 5GAMj 3CCUQ 2MWOA 4M78F 1VQNQ 3RMSA 3VS5A 2RM4A 1VA7A 2RHZA 5DM7R 1U5SA 3JB9D 1UHFA 3C95A 4RCBA 3CCEA 4HA8A 2FRYA 4XTVA 1W2BS 1QVFP 2YXYA 3VUBA 2J05A 2QGFB 3CCRA 4IKFA 3KXTA 2DXUA 3TCJA 3CMAT 1LPLA 2EYYA 4C92F 2ECZA 2J06A 2O4XB 1N5ZA 1O75A 1QWFA 4JRQA 3EGDA 1AHJB 4PJOF 1UJ0A 4BE1A 2M0YA 4GBQA 4M7DG 2HSPA 2C0TA 2WSFE 4LDYA 4M7AB 1FYNA 3FDRA 2Y4YA 3CCLQ 2JM8A 1YJWQ 1OX9A 4XTZA 3OS2A 1VUBA 5AT1B 3EG0A 1OPLA 3JB9H 4FYWB 1V76A 4DQ2A 3OYJA 3E9GA 4ATOA 4OMMA 3CC2T 2DVEA 4OMFB 1IGUA 2QQ9A 2DRMA 1AWWA 1ZHIA 1OU9A 1W2BP 1QVFS 1RAFB 3S3MA 1AD5A 1B07A 4KH0B 3G7ZA 4FT4A 2AZSA 2RD1A 4II1A 1ABQA 2J6FA 1OZ3A 2P4RA 3R6OA 1NEGA 1UECA 2JJ9A 2JNGA 2QASA 1Y07A 2QAZA 3CCRQ 4C92A 3WXMB 5KYWB 1VQ8Q 4J9CA 4XQ3A 1YN8A 2M51A 1X01A 4ELZC 3DLLA 5CK9A 1YJNQ 1D3BA 2D8JA 3G1JA 2O2OA 1WXTA 1TUCA 3A8MB 4AT1B 2QTVA 1NPPA 5LJ5j 1PWTA 3CCLA 1YJWA 2XICA 1AOJA 1YCSB 2RN8A 3HP9A 4KULA 2NUZA 4CC4B 1F1BB 1D0XA 1ZBXA 3FJPA 2QA4T 1P92A 2DILA 3TSZA 2COYA 1VQ9Q 4BDYA 2D9TA 2ROTA 2K4YA 3OW2S 4KRTA 2KY9A 1D1BA 1LCKA 2KRSA 2K7AA 2M0OA 2KBTA 2CP5A 1YJ9T 2RQTA 5A2QE 3CCJA 3META 1VQ7T 2ENMA 3CCSA 2QK0A 2DBMA 2KRMA 2G6FX 2GF7A 1NYFA 4RTXA 3G71Q 2XG8D 4C92B 1Q7YC 3A5ZB 1GBQA 1KSWA 1Q82R 3JCMQ 1WLPB 2YLBA 1JQQA 2CUBA 2L8DA 2QGGA 2DERA 1TWBA 4N0AA 4B9XA 4IUPA 2ZPGB 3ZEHA 2VVKA 1VQ5T 3PFSA 3PVQA 1K73U 5HK3A 2X4WA 3BDUA 3H0FA 3DB3A 2MWPA 1OX8A 3UWNA 1K73R 4C0FA 4R0KA 2ZCFB 2BE7D 3C94A 4LUEA 5GANh 2BKDN 4GY5A 1WHMA 3G6ET 3HFNA 1NLPC 2F1LA 3J7AF 1I81A 4E7HA 4BDZA 2MK5A 1VQMA 2ED1A 2O9VA 1IHVA 1TTHB 2JOYA 4JS5A 3P8HA 1K76A 1UJYA 1ZUKA 3JCMg 5KYUB 3HKSA 1BI1A
chains in the Genus database with same CATH topology
2DMOA 1G2BA 1CSKA 3UA6A 1Z9ZA 3GBQA 1SRMA 4EIKA 2DRKA 4Z89A 1RI9A 4ORZA 2XMFA 4F14A 2FG0A 2DA9A 2JMCA 1UUEA 2JMAA 4J9FA 3VS6A 2LP5A 3TSWA 3I35A 2RF0A 1K1ZA 1M3BA 1SEMA 1SRLA 4JPBW 1UG1A 2CH4W 2KEAA 3TVTA 1PNJA 2LQNA 2F2XA 3UF4A 1PRLC 1XOVA 1K0SA 4CC3A 2AKKA 2KXCA 1TUDA 3I9QA 4Y92A 1PKSA 2FO0A 3I5RA 2V1RA 1U06A 2GBQA 1BU1A 2MIOA 1UE9A 2HCKA 5FWBA 1JU5C 1IO6A 1UDLA 3M0TA 1W1FA 2GTJA 2C0IA 2NWMA 2FPDA 2YUPA 4D8KA 2DL7A 2DJQA 4E6RA 1OPKA 1M27C 1T0HA 2DL5A 1WIEA 1UFFA 1NM7A 1RUWA 2DX1A 4J9DA 1CKAA 2LCSA 2RMOA 2LX7A 2CUDA 3H0IA 1PHTA 2CT4A 4M4ZA 2JXBA 3REBB 2CDTA 4RTZA 1AEYA 3M0UA 3O5ZA 4F17A 1EFNA 3NPFA 5IHIA 5IXBA 2LQWA 1M3AA 2BTTA 2L3QA 2E5KA 2OAWA 1X27A 2PTKA 2J7IA 3PVLA 2DL3A 2VKNA 2EGCA 3THKA 4DEXA 1WDXA 4LUDA 1X69A 3VS4A 1AWOA 1I1JA 5FWCA 1MV3A 4DEYA 1HD3A 2JM9A 5GJVB 4RTWA 2GQIA 3EHQA 2FRWA 2KXDA 3KFVA 5I22A 4JJCA 2LJ0A 2HBWA 2K3BA 1SPKA 4ESRA 2L3PA 1JXOA 1SHFA 2FEIA 2GNCA 1GBRA 1NG2A 1E6GA 2RQRA 1M8MA 2YDLA 2DNUA 2L2PA 1H92A 1UHCA 1AZEA 2YT6A 1SSHA 2LZ6B 4J9GA 3VS3A 4CC7A 3ULRB 2A36A 1QKWA 4AFQC 4ZNXA 1I0CA 2O9SA 2K9GA 4LN2A 5I11A 1AWXA 3VRYA 4OMQA 3REAB 2MOXA 4QT7A 3EHRA 1X2KA 2W10A 2X3WD 1ARKA 1HSQA 1T3LA 2EQIA 1WI7A 3SEMA 2KT8A 1VYTA 3M0PA 4RTVA 5IHKA 1BK2A 2RQVA 5EC7A 1VYVA 2CT3A 1G83A 2EYXA 3M0RA 3VS0A 1E7OA 1X2QA 3NMZC 2ABLA 2VWFA 1Y57A 1QCFA 2KT1A 1NYGA 2SRCA 1E6HA 4RUGA 1AWJA 1SHGA 3EG1A 2J6OA 2RQWA 1M30A 1TG0A 1X6GA 2D1XA 1GCQA 1OEBA 2YUOA 2DL4A 1WFWA 2KNBB 1UTIA 4JJBA 5IXFA 2H8HA 3EG2A 2KROA 1GFDA 1T0JA 1X43A 2GGRA 3M0QA 1WXUA 4K11A 4HVVA 1MV0B 2ESWA 1BBZA 2DYBA 1GFCA 3RNJA 1S1NA 2LMJA 2C0OA 1YP5A 2YUQA 3ZL7C 3U23A 1J3TA 2AKLA 1MUZA 4OMNA 2BZ8A 5GJWB 1AZGB 1WA7A 2F2WA 3VS2A 3JV3A 2V1QA 2LJ1A 3CQTA 2EYZA 3VS5A 1VA7A 2KYMA 1U5SA 1UHFA 3VS7A 4J9IA 4J9EA 2FRYA 3UA7A 1A0NB 2J05A 3M0SA 4CC2A 3NHNA 2EYYA 4IIMA 3H41A 2LNHB 4D8DA 4AFZC 2EBPA 2ECZA 2L0AA 2HDAA 2J06A 1N5ZA 3VRZA 1CKBA 5IH2A 2DBKA 1VYUA 1QWFA 2KYBA 2EYWA 2RPNA 2O31A 4RTTA 1K9AA 1UJ0A 1T3SA 2BZXA 2QDLA 3QWXX 2M0YA 4GBQA 2EKHA 2O88A 2FPEA 2HSPA 2D8HA 2C0TA 1ZBJA 1FYNA 1GCPA 4A63B 2YSQA 5ECAA 2DM1A 2B86A 2KRNA 2JM8A 2K79A 4X1VA 1NEBA 1KIKA 2JS2A 2BZYA 2ROLA 2I0NA 1OOTA 1H8KA 1WX6A 3UATA 4JJDA 1I07A 2F2VA 3EG0A 1OPLA 3H0HA 3A98A 2AK5A 2CH4A 1X6BA 2GTOA 2D0NA 2DE0X 1V1CA 1ZX6A 4WCIA 4OMMA 2FPFA 1OV3A 1RLQC 2OI3A 2DRMA 2EVRA 1AWWA 2CREA 4LE9A 1AD5A 1B07A 1NLOC 2RNAA 2AZSA 1ABQA 1M3CA 2PNIA 2J6FA 5HCKA 2P4RA 1NEGA 2K2MA 2CSQA 2DLPA 1UECA 2W0ZA 4FSSA 2JT4A 2AZVA 4HVUA 3VS1A 2IIMA 4J9CA 1YN8A 2M51A 2EPDA 2MCNA 2KGTA 1JEGA 1YNZA 2D8JA 2JS0A 4OMPA 2O2OA 2KR3A 2X3XD 1WXTA 4AG1C 2EW3A 