1UECA

Crystal structure of autoinhibited form of tandem sh3 domain of p47phox
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
180
structure length
177
Chain Sequence
ILQTYRAIADYEKSEMALSTGDVVEVVEKSESGWWFCQMKAKRGWIPASFLEPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYLQKSGQDVSQAQRQIKRGAPPRRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFLQQRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil cytosol factor 1
publication title A molecular mechanism for autoinhibition of the tandem SH3 domains of p47phox, the regulatory subunit of the phagocyte NADPH oxidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 39
structure length 177
sequence length 180
ec nomenclature
pdb deposition date 2003-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF16621 NECFESHC SH3 terminal domain of 2nd SH3 on Neutrophil cytosol factor 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1uecA02
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1uecA01
1X2KA 2L2PA 2XMFA 3EG1A 3QWXX 1BU1A 2DILA 2LJ0A 1G83A 4CC2A 1YN8A 2KNBB 3FJ5A 1RLPC 2KYBA 2AKLA 1PKSA 3VS4A 2K79A 1NLPC 4EIKA 1JQQA 3KFVA 2F2XA 2JXBA 2K7AA 1H3HA 2JS2A 1H92A 5EC7A 4J9EA 2EBPA 1YCSB 3H0IA 1NYFA 1JXOA 1KJWA 4D8DA 1A0NB 1AWXA 2DX1A 2ED1A 4ZNXA 2A36A 4J9HA 2VVKA 1OOTA 1NEGA 2KRNA 2DL3A 1W6XA 4ESRA 2EVRA 3I5SA 2L3QA 1ZUYA 3SHWA 2AZSA 2FG0A 1G2BA 4CC4B 3JV3A 1V1CA 4D8KA 1BBZA 2EGAA 4AFUC 2MCNA 3ZL7C 2LP5A 4Z88A 2LCSA 2ROLA 1Z9QA 3R6NA 5ECAA 2JM8A 1RUWA 3C0CA 4LN2A 4E6RA 2RN8A 4RTXA 1NYGA 1UHCA 1X27A 1QCFA 1AEYA 3UATA 4K11A 3REAB 2O9VA 3EG2A 2DLPA 2FPDA 2C0OA 3PVQA 3REBB 4HVVA 2B86A 3NPFA 2HEQA 2YSQA 2W0ZA 2J05A 2FRYA 1M3BA 4JJBA 1NLOC 1BB9A 1OPKA 2L0AA 3M0RA 4Z89A 1K76A 2O9SA 3VS0A 4Y92A 3THKA 1ARKA 3M0TA 4JPBW 2RF0A 4JZ4A 1PHTA 4X1VA 2BZXA 1SPKA 3H0FA 4RTVA 2FO0A 2HCKA 1JO8A 2BZ8A 2KEAA 2YT6A 1WDXA 2EQIA 1UHFA 1TUCA 1JXMA 2F2WA 4FSSA 3IQLA 2CSQA 2IIMA 2DRMA 2CH4W 1CKAA 4IIOA 1TG0A 2DYBA 1M3AA 4WCIA 4OMPA 1E6HA 2FPEA 2YUNA 2LQNA 4R0KA 1TUDA 2J6KA 1YWOA 1B3QA 1NM7A 1AD5A 2J7IA 2CT4A 4HVUA 3VS6A 4RTZA 2EGCA 3ULRB 1WFWA 1W70A 3M0UA 1K1ZA 1WIEA 3VS7A 2AK5A 2OAWA 1UG1A 2JT4A 4AFQC 1GFDA 4RTTA 2A28A 2RQUA 1M3CA 3VS2A 2RQTA 1CSKA 5IHNA 4F16A 3UA7A 2K3BA 2CSIA 4RTWA 3PE0A 2D1XA 1JU5C 2LQWA 3A98A 2GNCA 4DEXA 3EG3A 2DE0X 1MV0B 2DJQA 3I35A 2CUBA 2EGEA 1PNJA 4J9BA 4OMLA 1I0CA 2G6FX 1HD3A 1VYVA 2KR3A 1YWPA 1UECA 2JS0A 3VS5A 2K9GA 1K4US 2YUQA 3SEMA 1NEBA 2JW4A 3EHRA 1PRLC 4LUDA 1UJ0A 4DEYA 1E6GA 2JMAA 2YDLA 2ED0A 1K9AA 3VS3A 3NGPA 4OMNA 4GLMA 1ZUKA 3EGUA 4Z8AA 1Z9ZA 1UDLA 1KIKA 4J9DA 1AWOA 2DF6A 1UUEA 5IHIA 1X43A 1MV3A 1I07A 4KRTA 1NG2A 4OMOA 2CH4A 1GRIA 1UGVA 1FMKA 1H8KA 2A08A 2LMJA 1K0XA 2EPDA 1PKTA 2ENMA 5FWBA 2KT1A 1GFCA 2YUOA 1SHGA 1T3LA 2CUDA 2GBQA 2I0NA 1SEMA 4AG2C 2EYWA 4RUGA 2HDAA 1PRMC 2DMOA 2EYZA 2X3WD 1ZLMA 2ESWA 1WXUA 1GCQC 1X2QA 2GTOA 1U5SA 2L3SA 2KXCA 2PNIA 1T3SA 1B07A 2LZ6B 4A63B 1U3OA 3H41A 1OPLA 2SRCA 4IIMA 1M8MA 4QT7A 2V1QA 5HCKA 2D0NA 5FW9A 3M0PA 2J06A 2VKNA 2DA9A 2GQIA 2RNAA 2DL8A 2W10A 2HSPA 1VA7A 4J9IA 4JJCA 4CC3A 2F2VA 1QKWA 1X6GA 4OMMA 4RTYA 1S1NA 2DM1A 2O88A 1HJDA 3M0QA 5GJVB 1UFFA 2J6OA 1QLYA 1YNZA 1Y57A 2KE9A 2X3XD 4JJDA 1HSQA 2K2MA 2MOXA 1ABOA 3O5ZA 4AFSC 2OJ2A 5GJWB 3LH5A 1SSHA 2GGRA 3UA6A 2DRKA 1T0JA 3PVLA 4LE9A 1GCQA 2AZVA 1KFZA 2PTKA 2DL4A 2V1RA 1M30A 1I1JA 2L3PA 5I11A 2KYMA 1YP5A 2LX7A 1MUZA 4F17A 2ABLA 5I22A 1K0SA 1OV3A 4HXJA 1GBQA 2NWMA 4LNPA 1ZSGA 2O2OA 3EHQA 3CQTA 2FRWA 3GBQA 1PWTA 1UTIA 2A37A 2RQRA 1M27C 1AWWA 1SHFA 2D8JA 1AOJA 2LJ3A 1WI7A 2ROTA 1SRMA 2D8HA 1KSWA 1WXTA 2RQVA 3VRZA 2PZ1A 4OMQA 4J9CA 2QDLA 1AZEA 1FYNA 2DBMA 1QKXA 2SEMA 1AZGB 1UJYA 3U23A 1ZBJA 2YUPA 3TVTA 2DBKA 3QWYA 4J9FA 4F14A 2H8HA 1WA7A 1E7OA 2AKKA 2RQWA 1VYUA 2CDTA 2RPNA 1VYTA 1BK2A 2BTTA 1RLQC 3NHNA 5IXFA 2DNUA 2LJ1A 2CREA 2BZYA 3EG0A 4AG1C 3VS1A 1AVZC 4HVWA 2KGTA 2C0TA 3RNJA 1U06A 1XOVA 2JMCA 4GBQA 2KROA 1WYXA 1SRLA 5L23A 2KRMA 1IO6A 2KRSA 2JTEA 1QWFA 5FWCA 2MIOA 1UE9A 1GBRA 1LCKA 1J3TA 2M0YA 2DVJA 1X69A 2VWFA 2EYXA 2JM9A 1X6BA 2OI3A 1WLPB 1GCPA 1ZX6A 2P4RA 2C0IA 2FEIA 3M0SA 4LUEA 5IHKA 1GL5A 1WXBA 1N5ZA 2J6FA 1Y0MA 1RI9A 2EKHA 1QWEA 1CKBA 2RMOA 1EFNA 4ORZA 2NUZA 2DL5A 2GTJA 2HBWA 1OEBA 2KXDA 3H0HA 1W1FA 2ECZA 3NMZC 2FPFA 2K6DA 5IH2A 4HCKA 2EYYA 4J9GA 5IXBA 3TSZA 4M4ZA 3TSWA 4RTUA 1JEGA 4AFZC 2DL7A 2KBTA 2O31A 3RBBB 2LNHB 3I9QA 2M51A 1ABQA 2KT8A 1T0HA 4CC7A 2E5KA 3UF4A 1ZUUA 2CT3A 2EW3A 3VRYA 4JZ3A 3I5RA 1AWJA 1WX6A
chains in the Genus database with same CATH superfamily
1KC8R 2F1LA 4DBFA 2L2PA 2ZPHB 2XMFA 3QXEB 1G83A 3X25B 1IREB 2X4JA 4LDUA 1RLPC 2KYBA 3R6OA 5CKEA 2DIGA 3EH1A 3SFMA 2ZPBB 1RADB 2KDSA 4EIKA 1JQQA 2NYSA 3KBGA 5EC7A 3Q1JA 5GAMd 3CCET 3OYIA 3JCMh 2E4HA 2A36A 2LNVA 4LDXA 1VQKA 1OOTA 2KRNA 1W6XA 3H9NA 3I5SA 3MP6A 1VQ7Q 2K5FA 1ZUYA 4IUPA 1BBZA 2EGAA 2LP5A 5IAYA 1M8VA 3V8LA 1D0YA 3R6NA 1VQOQ 1RUWA 3M54A 2ZAEA 2I2LA 5A0DA 2QTVA 3TU4K 2DETA 3OW2S 2OAUA 2ZZDA 4HT9A 3REAB 3EG2A 4X9CA 3PT9A 2C0OA 3CCVQ 2JNGA 2KY9A 3PVQA 2W0ZA 1M1KR 3L2VA 1M3BA 1NLOC 4M7AB 1ACMB 3M56A 3EG9B 1XJWB 4Z89A 1JJ2A 1K76A 1VQNT 5L8RE 3L2WA 3VS0A 5CIUA 3MHXA 3I55A 1X75C 3M0TA 4C5IA 1Y7XA 3UDCA 1BI3A 1SPKA 3CCRA 5FU7B 3E9GA 2EQIA 1M90C 2KQWA 1JXMA 3T9NA 4FSSA 4O5VA 2V26A 2WSCE 1CKAA 1TG0A 4PKCC 1YIJA 2YHTA 1VQ9A 2E41A 2FPEA 4C92F 4C92E 2DO3A 2J6KA 4IURA 4Y28E 1KC8C 1W2BP 3MEAA 3ASKA 2CT4A 4OF1A 3ULRB 1W70A 8AT1B 1WIEA 2OAWA 4LDYA 4C8QG 2A28A 1IGQA 3V7SA 2HQXA 5KE2A 2YRDA 1M3CA 5KYWA 2RQTA 5IHNA 4ZN3A 1VQMA 2HAXA 2OTLT 2K3BA 3F70A 3PE0A 1JU5C 2JJ9A 1PD0A 2GNCA 1VQLT 1VQ5T 1ZBXA 4N0AC 3MJXA 1PNJA 2RD1A 4E7LA 2E10A 1TWBA 3ZFJA 1N8RR 2KR3A 2EQUA 1YJWQ 3NTKA 2JOYA 1UECA 2K9GA 3SEMA 1YFNA 1XQHA 1D1AA 2JMAA 2ED0A 1K9AA 3CPWA 3VS3A 1P92A 2LCLA 3NGPA 4PFZA 2H3JA 4OMNA 1VIFA 2D0QB 1ZUKA 1WJQA 2E5QA 3EGUA 1KIKA 2HD0A 2GQVA 1MV3A 1I07A 4M78F 4OMOA 3VJPA 1GRIA 1M1KC 2MWPA 1M9SA 1WJSA 1K0XA 2EPDA 2ENMA 3X20B 4N0AA 1RABB 2QXFA 4DA4A 1G3TA 1K73U 1VQ8A 1Q81R 1SHGA 2GBQA 2I0NA 3VUBA 4M77A 5GMKl 2DMOA 1TH7A 1GCQC 4LD6A 5D6XA 4DBRA 4KT0E 5HK3A 5GAN5 1KQSA 4PJMA 4BUGA 1IXDA 4GLKA 2CZ7B 1N27A 4M7AD 4ZGJB 3FLGA 5HCKA 3M0PA 1VQPA 2VKNA 2DA9A 4NOYA 1QVGA 