1UELA

Solution structure of ubiquitin-like domain of hhr23b complexed with ubiquitin-interacting motif of proteasome subunit s5a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
95
structure length
95
Chain Sequence
MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALKEYKIDEKNFVVVMVTKPKAVSTPAPATLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Ubiquitin-interacting Motif of S5a Bound to the Ubiquitin-like Domain of HR23B
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation/protein binding
molecule keywords UV excision repair protein RAD23 homolog B
total genus 23
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2003-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1uelA00
5GMVA 2KN5A 4IM2A 4M8MA 2G4DB 3IFWB 3ZRFA 5JHBA 1E5WA 1KJTA 2CKHB 3VDZA 2K8BA 4KSLC 3GOEA 1WY8A 2D07B 1WXVA 5G2NA 3SDLC 1TBEA 4WJPA 1SE9A 2D11A 3MJWA 1SIFA 2JZZA 4GDLA 3TIXA 3U8ZA 4NJ6A 5DPWA 4MSMB 2MW5A 3PLVA 4MJSB 1E7VA 3VH4B 4B9KA 4BVUC 4MELA 2N9EB 1WFYA 1R4MI 3L0WB 2DYOA 4FJZA 4BBNC 1GNUA 3PSEB 1GUAB 1R4NI 4KVGB 2LVQA 2MA9B 4XZ4A 5CTRC 4GGQA 4KDLB 1JRUA 1OGWA 2C60A 3HHMA 1V86A 1X1MA 3VXWA 1S1QB 3DBRI 2OJRA 2QHOA 1WE7A 3QK0A 2L76A 3UINB 2NCNA 1Q5WB 3JW0X 4WQOB 2WX0A 4FJVB 1NDDA 1HE8A 2MCNB 1NI2A 1K8RB 2KHWB 3KW5B 5TR5A 3U7DA 1WXSA 3A9KB 1XQQA 4CO7A 3QA8A 2M8SA 4KIKA 3IG3A 3K9PB 2ZPYA 3JSVB 5CHVC 3W1SC 5IA7A 1ZW7A 3Q3FA 3PTFC 4WJOA 2V3SA 4MDKE 2KWVB 2I1JA 1UBIA 1L7YA 2NBVB 3NHEB 4GB9A 1IP9A 1P98A 2FAZA 4HXDA 4RM9A 1TTNA 2KJRA 1LQBA 2BGFA 3EHVA 2LXCA 2IO3B 1H4RA 4AUQC 4E71A 1WGDA 3ONSA 5D2MB 2DENB 3JVZX 4ASWC 2KDEB 3V60A 2O6VB 4HLEA 2MBEA 2KMAA 4ANVA 2KC1A 2ZPNA 4K1RB 4NAWB 5G55A 2KDBA 4IC7B 4G3XB 4MJSA 4GMVA 2AWTA 2MP2B 3ZO5B 1J8CA 3ZUNA 1I42A 2NBUA 2J0MA 1P9DU 3KYCD 3JYUA 4NAWA 2Y5BB 2EMSA 2G3QB 4JLCA 2V1YA 4AJYB 2LRWA 1KOTA 2KC2A 2KFJA 2DYMA 2IO0B 4P7IA 5CX3A 3WALA 1P1AA 2MSED 2N1VA 2BPSA 2REXA 4HCPB 5E6PA 4ZRIA 3OJ4B 2IZVB 4GU2A 1WF9A 2K6QA 2KK8A 