4AG2C 1TUCA 1HJDA 2CSIA 1PKTA 1ZUUA 5L23A 1PWTA 1JO8A 1Y0MA 2KE9A 1AOJA 1YCSB 2RN8A 2SEMA 4Z8AA 2DL8A 3RBBB 4J9HA 1ZSGA 2NUZA 4Z88A 2DVJA 4CC4B 4AFUC 1UGVA 1WYXA 2A08A 1Z9QA 2DILA 3TSZA 1B3QA 2ROTA 1WXBA 1GL5A 2YUNA 2A28A 1KJWA 1AVZC 3EGUA 4AFSC 3LH5A 4KRTA 1LCKA 2KRSA 4F16A 1W70A 2K7AA 3C0CA 2KBTA 4RTYA 2RQTA 2L3SA 2ENMA 3FJ5A 2DBMA 2KRMA 1GCQC 4HXJA 1H3HA 1BB9A 2HEQA 1PRMC 3IQLA 2G6FX 3QWYA 4J9BA 1NYFA 4JZ3A 4RTXA 1YWPA 1QWEA 4GLMA 1GBQA 1K0XA 1KSWA 2EGAA 3EG3A 1WLPB 2J6KA 2K6DA 1QKXA 1JQQA 3SHWA 1U3OA 1RLPC 2CUBA 1ZUYA 4IIOA 2A37A 4RTUA 3R6NA 1K4US 3PE0A 5IHNA 1W6XA 2PZ1A 2RQUA 2VVKA 3PVQA 1QLYA 3I5SA 3H0FA 2DF6A 2EGEA 4LNPA 1ZLMA 2ED0A 4OMLA 2LJ3A 4R0KA 4LUEA 5FW9A 1KFZA 1ABOA 1NLPC 2OJ2A 4HCKA 1GRIA 1YWOA 2ED1A 2JTEA 2O9VA 4JZ4A 4HVWA 1JXMA 1FMKA 1K76A 1UJYA 2JW4A 1ZUKA 3NGPA 4OMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DMO A;  1G2B A;  1CSK A;  3UA6 A;  1Z9Z A;  3GBQ A;  1SRM A;  4EIK A;  2DRK A;  4Z89 A;  1RI9 A;  4ORZ A;  2XMF A;  4F14 A;  2FG0 A;  2DA9 A;  2JMC A;  1UUE A;  2JMA A;  4J9F A;  3VS6 A;  2LP5 A;  3TSW A;  3I35 A;  2RF0 A;  1K1Z A;  1M3B A;  1SEM A;  1SRL A;  4JPB W;  1UG1 A;  2CH4 W;  2KEA A;  3TVT A;  1PNJ A;  2LQN A;  2F2X A;  3UF4 A;  1PRL C;  1XOV A;  1K0S A;  4CC3 A;  2AKK A;  2KXC A;  1TUD A;  3I9Q A;  4Y92 A;  1PKS A;  2FO0 A;  3I5R A;  2V1R A;  1U06 A;  2GBQ A;  1BU1 A;  2MIO A;  1UE9 A;  2HCK A;  5FWB A;  1JU5 C;  1IO6 A;  1UDL A;  3M0T A;  1W1F A;  2GTJ A;  2C0I A;  2NWM A;  2FPD A;  2YUP A;  4D8K A;  2DL7 A;  2DJQ A;  4E6R A;  1OPK A;  1M27 C;  1T0H A;  2DL5 A;  1WIE A;  1UFF A;  1NM7 A;  1RUW A;  2DX1 A;  4J9D A;  1CKA A;  2LCS A;  2RMO A;  2LX7 A;  2CUD A;  3H0I A;  1PHT A;  2CT4 A;  4M4Z A;  2JXB A;  3REB B;  2CDT A;  4RTZ A;  1AEY A;  3M0U A;  3O5Z A;  4F17 A;  1EFN A;  3NPF A;  5IHI A;  5IXB A;  2LQW A;  1M3A A;  2BTT A;  2L3Q A;  2E5K A;  2OAW A;  1X27 A;  2PTK A;  2J7I A;  3PVL A;  2DL3 A;  2VKN A;  2EGC A;  3THK A;  4DEX A;  1WDX A;  4LUD A;  1X69 A;  3VS4 A;  1AWO A;  1I1J A;  5FWC A;  1MV3 A;  4DEY A;  1HD3 A;  2JM9 A;  5GJV B;  4RTW A;  2GQI A;  3EHQ A;  2FRW A;  2KXD A;  3KFV A;  5I22 A;  4JJC A;  2LJ0 A;  2HBW A;  2K3B A;  1SPK A;  4ESR A;  2L3P A;  1JXO A;  1SHF A;  2FEI A;  2GNC A;  1GBR A;  1NG2 A;  1E6G A;  2RQR A;  1M8M A;  2YDL A;  2DNU A;  2L2P A;  1H92 A;  1UHC A;  1AZE A;  2YT6 A;  1SSH A;  2LZ6 B;  4J9G A;  3VS3 A;  4CC7 A;  3ULR B;  2A36 A;  1QKW A;  4AFQ C;  4ZNX A;  1I0C A;  2O9S A;  2K9G A;  4LN2 A;  5I11 A;  1AWX A;  3VRY A;  4OMQ A;  3REA B;  2MOX A;  4QT7 A;  3EHR A;  1X2K A;  2W10 A;  2X3W D;  1ARK A;  1HSQ A;  1T3L A;  2EQI A;  1WI7 A;  3SEM A;  2KT8 A;  1VYT A;  3M0P A;  4RTV A;  5IHK A;  1BK2 A;  2RQV A;  5EC7 A;  1VYV A;  2CT3 A;  1G83 A;  2EYX A;  3M0R A;  3VS0 A;  1E7O A;  1X2Q A;  3NMZ C;  2ABL A;  2VWF A;  1Y57 A;  1QCF A;  2KT1 A;  1NYG A;  2SRC A;  1E6H A;  4RUG A;  1AWJ A;  1SHG A;  3EG1 A;  2J6O A;  2RQW A;  1M30 A;  1TG0 A;  1X6G A;  2D1X A;  1GCQ A;  1OEB A;  2YUO A;  2DL4 A;  1WFW A;  2KNB B;  1UTI A;  4JJB A;  5IXF A;  2H8H A;  3EG2 A;  2KRO A;  1GFD A;  1T0J A;  1X43 A;  2GGR A;  3M0Q A;  1WXU A;  4K11 A;  4HVV A;  1MV0 B;  2ESW A;  1BBZ A;  2DYB A;  1GFC A;  3RNJ A;  1S1N A;  2LMJ A;  2C0O A;  1YP5 A;  2YUQ A;  3ZL7 C;  3U23 A;  1J3T A;  2AKL A;  1MUZ A;  4OMN A;  2BZ8 A;  5GJW B;  1AZG B;  1WA7 A;  2F2W A;  3VS2 A;  3JV3 A;  2V1Q A;  2LJ1 A;  3CQT A;  2EYZ A;  3VS5 A;  1VA7 A;  2KYM A;  1U5S A;  1UHF A;  3VS7 A;  4J9I A;  4J9E A;  2FRY A;  3UA7 A;  1A0N B;  2J05 A;  3M0S A;  4CC2 A;  3NHN A;  2EYY A;  4IIM A;  3H41 A;  2LNH B;  4D8D A;  4AFZ C;  2EBP A;  2ECZ A;  2L0A A;  2HDA A;  2J06 A;  1N5Z A;  3VRZ A;  1CKB A;  5IH2 A;  2DBK A;  1VYU A;  1QWF A;  2KYB A;  2EYW A;  2RPN A;  2O31 A;  4RTT A;  1K9A A;  1UJ0 A;  1T3S A;  2BZX A;  2QDL A;  3QWX X;  2M0Y A;  4GBQ A;  2EKH A;  2O88 A;  2FPE A;  2HSP A;  2D8H A;  2C0T A;  1ZBJ A;  1FYN A;  1GCP A;  4A63 B;  2YSQ A;  5ECA A;  2DM1 A;  2B86 A;  2KRN A;  2JM8 A;  2K79 A;  4X1V A;  1NEB A;  1KIK A;  2JS2 A;  2BZY A;  2ROL A;  2I0N A;  1OOT A;  1H8K A;  1WX6 A;  3UAT A;  4JJD A;  1I07 A;  2F2V A;  3EG0 A;  1OPL A;  3H0H A;  3A98 A;  2AK5 A;  2CH4 A;  