3CCUT 2DL8A 2MMPA 3GF5A 4IUQA 4OB3B 3VUZA 4CC3A 1JB0E 2F2VA 1QKWA 4XTZA 4KUIA 1QVFP 3I56A 5GANd 1S1NA 5DLQE 3M0QA 5GJVB 1UFFA 4C92B 2J6OA 5GAN2 1Y57A 2ZPGB 5LJ5e 3EGDA 4QKUA 3CEYA 1V76A 1M5Q1 1HSQA 1KD1U 1ABOA 2DZCA 3CD6A 3CMET 2OJ2A 3CMAA 4FT4A 1Y71A 1GCQA 4A4GA 4BE2A 4N4GA 1TOVA 2DL4A 5CQXA 2RA2A 4R55A 8ATCB 1M30A 4MZMA 1VQ6T 1D0XA 1YITA 2XG8D 3OMGA 5GAN6 1Y96A 4C92G 2KYMA 2QA4A 3FEOA 1OI1A 2RHXA 2DAQA 3OYLA 3L2QA 2D9TA 1N8RC 3HRSA 1OV3A 1K0SA 3DLLA 5EG2A 3M5AA 1F1BB 2O2OA 2Z0WA 4FCYA 1UTIA 1K9MU 3MPUB 5GAMj 2D8JA 5GAOq 2PVDB 3SWNB 1WI7A 2ROTA 2D8HA 4AMCA 1KSWA 1WXTA 2RQVA 2DTHA 4OMQA 4C5HA 4J9CA 1ZA2B 3LYIA 2YUPA 2DBKA 4J9FA 2H8HA 2LQ8A 1N9SA 1WA7A 4DOVA 1VYUA 3A8GB 1VQ7T 2WSEE 2FZCB 4PFOA 2BTTA 5IXFA 3NHNA 5I21A 2DNUA 2EWNA 4IUUA 2CREA 3EG0A 3G4ST 3C4SA 2KSSA 2C0TA 1U06A 4BDZA 4M78B 1WYXA 1SRLA 5CCAA 1IO6A 5LJ5g 2KRSA 1WHMA 1VQOT 1ZA1B 5FWCA 1UE9A 2E3IA 2HKQB 2QGGA 1WPYA 1FX7A 5D6YA 4JS5A 2B8AA 2QQ9A 4A4KA 5I2SA 4LXCA 3CCVT 2JM9A 1Q95G 2JN0A 1PSFA 2OI3A 3RUXA 4M78G 1LNXA 3CPFA 2OTJA 3M0SA 2CZ1B 1KK7A 3GOXA 3JSCA 4XU1A 1WXBA 2E6NA 4M7AC 4OP0A 1QWEA 3BW1A 3MKDA 3M4YA 2RMOA 4B6MA 4MMKA 3JCMd 1YJ9Q 1U1TA 2DL5A 2GTJA 2XU8A 1RAIB 3S3OA 4M75B 4VUBA 3EGXB 4AFZC 1ZSZB 2O31A 2M51A 3BE3A 1ZUUA 3OYMA 5KCHA 4LD9K 3M59A 1RI0A 2RI3A 2XI9A 2LT4A 3P8BB 4XTXA 2A3LA 4FYVB 5GMKh 2K2VA 3V8JA 4M75G 3CXCS 3QWXX 3H6ZA 2DILA 5FLXE 2DK3A 1Q86R 2KNBB 3EG9A 3SDZA 3X28B 2VASA 3MO8A 2HQEA 2AKLA 4TVRA 3VS4A 4IUTA 2RK2A 5D6WA 1H92A 1QCOA 1QQJA 3H0IA 1OU9A 1NYFA 4QW2A 2DX1A 1LPLA 2XKOC 4J9HA 5KYYB 4C8QA 2VXFA 2EVRA 3SHWA 1NPRA 5GAOp 2FG0A 4CC4B 9ATCB 4J6XA 3A8MB 1S72T 1O9SA 1V1CA 3G7ZA 4XK8E 4AFUC 4HT8A 5HK0A 3G71A 1VQ4T 2QQSA 2LCSA 1G8XA 2ROLA 3HSBA 1BCOA 1M2VB 2COZA 5ECAA 3C0CA 4LN2A 1B34B 2RN8A 1NYGA 1UHCA 1FWZA 3CBPA 2EJ9A 4PNOA 1AEYA 3UATA 3OW2P 4HCZA 2O9VA 4M7AE 4M7AF 1X6OA 1UB4A 5FU6B 1NJIU 2YSQA 3N5BB 1Q82U 3RKYA 3JCMb 3JCMQ 2EFIA 2QI2A 3JCMJ 2Y90A 3JCMV 4V2SA 4M78D 1BB9A 4MZTA 1WHLA 1YIJQ 1OPKA 2YLBA 2LCCA 5C0MA 2EQKA 3CCUQ 1DJ7B 2M16A 3THKA 5FRNA 1ARKA 2QYZA 4JZ4A 2MI6A 2BZXA 1VIEA 2FO0A 2NUTB 2HCKA 2BUDA 1JO8A 2KEAA 2L3RA 2YT6A 4QVCA 1WDXA 1TUCA 4A4HA 2IIMA 5GAN7 2DD4A 1OU8A 3M55A 2DYBA 3CC4A 4WCIA 5LJ5j 1M90R 1E6HA 1TXQA 5GANj 1G3YA 4R0KA 1Q7YU 2QAZA 3ZBDA 2EJFA 4XTVA 3LLRA 1YWOA 4JRPA 2EYQA 1FXXA 4JUVA 4HVUA 3CCQQ 4RTZA 1Q86C 1WFWA 3M0UA 1K1ZA 4C92C 2PU9B 4D6WA 4M75D 5J39A 2K3XA 1MMNA 2IVWA 5CK9A 1XTDA 2HMAA 2RQUA 5LJ3h 3DB3A 2AHJB 4HA8A 1NBEB 4F16A 4NL3A 4RTWA 3TEEA 4MZPA 3LH0A 2V8IA 4OVAA 2KI7A 3EG3A 1Y07A 1MV0B 4ANJA 4J9BA 1QMCA 3CC2Q 4JDSA 2G6FX 5GAMe 1HD3A 4HKEA 5GAN4 1YWPA 3KUFA 4A54A 3VS5A 1K4US 2FB7A 1PRLC 5GAOm 3G4SQ 2YDLA 5KYXB 3KXTA 4J5YA 1VQLA 4C92A 3SWNC 3OMCA 5AT1B 1VQ5A 4Z8AA 1AWOA 3PNWC 3HPWA 3PIOA 2DD5A 2HNIA 1PG5B 1NG2A 3OSVA 2L89A 2PVGB 2R58A 4LDVA 2DTOA 2A08A 2LMJA 3A1PA 1D09B 5DY9A 1MMGA 2HSEB 2A7YA 1BKBA 2YUOA 5GAMf 1SSFA 2KMTA 3QDRB 4M78C 2E6ZA 4JJNK 3CC7A 4RUGA 3LGFA 2X4XA 2X3WD 2ESWA 5GAN8 2XDDA 4Y91A 1X2QA 4A4FA 1YI2Q 3CCMA 2GCXA 1U5SA 3OY9A 4HCBA 3SWNA 1T3SA 3P8DA 1B07A 2Y4XA 2M9UA 3CCLT 4BE1A 1FMVA 3EFOA 3CD6Q 2SRCA 4M7AG 4QT7A 3CMAQ 5FW9A 1I5LA 3G1JA 5GAOn 2GQIA 3QJYA 1NZ9A 2HSPA 5GAMg 1AHJB 2F69A 3QUIA 1YITQ 2XIDA 1YJ9T 2QA4Q 3VV0A 2DM1A 1HJDA 1QLYA 1YNZA 2E64A 1RAGB 2CZ6B 2O4XB 3X26B 3S3NA 3O5ZA 3HHTB 2MAMA 4M75C 4FW2A 2YLCA 2DRKA 4UC4A 2PVOB 1ZSZC 1KFZA 3E2UA 1IB8A 2GFUA 2V1RA 1MMDA 1QP2A 3OS5A 4J7FA 3OYJA 1YJNA 1PM3A 4WF2A 1EZZB 2BIVA 2LX7A 2QGFB 2GF7A 5I22A 1QVPA 3OYHA 1NPPA 4A4EA 1VQKT 3RKWA 2NWMA 4LNPA 3GBQA 3CQTA 3UPUA 1PWTA 2DEQA 1AT1B 1S72Q 1K8AR 3HFNA 1VQ6A 2CP5A 1SRMA 1VQ4Q 1VOMA 1M1FA 1BI1A 3JCMP 2LX9A 2PZ1A 3S3MA 1AZEA 1FYNA 1QKXA 1VUBA 1AZGB 1R0BG 3U23A 3EGXA 4F14A 3TVTA 1ZSZA 3EFSA 3CCJA 5CQYA 2AKKA 1E7OA 2H3EB 1KC8U 1VYTA 4M78E 2M02A 1RL2A 1QVFA 2LJ1A 2BZYA 4F7UF 4F7UE 2KGTA 3RNJA 4BB7A 1XOVA 4GBQA 3AHUA 2KROA 4FW1A 1WNLA 2KRMA 4AT1B 2JTEA 2IG0A 1QWFA 1TSFA 1BI2A 5CR2A 2QEXA 3FRNA 1LCKA 1KD1C 3A5ZB 4II1A 5HY6A 4F04B 3I55T 1YHQA 1VQ7A 3FJPA 2ZCFB 2EYXA 3CCRT 4L59A 1RAFB 2DVEA 4GY5A 4PL6A 2Y4YA 2XICA 4E7SA 5FU6C 2V8KA 2P4RA 3OYAA 4J7IA 1YIJT 1VQ9T 2DIQA 3BFMA 2J6FA 1Y0MA 2MWOA 3J80E 1MNDA 5KYYA 5KE3A 3CCSQ 4M75E 4M75F 3CCVA 2L5QA 2BE9B 2RJFA 2HBWA 1OEBA 3H0HA 1C1AA 4HCKA 3RERA 5IXBA 3TSWA 5GANe 1OX8A 2AIRB 1JEGA 1M2VA 1B34A 1D3BB 3RBBB 1M1KU 2YXYA 3OYBA 3I9QA 1ABQA 1IRXA 4J6WA 4ELYC 1VQMT 1OZ2A 4B9WA 2LT1A 2P4TA 4E7HA 3I5RA 3TQ7P 4JRKA 1WX6A 3CCQT 1QP3A 4ATOA 2L8DA 3CXCP 2MK5A 3EG1A 1BU1A 2LJ0A 4CC2A 1YN8A 1JJ2S 3QHSA 3HRUA 1K8AC 3VKIA 1ZHIA 2VC8A 4OMFB 1PKSA 1NLPC 2ATCB 4M77F 2VGNA 3WXMB 3KFVA 2F2XA 1C6VX 2JXBA 4L6V5 3G71Q 2K7AA 5LJ5f 2VV5A 5A0GA 2NUTA 4J9EA 5GANf 2EBPA 4QVDA 1HK9A 4FIBA 1OULA 1JXOA 1KJWA 4D8DA 4PJOD 1AWXA 1A0NB 2RB6A 3CC2T 2ED1A 4ZNXA 4CRIA 1NJIR 1NEGA 3OYDA 1MHNA 2EAYA 2A0FB 3INZA 3JV3A 4EMHA 4D8KA 4ZGEB 3MEWA 5KYNA 4N4HA 3RR6A 5CKDA 2MCNA 2RI5A 1D0ZA 4Z88A 2G3RA 1Z9QA 5IT9E 1QW1A 1VQ8T 1UGPB 4ME7A 4RTXA 1I8FA 2PUOB 4F7UB 5GANg 3C95A 2RHZA 5GAN3 2DXBA 3LGLA 2DLPA 1YJWA 2FPDA 2HL5C 3G6EA 3V8KA 4DQ2A 2OX7A 4E47A 1WGSA 4J8OA 3REBB 2B86A 1IHVA 1N8RU 3M57A 3MEUA 3V7RA 2J05A 5LJ3d 2FRYA 3CCLQ 4XTWA 4JJBA 4M7DD 2FZGB 5GAOr 3CC4Q 5AYFA 3JAME 1QCNA 4F7UG 4C0ZA 2O9SA 3D7SB 1SF9A 1U8RA 5CVIA 4QQDA 2DFUA 1OYXA 2COWA 4JPBW 2RF0A 4Q5WA 4X1VA 4EDUA 1YI2T 4RTVA 3OSSC 1R77A 3CPWS 5KYXA 3JCMe 2QQAA 1UHFA 1G3SA 3CD6T 4DBHA 1BI0A 2XD0A 4IIOA 1D1CA 3QYGB 5D7UA 4E7KA 3CMAT 3HL8A 1M3AA 2K4YA 4OMPA 2RH2A 2R5MA 2YUNA 2LQNA 1WQWA 1D1BA 3M53A 1TUDA 1Q81U 2ZPEB 3O8VA 1R0CB 1YITT 1AD5A 2QA4T 1UGSB 3QDFA 4MMLA 3VS6A 1W4SA 2EGCA 2QTXA 3RDVA 4M7AA 1HYOA 4ELZC 1VQKQ 3OW2A 5KCOA 4BD3A 1O75A 5DM7R 3QZ5B 1CSKA 2QQRA 1H641 2CSIA 3TCJA 3JCMf 3A98A 3BY7A 4DEXA 2DE0X 1KQSS 2DJQA 1NJIC 2EGEA 4M77B 4OMLA 4ZGDB 1I0CA 4N4IA 2JTMA 4PJOC 2C06A 1QVGS 5LJ3g 1VYVA 3MCAB 3FDRA 4ZTJA 2JZ2A 2JS0A 3OS0A 3VYHB 2AT1B 2YUQA 2JW4A 3V7CA 4HCCA 3RMSA 4LUDA 5KH6A 1UJ0A 4DEYA 4GLMA 3SD4A 3A8HB 3VU3C 1Z9ZA 4M77G 4J9DA 5LJ5h 1KG1A 2DF6A 2CP2A 3JCMg 3QJ6A 2O4XA 5IHIA 3CCEA 1X43A 1OZ3A 2RHYA 3I55Q 3FC3A 3HFOA 4KRTA 3OBWA 2P0QA 3CCMQ 2CH4A 2HL3A 1FMKA 1H8KA 3CCRQ 1JRIA 3P8HA 