3M63B 5AZFA 4GXBA 5J17A 1E7UA 3X0WA 2W9NA 2MBQA 4KSKC 2NBWB 2ZVNA 2LUEA 4AJWA 1LFDA 4EFOA 4BBNF 2YVCA 4J6IA 2RSUA 2ZZPB 1H8CA 3PHXB 3IBEA 3W1YA 5L95C 4NQLB 3VH3B 2I1KA 3L13A 2AEHA 2KQSA 5CHFA 5DPTA 2LJ5A 3HIZA 2DAJA 5C23A 4BKSD 4IM0A 4DDGD 1WX9A 2HE7A 4W9DA 2K8HA 4WJQA 4FLHA 4WWOA 3AXCA 4TUUA 4KV2A 3EECA 5EDSA 3RCZA 3CSFA 4URKA 1WX8A 2ZVOA 1V80A 5FR6A 2M1MA 3PRZA 2LRUA 2O2VB 4I6PA 4FADA 3CMMB 3ZRCA 4GDLB 5E6OA 1PQSA 4BFRA 3ZNHB 3A4RA 3R7QA 2BYEA 2L0FA 2IY0B 2UYZB 3B08A 4CHKA 2KQ7A 4HJKA 2KJHB 4GSWA 3ML8A 2ZNVB 2BYFA 3KUDB 3QQ8B 5AZHA 4IWOA 4A3PA 4GN1A 1G6JA 2BWFA 3VTWA 3AULA 4XC2A 2WYQA 4GIVA 2JPHA 2KMCA 3KVFB 2HD5B 2FCNA 4NY0A 1WI0A 1GC6A 3APFA 1E8XA 5E6NA 2C7MB 2EKEC 4EZKA 1NBFC 1I35A 2C7HA 1UD7A 2VRRB 3V6EB 2KWUB 2KOXA 2G4SA 4HCNB 4HWIB 2NS5A 2KKCA 3U30A 3UIPB 1A5RA 4B95A 2KTRA 4JGHB 5JHAA 3AU5A 1WRDB 3B0AA 3OLMD 4DHJB 3APDA 4TV3A 1WZ0A 2DAFA 3M3JA 4ZRKA 1LM8B 2V4LA 3PPAA 4GDKA 4EKUA 2C9WB 2KX3A 2CS4A 4LDTB 4ANWA 3SHQA 4NJ7A 5IAAC 3L10B 2FIDA 4HPLB 4AOFA 4F7ZA 3B1LX 4IG7B 1C3TA 4DHZB 5J18A 3H7SA 2K6DB 1J19A 3KUCB 3A1QA 2LZ6A 4W9LA 2JY6A 1UGMA 4FULA 2BF8B 2N7DA 1GJZA 1WGGA 4FN2A 1WJUA 2UWQA 1E90A 3UGBB 2FUHB 4TKNA 2IYDB 4IM3A 4KZCA 3VHTC 2MX2A 3WANA 3CF6E 4HDQA 5D7GA 3C0RB 2K39A 1WJ4A 2PE9A 1D3ZA 3TJPA 1YIWA 3ML9A 3DQVA 3A4SC 3KH0A 3DBLI 1BT0A 3MTNB 1ZGUB 3L17A 1Q0WB 4LJOB 3AI5A 1WMHA 2O6VD 4PYZA 2M17A 4WJNA 3L08A 4II2B 1WX7A 2PEAA 4W9EA 3PLUA 1V5OA 3DVNU 3APCA 1WJNA 2ASQA 3PGEA 4W9CA 4KDIC 2N9PC 2BKFA 3DBHI 1WM3A 5AZGA 4BKSA 3ECIA 4ICUA 2JVCA 3H7PB 4II3B 3VTUA 3ZTDA 3PZDA 3R7RA 2DX5B 1S3SG 2LWPA 5L83A 1WE6A 5JZEB 3ZDTA 3PRMB 3ZIMA 3DPDA 2A4ZA 2KTRB 3KUZA 3NZUA 2NR2A 4HK2A 3CSTA 4LJPB 1OEYJ 1VCBA 2LGXA 2LXAA 1V49A 4K7SA 3RD2A 3ZKJC 5HKHA 2FCQA 3K9OB 3QWZB 1Q1OA 2KLGA 2GMIC 2WDTB 1Z5SB 2RR9A 4HPMB 4GDKB 1WR1A 3ZNGC 1IPGA 1E8WA 4PS7A 3PS6A 1GC7A 2L8JA 2NPTA 2N7EA 2JRIB 3QJZA 1CMXB 4ZYNA 1WGYA 5KHQA 1EO6A 3PHWB 1WM2A 2G45B 1J0GA 5DCNA 3WIMA 4BOZB 3IHPC 