1X6B A;  2GTO A;  2D0N A;  2DE0 X;  1V1C A;  1ZX6 A;  4WCI A;  4OMM A;  2FPF A;  1OV3 A;  1RLQ C;  2OI3 A;  2DRM A;  2EVR A;  1AWW A;  2CRE A;  4LE9 A;  1AD5 A;  1B07 A;  1NLO C;  2RNA A;  2AZS A;  1ABQ A;  1M3C A;  2PNI A;  2J6F A;  5HCK A;  2P4R A;  1NEG A;  2K2M A;  2CSQ A;  2DLP A;  1UEC A;  2W0Z A;  4FSS A;  2JT4 A;  2AZV A;  4HVU A;  3VS1 A;  2IIM A;  4J9C A;  1YN8 A;  2M51 A;  2EPD A;  2MCN A;  2KGT A;  1JEG A;  1YNZ A;  2D8J A;  2JS0 A;  4OMP A;  2O2O A;  2KR3 A;  2X3X D;  1WXT A;  4AG1 C;  2EW3 A;  4AG2 C;  1TUC A;  1HJD A;  2CSI A;  1PKT A;  1ZUU A;  5L23 A;  1PWT A;  1JO8 A;  1Y0M A;  2KE9 A;  1AOJ A;  1YCS B;  2RN8 A;  2SEM A;  4Z8A A;  2DL8 A;  3RBB B;  4J9H A;  1ZSG A;  2NUZ A;  4Z88 A;  2DVJ A;  4CC4 B;  4AFU C;  1UGV A;  1WYX A;  2A08 A;  1Z9Q A;  2DIL A;  3TSZ A;  1B3Q A;  2ROT A;  1WXB A;  1GL5 A;  2YUN A;  2A28 A;  1KJW A;  1AVZ C;  3EGU A;  4AFS C;  3LH5 A;  4KRT A;  1LCK A;  2KRS A;  4F16 A;  1W70 A;  2K7A A;  3C0C A;  2KBT A;  4RTY A;  2RQT A;  2L3S A;  2ENM A;  3FJ5 A;  2DBM A;  2KRM A;  1GCQ C;  4HXJ A;  1H3H A;  1BB9 A;  2HEQ A;  1PRM C;  3IQL A;  2G6F X;  3QWY A;  4J9B A;  1NYF A;  4JZ3 A;  4RTX A;  1YWP A;  1QWE A;  4GLM A;  1GBQ A;  1K0X A;  1KSW A;  2EGA A;  3EG3 A;  1WLP B;  2J6K A;  2K6D A;  1QKX A;  1JQQ A;  3SHW A;  1U3O A;  1RLP C;  2CUB A;  1ZUY A;  4IIO A;  2A37 A;  4RTU A;  3R6N A;  1K4U S;  3PE0 A;  5IHN A;  1W6X A;  2PZ1 A;  2RQU A;  2VVK A;  3PVQ A;  1QLY A;  3I5S A;  3H0F A;  2DF6 A;  2EGE A;  4LNP A;  1ZLM A;  2ED0 A;  4OML A;  2LJ3 A;  4R0K A;  4LUE A;  5FW9 A;  1KFZ A;  1ABO A;  1NLP C;  2OJ2 A;  4HCK A;  1GRI A;  1YWO A;  2ED1 A;  2JTE A;  2O9V A;  4JZ4 A;  4HVW A;  1JXM A;  1FMK A;  1K76 A;  1UJY A;  2JW4 A;  1ZUK A;  3NGP A;  4OMO A; 
#chains in the Genus database with same CATH topology
 4CI0 C;  1Z9Z A;  5FLX E;  2RI5 A;  3QXE B;  1M2V A;  4E7I A;  1M4Z A;  4ZTJ A;  1ACM B;  2KI7 A;  4ZN3 A;  1VQO A;  3VS6 A;  4A4G A;  3TSW A;  3G71 A;  3CC7 T;  1BI2 A;  2E5Q A;  1UG1 A;  2KEA A;  1FXX A;  2WAC A;  1XOV A;  2I2L A;  2VV5 A;  3I9Q A;  3RMQ A;  2NUT A;  2YLC A;  1PKS A;  3QHS A;  2QI2 A;  1G3T A;  4IUV A;  2X35 A;  3ASK A;  1M8V A;  1BU1 A;  1B7T A;  1JU5 C;  2CP7 A;  5GAO n;  2HAX A;  5GAM f;  1IHW A;  2C0I A;  4M75 G;  3FEO A;  1D0Z A;  2YUP A;  1WZO A;  5I21 A;  3V7C A;  1JB0 E;  1M90 U;  5M9O A;  3DB4 A;  2DZ9 A;  1BI0 A;  2F5K A;  1WIE A;  3EFS A;  4J9D A;  1JJ2 A;  1VQ5 A;  2RMO A;  2RI3 A;  3QYG B;  3H0I A;  2JXB A;  4RTZ A;  4X9C A;  3PMT A;  5CR2 A;  3RKW A;  4O5V A;  5IHI A;  5FRN A;  4BB7 A;  1YFN A;  1VQK A;  2ZPI B;  4DEX A;  1WDX A;  3MKD A;  1KQS P;  4E7Z A;  1Q7Y R;  3FLG A;  2V8J A;  3OYH A;  3CD6 Q;  3CCS T;  2P0Q A;  3CCJ T;  1IZ6 A;  1R0C B;  3X26 B;  3UPU A;  1QVG S;  3EHQ A;  2FRW A;  1QMC A;  2KXD A;  2YRD A;  3SB2 A;  4N4G A;  4C8Q G;  3KUF A;  4N4H A;  2K3B A;  5LJ5 d;  3GOX A;  2FYK A;  1RL2 A;  4ESR A;  2R5A A;  2BIV A;  3CCQ Q;  4RMO A;  2GNC A;  2QQS A;  2VAS A;  4KUD K;  4C0D B;  3I55 T;  2WSE E;  3CCL T;  1H92 A;  1AZE A;  4J9G A;  4J7F A;  4VUB A;  3VS3 A;  3NTH A;  1N6A A;  2QEX Q;  4AFQ C;  2LQ8 A;  2QQA A;  4E7J A;  1S72 A;  2E12 A;  1AWX A;  3N5B B;  3VRY A;  4F7U G;  4OMQ A;  2MOX A;  4DBH A;  3CD6 A;  4BI8 B;  3EHR A;  1X2K A;  3Q1J A;  1HSQ A;  1OUL A;  3EH1 A;  2KQW A;  4M7A D;  4PJO B;  3OMG A;  1AT1 B;  1G83 A;  1RI0 A;  3G4S T;  3E2U A;  4J5Y A;  1N8R U;  3TU4 K;  3MHX A;  2KT1 A;  1E6H A;  4RUG A;  1N8R R;  2CP2 A;  1Q86 U;  3EG1 A;  2J6O A;  2RQW A;  1RAE B;  4FL6 A;  1OEB A;  1I4K 1;  2YUO A;  1KQ1 A;  4M7A E;  4JJB A;  5IXF A;  3CBP A;  1RAA B;  1GFD A;  4ZGJ B;  3LGL A;  1T0J A;  2GGR A;  2K5I A;  3JCM h;  2YHT A;  2ESW A;  2VYT A;  3CC4 Q;  1TH7 A;  1WJQ A;  3I56 Q;  3QPH A;  5GMK l;  3RNJ A;  1G3Y A;  5J3B A;  4DBF A;  1YP5 A;  5KYW A;  3O8V A;  5DY9 A;  4OMN A;  2BZ8 A;  2CP6 A;  3OS0 A;  1AZG B;  4F04 B;  3FRN A;  4IUU A;  3M4Y A;  1LJO A;  1VIE A;  1KK7 A;  1WGS A;  1VQL Q;  3X24 B;  3L2R A;  2LCC A;  2KYM A;  1TU0 B;  1PD1 A;  4MMK A;  4IUQ A;  5D6X A;  1A0N B;  1MHN A;  1NE8 A;  2R5M A;  4F7U F;  3CMA A;  1SSF A;  5LJ3 g;  3NHN A;  2C06 A;  4L6V 5;  3H41 A;  3OYG A;  4D8D A;  4ZGE B;  