2K5LA 4OB0B 3M58A 4NL2A 1PKTA 5FWBA 2E70A 1GFCA 2KT1A 5GMKj 1WHGA 4M7DC 3WVEB 4JLGA 1VQ9Q 1SEMA 4AG2C 2HDAA 1PRMC 3A8LB 4PLLA 3H8ZA 2CP6A 2L3SA 1H3ZA 4OB1B 2VYTA 4A63B 2VXEA 1IZ6A 1MMAA 1TUGB 2K57A 4IIMA 1M8MA 5CKFA 3L1AA 3ZEHA 2D0NA 1RAHB 4BI3A 1VQNA 2QG9B 3OS2A 4P5NA 4J9IA 4JJCA 2NUPB 2RJEA 2WSFE 3EAEA 3JCMc 1VQMQ 1YJNQ 3CCST 1X6GA 4IUVA 2RI2A 2XK0A 5CO7A 2O88A 4JJDA 5GMKm 1I4K1 2CS7A 3JB9I 2MOXA 2LQKA 4ZN1A 4FM4B 4AFSC 3LH5A 2DYIA 4DBQA 1SSHA 2GGRA 4PJNA 4FSXA 4PLIA 3C12A 4LE9A 3PVLA 1FMWA 3JB9J 4PJOF 4PJOE 1TTHB 2KVQG 1I1JA 2ZGWA 2L3PA 5I11A 2IPOB 4NS5A 1G5VA 4BACA 4BI8B 4F17A 1WQ7A 3RIRA 4IKFA 2ABLA 5CKBA 5GMKi 4HXJA 3CCJQ 1N9RA 4BY6B 1GBQA 2DKGA 1ZSGA 4X9DA 2FRWA 4FL6A 2RQRA 2R5AA 1AWWA 3LX7A 2QDYB 1SHFA 2QASA 2OTLA 1K73R 1AOJA 4JS4A 4E7ZA 3G71T 4C0DC 4EPCA 2RHIA 4MDWA 2PUKB 3VRZA 1VQ8Q 2QDLA 4XQ3A 2QEXQ 2DBMA 4M77D 4KGZB 1ZBJA 4KUDK 2VB6A 3QWYA 3OYKA 2MYSA 1LVKA 1YHQQ 1D3BA 1WJRA 2DERA 1HXDA 4M7DF 4M7DE 1BK2A 1TS9A 6AT1B 4YTLA 1Q86U 4C5EA 3QO3A 3C94A 4AG1C 1W2BA 3ME9A 1AVZC 1WHJA 3AT1B 4HVWA 1VQPQ 5KYUB 1GBRA 2CP3A 2ZPFB 2M0YA 3EFRA 2HBPA 5LJ3j 1RACB 1KD1R 3I56Q 3DLMA 4KH1B 1X6BA 4WTOB 1PSEA 1GCPA 1ZX6A 2C0IA 2FEIA 4KULA 3URGA 3LWHA 2DEUA 2JUFA 1GL5A 3CC4T 4MDXA 4RCCA 4E2FB 2P0KA 1N6AA 4XTUA 1EFNA 2FZKB 5A2QE 1WHHA 5DLOA 2KAFA 4E7IA 1PC0A 2KXDA 4RCBA 2CGHA 2ECZA 3NMZC 4FYWB 2FPFA 3S6WA 5IH2A 4M4ZA 4RKUE 3PGGA 4RTUA 4M78A 1K9MR 3JCMX 3QKJA 4C8QB 2EKOA 4CI0C 4F7UA 3CCUA 2KT8A 4CC7A 2X4YA 2CT3A 2M0OA 2EW3A 3JRZA 2HKNA 3VRYA 3EH2A 3QPHA 1AWJA 2CZ0B 4EMKB 2X35A 3E9FA 3M9QA 4BE0A 1X2KA 4PJOB 3RMQA 4X34A 3CMEA 1JJ2P 3FJ5A 3DB4A 1V29B 2YRCA 1K73C 4RMOA 2RK1A 4R56A 2K79A 3OA6A 1M90U 2DXCA 1H3HA 2JS2A 3CCQA 1YCSB 1OX9A 4RG8A 2X9HA 4PJOG 4M75A 4OGCA 4M77C 2VVKA 2DL3A 4ESRA 3G6EQ 1KHCA 2L3QA 3LWIA 2FYKA 2AZSA 1G2BA 2E12A 1LOJA 1SG5A 3ZL7C 4BI4A 2HQHA 2QQBA 4M7DB 2OTJQ 2JM8A 4E6RA 3CC2A 3CC7T 2XHCA 1X27A 1QCFA 2RJCA 1R8OB 4K11A 3GNFB 3NFCA 3FIFA 1KQ1A 4KBMB 2FHDA 4OB2B 4XAXB 3CCMT 4HVVA 3NPFA 5GMKe 4LDWA 2HEQA 3G4SA 3GLXA 1UEBA 4PJLA 1KQ2A 4M7DG 3BDLA 1PCXA 3CXCA 2HZYA 1VQOA 2NLUA 2L0AA 3M0RA 1MGQA 3OYCA 1EIFA 3PTAA 3BDUA 4Y92A 4FYXB 5GAMh 1WZOA 5M9OA 3OYYA 3RESA 1PHTA 3OB9A 3J7AF 3H0FA 1GXIE 1BYMA 1K9MC 2BZ8A 3CPWP 1UGQB 3JB9F 1NE8A 4B9XA 2F2WA 3IQLA 2CSQA 2DPPB 2DRMA 2CH4W 3MEVA 1EX4A 3OS1A 2X4WA 2RHUA 2EJGA 4QQGA 5LJ5d 2EQJA 4L5GA 3JB9H 1YJNT 1B3QA 1NM7A 1YI2A 1W2BS 1I5OB 1KHIA 2J7IA 4A53A 2JTFA 5GAOl 3VS7A 1C0MA 1M2OA 4JRQA 1RAAB 2AK5A 1UG1A 2E3HA 2JT4A 3DKMA 4AFQC 1GFDA 3E1SA 2BE7D 4C8QD 4RTTA 4JLIA 4C5GA 4C0FA 1B7TA 3VS2A 5IN1A 2EQMA 4BDYA 3NTHA 4C0DB 2CKKA 1MNEA 3UA7A 1UGRB 2D1XA 4M77E 2LQWA 3LW5E 1KQSP 3HTRA 3I35A 2CUBA 3CCEQ 1LJOA 3CCJT 2ZPIB 2COYA 1QVGP 4Z02A 3J81E 1Q82R 4BY6C 1NEBA 2NUPA 3EHRA 5I2MA 2F5TX 1E6GA 1SKUB 3UWNA 3EFOB 2DTIA 5LL6S 1ZQ1A 3OYEA 1XNIA 4XU3A 1UDLA 2P84A 4O6JA 2QEXT 1UUEA 3MP8A 3OYFA 2DXTA 2GFAA 5A0LA 1YHQT 2M1HA 1UGVA 1S72A 1Q81C 5J3BA 1VQ4A 1TU0B 2K5IA 2BKDN 3L2UA 2LVMA 1K8AU 3TREA 3PFSA 1Q7YR 1T3LA 2CUDA 2CYZB 1VQPT 3WVDB 5LJ3e 2EYWA 1VQNQ 1YBYA 4RG2A 2R57A 5KYWB 4QQ6A 5FRMA 3HP9A 2EYZA 1ZLMA 2E65A 2JVVA 1WXUA 2GTOA 1U1SA 3I56T 2KXCA 2PNIA 2LZ6B 4XU0A 1U3OA 2O01E 3H41A 1OPLA 4OGEA 2V1QA 2YWWA 2J06A 4KGXB 2RNAA 2W10A 3VYGA 1VA7A 3CBOA 4FYYB 1QVFS 4RTYA 1BCMA 4OMMA 2KE9A 3GPLA 2X3XD 5FU7C 3PIPA 2K2MA 5LJ3f 2VGMA 3UT1A 5GJWB 2FL7A 5KYUA 3UA6A 1T0JA 4C8QC 3JB9G 2D6FA 2AZVA 2PTKA 3L42A 2OTLQ 3A8OB 3CCSA 2QK0A 5FROA 4C92D 1YP5A 1VQLQ 4FU6A 1VQ5Q 1MUZA 4EMKC 1Q82C 7AT1B 3META 3EHQA 1G3WA 3QYHB 3JCMW 2A37A 1M27C 1X01A 2LJ3A 4JRIA 3OYGA 1M1GA 2V8JA 1I81A 4PK4A 2RO0A 2RJDA 2SEMA 5J26A 1UJYA 5CAIA 3CC7Q 4PFPA 2FVUA 5GANh 2KK4A 2RQWA 3HRTA 1YJWT 2CDTA 2RPNA 3HKSA 4XTYA 4EMGA 3G6ET 1RLQC 3OYNA 2WACA 1BIBA 3L2RA 3VS1A 3EGDB 2MPXC 1Q7YC 2XDBA 1IGUA 4E7JA 2JMCA 1BIAA 2DXUA 4EMKA 3RKXA 3SB2A 3X24B 5L23A 2VUBA 3QIIA 2OTJT 3M4GA 2MIOA 4PJOA 4XU2A 3QBYA 4J83A 2RM4A 1J3TA 2K3YA 2YRVA 3ER0A 3L2ZA 2DVJA 1M4ZA 1X69A 2XDPA 2VWFA 3QG1A 3PMTA 4PJJA 1Y96B 3CBMA 3MP1A 2DZ9A 3PMIA 1WLPB 1IHWA 4KH0B 3GP8A 4J6YA 1OQKA 2X51A 4LUEA 5IHKA 3GIBA 1N5ZA 3GNGA 2LRQA 3QZ9B 2EIFA 3OQ5A 1RI9A 1WHKA 2EKHA 1CKBA 2LC4A 4QVZA 3QSUA 4ORZA 2NUZA 1YCYA 2E1HA 4C8QE 1W1FA 4C8QF 4C0GA 2CP7A 2K6DA 4FT2A 2EYYA 2PQWA 4J9GA 3CCLA 3TSZA 2F5KA 4M7DA 3CMEQ 4KGVB 2MF2A 1PD1A 4ZTFA 2DL7A 2KBTA 1RAEB 2LTOA 2DJZA 2CP0A 2LNHB 2LDMA 1T0HA 2E5KA 3UF4A 3NTIA 3JB9D 5CKHA 3E19A 1VQ6Q 1JBMA 4DOWA 4JZ3A 5C6SA 1YJ9A 2P0PA 3FB9A 3OBYA 5HKCA
chains in the Genus database with same CATH topology
1X2KA 2L2PA 2XMFA 3EG1A 3QWXX 1BU1A 2DILA 2LJ0A 1G83A 4CC2A 1YN8A 2KNBB 3FJ5A 1RLPC 2KYBA 2AKLA 1PKSA 3VS4A 2K79A 1NLPC 4EIKA 1JQQA 3KFVA 2F2XA 2JXBA 2K7AA 1H3HA 2JS2A 1H92A 5EC7A 4J9EA 2EBPA 1YCSB 3H0IA 1NYFA 1JXOA 1KJWA 4D8DA 1A0NB 1AWXA 2DX1A 2ED1A 4ZNXA 2A36A 4J9HA 2VVKA 1OOTA 1NEGA 2KRNA 2DL3A 1W6XA 4ESRA 2EVRA 3I5SA 2L3QA 1ZUYA 3SHWA 2AZSA 2FG0A 1G2BA 4CC4B 3JV3A 1V1CA 4D8KA 1BBZA 2EGAA 4AFUC 2MCNA 3ZL7C 2LP5A 4Z88A 2LCSA 2ROLA 1Z9QA 3R6NA 5ECAA 2JM8A 1RUWA 3C0CA 4LN2A 4E6RA 2RN8A 4RTXA 1NYGA 1UHCA 1X27A 1QCFA 1AEYA 3UATA 4K11A 3REAB 2O9VA 3EG2A 2DLPA 2FPDA 2C0OA 3PVQA 3REBB 4HVVA 2B86A 3NPFA 2HEQA 2YSQA 2W0ZA 2J05A 2FRYA 1M3BA 4JJBA 1NLOC 1BB9A 1OPKA 2L0AA 3M0RA 4Z89A 1K76A 2O9SA 3VS0A 4Y92A 3THKA 1ARKA 3M0TA 4JPBW 2RF0A 4JZ4A 1PHTA 4X1VA 2BZXA 1SPKA 3H0FA 4RTVA 2FO0A 2HCKA 1JO8A 2BZ8A 2KEAA 2YT6A 1WDXA 2EQIA 1UHFA 1TUCA 1JXMA 2F2WA 4FSSA 3IQLA 2CSQA 2IIMA 2DRMA 2CH4W 1CKAA 4IIOA 1TG0A 2DYBA 1M3AA 4WCIA 4OMPA 1E6HA 2FPEA 2YUNA 2LQNA 4R0KA 1TUDA 2J6KA 1YWOA 1B3QA 1NM7A 1AD5A 2J7IA 2CT4A 4HVUA 3VS6A 4RTZA 2EGCA 3ULRB 1WFWA 1W70A 3M0UA 1K1ZA 1WIEA 3VS7A 2AK5A 2OAWA 1UG1A 2JT4A 4AFQC 1GFDA 4RTTA 2A28A 2RQUA 1M3CA 3VS2A 2RQTA 1CSKA 5IHNA 4F16A 3UA7A 2K3BA 2CSIA 4RTWA 3PE0A 2D1XA 1JU5C 2LQWA 3A98A 2GNCA 4DEXA 3EG3A 2DE0X 1MV0B 2DJQA 3I35A 2CUBA 2EGEA 1PNJA 4J9BA 4OMLA 1I0CA 2G6FX 1HD3A 1VYVA 2KR3A 1YWPA 1UECA 2JS0A 3VS5A 2K9GA 1K4US 2YUQA 3SEMA 1NEBA 2JW4A 3EHRA 1PRLC 4LUDA 1UJ0A 4DEYA 1E6GA 2JMAA 2YDLA 2ED0A 1K9AA 3VS3A 3NGPA 4OMNA 4GLMA 1ZUKA 3EGUA 4Z8AA 1Z9ZA 1UDLA 1KIKA 4J9DA 1AWOA 2DF6A 1UUEA 5IHIA 1X43A 1MV3A 