1V5TA 3SU8X 3WA0A 2ZNVC 1WGHA 1WJ6A 4IW0A 2MQJA 2DZKA 2KDFB 4OVUA 5D94A 3TBLD 4W9KA 2CHZA 5LXIB 2D10A 3DVGY 1RFAA 1RRBA 1WH3A 2PPHA 2BYVE 5AEKB 2A5UA 4ICVA 3N32A 1P3QU 2MBBB 3HM3A 3UIOB 1V9JA 4MGIE 5JH5C 2GBNA 3QAQA 4FBJB 3BINA 1E8ZA 4NPNA 1OEYA 3QCAA 3ZNID 3JSVA 2KD0A 2MBHA 2R2QA 3QIJA 1WMHB 2CHWA 4AWJA 3L54A 2AYOB 2LGYA 3RUIB 2MBOA 4JQWC 2J7QB 3R3MA 4GOCA 4ZRJA 2FCMA 4ZDVA 3V6CB 3RZWC 2YLMA 2KWCA 1L2NA 4IUMB 4IWPA 5DPRA 1WZ3A 3VFKA 3X23A 1EF1A 2JF5A 3TMPB 5D6JB 3EFUA 2N1WA 2HJ8A 2D3GA 3UF8A 4EZJA 3A1QB 3S2AA 3VTVA 5LXHA 1ISNA 4EZLA 3A9JA 1YX6B 3KYDD 3ENEA 3ALBA 3TCAA 3QARA 1WR6E 1AARA 3VUYA 2NPTB 3RYTA 2L00B 3VUXA 3RULA 2KLCA 3M95A 2L05A 4X57B 3ZLZA 2O6VA 4NNJB 3NY5A 3H1UA 2K1FA 2RPQA 1OQYA 2WX1A 3R66C 3OJ3A 4YL8A 3ZW3A 1OTRB 4BKTA 3WAPA 3PT2B 4WWPA 3D32A 4FHJA 5J2RA 2CR5A 1V2YA 2GBMA 3QX1A 1F9JA 4I6LB 2FNJB 2KANA 2BWES 1V81A 4HDOA 3H7PA 3UQAA 3AU4A 4MGZE 3O65B 4OVVA 3W1SA 4FJYA 2C5LC 1MG8A 4XX5A 3V62A 4DHZE 2JRHA 3IVFA 4TQ1A 1T0YA 4DK5A 2ZEQA 2NVUI 2KVRA 1TGZB 1IYFA 3GZNI 4PS8A 2N9XA 2B3AA 2XEWA 1WYWB 3DDCB 4K7UA 3V61A 3WAMA 2ZCBA 4K81A 2AL3A 1YD8U 2FIFA 1U4AA 4G0NB 1C1YB 3VVWB 1V6EA 2HTHA 2M4NA 1P0RA 2J0JA 4PYUA 4JL9A 2LVPA 2GBKA 3A9JB 4JIOU 1RLFA 2O2VA 3M62B 1UZXB 2AL6A 4CYEA 2L7RA 1KLVA 2MLBA 4E3CA 3H9DA 1M94A 4F8CB 4MM3A 5DPSA 4EOYA 4E74A 4RM8A 4W9HA 5C1ZA 4G11A 1WIAA 3QHTA 3ZVVA 2XBBC 2MP2A 2XK5B 2GOWA 4I6NB 2ZCCA 2IBIB 2KFKA 3NOBA 4A20A 4B6WA 2OOBB 3PREA 2JUOA 2KXJA 1WXMA 4K7WA 4MH0E 4MGKE 4BKGA 2FCSA 2DYBA 4DWFA 1UH6A 1XT9B 2ZJDA 3ZTCA 4N9F4 2XK5A 3N30A 3N3KB 2LI5A 1KM7A 3T9LA 2R2OA 1YJ1A 4MSQB 2KJ6A 3RZFA 3NS8A 4EUTA 2PE6B 4W9IA 4DXAB 2LGDA 3DBSA 2MRPA 2CU1A 3NZSA 4AP4C 4FA6A 3DOWA 2DHZA 4ANUA 4LCDE 3DVGX 2RD0A 2J0KA 2Z0DB 2MWSB 4LDTD 3DVNV 4NQKE 3UQBA 2JZ3B 2RGFA 3MHSD 4IWQA 3P2BA 1Z2MA 1EF5A 3HM6X 4M0WB 3H6NA 4M8NA 4BOSC 1Y8RC 2GBJA 2M0XA 3I3TB 3QC8B 2IO1B 1VD2A 4DHJD 4W9FA 4EEWA 3WAOA 2D2QA 4HVBA 1YX5B 1WXAA 4WAAA 2BKRB 2PJHA 4W9JA 