4F7U A;  4DBQ A;  3EGX B;  5IH2 A;  1C1A A;  3KBG A;  2RPN A;  2Z0W A;  5GAM g;  4XU3 A;  2BZX A;  2NLU A;  2FPE A;  1QVP A;  4PJN A;  5GAN 8;  1G5V A;  1VQ8 A;  1D3B B;  3MP8 A;  4A54 A;  3OS1 A;  3SDZ A;  3LGF A;  2JS2 A;  2ROL A;  1OOT A;  4B6M A;  3EGD B;  1M1K U;  5D7U A;  2YRC A;  2F2V A;  2XKO C;  4XAX B;  5GAM h;  3L2V A;  4MZT A;  4A4F A;  2GTO A;  2D0N A;  2DE0 X;  5AYF A;  1OV3 A;  2K3Y A;  2DXT A;  2CRE A;  4A4E A;  1WHH A;  3HL8 A;  1NJI R;  3INZ A;  2XDD A;  1I5O B;  1M3C A;  3GNF B;  4QVD A;  2VUB A;  1XNI A;  2DLP A;  2AIR B;  3ZBD A;  3WVD B;  1XQH A;  5CIU A;  4C0Z A;  5GAN 4;  2EFI A;  2IPO B;  1R0B G;  2BE9 B;  1WQW A;  3QBY A;  4QVC A;  3L2W A;  2IG0 A;  3CME T;  5DLQ E;  3GIB A;  2Y90 A;  2EPD A;  4MML A;  4A4H A;  1JEG A;  3CCV Q;  1Q86 C;  1D0Y A;  1YNZ A;  1D1C A;  1Y96 B;  4OMP A;  2KR3 A;  3X20 B;  2QG9 B;  2PUK B;  4LDX A;  4AG1 C;  1K8A U;  1HJD A;  3QJ6 A;  1JO8 A;  2FZC B;  1Y0M A;  3OQ5 A;  5GAO r;  3JCM f;  2RA2 A;  4AFU C;  1WYX A;  2X9H A;  1Z9Q A;  1VQ6 Q;  2ZGW A;  2RHX A;  4OB1 B;  1WXB A;  2RO0 A;  4C8Q F;  4XTY A;  2A28 A;  3QSU A;  3EGU A;  2RI2 A;  3SWN A;  3CCQ A;  2FZG B;  1R77 A;  3S3N A;  1YJ9 Q;  3VUZ A;  4AFS C;  3LH5 A;  4F16 A;  3C0C A;  4RTY A;  1W2B A;  4PJM A;  4BD3 A;  3FJ5 A;  1VQ5 Q;  3BDL A;  2OTJ T;  4F7U E;  1GCQ C;  3ME9 A;  2HEQ A;  4JZ3 A;  3QWY A;  1BYM A;  1QWE A;  3LWH A;  1KC8 C;  3M59 A;  4M77 B;  5LJ5 g;  2HQX A;  1C0M A;  1U3O A;  1ZUY A;  4EMK C;  4C8Q B;  3OY9 A;  2E10 A;  1VQO Q;  5IHN A;  4OB0 B;  3RKY A;  2RQU A;  3A1P A;  4DA4 A;  5FU6 B;  1QLY A;  2EQM A;  4XU1 A;  4Y28 E;  1X75 C;  3V8L A;  4OML A;  5FW9 A;  1KFZ A;  2LT4 A;  2OJ2 A;  1VQP T;  1G3S A;  5GMK e;  4MDX A;  2OTL Q;  4AMC A;  1GRI A;  1YWO A;  3CCU A;  4WTO B;  3TQ7 P;  1JXM A;  2COZ A;  4MZM A;  4DOV A;  1LNX A;  3I55 A;  2XID A;  1Y71 A;  5FU7 C;  1QVF A;  2PUO B;  4PJO A;  4M77 E;  1CSK A;  2P0K A;  3GBQ A;  1M1F A;  5LJ3 e;  3JCM c;  3CC7 A;  3G71 T;  2QEX A;  1MGQ A;  3I55 Q;  2FG0 A;  2DA9 A;  2ZPF B;  1WHL A;  3EG9 A;  5GAN g;  2JMA A;  1G8X A;  4J9F A;  4M7D E;  2LP5 A;  1N8R C;  4C92 D;  3OYI A;  2LQN A;  2MMP A;  2F2X A;  1EIF A;  1PRL C;  4LD9 K;  2MPX C;  4CC3 A;  2ZPB B;  3MO8 A;  4B9W A;  2PVD B;  2FO0 A;  3OYA A;  3L2U A;  4N4I A;  3PT9 A;  2GBQ A;  1Q81 R;  1UGS B;  4V2S A;  5D6W A;  3VU3 C;  4WF2 A;  1IO6 A;  1ZSZ C;  3M0T A;  3QO3 A;  1PCX A;  3UT1 A;  4PKC C;  4FW1 A;  3G6E A;  1IRE B;  4QVZ A;  2E4H A;  1RAH B;  2ATC B;  2FPD A;  3OS5 A;  2DL7 A;  3TEE A;  2DJQ A;  4Q5W A;  2A0F B;  1UFF A;  1RUW A;  1IXD A;  1CKA A;  2CUD A;  4PFZ A;  4LDV A;  3EAE A;  3C4S A;  3REB B;  2XD0 A;  3QDR B;  3M0U A;  3QJY A;  3NPF A;  3LX7 A;  1M2O A;  2BTT A;  2E5K A;  2OAW A;  3FC3 A;  2HQH A;  2PTK A;  3PNW C;  1OYX A;  3S6W A;  3PVL A;  3JCM W;  2DO3 A;  2VKN A;  1QP2 A;  2FHD A;  1KC8 R;  4LUD A;  1TUG B;  1UGP B;  4QQD A;  2KVQ G;  4OB2 B;  1U8R A;  3QG1 A;  1MV3 A;  2L5Q A;  1HD3 A;  3C12 A;  4EDU A;  2JM9 A;  4ZTF A;  3TRE A;  1FWZ A;  1OQK A;  5I22 A;  5I2M A;  3CMA Q;  1KG1 A;  2LJ0 A;  3I56 A;  4CRI A;  3M55 A;  2HZY A;  4XU0 A;  1SPK A;  4KGZ B;  2EQJ A;  1KHC A;  1VQN A;  1JJ2 P;  1NG2 A;  2DEU A;  2GCX A;  2RJF A;  2RQR A;  3L2Z A;  2DIG A;  2YDL A;  4XTX A;  2XDB A;  3QII A;  3HFO A;  1SSH A;  5KCO A;  3P8D A;  2A36 A;  1NZ9 A;  1QKW A;  2O9S A;  2K9G A;  5I11 A;  2XDP A;  3FB9 A;  1ARK A;  2K5L A;  3M53 A;  1WI7 A;  3CME A;  3SEM A;  2KT8 A;  2A3L A;  1BK2 A;  2RQV A;  3H6Z A;  1E7O A;  4M78 A;  4FW2 A;  1JRI A;  3A8O B;  2RHI A;  3VKI A;  4C8Q D;  4C92 E;  4KUI A;  3CPW P;  1Y96 A;  4M77 C;  3GPL A;  2OTJ A;  5KE2 A;  1GCQ A;  1YJ9 A;  5FRM A;  2DL4 A;  1NJI U;  1WFW A;  2NUP A;  3JCM J;  2CZ6 B;  1YIT A;  3EG2 A;  3G4S Q;  3JB9 I;  5HY6 A;  2XK0 A;  2DXB A;  2O4X A;  1X43 A;  3VYH B;  3M0Q A;  2PVO B;  3L42 A;  4MZP A;  4RKU E;  4K11 A;  2CGH A;  1YJN T;  4OB3 B;  1MV0 B;  4JLI A;  2P0P A;  1HK9 A;  1GFC A;  2QQR A;  3CCJ Q;  3U23 A;  1J3T A;  2AKL A;  3CC4 A;  2LVM A;  4JDS A;  1O9S A;  2CP0 A;  2DXC A;  2F2W A;  3VS2 A;  2V1Q A;  2LJ1 A;  1KD1 C;  1QCO A;  2EYZ A;  1RAG B;  5EG2 A;  4KGX B;  4JLG A;  3VS7 A;  3RUX A;  2XI9 A;  