1I07A 4KRTA 1NG2A 4OMOA 2CH4A 1GRIA 1UGVA 1FMKA 1H8KA 2A08A 2LMJA 1K0XA 2EPDA 1PKTA 2ENMA 5FWBA 2KT1A 1GFCA 2YUOA 1SHGA 1T3LA 2CUDA 2GBQA 2I0NA 1SEMA 4AG2C 2EYWA 4RUGA 2HDAA 1PRMC 2DMOA 2EYZA 2X3WD 1ZLMA 2ESWA 1WXUA 1GCQC 1X2QA 2GTOA 1U5SA 2L3SA 2KXCA 2PNIA 1T3SA 1B07A 2LZ6B 4A63B 1U3OA 3H41A 1OPLA 2SRCA 4IIMA 1M8MA 4QT7A 2V1QA 5HCKA 2D0NA 5FW9A 3M0PA 2J06A 2VKNA 2DA9A 2GQIA 2RNAA 2DL8A 2W10A 2HSPA 1VA7A 4J9IA 4JJCA 4CC3A 2F2VA 1QKWA 1X6GA 4OMMA 4RTYA 1S1NA 2DM1A 2O88A 1HJDA 3M0QA 5GJVB 1UFFA 2J6OA 1QLYA 1YNZA 1Y57A 2KE9A 2X3XD 4JJDA 1HSQA 2K2MA 2MOXA 1ABOA 3O5ZA 4AFSC 2OJ2A 5GJWB 3LH5A 1SSHA 2GGRA 3UA6A 2DRKA 1T0JA 3PVLA 4LE9A 1GCQA 2AZVA 1KFZA 2PTKA 2DL4A 2V1RA 1M30A 1I1JA 2L3PA 5I11A 2KYMA 1YP5A 2LX7A 1MUZA 4F17A 2ABLA 5I22A 1K0SA 1OV3A 4HXJA 1GBQA 2NWMA 4LNPA 1ZSGA 2O2OA 3EHQA 3CQTA 2FRWA 3GBQA 1PWTA 1UTIA 2A37A 2RQRA 1M27C 1AWWA 1SHFA 2D8JA 1AOJA 2LJ3A 1WI7A 2ROTA 1SRMA 2D8HA 1KSWA 1WXTA 2RQVA 3VRZA 2PZ1A 4OMQA 4J9CA 2QDLA 1AZEA 1FYNA 2DBMA 1QKXA 2SEMA 1AZGB 1UJYA 3U23A 1ZBJA 2YUPA 3TVTA 2DBKA 3QWYA 4J9FA 4F14A 2H8HA 1WA7A 1E7OA 2AKKA 2RQWA 1VYUA 2CDTA 2RPNA 1VYTA 1BK2A 2BTTA 1RLQC 3NHNA 5IXFA 2DNUA 2LJ1A 2CREA 2BZYA 3EG0A 4AG1C 3VS1A 1AVZC 4HVWA 2KGTA 2C0TA 3RNJA 1U06A 1XOVA 2JMCA 4GBQA 2KROA 1WYXA 1SRLA 5L23A 2KRMA 1IO6A 2KRSA 2JTEA 1QWFA 5FWCA 2MIOA 1UE9A 1GBRA 1LCKA 1J3TA 2M0YA 2DVJA 1X69A 2VWFA 2EYXA 2JM9A 1X6BA 2OI3A 1WLPB 1GCPA 1ZX6A 2P4RA 2C0IA 2FEIA 3M0SA 4LUEA 5IHKA 1GL5A 1WXBA 1N5ZA 2J6FA 1Y0MA 1RI9A 2EKHA 1QWEA 1CKBA 2RMOA 1EFNA 4ORZA 2NUZA 2DL5A 2GTJA 2HBWA 1OEBA 2KXDA 3H0HA 1W1FA 2ECZA 3NMZC 2FPFA 2K6DA 5IH2A 4HCKA 2EYYA 4J9GA 5IXBA 3TSZA 4M4ZA 3TSWA 4RTUA 1JEGA 4AFZC 2DL7A 2KBTA 2O31A 3RBBB 2LNHB 3I9QA 2M51A 1ABQA 2KT8A 1T0HA 4CC7A 2E5KA 3UF4A 1ZUUA 2CT3A 2EW3A 3VRYA 4JZ3A 3I5RA 1AWJA 1WX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X2K A;  2L2P A;  2XMF A;  3EG1 A;  3QWX X;  1BU1 A;  2DIL A;  2LJ0 A;  1G83 A;  4CC2 A;  1YN8 A;  2KNB B;  3FJ5 A;  1RLP C;  2KYB A;  2AKL A;  1PKS A;  3VS4 A;  2K79 A;  1NLP C;  4EIK A;  1JQQ A;  3KFV A;  2F2X A;  2JXB A;  2K7A A;  1H3H A;  2JS2 A;  1H92 A;  5EC7 A;  4J9E A;  2EBP A;  1YCS B;  3H0I A;  1NYF A;  1JXO A;  1KJW A;  4D8D A;  1A0N B;  1AWX A;  2DX1 A;  2ED1 A;  4ZNX A;  2A36 A;  4J9H A;  2VVK A;  1OOT A;  1NEG A;  2KRN A;  2DL3 A;  1W6X A;  4ESR A;  2EVR A;  3I5S A;  2L3Q A;  1ZUY A;  3SHW A;  2AZS A;  2FG0 A;  1G2B A;  4CC4 B;  3JV3 A;  1V1C A;  4D8K A;  1BBZ A;  2EGA A;  4AFU C;  2MCN A;  3ZL7 C;  2LP5 A;  4Z88 A;  2LCS A;  2ROL A;  1Z9Q A;  3R6N A;  5ECA A;  2JM8 A;  1RUW A;  3C0C A;  4LN2 A;  4E6R A;  2RN8 A;  4RTX A;  1NYG A;  1UHC A;  1X27 A;  1QCF A;  1AEY A;  3UAT A;  4K11 A;  3REA B;  2O9V A;  3EG2 A;  2DLP A;  2FPD A;  2C0O A;  3PVQ A;  3REB B;  4HVV A;  2B86 A;  3NPF A;  2HEQ A;  2YSQ A;  2W0Z A;  2J05 A;  2FRY A;  1M3B A;  4JJB A;  1NLO C;  1BB9 A;  1OPK A;  2L0A A;  3M0R A;  4Z89 A;  1K76 A;  2O9S A;  3VS0 A;  4Y92 A;  3THK A;  1ARK A;  3M0T A;  4JPB W;  2RF0 A;  4JZ4 A;  1PHT A;  4X1V A;  2BZX A;  1SPK A;  3H0F A;  4RTV A;  2FO0 A;  2HCK A;  1JO8 A;  2BZ8 A;  2KEA A;  2YT6 A;  1WDX A;  2EQI A;  1UHF A;  1TUC A;  1JXM A;  2F2W A;  4FSS A;  3IQL A;  2CSQ A;  2IIM A;  2DRM A;  2CH4 W;  1CKA A;  4IIO A;  1TG0 A;  2DYB A;  1M3A A;  4WCI A;  4OMP A;  1E6H A;  2FPE A;  2YUN A;  2LQN A;  4R0K A;  1TUD A;  2J6K A;  1YWO A;  1B3Q A;  1NM7 A;  1AD5 A;  2J7I A;  2CT4 A;  4HVU A;  3VS6 A;  4RTZ A;  2EGC A;  3ULR B;  1WFW A;  1W70 A;  3M0U A;  1K1Z A;  1WIE A;  3VS7 A;  2AK5 A;  2OAW A;  1UG1 A;  2JT4 A;  4AFQ C;  1GFD A;  4RTT A;  2A28 A;  2RQU A;  1M3C A;  3VS2 A;  2RQT A;  1CSK A;  5IHN A;  4F16 A;  3UA7 A;  2K3B A;  2CSI A;  4RTW A;  3PE0 A;  2D1X A;  1JU5 C;  2LQW A;  3A98 A;  2GNC A;  4DEX A;  3EG3 A;  2DE0 X;  1MV0 B;  2DJQ A;  3I35 A;  2CUB A;  2EGE A;  1PNJ A;  4J9B A;  4OML A;  1I0C A;  2G6F X;  1HD3 A;  1VYV A;  2KR3 A;  1YWP A;  1UEC A;  2JS0 A;  3VS5 A;  2K9G A;  1K4U S;  2YUQ A;  3SEM A;  1NEB A;  2JW4 A;  3EHR A;  1PRL C;  4LUD A;  1UJ0 A;  4DEY A;  1E6G A;  2JMA A;  2YDL A;  2ED0 A;  1K9A A;  3VS3 A;  3NGP A;  4OMN A;  4GLM A;  1ZUK A;  3EGU A;  4Z8A A;  1Z9Z A;  1UDL A;  1KIK A;  4J9D A;  1AWO A;  2DF6 A;  1UUE A;  5IHI A;  1X43 A;  1MV3 A;  1I07 A;  4KRT A;  1NG2 A;  4OMO A;  2CH4 A;  1GRI A;  1UGV A;  1FMK A;  1H8K A;  2A08 A;  2LMJ A;  1K0X A;  2EPD A;  1PKT A;  2ENM A;  5FWB A;  2KT1 A;  1GFC A;  2YUO A;  1SHG A;  1T3L A;  2CUD A;  2GBQ A;  2I0N A;  1SEM A;  4AG2 C;  2EYW A;  4RUG A;  2HDA A;  1PRM C;  2DMO A;  2EYZ A;  2X3W D;  1ZLM A;  2ESW A;  1WXU A;  1GCQ C;  1X2Q A;  2GTO A;  1U5S A;  2L3S A;  2KXC A;  2PNI A;  1T3S A;  1B07 A;  2LZ6 B;  4A63 B;  1U3O A;  3H41 A;  1OPL A;  2SRC A;  4IIM A;  1M8M A;  4QT7 A;  2V1Q A;  5HCK A;  2D0N A;  5FW9 A;  3M0P A;  2J06 A;  2VKN A;  2DA9 A;  2GQI A;  2RNA A;  2DL8 A;  2W10 A;  2HSP A;  1VA7 A;  4J9I A;  4JJC A;  4CC3 A;  2F2V A;  1QKW A;  1X6G A;  4OMM A;  4RTY A;  1S1N A;  2DM1 A;  2O88 A;  1HJD A;  3M0Q A;  5GJV B;  1UFF A;  2J6O A;  1QLY A;  1YNZ A;  1Y57 A;  2KE9 A;  2X3X D;  4JJD A;  1HSQ A;  2K2M A;  2MOX A;  1ABO A;  3O5Z A;  4AFS C;  2OJ2 A;  5GJW B;  3LH5 A;  1SSH A;  2GGR A;  3UA6 A;  2DRK A;  1T0J A;  3PVL A;  4LE9 A;  1GCQ A;  2AZV A;  1KFZ A;  2PTK A;  2DL4 A;  2V1R A;  1M30 A;  1I1J A;  2L3P A;  5I11 A;  2KYM A;  1YP5 A;  2LX7 A;  1MUZ A;  4F17 A;  2ABL A;  5I22 A;  1K0S A;  1OV3 A;  4HXJ A;  1GBQ A;  2NWM A;  4LNP A;  1ZSG A;  2O2O A;  3EHQ A;  3CQT A;  2FRW A;  3GBQ A;  1PWT A;  1UTI A;  2A37 A;  2RQR A;  1M27 C;  1AWW A;  1SHF A;  2D8J A;  1AOJ A;  2LJ3 A;  1WI7 A;  2ROT A;  1SRM A;  2D8H A;  1KSW A;  1WXT A;  2RQV A;  3VRZ A;  2PZ1 A;  4OMQ A;  4J9C A;  2QDL A;  1AZE A;  1FYN A;  2DBM A;  1QKX A;  2SEM A;  1AZG B;  1UJY A;  3U23 A;  1ZBJ A;  2YUP A;  3TVT A;  2DBK A;  3QWY A;  4J9F A;  4F14 A;  2H8H A;  1WA7 A;  1E7O A;  2AKK A;  2RQW A;  1VYU A;  2CDT A;  2RPN A;  1VYT A;  1BK2 A;  2BTT A;  1RLQ C;  3NHN A;  5IXF A;  2DNU A;  2LJ1 A;  2CRE A;  2BZY A;  3EG0 A;  4AG1 C;  3VS1 A;  1AVZ C;  4HVW A;  2KGT A;  2C0T A;  3RNJ A;  1U06 A;  1XOV A;  2JMC A;  4GBQ A;  2KRO A;  1WYX A;  1SRL A;  5L23 A;  2KRM A;  1IO6 A;  2KRS A;  2JTE A;  1QWF A;  5FWC A;  2MIO A;  1UE9 A;  1GBR A;  1LCK A;  1J3T A;  2M0Y A;  2DVJ A;  1X69 A;  2VWF A;  2EYX A;  2JM9 A;  1X6B A;  2OI3 A;  1WLP B;  1GCP A;  1ZX6 A;  2P4R A;  2C0I A;  2FEI A;  3M0S A;  4LUE A;  5IHK A;  1GL5 A;  1WXB A;  1N5Z A;  2J6F A;  1Y0M A;  1RI9 A;  2EKH A;  1QWE A;  1CKB A;  2RMO A;  1EFN A;  4ORZ A;  2NUZ A;  2DL5 A;  2GTJ A;  2HBW A;  1OEB A;  2KXD A;  3H0H A;  1W1F A;  2ECZ A;  3NMZ C;  2FPF A;  2K6D A;  5IH2 A;  4HCK A;  2EYY A;  4J9G A;  5IXB A;  3TSZ A;  4M4Z A;  3TSW A;  4RTU A;  1JEG A;  4AFZ C;  2DL7 A;  2KBT A;  2O31 A;  3RBB B;  2LNH B;  3I9Q A;  2M51 A;  1ABQ A;  2KT8 A;  1T0H A;  4CC7 A;  2E5K A;  3UF4 A;  1ZUU A;  2CT3 A;  2EW3 A;  3VRY A;  4JZ3 A;  3I5R A;  1AWJ A;  1WX6 A; 