3PRPB 1GG3A 3LDZE 1LXDA 4W9GA 3OAWA 2LVOA 2DZIA 1QZEA 3EC8A 4A3OA 4FHKA 2CHXA 2Z0EB 4MGYE 1ZKHA 2DZJA 1RAXA 2KDIA 4RMAA 4WWNA 3TL5A 1FXTB 2JXXA 1UBQA 5KHOA 2WWZA 2K8CA 2L0TA 3L16A 4DBGA 3T8MA 2K25A 3A33B 3VAWA 3VQIA 2DZMA 4F1SA 2KFKB 1YQBA 4G50A 2GBRA 2IY1B 3A9KA 3PVLA 3Q3JA 2JT4B 1TZ1A 1WGRA 2L3ZA 3VUWA 3LJ3A 2KTFA 4KIKB 3HK0A 2EMTA 2Z59B 4DDID 2IO2B 1UELA 2KX0A 1EUVB 2KO3A 2KZRA 2LASA 1XD3B 2KNBA 3DCGA 3ZDMC 2LD9A 5LLIA 4ANXA 2C7NB 4PS3A 4KZ0A 5CHWA 3BY4B 4MEMA 3RT3B 1SGHA 2N4FA 4TQ0A 5BO4B 3SD5A 3PV1A 1E8YA 3ZNZB 2JWZA
chains in the Genus database with same CATH superfamily
2KN5A 4M8MA 2BYTA 2G4DB 1E5WA 1C76A 4RGTA 3MJWA 1SIFA 4N58A 4YWGG 2AX5A 4NJ6A 3VR9B 2RDGA 4MSMB 3PLVA 4MJSB 3VH4B 4FBJB 2N9EB 2DYOA 4BBNC 3AE2B 1R4NI 1T0SC 5GXGB 2LVQA 1XF5L 2EELA 3VXWA 4OVZA 1YQ4B 2L76A 2NCNA 3JW0X 2RMMA 3L4PA 2IDYA 2D5GA 2MCNB 3KW5B 3A9KB 2LGSA 5IOIA 3QA8A 3W2DA 1QOAA 2ZPYA 1GB1A 1ZDVA 5IA7A 1QF6A 5H8YE 1MVKA 4MDKE 4LNOA 5FKAC 1KTKA 4OZAA 3EHVA 2IO3B 1L6VA 3ONSA 2DENB 4MACA 3JVZX 4ASWC 2KDEB 2O6VB 4HPPA 2VZKD 2Y3AA 2KC1A 4NAWB 2FE8A 1IGDA 3W5VB 4GMVA 2MP2B 3ZO5B 1J8CA 3PZ8A 2J0MA 3JYUA 1XO3A 4NZLB 2B76B 2WLBA 2LRWA 2KFJA 3U2SC 3N1XC 5CX3A 2X8XX 5E6PA 1FFVA 1PYWD 3OJ4B 4OHJA 3IT6B 2BB6A 5J17A 4RFBA 4IKGA 2NBWB 2K0PA 1LFDA 4EFOA 4BBNF 2J52A 4J6IA 4NQLB 2I1KA 3L13A 4LTUA 5CHFA 3ZYYX 2VZKB 1FPYA 1DOYA 2HDEA 1WX9A 3SFDB 4TUUA 4LLGM 5EDSA 2OJWA 4URKA 1WX8A 2LRUA 2O2VB 1JWBD 1V1OA 2JYTA 3ZNHB 3R7QA 2BYEA 2WU5B 2LFIA 2IY0B 2UYZB 3B08A 3BVGA 5BMGA 2BYFA 4A3PA 5H92C 3AULA 4MT5A 2JPHA 2KMCA 2WDRB 2FCNA 1WI0A 1E8XA 4EZKA 3RMKC 1T0RC 3FILB 4XE0A 1UD7A 2ON8A 2KKCA 1FXIA 5JHAA 2KTRA 1JRPA 2D3CA 1F2RI 3APDA 4TV3A 1WZ0A 1L4ZB 1D6EC 3M3JA 4ZRKA 3B2GA 1QOFA 5BYSA 2KX3A 4DXFA 1SE2A 4ANWA 1SF0A 5IAAC 2FIDA 4ZRQA 1FMAD 4DHZB 5J18A 1J19A 1EU3A 2D3BA 4FULA 3FC4A 1GJZA 1T0QC 3UGBB 1MJDA 2IYDB 4KZCA 3VHTC 2MX2A 3CF6E 4HDQA 5D7GA 2BT6A 1WJ4A 2K39A 1D3ZA 1FNWA 3ML9A 1YN4A 1R7SA 3TUOA 