3JCM V;  1SKU B;  1MND A;  2BUD A;  3H8Z A;  3X28 B;  3EFR A;  1D1A A;  1NPR A;  4HT9 A;  1IGQ A;  4CC2 A;  3HHT B;  4C8Q A;  3JCM d;  4IIM A;  4M77 G;  2LNH B;  2V8I A;  4AFZ C;  1YBY A;  5CCA A;  3CBM A;  2L0A A;  4C0D C;  2HDA A;  2L3R A;  1ZA1 B;  2YWW A;  2DBK A;  1KQS S;  1VYU A;  2KYB A;  4PJL A;  2EYW A;  4M78 G;  4RTT A;  1K9A A;  4KH1 B;  3CPW S;  2O88 A;  3HRS A;  1C6V X;  2D8H A;  1ZBJ A;  1GCP A;  1YIT Q;  4A63 B;  2VXE A;  3CC4 T;  2WSC E;  5ECA A;  3OB9 A;  2DM1 A;  4ME7 A;  2KRN A;  2K79 A;  2OX7 A;  1VQ4 A;  3CC2 A;  1KIK A;  4BY6 B;  2I0N A;  3UAT A;  1H8K A;  2DJZ A;  5LJ3 h;  4JJD A;  1I07 A;  5GAO p;  2EQU A;  2AK5 A;  1M1K R;  1Q7Y U;  2CH4 A;  3RKX A;  1ZX6 A;  4WCI A;  3M56 A;  2OI3 A;  1ZA2 B;  4LE9 A;  1M9S A;  1Q82 C;  1NLO C;  2EYQ A;  2RNA A;  2XHC A;  1M5Q 1;  1M90 C;  5HCK A;  3UDC A;  2K2M A;  5KYN A;  2F69 A;  2DYI A;  4BE0 A;  4FU6 A;  3D7S B;  4N0A C;  4HVU A;  1TSF A;  4EMG A;  3A8L B;  3VS1 A;  5LJ5 h;  1BKB A;  3M4G A;  1QQJ A;  1MMA A;  4Y91 A;  1VQ9 A;  4LXC A;  3OYB A;  3CC7 Q;  2JS0 A;  4M7A A;  1S72 T;  3JB9 F;  2HKN A;  4E7S A;  2X3X D;  2ZPE B;  4AG2 C;  1ZUU A;  4PJO G;  5L23 A;  1S72 Q;  5GAM e;  4UC4 A;  5KCH A;  1VQ4 Q;  4M7D B;  1MMN A;  4YTL A;  4PLI A;  4ZGD B;  1VQN T;  1OU8 A;  2DVJ A;  1WJS A;  4HT8 A;  5GAM d;  5GAN 7;  1B3Q A;  1YJN A;  1PD0 A;  1GL5 A;  2JVV A;  4M7A F;  1B34 B;  2OTL T;  1VQ7 Q;  3E19 A;  4C5G A;  1W70 A;  4E7K A;  5GAO q;  1VIF A;  1M1G A;  1RAC B;  2LT1 A;  4FYX B;  5GAO l;  4X9D A;  1BB9 A;  3JSC A;  4J9B A;  1M2V B;  1VQ6 T;  5GAN j;  1YWP A;  2EAY A;  1K0X A;  2EGA A;  3JCM e;  5LJ3 j;  1JBM A;  2RK2 A;  3JCM b;  5I2S A;  3OBY A;  4JS4 A;  5GMK m;  4RTU A;  3R6N A;  3PE0 A;  3GLX A;  1OZ2 A;  1BIA A;  1QVG P;  2DIQ A;  1WHJ A;  1W4S A;  3LH0 A;  3LYI A;  3CD6 T;  2DF6 A;  2K3X A;  3DKM A;  4FYV B;  2LJ3 A;  2M16 A;  1N9S A;  3V8J A;  3J80 E;  1ABO A;  4M75 F;  1NJI C;  1VQL A;  4J6W A;  2R57 A;  4HCK A;  5IT9 E;  1M90 R;  1QW1 A;  2E6N A;  1K8A C;  4JZ4 A;  2X4J A;  5CKH A;  3PIP A;  1FMK A;  3CCM A;  2E70 A;  4C92 G;  3NTK A;  4OMO A;  2DMO A;  1G2B A;  4M77 A;  1U1T A;  5FRO A;  1X6O A;  1SRM A;  2DRK A;  1BCM A;  1RI9 A;  4Z89 A;  2QDY B;  1I8F A;  3CCM Q;  3NTI A;  4M7A C;  2HQE A;  2JTF A;  2JMC A;  1VQO T;  1UUE A;  3M57 A;  4J8O A;  3MPU B;  4BAC A;  1QP3 A;  3QDF A;  2KAF A;  2NUT B;  4EMH A;  2RF0 A;  1M3B A;  2CS7 A;  1WNL A;  2HBP A;  2O01 E;  3UF4 A;  1ZSZ B;  1K9M C;  3V7S A;  4JRP A;  2X4X A;  3EFO B;  2LRQ A;  2KXC A;  1TUD A;  2H3J A;  4Y92 A;  8ATC B;  5LJ5 e;  3I5R A;  4HCZ A;  1VQM T;  1YHQ Q;  2MIO A;  1BCO A;  7AT1 B;  2RJE A;  3EFO A;  3CXC A;  1VQP A;  2FB7 A;  3RES A;  4M7D F;  1Q81 U;  4D8K A;  2MAM A;  4E6R A;  1OPK A;  1M27 C;  1T0H A;  2DL5 A;  3AHU A;  5A0D A;  4L5G A;  2DX1 A;  2LCS A;  2E64 A;  3PIO A;  1UGQ B;  2CT4 A;  3EG9 B;  1PM3 A;  1FMV A;  2CDT A;  3OYC A;  1AEY A;  1TOV A;  1XJW B;  4Z02 A;  1EZZ B;  3CXC P;  5IXB A;  4BI4 A;  3S3O A;  4LDW A;  2HMA A;  2L3Q A;  3FIF A;  3M58 A;  4BE2 A;  1LVK A;  2KMT A;  4KGV B;  2CZ0 B;  2J7I A;  2H3E B;  1VQM Q;  4M7D C;  2EGC A;  3EH2 A;  3THK A;  1YIJ T;  2K5F A;  1X69 A;  2DD5 A;  4HCC A;  1I1J A;  4C92 C;  2XU8 A;  4DEY A;  4IUR A;  1HYO A;  2K57 A;  4M78 B;  2GQI A;  3OSV A;  2HNI A;  5J26 A;  4JJC A;  3V7R A;  2VB6 A;  1KQ2 A;  5CQX A;  2L3P A;  1SHF A;  2FEI A;  4M7D D;  5FU6 C;  3NFC A;  1GBR A;  3A8H B;  4J6X A;  4M75 A;  5KYX B;  5KH6 A;  1N9R A;  1M8M A;  2DNU A;  4QKU A;  1YJW T;  1UEB A;  3BE3 A;  3CCU T;  2L2P A;  2R58 A;  5CO7 A;  2YT6 A;  2LZ6 B;  4CC7 A;  4O6J A;  3ULR B;  1YI2 A;  1K8A R;  3L1A A;  4ZNX A;  2HL5 C;  5L8R E;  1I0C A;  4LN2 A;  2MF2 A;  2JUF A;  3REA B;  2FVU A;  4QT7 A;  5IAY A;  2DTH A;  2X3W D;  1T3L A;  3SFM A;  2EQI A;  1MMD A;  2YRV A;  4PLL A;  3PGG A;  3M0P A;  4RTV A;  5IHK A;  1VYV A;  2HL3 A;  4PNO A;  3BFM A;  2CT3 A;  5CKF A;  3M0R A;  4X34 A;  1K9M R;  3NMZ C;  1WQ7 A;  2ABL A;  2VWF A;  3VJP A;  3OA6 A;  1QCF A;  2M02 A;  1AWJ A;  3OYL A;  5J39 A;  1Q81 C;  1VOM A;  2A7Y A;  2OAU A;  1M30 A;  4ZN1 A;  1TG0 A;  3RR6 A;  1G3W A;  3CC2 Q;  4NL2 A;  4IUT A;  1VQ7 A;  5HK0 A;  2KNB B;  