#chains in the Genus database with same CATH topology
 1KC8 R;  2F1L A;  4DBF A;  2L2P A;  2ZPH B;  2XMF A;  3QXE B;  1G83 A;  3X25 B;  1IRE B;  2X4J A;  4LDU A;  1RLP C;  2KYB A;  3R6O A;  5CKE A;  2DIG A;  3EH1 A;  3SFM A;  2ZPB B;  1RAD B;  2KDS A;  4EIK A;  1JQQ A;  2NYS A;  3KBG A;  5EC7 A;  3Q1J A;  5GAM d;  3CCE T;  3OYI A;  3JCM h;  2E4H A;  2A36 A;  2LNV A;  4LDX A;  1VQK A;  1OOT A;  2KRN A;  1W6X A;  3H9N A;  3I5S A;  3MP6 A;  1VQ7 Q;  2K5F A;  1ZUY A;  4IUP A;  1BBZ A;  2EGA A;  2LP5 A;  5IAY A;  1M8V A;  3V8L A;  1D0Y A;  3R6N A;  1VQO Q;  1RUW A;  3M54 A;  2ZAE A;  2I2L A;  5A0D A;  2QTV A;  3TU4 K;  2DET A;  3OW2 S;  2OAU A;  2ZZD A;  4HT9 A;  3REA B;  3EG2 A;  4X9C A;  3PT9 A;  2C0O A;  3CCV Q;  2JNG A;  2KY9 A;  3PVQ A;  2W0Z A;  1M1K R;  3L2V A;  1M3B A;  1NLO C;  4M7A B;  1ACM B;  3M56 A;  3EG9 B;  1XJW B;  4Z89 A;  1JJ2 A;  1K76 A;  1VQN T;  5L8R E;  3L2W A;  3VS0 A;  5CIU A;  3MHX A;  3I55 A;  1X75 C;  3M0T A;  4C5I A;  1Y7X A;  3UDC A;  1BI3 A;  1SPK A;  3CCR A;  5FU7 B;  3E9G A;  2EQI A;  1M90 C;  2KQW A;  1JXM A;  3T9N A;  4FSS A;  4O5V A;  2V26 A;  2WSC E;  1CKA A;  1TG0 A;  4PKC C;  1YIJ A;  2YHT A;  1VQ9 A;  2E41 A;  2FPE A;  4C92 F;  4C92 E;  2DO3 A;  2J6K A;  4IUR A;  4Y28 E;  1KC8 C;  1W2B P;  3MEA A;  3ASK A;  2CT4 A;  4OF1 A;  3ULR B;  1W70 A;  8AT1 B;  1WIE A;  2OAW A;  4LDY A;  4C8Q G;  2A28 A;  1IGQ A;  3V7S A;  2HQX A;  5KE2 A;  2YRD A;  1M3C A;  5KYW A;  2RQT A;  5IHN A;  4ZN3 A;  1VQM A;  2HAX A;  2OTL T;  2K3B A;  3F70 A;  3PE0 A;  1JU5 C;  2JJ9 A;  1PD0 A;  2GNC A;  1VQL T;  1VQ5 T;  1ZBX A;  4N0A C;  3MJX A;  1PNJ A;  2RD1 A;  4E7L A;  2E10 A;  1TWB A;  3ZFJ A;  1N8R R;  2KR3 A;  2EQU A;  1YJW Q;  3NTK A;  2JOY A;  1UEC A;  2K9G A;  3SEM A;  1YFN A;  1XQH A;  1D1A A;  2JMA A;  2ED0 A;  1K9A A;  3CPW A;  3VS3 A;  1P92 A;  2LCL A;  3NGP A;  4PFZ A;  2H3J A;  4OMN A;  1VIF A;  2D0Q B;  1ZUK A;  1WJQ A;  2E5Q A;  3EGU A;  1KIK A;  2HD0 A;  2GQV A;  1MV3 A;  1I07 A;  4M78 F;  4OMO A;  3VJP A;  1GRI A;  1M1K C;  2MWP A;  1M9S A;  1WJS A;  1K0X A;  2EPD A;  2ENM A;  3X20 B;  4N0A A;  1RAB B;  2QXF A;  4DA4 A;  1G3T A;  1K73 U;  1VQ8 A;  1Q81 R;  1SHG A;  2GBQ A;  2I0N A;  3VUB A;  4M77 A;  5GMK l;  2DMO A;  1TH7 A;  1GCQ C;  4LD6 A;  5D6X A;  4DBR A;  4KT0 E;  5HK3 A;  5GAN 5;  1KQS A;  4PJM A;  4BUG A;  1IXD A;  4GLK A;  2CZ7 B;  1N27 A;  4M7A D;  4ZGJ B;  3FLG A;  5HCK A;  3M0P A;  1VQP A;  2VKN A;  2DA9 A;  4NOY A;  1QVG A;  3CCU T;  2DL8 A;  2MMP A;  3GF5 A;  4IUQ A;  4OB3 B;  3VUZ A;  4CC3 A;  1JB0 E;  2F2V A;  1QKW A;  4XTZ A;  4KUI A;  1QVF P;  3I56 A;  5GAN d;  1S1N A;  5DLQ E;  3M0Q A;  5GJV B;  1UFF A;  4C92 B;  2J6O A;  5GAN 2;  1Y57 A;  2ZPG B;  5LJ5 e;  3EGD A;  4QKU A;  3CEY A;  1V76 A;  1M5Q 1;  1HSQ A;  1KD1 U;  1ABO A;  2DZC A;  3CD6 A;  3CME T;  2OJ2 A;  3CMA A;  4FT4 A;  1Y71 A;  1GCQ A;  4A4G A;  4BE2 A;  4N4G A;  1TOV A;  2DL4 A;  5CQX A;  2RA2 A;  4R55 A;  8ATC B;  1M30 A;  4MZM A;  1VQ6 T;  1D0X A;  1YIT A;  2XG8 D;  3OMG A;  5GAN 6;  1Y96 A;  4C92 G;  2KYM A;  2QA4 A;  3FEO A;  1OI1 A;  2RHX A;  2DAQ A;  3OYL A;  3L2Q A;  2D9T A;  1N8R C;  3HRS A;  1OV3 A;  1K0S A;  3DLL A;  5EG2 A;  3M5A A;  1F1B B;  2O2O A;  2Z0W A;  4FCY A;  1UTI A;  1K9M U;  3MPU B;  5GAM j;  2D8J A;  5GAO q;  2PVD B;  3SWN B;  1WI7 A;  2ROT A;  2D8H A;  4AMC A;  1KSW A;  1WXT A;  2RQV A;  2DTH A;  4OMQ A;  4C5H A;  4J9C A;  1ZA2 B;  3LYI A;  2YUP A;  2DBK A;  4J9F A;  2H8H A;  2LQ8 A;  1N9S A;  1WA7 A;  4DOV A;  1VYU A;  3A8G B;  1VQ7 T;  2WSE E;  2FZC B;  4PFO A;  2BTT A;  5IXF A;  3NHN A;  5I21 A;  2DNU A;  2EWN A;  4IUU A;  2CRE A;  3EG0 A;  3G4S T;  3C4S A;  2KSS A;  2C0T A;  1U06 A;  4BDZ A;  4M78 B;  1WYX A;  1SRL A;  5CCA A;  1IO6 A;  5LJ5 g;  2KRS A;  1WHM A;  1VQO T;  1ZA1 B;  5FWC A;  1UE9 A;  2E3I A;  2HKQ B;  2QGG A;  1WPY A;  1FX7 A;  5D6Y A;  4JS5 A;  2B8A A;  2QQ9 A;  4A4K A;  5I2S A;  4LXC A;  3CCV T;  2JM9 A;  1Q95 G;  2JN0 A;  1PSF A;  2OI3 A;  3RUX A;  4M78 G;  1LNX A;  3CPF A;  2OTJ A;  3M0S A;  2CZ1 B;  1KK7 A;  3GOX A;  3JSC A;  4XU1 A;  1WXB A;  2E6N A;  4M7A C;  4OP0 A;  1QWE A;  3BW1 A;  3MKD A;  3M4Y A;  2RMO A;  4B6M A;  4MMK A;  3JCM d;  1YJ9 Q;  1U1T A;  2DL5 A;  2GTJ A;  2XU8 A;  1RAI B;  3S3O A;  4M75 B;  4VUB A;  3EGX B;  4AFZ C;  1ZSZ B;  2O31 A;  2M51 A;  3BE3 A;  1ZUU A;  3OYM A;  5KCH A;  4LD9 K;  3M59 A;  1RI0 A;  2RI3 A;  2XI9 A;  2LT4 A;  3P8B B;  4XTX A;  2A3L A;  4FYV B;  5GMK h;  2K2V A;  3V8J A;  4M75 G;  3CXC S;  3QWX X;  3H6Z A;  2DIL A;  5FLX E;  2DK3 A;  1Q86 R;  2KNB B;  3EG9 A;  3SDZ A;  3X28 B;  2VAS A;  3MO8 A;  2HQE A;  2AKL A;  4TVR A;  3VS4 A;  4IUT A;  2RK2 A;  5D6W A;  1H92 A;  1QCO A;  1QQJ A;  3H0I A;  1OU9 A;  1NYF A;  4QW2 A;  2DX1 A;  1LPL A;  2XKO C;  4J9H A;  5KYY B;  4C8Q A;  2VXF A;  2EVR A;  3SHW A;  1NPR A;  5GAO p;  2FG0 A;  4CC4 B;  9ATC B;  4J6X A;  3A8M B;  1S72 T;  1O9S A;  1V1C A;  3G7Z A;  4XK8 E;  4AFU C;  4HT8 A;  5HK0 A;  3G71 A;  1VQ4 T;  2QQS A;  2LCS A;  1G8X A;  2ROL A;  3HSB A;  1BCO A;  1M2V B;  2COZ A;  5ECA A;  3C0C A;  4LN2 A;  1B34 B;  2RN8 A;  1NYG A;  1UHC A;  1FWZ A;  3CBP A;  2EJ9 A;  4PNO A;  1AEY A;  3UAT A;  3OW2 P;  