5GAN 5;  4KBM B;  2H8H A;  2KRO A;  2F5T X;  1GXI E;  3CCQ T;  2OTL A;  4P5N A;  1WXU A;  6AT1 B;  5IN1 A;  3CCV T;  2DYB A;  3F70 A;  2QA4 A;  5KYU A;  1SG5 A;  4JUV A;  2DTI A;  4PFO A;  1S1N A;  2LMJ A;  3MCA B;  2C0O A;  2RJC A;  2G3R A;  2DEQ A;  4C8Q C;  3BW1 A;  2YUQ A;  1YCY A;  3M54 A;  4M77 D;  5GJW B;  5LJ3 d;  1WA7 A;  2QA4 Q;  3JV3 A;  5LJ3 f;  3OYF A;  2FZK B;  3CQT A;  1IRX A;  4PL6 A;  5GMK j;  3RER A;  2GQV A;  3CBO A;  2RB6 A;  4J9I A;  4J9E A;  3UA7 A;  3H9N A;  4XU2 A;  3DLM A;  1PSF A;  4HCB A;  3JB9 J;  2RK1 A;  2CYZ B;  3M0S A;  1LOJ A;  2JTM A;  2EBP A;  1UGR B;  1BIB A;  3CCE T;  3VRZ A;  1CKB A;  1QCN A;  5CKE A;  2O31 A;  1MMG A;  1T3S A;  2LCL A;  2QDL A;  1VQK Q;  2LQK A;  3QWX X;  2EKH A;  1D09 B;  3J81 E;  1RAD B;  4C0G A;  2CZ1 B;  4RCC A;  4TVR A;  2X51 A;  2YSQ A;  1RAB B;  2B86 A;  4X1V A;  2EWN A;  1NEB A;  1V29 B;  2BZY A;  3RIR A;  1WX6 A;  2PU9 B;  3QUI A;  3URG A;  3JRZ A;  4E47 A;  1MNE A;  1JJ2 S;  3EGX A;  3H0H A;  3A98 A;  1KC8 U;  4M78 C;  1X6B A;  4DBR A;  1V1C A;  5FU7 B;  1VQ4 T;  2FPF A;  1RLQ C;  2EVR A;  2EIF A;  1Q95 G;  1WHK A;  4R56 A;  5C0M A;  1VQ8 T;  3HRU A;  3MEV A;  3P8B B;  2PNI A;  4L59 A;  5CKB A;  3OYN A;  3JCM P;  1YIJ Q;  3CEY A;  2CSQ A;  2W0Z A;  2GFU A;  2E3I A;  4FSS A;  4M78 D;  2JT4 A;  5KYX A;  2AZV A;  2CKK A;  9ATC B;  2DAQ A;  4XTW A;  1K73 C;  3CCE Q;  1RAI B;  3CCR T;  2IIM A;  3OSS C;  2LX9 A;  4ELY C;  2MCN A;  2KGT A;  2DD4 A;  5GAN e;  3ER0 A;  4E7L A;  4OP0 A;  1Q82 U;  2D0Q B;  2D6F A;  2ZPH B;  2DPP B;  1B34 A;  2EW3 A;  1YI2 T;  4XTU A;  2CSI A;  5LL6 S;  1PKT A;  2AT1 B;  1KD1 R;  2NUP B;  2V26 A;  3CXC S;  2QXF A;  4JJN K;  2KE9 A;  2P4T A;  2SEM A;  1KD1 U;  4Z8A A;  2DL8 A;  5KE3 A;  4QQ6 A;  3RBB B;  4J9H A;  1ZSG A;  5D6Y A;  4XK8 E;  4Z88 A;  1UGV A;  2A08 A;  5CAI A;  4FYY B;  2EJG A;  4OF1 A;  2GFA A;  3CCV A;  3CME Q;  2YUN A;  1N27 A;  1WPY A;  3I56 T;  1KJW A;  3PMI A;  3ZFJ A;  1AVZ C;  1YHQ A;  1K9M U;  2EJ9 A;  3LW5 E;  4D6W A;  4M77 F;  1YIT T;  5KYY B;  4PJO C;  1XTD A;  2HD0 A;  4C8Q E;  2QYZ A;  2L3S A;  3MJX A;  3HSB A;  4BI3 A;  4HXJ A;  1H3H A;  3IQL A;  1PRM C;  3GP8 A;  1YIJ A;  1PG5 B;  8AT1 B;  4HKE A;  4GLM A;  2VGN A;  3MEU A;  1Y7X A;  4LDU A;  4RG8 A;  4FSX A;  3OW2 P;  3EG3 A;  4F7U B;  3GF5 A;  3M5A A;  5KYY A;  2AHJ B;  2J6K A;  5CQY A;  2K6D A;  1QKX A;  3SHW A;  1DJ7 B;  3JCM X;  1RLP C;  4IIO A;  3G4S A;  1QVG A;  2A37 A;  2QQB A;  1K4U S;  3CPW A;  2DZC A;  4MDW A;  1EX4 A;  5A0G A;  1W6X A;  2M1H A;  2PZ1 A;  2X4Y A;  2DTO A;  5GAN 3;  2KDS A;  1SF9 A;  2IVW A;  3JAM E;  3I5S A;  2DKG A;  1KHI A;  2PQW A;  2ZZD A;  4LNP A;  2EGE A;  2LTO A;  2DET A;  3OYY A;  3MEA A;  2E1H A;  1ZLM A;  2JN0 A;  2ED0 A;  2ZAE A;  3SWN C;  2RJD A;  3JB9 G;  4FT2 A;  4EPC A;  1PC0 A;  1Q86 R;  2JTE A;  2NYS A;  1VQP Q;  4HVW A;  3MP6 A;  2Y4X A;  2JW4 A;  5CKD A;  3NGP A;  1WJR A;  3UA6 A;  4EIK A;  1HXD A;  4M7A G;  4ORZ A;  2XMF A;  4FM4 B;  4M78 E;  4F14 A;  2HKQ B;  4J6Y A;  4JRK A;  2KK4 A;  1FX7 A;  3OYM A;  2E41 A;  4M75 E;  4E2F B;  3L2Q A;  1BI3 A;  2DK3 A;  3I35 A;  1K1Z A;  1SEM A;  1SRL A;  4JPB W;  4BUG A;  2CH4 W;  3AT1 B;  4QW2 A;  3TVT A;  1PNJ A;  4QQG A;  3CCS Q;  1VQK T;  3RDV A;  4PFP A;  1K0S A;  3X25 B;  3VYG A;  5GAN f;  1KQS A;  2AKK A;  5GAN d;  3BY7 A;  4ANJ A;  2V1R A;  1U06 A;  1IB8 A;  1UE9 A;  2HCK A;  5FWB A;  1I5L A;  2E3H A;  3T9N A;  5GAO m;  1UDL A;  1W1F A;  2GTJ A;  2NWM A;  4PJJ A;  4J7I A;  3HTR A;  3VV0 A;  3QZ9 B;  1WHG A;  2L89 A;  2P84 A;  3OBW A;  1NM7 A;  3WVE B;  2LX7 A;  4M4Z A;  1PHT A;  3OW2 A;  4FCY A;  4PJO D;  2OTJ Q;  1YI2 Q;  3O5Z A;  4F17 A;  1EFN A;  2PVG B;  4LD6 A;  4C5H A;  2CP3 A;  2LQW A;  1M3A A;  3HPW A;  1TS9 A;  1X27 A;  2HSE B;  3MEW A;  3QZ5 B;  2VC8 A;  4R55 A;  1VQ6 A;  2DL3 A;  3LWI A;  3LLR A;  3VS4 A;  1AWO A;  5FWC A;  5GMK i;  5GJV B;  4RTW A;  4PJO E;  4J83 A;  2EQK A;  3KFV A;  2QEX T;  4A53 A;  2HBW A;  1OI1 A;  1JXO A;  1H3Z A;  1NBE B;  1TXQ A;  1ZSZ A;  1H64 1;  3V8K A;  2FL7 A;  2LC4 A;  3CCM T;  4OGE A;  1E6G A;  4C5E A;  4DOW A;  5GAN 2;  4PK4 A;  4RG2 A;  1UHC A;  3E9F A;  1VQL T;  2EKO A;  3SD4 A;  3QYH