4HCZ A;  2O9V A;  4M7A E;  4M7A F;  1X6O A;  1UB4 A;  5FU6 B;  1NJI U;  2YSQ A;  3N5B B;  1Q82 U;  3RKY A;  3JCM b;  3JCM Q;  2EFI A;  2QI2 A;  3JCM J;  2Y90 A;  3JCM V;  4V2S A;  4M78 D;  1BB9 A;  4MZT A;  1WHL A;  1YIJ Q;  1OPK A;  2YLB A;  2LCC A;  5C0M A;  2EQK A;  3CCU Q;  1DJ7 B;  2M16 A;  3THK A;  5FRN A;  1ARK A;  2QYZ A;  4JZ4 A;  2MI6 A;  2BZX A;  1VIE A;  2FO0 A;  2NUT B;  2HCK A;  2BUD A;  1JO8 A;  2KEA A;  2L3R A;  2YT6 A;  4QVC A;  1WDX A;  1TUC A;  4A4H A;  2IIM A;  5GAN 7;  2DD4 A;  1OU8 A;  3M55 A;  2DYB A;  3CC4 A;  4WCI A;  5LJ5 j;  1M90 R;  1E6H A;  1TXQ A;  5GAN j;  1G3Y A;  4R0K A;  1Q7Y U;  2QAZ A;  3ZBD A;  2EJF A;  4XTV A;  3LLR A;  1YWO A;  4JRP A;  2EYQ A;  1FXX A;  4JUV A;  4HVU A;  3CCQ Q;  4RTZ A;  1Q86 C;  1WFW A;  3M0U A;  1K1Z A;  4C92 C;  2PU9 B;  4D6W A;  4M75 D;  5J39 A;  2K3X A;  1MMN A;  2IVW A;  5CK9 A;  1XTD A;  2HMA A;  2RQU A;  5LJ3 h;  3DB3 A;  2AHJ B;  4HA8 A;  1NBE B;  4F16 A;  4NL3 A;  4RTW A;  3TEE A;  4MZP A;  3LH0 A;  2V8I A;  4OVA A;  2KI7 A;  3EG3 A;  1Y07 A;  1MV0 B;  4ANJ A;  4J9B A;  1QMC A;  3CC2 Q;  4JDS A;  2G6F X;  5GAM e;  1HD3 A;  4HKE A;  5GAN 4;  1YWP A;  3KUF A;  4A54 A;  3VS5 A;  1K4U S;  2FB7 A;  1PRL C;  5GAO m;  3G4S Q;  2YDL A;  5KYX B;  3KXT A;  4J5Y A;  1VQL A;  4C92 A;  3SWN C;  3OMC A;  5AT1 B;  1VQ5 A;  4Z8A A;  1AWO A;  3PNW C;  3HPW A;  3PIO A;  2DD5 A;  2HNI A;  1PG5 B;  1NG2 A;  3OSV A;  2L89 A;  2PVG B;  2R58 A;  4LDV A;  2DTO A;  2A08 A;  2LMJ A;  3A1P A;  1D09 B;  5DY9 A;  1MMG A;  2HSE B;  2A7Y A;  1BKB A;  2YUO A;  5GAM f;  1SSF A;  2KMT A;  3QDR B;  4M78 C;  2E6Z A;  4JJN K;  3CC7 A;  4RUG A;  3LGF A;  2X4X A;  2X3W D;  2ESW A;  5GAN 8;  2XDD A;  4Y91 A;  1X2Q A;  4A4F A;  1YI2 Q;  3CCM A;  2GCX A;  1U5S A;  3OY9 A;  4HCB A;  3SWN A;  1T3S A;  3P8D A;  1B07 A;  2Y4X A;  2M9U A;  3CCL T;  4BE1 A;  1FMV A;  3EFO A;  3CD6 Q;  2SRC A;  4M7A G;  4QT7 A;  3CMA Q;  5FW9 A;  1I5L A;  3G1J A;  5GAO n;  2GQI A;  3QJY A;  1NZ9 A;  2HSP A;  5GAM g;  1AHJ B;  2F69 A;  3QUI A;  1YIT Q;  2XID A;  1YJ9 T;  2QA4 Q;  3VV0 A;  2DM1 A;  1HJD A;  1QLY A;  1YNZ A;  2E64 A;  1RAG B;  2CZ6 B;  2O4X B;  3X26 B;  3S3N A;  3O5Z A;  3HHT B;  2MAM A;  4M75 C;  4FW2 A;  2YLC A;  2DRK A;  4UC4 A;  2PVO B;  1ZSZ C;  1KFZ A;  3E2U A;  1IB8 A;  2GFU A;  2V1R A;  1MMD A;  1QP2 A;  3OS5 A;  4J7F A;  3OYJ A;  1YJN A;  1PM3 A;  4WF2 A;  1EZZ B;  2BIV A;  2LX7 A;  2QGF B;  2GF7 A;  5I22 A;  1QVP A;  3OYH A;  1NPP A;  4A4E A;  1VQK T;  3RKW A;  2NWM A;  4LNP A;  3GBQ A;  3CQT A;  3UPU A;  1PWT A;  2DEQ A;  1AT1 B;  1S72 Q;  1K8A R;  3HFN A;  1VQ6 A;  2CP5 A;  1SRM A;  1VQ4 Q;  1VOM A;  1M1F A;  1BI1 A;  3JCM P;  2LX9 A;  2PZ1 A;  3S3M A;  1AZE A;  1FYN A;  1QKX A;  1VUB A;  1AZG B;  1R0B G;  3U23 A;  3EGX A;  4F14 A;  3TVT A;  1ZSZ A;  3EFS A;  3CCJ A;  5CQY A;  2AKK A;  1E7O A;  2H3E B;  1KC8 U;  1VYT A;  4M78 E;  2M02 A;  1RL2 A;  1QVF A;  2LJ1 A;  2BZY A;  4F7U F;  4F7U E;  2KGT A;  3RNJ A;  4BB7 A;  1XOV A;  4GBQ A;  3AHU A;  2KRO A;  4FW1 A;  1WNL A;  2KRM A;  4AT1 B;  2JTE A;  2IG0 A;  1QWF A;  1TSF A;  1BI2 A;  5CR2 A;  2QEX A;  3FRN A;  1LCK A;  1KD1 C;  3A5Z B;  4II1 A;  5HY6 A;  4F04 B;  3I55 T;  1YHQ A;  1VQ7 A;  3FJP A;  2ZCF B;  2EYX A;  3CCR T;  4L59 A;  1RAF B;  2DVE A;  4GY5 A;  4PL6 A;  2Y4Y A;  2XIC A;  4E7S A;  5FU6 C;  2V8K A;  2P4R A;  3OYA A;  4J7I A;  1YIJ T;  1VQ9 T;  2DIQ A;  3BFM A;  2J6F A;  1Y0M A;  2MWO A;  3J80 E;  1MND A;  5KYY A;  5KE3 A;  3CCS Q;  4M75 E;  4M75 F;  3CCV A;  2L5Q A;  2BE9 B;  2RJF A;  2HBW A;  1OEB A;  3H0H A;  1C1A A;  4HCK A;  3RER A;  5IXB A;  3TSW A;  5GAN e;  1OX8 A;  2AIR B;  1JEG A;  1M2V A;  1B34 A;  1D3B B;  3RBB B;  1M1K U;  2YXY A;  3OYB A;  3I9Q A;  1ABQ A;  1IRX A;  4J6W A;  4ELY C;  1VQM T;  1OZ2 A;  4B9W A;  2LT1 A;  2P4T A;  4E7H A;  3I5R A;  3TQ7 P;  4JRK A;  1WX6 A;  3CCQ T;  1QP3 A;  4ATO A;  2L8D A;  3CXC P;  2MK5 A;  3EG1 A;  1BU1 A;  2LJ0 A;  4CC2 A;  1YN8 A;  1JJ2 S;  3QHS A;  3HRU A;  1K8A C;  3VKI A;  1ZHI A;  2VC8 A;  4OMF B;  1PKS A;  1NLP C;  2ATC B;  4M77 F;  2VGN A;  3WXM B;  3KFV A;  2F2X A;  1C6V X;  2JXB A;  4L6V 5;  3G71 Q;  2K7A A;  5LJ5 f;  2VV5 A;  5A0G A;  2NUT A;  4J9E A;  5GAN f;  2EBP A;  4QVD A;  1HK9 A;  4FIB A;  1OUL A;  1JXO A;  1KJW A;  4D8D A;  4PJO D;  1AWX A;  1A0N B;  2RB6 A;  3CC2 T;  2ED1 A;  4ZNX A;  4CRI A;  1NJI R;  1NEG A;  3OYD A;  1MHN A;  2EAY A;  2A0F B;  3INZ A;  3JV3 A;  4EMH A;  4D8K A;  4ZGE B;  3MEW A;  5KYN A;  4N4H A;  3RR6 A;  5CKD A;  2MCN A;  2RI5 A;  1D0Z A;  4Z88 A;  2G3R A;  1Z9Q A;  5IT9 E;  1QW1 A;  1VQ8 T;  1UGP B;  4ME7 A;  4RTX A;  1I8F A;  2PUO B;  4F7U B;  5GAN g;  3C95 A;  2RHZ A;  5GAN 3;  2DXB A;  3LGL A;  2DLP A;  1YJW A;  2FPD A;  2HL5 C;  3G6E A;  3V8K A;  4DQ2 A;  2OX7 A;  4E47 A;  1WGS A;  4J8O A;  3REB B;  2B86 A;  1IHV A;  1N8R U;  3M57 A;  3MEU A;  3V7R A;  2J05 A;  5LJ3 d;  2FRY A;  3CCL Q;  4XTW A;  4JJB A;  4M7D D;  2FZG B;  5GAO r;  3CC4 Q;  5AYF A;  3JAM E;  1QCN A;  4F7U G;  4C0Z A;  2O9S A;  3D7S B;  1SF9 A;  1U8R A;  5CVI A;  4QQD A;  2DFU A;  1OYX A;  2COW A;  4JPB W;  2RF0 A;  4Q5W A;  4X1V A;  4EDU A;  1YI2 T;  4RTV A;  3OSS C;  1R77 A;  3CPW S;  5KYX A;  3JCM e;  2QQA A;  1UHF A;  1G3S A;  3CD6 T;  4DBH A;  1BI0 A;  2XD0 A;  4IIO A;  1D1C A;  3QYG B;  5D7U A;  4E7K A;  3CMA T;  3HL8 A;  1M3A A;  2K4Y A;  4OMP A;  2RH2 A;  2R5M A;  2YUN A;  2LQN A;  1WQW A;  1D1B A;  3M53 A;  1TUD A;  1Q81 U;  2ZPE B;  3O8V A;  1R0C B;  1YIT T;  1AD5 A;  2QA4 T;  1UGS B;  3QDF A;  4MML A;  3VS6 A;  1W4S A;  2EGC A;  2QTX A;  3RDV A;  4M7A A;  1HYO A;  4ELZ C;  1VQK Q;  3OW2 A;  5KCO A;  4BD3 A;  1O75 A;  5DM7 R;  3QZ5 B;  1CSK A;  2QQR A;  1H64 1;  2CSI A;  3TCJ A;  3JCM f;  3A98 A;  3BY7 A;  4DEX A;  2DE0 X;  1KQS S;  2DJQ A;  1NJI C;  2EGE A;  4M77 B;  4OML A;  4ZGD B;  1I0C A;  4N4I A;  2JTM A;  4PJO C;  2C06 A;  1QVG S;  5LJ3 g;  1VYV A;  3MCA B;  3FDR A;  4ZTJ A;  2JZ2 A;  2JS0 A;  3OS0 A;  3VYH B;  2AT1 B;  2YUQ A;  2JW4 A;  3V7C A;  4HCC A;  3RMS A;  4LUD A;  5KH6 A;  1UJ0 A;  4DEY