B;  4JRI A;  4OVA A;  2VGM A;  1UB4 A;  5GMK h;  1VQ9 T;  4BY6 C;  2W10 A;  5LJ5 f;  4NL3 A;  3G6E Q;  1VYT A;  4OGC A;  5DLO A;  2LDM A;  5EC7 A;  4M7D A;  5C6S A;  2EYX A;  3SWN B;  4NS5 A;  3VS0 A;  3OMC A;  4GLK A;  1X2Q A;  4M75 D;  2DFU A;  1Y57 A;  1ZQ1 A;  2E6Z A;  2SRC A;  1NYG A;  2RH2 A;  3OYD A;  1SHG A;  4NOY A;  2RHY A;  2QTX A;  1X6G A;  4EMK A;  2D1X A;  2MYS A;  2MI6 A;  2V8K A;  3CPF A;  2VXF A;  2B8A A;  1UTI A;  2LNV A;  1M1K C;  3PTA A;  3E1S A;  2JZ2 A;  4A4K A;  1U1S A;  1YHQ T;  2COW A;  2K2V A;  2KSS A;  4M75 C;  5GAN 6;  3OYK A;  1R8O B;  3HRT A;  3QKJ A;  4HVV A;  1BBZ A;  3M9Q A;  2E65 A;  4M75 B;  2M9U A;  2RHU A;  3A8G B;  3GNG A;  4C5I A;  3ZL7 C;  2CZ7 B;  1MUZ A;  2EJF A;  5A0L A;  4KT0 E;  5HKC A;  4FIB A;  3OYE A;  4EMK B;  3MP1 A;  5CVI A;  1FMW A;  1PSE A;  5GAM j;  3CCU Q;  2MWO A;  4M78 F;  1VQN Q;  3RMS A;  3VS5 A;  2RM4 A;  1VA7 A;  2RHZ A;  5DM7 R;  1U5S A;  3JB9 D;  1UHF A;  3C95 A;  4RCB A;  3CCE A;  4HA8 A;  2FRY A;  4XTV A;  1W2B S;  1QVF P;  2YXY A;  3VUB A;  2J05 A;  2QGF B;  3CCR A;  4IKF A;  3KXT A;  2DXU A;  3TCJ A;  3CMA T;  1LPL A;  2EYY A;  4C92 F;  2ECZ A;  2J06 A;  2O4X B;  1N5Z A;  1O75 A;  1QWF A;  4JRQ A;  3EGD A;  1AHJ B;  4PJO F;  1UJ0 A;  4BE1 A;  2M0Y A;  4GBQ A;  4M7D G;  2HSP A;  2C0T A;  2WSF E;  4LDY A;  4M7A B;  1FYN A;  3FDR A;  2Y4Y A;  3CCL Q;  2JM8 A;  1YJW Q;  1OX9 A;  4XTZ A;  3OS2 A;  1VUB A;  5AT1 B;  3EG0 A;  1OPL A;  3JB9 H;  4FYW B;  1V76 A;  4DQ2 A;  3OYJ A;  3E9G A;  4ATO A;  4OMM A;  3CC2 T;  2DVE A;  4OMF B;  1IGU A;  2QQ9 A;  2DRM A;  1AWW A;  1ZHI A;  1OU9 A;  1W2B P;  1QVF S;  1RAF B;  3S3M A;  1AD5 A;  1B07 A;  4KH0 B;  3G7Z A;  4FT4 A;  2AZS A;  2RD1 A;  4II1 A;  1ABQ A;  2J6F A;  1OZ3 A;  2P4R A;  3R6O A;  1NEG A;  1UEC A;  2JJ9 A;  2JNG A;  2QAS A;  1Y07 A;  2QAZ A;  3CCR Q;  4C92 A;  3WXM B;  5KYW B;  1VQ8 Q;  4J9C A;  4XQ3 A;  1YN8 A;  2M51 A;  1X01 A;  4ELZ C;  3DLL A;  5CK9 A;  1YJN Q;  1D3B A;  2D8J A;  3G1J A;  2O2O A;  1WXT A;  1TUC A;  3A8M B;  4AT1 B;  2QTV A;  1NPP A;  5LJ5 j;  1PWT A;  3CCL A;  1YJW A;  2XIC A;  1AOJ A;  1YCS B;  2RN8 A;  3HP9 A;  4KUL A;  2NUZ A;  4CC4 B;  1F1B B;  1D0X A;  1ZBX A;  3FJP A;  2QA4 T;  1P92 A;  2DIL A;  3TSZ A;  2COY A;  1VQ9 Q;  4BDY A;  2D9T A;  2ROT A;  2K4Y A;  3OW2 S;  4KRT A;  2KY9 A;  1D1B A;  1LCK A;  2KRS A;  2K7A A;  2M0O A;  2KBT A;  2CP5 A;  1YJ9 T;  2RQT A;  5A2Q E;  3CCJ A;  3MET A;  1VQ7 T;  2ENM A;  3CCS A;  2QK0 A;  2DBM A;  2KRM A;  2G6F X;  2GF7 A;  1NYF A;  4RTX A;  3G71 Q;  2XG8 D;  4C92 B;  1Q7Y C;  3A5Z B;  1GBQ A;  1KSW A;  1Q82 R;  3JCM Q;  1WLP B;  2YLB A;  1JQQ A;  2CUB A;  2L8D A;  2QGG A;  2DER A;  1TWB A;  4N0A A;  4B9X A;  4IUP A;  2ZPG B;  3ZEH A;  2VVK A;  1VQ5 T;  3PFS A;  3PVQ A;  1K73 U;  5HK3 A;  2X4W A;  3BDU A;  3H0F A;  3DB3 A;  2MWP A;  1OX8 A;  3UWN A;  1K73 R;  4C0F A;  4R0K A;  2ZCF B;  2BE7 D;  3C94 A;  4LUE A;  5GAN h;  2BKD N;  4GY5 A;  1WHM A;  3G6E T;  3HFN A;  1NLP C;  2F1L A;  3J7A F;  1I81 A;  4E7H A;  4BDZ A;  2MK5 A;  1VQM A;  2ED1 A;  2O9V A;  1IHV A;  1TTH B;  2JOY A;  4JS5 A;  3P8H A;  1K76 A;  1UJY A;  1ZUK A;  3JCM g;  5KYU B;  3HKS A;  1BI1 A; 
#chains in the Genus database with same CATH homology
 2DMO A;  1G2B A;  1CSK A;  3UA6 A;  1Z9Z A;  3GBQ A;  1SRM A;  4EIK A;  2DRK A;  4Z89 A;  1RI9 A;  4ORZ A;  2XMF A;  4F14 A;  2FG0 A;  2DA9 A;  2JMC A;  1UUE A;  2JMA A;  4J9F A;  3VS6 A;  2LP5 A;  3TSW A;  3I35 A;  2RF0 A;  1K1Z A;  1M3B A;  1SEM A;  1SRL A;  4JPB W;  1UG1 A;  2CH4 W;  2KEA A;  3TVT A;  1PNJ A;  2LQN A;  2F2X A;  3UF4 A;  1PRL C;  1XOV A;  1K0S A;  4CC3 A;  2AKK A;  2KXC A;  1TUD A;  3I9Q A;  4Y92 A;  1PKS A;  2FO0 A;  3I5R A;  2V1R A;  1U06 A;  2GBQ A;  1BU1 A;  2MIO A;  1UE9 A;  2HCK A;  5FWB A;  1JU5 C;  1IO6 A;  1UDL A;  3M0T A;  1W1F A;  2GTJ A;  2C0I A;  2NWM A;  2FPD A;  2YUP A;  4D8K A;  2DL7 A;  2DJQ A;  4E6R A;  1OPK A;  1M27 C;  1T0H A;  2DL5 A;  1WIE A;  1UFF A;  1NM7 A;  1RUW A;  2DX1 A;  4J9D A;  1CKA A;  2LCS A;  2RMO A;  2LX7 A;  2CUD A;  3H0I A;  1PHT A;  2CT4 A;  4M4Z A;  2JXB A;  3REB B;  2CDT A;  4RTZ A;  1AEY A;  3M0U A;  3O5Z A;  4F17 A;  1EFN A;  3NPF A;  5IHI A;  5IXB A;  2LQW A;  1M3A A;  2BTT A;  2L3Q A;  2E5K A;  2OAW A;  1X27 A;  2PTK A;  2J7I A;  3PVL A;  2DL3 A;  2VKN A;  2EGC A;  3THK A;  4DEX A;  1WDX A;  4LUD A;  1X69 A;  3VS4 A;  1AWO A;  1I1J A;  5FWC A;  1MV3 A;  4DEY A;  1HD3 A;  2JM9 A;  5GJV B;  4RTW A;  2GQI A;  3EHQ A;  2FRW A;  2KXD A;  3KFV A;  5I22 A;  4JJC A;  2LJ0 A;  2HBW A;  2K3B A;  1SPK A;  4ESR A;  2L3P A;  1JXO A;  1SHF A;  2FEI A;  2GNC A;  1GBR A;  1NG2 A;  1E6G A;  2RQR A;  1M8M A;  2YDL A;  2DNU A;  2L2P A;  1H92 A;  1UHC A;  1AZE A;  2YT6 A;  1SSH A;  2LZ6 B;  4J9G A;  3VS3 A;  4CC7 A;  3ULR B;  2A36 A;  1QKW A;  4AFQ C;  4ZNX A;  1I0C A;  2O9S A;  2K9G A;  4LN2 A;  5I11 A;  1AWX A;  3VRY A;  4OMQ A;  3REA B;  2MOX A;  4QT7 A;  3EHR A;  1X2K A;  2W10 A;  2X3W D;  1ARK A;  1HSQ A;  1T3L A;  2EQI A;  1WI7 A;  3SEM A;  2KT8 A;  1VYT A;  3M0P A;  4RTV A;  5IHK A;  1BK2 A;  2RQV A;  5EC7 A;  1VYV A;  2CT3 A;  1G83 A;  2EYX A;  3M0R A;  3VS0 A;  1E7O A;  1X2Q A;  3NMZ C;  2ABL A;  2VWF A;  1Y57 A;  1QCF A;  2KT1 A;  1NYG A;  2SRC A;  1E6H A;  4RUG A;  1AWJ A;  1SHG A;  3EG1 A;  2J6O A;  2RQW A;  1M30 A;  1TG0 A;  1X6G A;  2D1X A;  1GCQ A;  1OEB A;  2YUO A;  2DL4 A;  1WFW A;  2KNB B;  1UTI A;  4JJB A;  5IXF A;  2H8H A;  3EG2 A;  2KRO A;  1GFD A;  1T0J A;  1X43 A;  2GGR A;  3M0Q A;  1WXU A;  4K11 A;  4HVV A;  1MV0 B;  2ESW A;  1BBZ A;  2DYB A;  1GFC A;  3RNJ A;  1S1N A;  2LMJ A;  2C0O A;  1YP5 A;  2YUQ A;  3ZL7 C;  3U23 A;  1J3T A;  2AKL A;  1MUZ A;  4OMN A;  2BZ8 A;  5GJW B;  1AZG B;  1WA7 A;  2F2W A;  3VS2 A;  3JV3 A;  2V1Q A;  2LJ1 A;  3CQT A;  2EYZ A;  3VS5 A;  1VA7 A;  2KYM A;  1U5S A;  1UHF A;  3VS7 A;  4J9I A;  4J9E A;  2FRY A;  3UA7 A;  1A0N B;  2J05 A;  3M0S A;  4CC2 A;  3NHN A;  2EYY A;  4IIM A;  3H41 A;  2LNH B;  4D8D A;  4AFZ C;  2EBP A;  2ECZ A;  2L0A A;  2HDA A;  2J06 A;  1N5Z A;  3VRZ A;  1CKB A;  5IH2 A;  2DBK A;  1VYU A;  1QWF A;  2KYB A;  2EYW A;  2RPN A;  2O31 A;  4RTT A;  1K9A A;  1UJ0 A;  1T3S A;  2BZX A;  2QDL A;  3QWX X;  2M0Y A;  4GBQ A;  2EKH A;  2O88 A;  2FPE A;  2HSP A;  2D8H A;  2C0T A;  1ZBJ A;  1FYN A;  1GCP A;  4A63 B;  2YSQ A;  5ECA A;  2DM1 A;  2B86 A;  2KRN A;  2JM8 A;  2K79 A;  4X1V A;  1NEB A;  1KIK A;  2JS2 A;  2BZY A;  2ROL A;  2I0N A;  1OOT A;  1H8K A;  1WX6 A;  3UAT A;  4JJD A;  1I07 A;  2F2V A;  3EG0 A;  1OPL A;  3H0H A;  3A98 A;  2AK5 A;  2CH4 A;  1X6B A;  2GTO A;  2D0N A;  2DE0 X;  1V1C A;  1ZX6 A;  4WCI A;  4OMM A;  2FPF A;  1OV3 A;  1RLQ C;  2OI3 A;  2DRM A;  2EVR A;  1AWW A;  2CRE A;  4LE9 A;  1AD5 A;  1B07 A;  1NLO C;  2RNA A;  2AZS A;  1ABQ A;  1M3C A;  2PNI A;  2J6F A;  5HCK A;  2P4R A;  1NEG A;  2K2M A;  2CSQ A;  2DLP A;  1UEC A;  2W0Z A;  4FSS A;  2JT4 A;  2AZV A;  4HVU A;  3VS1 A;  2IIM A;  4J9C A;  1YN8 A;  2M51 A;  2EPD A;  2MCN A;  2KGT A;  1JEG A;  1YNZ A;  2D8J A;  2JS0 A;  4OMP A;  2O2O A;  2KR3 A;  2X3X D;  1WXT A;  4AG1 C;  2EW3 A;  4AG2 C;  1TUC A;  1HJD A;  2CSI A;  1PKT A;  1ZUU A;  5L23 A;  1PWT A;  1JO8 A;  1Y0M A;  2KE9 A;  1AOJ A;  1YCS B;  2RN8 A;  2SEM A;  4Z8A A;  2DL8 A;  3RBB B;  4J9H A;  1ZSG A;  2NUZ A;  4Z88 A;  2DVJ A;  4CC4 B;  4AFU C;  1UGV A;  1WYX A;  2A08 A;  1Z9Q A;  2DIL A;  3TSZ A;  1B3Q A;  2ROT A;  1WXB A;  1GL5 A;  2YUN A;  2A28 A;  1KJW A;  1AVZ C;  3EGU A;  4AFS C;  3LH5 A;  4KRT A;  1LCK A;  2KRS A;  4F16 A;  1W70 A;  2K7A A;  3C0C A;  2KBT A;  4RTY A;  2RQT A;  2L3S A;  2ENM A;  3FJ5 A;  2DBM A;  2KRM A;  1GCQ C;  4HXJ A;  1H3H A;  1BB9 A;  2HEQ A;  1PRM C;  3IQL A;  2G6F X;  3QWY A;  4J9B A;  1NYF A;  4JZ3 A;  4RTX A;  1YWP A;  1QWE A;  4GLM A;  1GBQ A;  1K0X A;  1KSW A;  2EGA A;  3EG3 A;  1WLP B;  2J6K A;  2K6D A;  1QKX A;  1JQQ A;  3SHW A;  1U3O A;  1RLP C;  2CUB A;  1ZUY A;  4IIO A;  2A37 A;  4RTU A;  3R6N A;  1K4U S;  3PE0 A;  5IHN A;  1W6X A;  2PZ1 A;  2RQU A;  2VVK A;  3PVQ A;  1QLY A;  3I5S A;  3H0F A;  2DF6 A;  2EGE A;  4LNP A;  1ZLM A;  2ED0 A;  4OML A;  2LJ3 A;  4R0K A;  4LUE A;  5FW9 A;  1KFZ A;  1ABO A;  1NLP C;  2OJ2 A;  4HCK A;  1GRI A;  1YWO A;  2ED1 A;  2JTE A;  2O9V A;  4JZ4 A;  4HVW A;  1JXM A;  1FMK A;  1K76 A;  1UJY A;  2JW4 A;  1ZUK A;  3NGP A;  4OMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...