A;  4GLM A;  3SD4 A;  3A8H B;  3VU3 C;  1Z9Z A;  4M77 G;  4J9D A;  5LJ5 h;  1KG1 A;  2DF6 A;  2CP2 A;  3JCM g;  3QJ6 A;  2O4X A;  5IHI A;  3CCE A;  1X43 A;  1OZ3 A;  2RHY A;  3I55 Q;  3FC3 A;  3HFO A;  4KRT A;  3OBW A;  2P0Q A;  3CCM Q;  2CH4 A;  2HL3 A;  1FMK A;  1H8K A;  3CCR Q;  1JRI A;  3P8H A;  2K5L A;  4OB0 B;  3M58 A;  4NL2 A;  1PKT A;  5FWB A;  2E70 A;  1GFC A;  2KT1 A;  5GMK j;  1WHG A;  4M7D C;  3WVE B;  4JLG A;  1VQ9 Q;  1SEM A;  4AG2 C;  2HDA A;  1PRM C;  3A8L B;  4PLL A;  3H8Z A;  2CP6 A;  2L3S A;  1H3Z A;  4OB1 B;  2VYT A;  4A63 B;  2VXE A;  1IZ6 A;  1MMA A;  1TUG B;  2K57 A;  4IIM A;  1M8M A;  5CKF A;  3L1A A;  3ZEH A;  2D0N A;  1RAH B;  4BI3 A;  1VQN A;  2QG9 B;  3OS2 A;  4P5N A;  4J9I A;  4JJC A;  2NUP B;  2RJE A;  2WSF E;  3EAE A;  3JCM c;  1VQM Q;  1YJN Q;  3CCS T;  1X6G A;  4IUV A;  2RI2 A;  2XK0 A;  5CO7 A;  2O88 A;  4JJD A;  5GMK m;  1I4K 1;  2CS7 A;  3JB9 I;  2MOX A;  2LQK A;  4ZN1 A;  4FM4 B;  4AFS C;  3LH5 A;  2DYI A;  4DBQ A;  1SSH A;  2GGR A;  4PJN A;  4FSX A;  4PLI A;  3C12 A;  4LE9 A;  3PVL A;  1FMW A;  3JB9 J;  4PJO F;  4PJO E;  1TTH B;  2KVQ G;  1I1J A;  2ZGW A;  2L3P A;  5I11 A;  2IPO B;  4NS5 A;  1G5V A;  4BAC A;  4BI8 B;  4F17 A;  1WQ7 A;  3RIR A;  4IKF A;  2ABL A;  5CKB A;  5GMK i;  4HXJ A;  3CCJ Q;  1N9R A;  4BY6 B;  1GBQ A;  2DKG A;  1ZSG A;  4X9D A;  2FRW A;  4FL6 A;  2RQR A;  2R5A A;  1AWW A;  3LX7 A;  2QDY B;  1SHF A;  2QAS A;  2OTL A;  1K73 R;  1AOJ A;  4JS4 A;  4E7Z A;  3G71 T;  4C0D C;  4EPC A;  2RHI A;  4MDW A;  2PUK B;  3VRZ A;  1VQ8 Q;  2QDL A;  4XQ3 A;  2QEX Q;  2DBM A;  4M77 D;  4KGZ B;  1ZBJ A;  4KUD K;  2VB6 A;  3QWY A;  3OYK A;  2MYS A;  1LVK A;  1YHQ Q;  1D3B A;  1WJR A;  2DER A;  1HXD A;  4M7D F;  4M7D E;  1BK2 A;  1TS9 A;  6AT1 B;  4YTL A;  1Q86 U;  4C5E A;  3QO3 A;  3C94 A;  4AG1 C;  1W2B A;  3ME9 A;  1AVZ C;  1WHJ A;  3AT1 B;  4HVW A;  1VQP Q;  5KYU B;  1GBR A;  2CP3 A;  2ZPF B;  2M0Y A;  3EFR A;  2HBP A;  5LJ3 j;  1RAC B;  1KD1 R;  3I56 Q;  3DLM A;  4KH1 B;  1X6B A;  4WTO B;  1PSE A;  1GCP A;  1ZX6 A;  2C0I A;  2FEI A;  4KUL A;  3URG A;  3LWH A;  2DEU A;  2JUF A;  1GL5 A;  3CC4 T;  4MDX A;  4RCC A;  4E2F B;  2P0K A;  1N6A A;  4XTU A;  1EFN A;  2FZK B;  5A2Q E;  1WHH A;  5DLO A;  2KAF A;  4E7I A;  1PC0 A;  2KXD A;  4RCB A;  2CGH A;  2ECZ A;  3NMZ C;  4FYW B;  2FPF A;  3S6W A;  5IH2 A;  4M4Z A;  4RKU E;  3PGG A;  4RTU A;  4M78 A;  1K9M R;  3JCM X;  3QKJ A;  4C8Q B;  2EKO A;  4CI0 C;  4F7U A;  3CCU A;  2KT8 A;  4CC7 A;  2X4Y A;  2CT3 A;  2M0O A;  2EW3 A;  3JRZ A;  2HKN A;  3VRY A;  3EH2 A;  3QPH A;  1AWJ A;  2CZ0 B;  4EMK B;  2X35 A;  3E9F A;  3M9Q A;  4BE0 A;  1X2K A;  4PJO B;  3RMQ A;  4X34 A;  3CME A;  1JJ2 P;  3FJ5 A;  3DB4 A;  1V29 B;  2YRC A;  1K73 C;  4RMO A;  2RK1 A;  4R56 A;  2K79 A;  3OA6 A;  1M90 U;  2DXC A;  1H3H A;  2JS2 A;  3CCQ A;  1YCS B;  1OX9 A;  4RG8 A;  2X9H A;  4PJO G;  4M75 A;  4OGC A;  4M77 C;  2VVK A;  2DL3 A;  4ESR A;  3G6E Q;  1KHC A;  2L3Q A;  3LWI A;  2FYK A;  2AZS A;  1G2B A;  2E12 A;  1LOJ A;  1SG5 A;  3ZL7 C;  4BI4 A;  2HQH A;  2QQB A;  4M7D B;  2OTJ Q;  2JM8 A;  4E6R A;  3CC2 A;  3CC7 T;  2XHC A;  1X27 A;  1QCF A;  2RJC A;  1R8O B;  4K11 A;  3GNF B;  3NFC A;  3FIF A;  1KQ1 A;  4KBM B;  2FHD A;  4OB2 B;  4XAX B;  3CCM T;  4HVV A;  3NPF A;  5GMK e;  4LDW A;  2HEQ A;  3G4S A;  3GLX A;  1UEB A;  4PJL A;  1KQ2 A;  4M7D G;  3BDL A;  1PCX A;  3CXC A;  2HZY A;  1VQO A;  2NLU A;  2L0A A;  3M0R A;  1MGQ A;  3OYC A;  1EIF A;  3PTA A;  3BDU A;  4Y92 A;  4FYX B;  5GAM h;  1WZO A;  5M9O A;  3OYY A;  3RES A;  1PHT A;  3OB9 A;  3J7A F;  3H0F A;  1GXI E;  1BYM A;  1K9M C;  2BZ8 A;  3CPW P;  1UGQ B;  3JB9 F;  1NE8 A;  4B9X A;  2F2W A;  3IQL A;  2CSQ A;  2DPP B;  2DRM A;  2CH4 W;  3MEV A;  1EX4 A;  3OS1 A;  2X4W A;  2RHU A;  2EJG A;  4QQG A;  5LJ5 d;  2EQJ A;  4L5G A;  3JB9 H;  1YJN T;  1B3Q A;  1NM7 A;  1YI2 A;  1W2B S;  1I5O B;  1KHI A;  2J7I A;  4A53 A;  2JTF A;  5GAO l;  3VS7 A;  1C0M A;  1M2O A;  4JRQ A;  1RAA B;  2AK5 A;  1UG1 A;  2E3H A;  2JT4 A;  3DKM A;  4AFQ C;  1GFD A;  3E1S A;  2BE7 D;  4C8Q D;  4RTT A;  4JLI A;  4C5G A;  4C0F A;  1B7T A;  3VS2 A;  5IN1 A;  2EQM A;  4BDY A;  3NTH A;  4C0D B;  2CKK A;  1MNE A;  3UA7 A;  1UGR B;  2D1X A;  4M77 E;  2LQW A;  3LW5 E;  1KQS P;  3HTR A;  3I35 A;  2CUB A;  3CCE Q;  1LJO A;  3CCJ T;  2ZPI B;  2COY A;  1QVG P;  4Z02 A;  3J81 E;  1Q82 R;  4BY6 C;  1NEB A;  2NUP A;  3EHR A;  5I2M A;  2F5T X;  1E6G A;  1SKU B;  3UWN A;  3EFO B;  2DTI A;  5LL6 S;  1ZQ1 A;  3OYE A;  1XNI A;  4XU3 A;  1UDL A;  2P84 A;  4O6J A;  2QEX T;  1UUE A;  3MP8 A;  3OYF A;  2DXT A;  2GFA A;  5A0L A;  1YHQ T;  2M1H A;  1UGV A;  1S72 A;  1Q81 C;  5J3B A;  1VQ4 A;  1TU0 B;  2K5I A;  2BKD N;  3L2U A;  2LVM A;  1K8A U;  3TRE A;  3PFS A;  1Q7Y R;  1T3L A;  2CUD A;  2CYZ B;  1VQP T;  3WVD B;  5LJ3 e;  2EYW A;  1VQN Q;  1YBY A;  4RG2 A;  2R57 A;  5KYW B;  4QQ6 A;  5FRM A;  3HP9 A;  2EYZ A;  1ZLM A;  2E65 A;  2JVV A;  1WXU A;  2GTO A;  1U1S A;  3I56 T;  2KXC A;  2PNI A;  2LZ6 B;  4XU0 A;  1U3O A;  2O01 E;  3H41 A;  1OPL A;  4OGE A;  2V1Q A;  2YWW A;  2J06 A;  4KGX B;  2RNA A;  2W10 A;  3VYG A;  1VA7 A;  3CBO A;  4FYY B;  1QVF S;  4RTY A;  1BCM A;  4OMM A;  2KE9 A;  3GPL A;  2X3X D;  5FU7 C;  3PIP A;  2K2M A;  5LJ3 f;  2VGM A;  3UT1 A;  5GJW B;  2FL7 A;  5KYU A;  3UA6 A;  1T0J A;  4C8Q C;  3JB9 G;  2D6F A;  2AZV A;  2PTK A;  3L42 A;  2OTL Q;  3A8O B;  3CCS A;  2QK0 A;  5FRO A;  4C92 D;  1YP5 A;  1VQL Q;  4FU6 A;  1VQ5 Q;  1MUZ A;  4EMK C;  1Q82 C;  7AT1 B;  3MET A;  3EHQ A;  1G3W A;  3QYH B;  3JCM W;  2A37 A;  1M27 C;  1X01 A;  2LJ3 A;  4JRI A;  3OYG A;  1M1G A;  2V8J A;  1I81 A;  4PK4 A;  2RO0 A;  2RJD A;  2SEM A;  5J26 A;  1UJY A;  5CAI A;  3CC7 Q;  4PFP A;  2FVU A;  5GAN h;  2KK4 A;  2RQW A;  3HRT A;  1YJW T;  2CDT A;  2RPN A;  3HKS A;  4XTY A;  4EMG A;  3G6E T;  1RLQ C;  3OYN A;  2WAC A;  1BIB A;  3L2R A;  3VS1 A;  3EGD B;  2MPX C;  1Q7Y C;  2XDB A;  1IGU A;  4E7J A;  2JMC A;  1BIA A;  2DXU A;  4EMK A;  3RKX A;  3SB2 A;  3X24 B;  5L23 A;  2VUB A;  3QII A;  2OTJ T;  3M4G A;  2MIO A;  4PJO A;  4XU2 A;  3QBY A;  4J83 A;  2RM4 A;  1J3T A;  2K3Y A;  2YRV A;  3ER0 A;  3L2Z A;  2DVJ A;  1M4Z A;  1X69 A;  2XDP A;  2VWF A;  3QG1 A;  3PMT A;  4PJJ A;  1Y96 B;  3CBM A;  3MP1 A;  2DZ9 A;  3PMI A;  1WLP B;  1IHW A;  4KH0 B;  3GP8 A;  4J6Y A;  1OQK A;  2X51 A;  4LUE A;  5IHK A;  3GIB A;  1N5Z A;  3GNG A;  2LRQ A;  3QZ9 B;  2EIF A;  3OQ5 A;  1RI9 A;  1WHK A;  2EKH A;  1CKB A;  2LC4 A;  4QVZ A;  3QSU A;  4ORZ A;  2NUZ A;  1YCY A;  2E1H A;  4C8Q E;  1W1F A;  4C8Q F;  4C0G A;  2CP7 A;  2K6D A;  4FT2 A;  2EYY A;  2PQW A;  4J9G A;  3CCL A;  3TSZ A;  2F5K A;  4M7D A;  3CME Q;  4KGV B;  2MF2 A;  1PD1 A;  4ZTF A;  2DL7 A;  2KBT A;  1RAE B;  2LTO A;  2DJZ A;  2CP0 A;  2LNH B;  2LDM A;  1T0H A;  2E5K A;  3UF4 A;  3NTI A;  3JB9 D;  5CKH A;  3E19 A;  1VQ6 Q;  1JBM A;  4DOW A;  4JZ3 A;  5C6S A;  1YJ9 A;  2P0P A;  3FB9 A;  3OBY A;  5HKC A; 
#chains in the Genus database with same CATH homology
 1X2K A;  2L2P A;  2XMF A;  3EG1 A;  3QWX X;  1BU1 A;  2DIL A;  2LJ0 A;  1G83 A;  4CC2 A;  1YN8 A;  2KNB B;  3FJ5 A;  1RLP C;  2KYB A;  2AKL A;  1PKS A;  3VS4 A;  2K79 A;  1NLP C;  4EIK A;  1JQQ A;  3KFV A;  2F2X A;  2JXB A;  2K7A A;  1H3H A;  2JS2 A;  1H92 A;  5EC7 A;  4J9E A;  2EBP A;  1YCS B;  3H0I A;  1NYF A;  1JXO A;  1KJW A;  4D8D A;  1A0N B;  1AWX A;  2DX1 A;  2ED1 A;  4ZNX A;  2A36 A;  4J9H A;  2VVK A;  1OOT A;  1NEG A;  2KRN A;  2DL3 A;  1W6X A;  4ESR A;  2EVR A;  3I5S A;  2L3Q A;  1ZUY A;  3SHW A;  2AZS A;  2FG0 A;  1G2B A;  4CC4 B;  3JV3 A;  1V1C A;  4D8K A;  1BBZ A;  2EGA A;  4AFU C;  2MCN A;  3ZL7 C;  2LP5 A;  4Z88 A;  2LCS A;  2ROL A;  1Z9Q A;  3R6N A;  5ECA A;  2JM8 A;  1RUW A;  3C0C A;  4LN2 A;  4E6R A;  2RN8 A;  4RTX A;  1NYG A;  1UHC A;  1X27 A;  1QCF A;  1AEY A;  3UAT A;  4K11 A;  3REA B;  2O9V A;  3EG2 A;  2DLP A;  2FPD A;  2C0O A;  3PVQ A;  3REB B;  4HVV A;  2B86 A;  3NPF A;  2HEQ A;  2YSQ A;  2W0Z A;  2J05 A;  2FRY A;  1M3B A;  4JJB A;  1NLO C;  1BB9 A;  1OPK A;  2L0A A;  3M0R A;  4Z89 A;  1K76 A;  2O9S A;  3VS0 A;  4Y92 A;  3THK A;  1ARK A;  3M0T A;  4JPB W;  2RF0 A;  4JZ4 A;  1PHT A;  4X1V A;  2BZX A;  1SPK A;  3H0F A;  4RTV A;  2FO0 A;  2HCK A;  1JO8 A;  2BZ8 A;  2KEA A;  2YT6 A;  1WDX A;  2EQI A;  1UHF A;  1TUC A;  1JXM A;  2F2W A;  4FSS A;  3IQL A;  2CSQ A;  2IIM A;  2DRM A;  2CH4 W;  1CKA A;  4IIO A;  1TG0 A;  2DYB A;  1M3A A;  4WCI A;  4OMP A;  1E6H A;  2FPE A;  2YUN A;  2LQN A;  4R0K A;  1TUD A;  2J6K A;  1YWO A;  1B3Q A;  1NM7 A;  1AD5 A;  2J7I A;  2CT4 A;  4HVU A;  3VS6 A;  4RTZ A;  2EGC A;  3ULR B;  1WFW A;  1W70 A;  3M0U A;  1K1Z A;  1WIE A;  3VS7 A;  2AK5 A;  2OAW A;  1UG1 A;  2JT4 A;  4AFQ C;  1GFD A;  4RTT A;  2A28 A;  2RQU A;  1M3C A;  3VS2 A;  2RQT A;  1CSK A;  5IHN A;  4F16 A;  3UA7 A;  2K3B A;  2CSI A;  4RTW A;  3PE0 A;  2D1X A;  1JU5 C;  2LQW A;  3A98 A;  2GNC A;  4DEX A;  3EG3 A;  2DE0 X;  1MV0 B;  2DJQ A;  3I35 A;  2CUB A;  2EGE A;  1PNJ A;  4J9B A;  4OML A;  1I0C A;  2G6F X;  1HD3 A;  1VYV A;  2KR3 A;  1YWP A;  1UEC A;  2JS0 A;  3VS5 A;  2K9G A;  1K4U S;  2YUQ A;  3SEM A;  1NEB A;  2JW4 A;  3EHR A;  1PRL C;  4LUD A;  1UJ0 A;  4DEY A;  1E6G A;  2JMA A;  2YDL A;  2ED0 A;  1K9A A;  3VS3 A;  3NGP A;  4OMN A;  4GLM A;  1ZUK A;  3EGU A;  4Z8A A;  1Z9Z A;  1UDL A;  1KIK A;  4J9D A;  1AWO A;  2DF6 A;  1UUE A;  5IHI A;  1X43 A;  1MV3 A;  1I07 A;  4KRT A;  1NG2 A;  4OMO A;  2CH4 A;  1GRI A;  1UGV A;  1FMK A;  1H8K A;  2A08 A;  2LMJ A;  1K0X A;  2EPD A;  1PKT A;  2ENM A;  5FWB A;  2KT1 A;  1GFC A;  2YUO A;  1SHG A;  1T3L A;  2CUD A;  2GBQ A;  2I0N A;  1SEM A;  4AG2 C;  2EYW A;  4RUG A;  2HDA A;  1PRM C;  2DMO A;  2EYZ A;  2X3W D;  1ZLM A;  2ESW A;  1WXU A;  1GCQ C;  1X2Q A;  2GTO A;  1U5S A;  2L3S A;  2KXC A;  2PNI A;  1T3S A;  1B07 A;  2LZ6 B;  4A63 B;  1U3O A;  3H41 A;  1OPL A;  2SRC A;  4IIM A;  1M8M A;  4QT7 A;  2V1Q A;  5HCK A;  2D0N A;  5FW9 A;  3M0P A;  2J06 A;  2VKN A;  2DA9 A;  2GQI A;  2RNA A;  2DL8 A;  2W10 A;  2HSP A;  1VA7 A;  4J9I A;  4JJC A;  4CC3 A;  2F2V A;  1QKW A;  1X6G A;  4OMM A;  4RTY A;  1S1N A;  2DM1 A;  2O88 A;  1HJD A;  3M0Q A;  5GJV B;  1UFF A;  2J6O A;  1QLY A;  1YNZ A;  1Y57 A;  2KE9 A;  2X3X D;  4JJD A;  1HSQ A;  2K2M A;  2MOX A;  1ABO A;  3O5Z A;  4AFS C;  2OJ2 A;  5GJW B;  3LH5 A;  1SSH A;  2GGR A;  3UA6 A;  2DRK A;  1T0J A;  3PVL A;  4LE9 A;  1GCQ A;  2AZV A;  1KFZ A;  2PTK A;  2DL4 A;  2V1R A;  1M30 A;  1I1J A;  2L3P A;  5I11 A;  2KYM A;  1YP5 A;  2LX7 A;  1MUZ A;  4F17 A;  2ABL A;  5I22 A;  1K0S A;  1OV3 A;  4HXJ A;  1GBQ A;  2NWM A;  4LNP A;  1ZSG A;  2O2O A;  3EHQ A;  3CQT A;  2FRW A;  3GBQ A;  1PWT A;  1UTI A;  2A37 A;  2RQR A;  1M27 C;  1AWW A;  1SHF A;  2D8J A;  1AOJ A;  2LJ3 A;  1WI7 A;  2ROT A;  1SRM A;  2D8H A;  1KSW A;  1WXT A;  2RQV A;  3VRZ A;  2PZ1 A;  4OMQ A;  4J9C A;  2QDL A;  1AZE A;  1FYN A;  2DBM A;  1QKX A;  2SEM A;  1AZG B;  1UJY A;  3U23 A;  1ZBJ A;  2YUP A;  3TVT A;  2DBK A;  3QWY A;  4J9F A;  4F14 A;  2H8H A;  1WA7 A;  1E7O A;  2AKK A;  2RQW A;  1VYU A;  2CDT A;  2RPN A;  1VYT A;  1BK2 A;  2BTT A;  1RLQ C;  3NHN A;  5IXF A;  2DNU A;  2LJ1 A;  2CRE A;  2BZY A;  3EG0 A;  4AG1 C;  3VS1 A;  1AVZ C;  4HVW A;  2KGT A;  2C0T A;  3RNJ A;  1U06 A;  1XOV A;  2JMC A;  4GBQ A;  2KRO A;  1WYX A;  1SRL A;  5L23 A;  2KRM A;  1IO6 A;  2KRS A;  2JTE A;  1QWF A;  5FWC A;  2MIO A;  1UE9 A;  1GBR A;  1LCK A;  1J3T A;  2M0Y A;  2DVJ A;  1X69 A;  2VWF A;  2EYX A;  2JM9 A;  1X6B A;  2OI3 A;  1WLP B;  1GCP A;  1ZX6 A;  2P4R A;  2C0I A;  2FEI A;  3M0S A;  4LUE A;  5IHK A;  1GL5 A;  1WXB A;  1N5Z A;  2J6F A;  1Y0M A;  1RI9 A;  2EKH A;  1QWE A;  1CKB A;  2RMO A;  1EFN A;  4ORZ A;  2NUZ A;  2DL5 A;  2GTJ A;  2HBW A;  1OEB A;  2KXD A;  3H0H A;  1W1F A;  2ECZ A;  3NMZ C;  2FPF A;  2K6D A;  5IH2 A;  4HCK A;  2EYY A;  4J9G A;  5IXB A;  3TSZ A;  4M4Z A;  3TSW A;  4RTU A;  1JEG A;  4AFZ C;  2DL7 A;  2KBT A;  2O31 A;  3RBB B;  2LNH B;  3I9Q A;  2M51 A;  1ABQ A;  2KT8 A;  1T0H A;  4CC7 A;  2E5K A;  3UF4 A;  1ZUU A;  2CT3 A;  2EW3 A;  3VRY A;  4JZ3 A;  3I5R A;  1AWJ A;  1WX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...