3MTNB 1VRAB 1ZGUB 2RPVA 1E9MA 3LYYA 4II2B 1F0ZA 2V4IB 1V5OA 3PGEA 2DNFA 4KDIC 1EWCA 2N7JA 1SIJA 2Y5CA 5AZGA 1VLBA 4BKSA 4II3B 2JVCA 3AECB 3H7PB 3ZTDA 3R7RA 2LHEA 5L83A 5JZEB 2LJIA 3PRMB 3DPDA 3AE8B 3RNBC 4HK2A 1HTQA 2NR2A 2IGDA 1VCBA 4K7SA 2LXAA 3RD2A 3DHGC 5HKHA 3R2TA 1XCQL 4WQMA 4GDKB 1E8WA 1GC7A 2L8JA 4YXDB 2BS4B 2N7EA 1SSNA 3QJZA 1WM2A 3NJTA 5DCNA 3WIMA 3SU8X 3NVWA 1WGHA 1WJ6A 4IW0A 2DZKA 2KDFB 3P1MA 4HJGE 4OVUA 1GB4A 2E6XA 2WXIA 3DVGY 5AEKB 1RRBA 1FIQA 2A5UA 4ICVA 1UWXA 4XDCA 3QAQA 3BINA 4IOIE 1SEBD 5HFYA 1YN5A 2PVOD 3QCAA 3Q3MC 3ZNID 2INDC 2R2QA 3QIJA 1SJED 2AYOB 5HHDG 3RUIB 1SXTA 2J7QB 2YEPF 2FCMA 3RZWC 2KWCA 1R4NB 2ONQA 3VFKA 2ICIA 2KWDA 1FNUA 2BS3B 3NRZA 1CJEA 4EZJA 3S2AA 2KT7A 3VTVA 5LXHA 3KYDD 3ENEA 3QARA 1WR6E 3VUYA 2IPKD 2KLCA 2L05A 1V8CA 3R66C 4YL8A 3OJ3A 2GRIA 1OTRB 3WAPA 1WSPA 1YQ3B 2QMTA 1FRRA 4CQNA 2HTME 4I6LB 2BWES 1V81A 3V62A 1MHXA 4XX5A 3ZJUA 1EM7A 2XEWA 2B3AA 4K81A 3ZXVA 4XGAB 2HTHA 1P0RA 5FK9C 2O2VA 4WWMA 1UZXB 4C7ZA 1TY0A 4M00A 2MLBA 4E3CA 5G5GA 4MM3A 4EOYA 4RM8A 1WIAA 3QHTA 4REZA 2KFKA 2OOBB 4A55A 2FCSA 2JX5A 4FXCA 4DWFA 1UH6A 3ZTCA 2WXLA 2BTEA 4PK1A 2LI5A 5EE9A 2KJ6A 5IKCM 3RZFA 2DBYA 4W9IA 2LGDA 4XWTA 2CU1A 2SAKA 2RD0A 3Q8BA 2MWSB 2CJOA 3DVNV 3AE6B 4LDTD 2RGFA 1TKYA 3UQBA 4JPSA 3P42A 4M0WB 4M8NA 2M56B 1VD2A 2BQQA 4EEWA 3WAOA 2WQYB 1SBBB 3ABVB 4WAAA 2BKRB 3ZQ4A 4W9JA 4W9GA 1FEHA 2LVOA 1CZPA 3OAWA 4M02A 2CHXA 1RAXA 2JXXA 5KHOA 3Q3JA 1C4CA 3PVLA 3ZXRA 4LNIA 1GPXA 3ZJVA 2KTFA 3HK0A 2EMTA 3HRDD 1UELA 1EUVB 3URYA 4US8A 1SGHA 5IP4D 2N4FA 3PV1A 1E8YA 3BYYB 3ZRFA 1FFUA 2CKHB 4KSLC 3GOEA 1WXVA 4WURA 2D11A 4XYCA 5AUIA 2PTLA 3TIXA 4BVUC 4HKQA 4FJZA 4KVGB 1FD6A 2JXTA 1JALA 4GGQA 4KDLB 1S1QB 1WE7A 3DBLB 4WQOB 4FJVB 1K8RB 2KHWB 1WXSA 1XXGA 4CO7A 3K9PB 1ZW7A 2HJ1A 3PTFC 2E3TA 3RI7C 2W3SA 1UBIA 2XNAC 4GB9A 1IP9A 3DHHC 4HXDA 1KF6B 2LXCA 2IGHA 5D3IB 3CIRB 1STEA 3V60A 4HLEA 2ZW1A 2ZPNA 4G3XB 4ARCA 4MJSA 3V3XA 4HRSA 1P9DU 2M19A 1F52A 5C3JB 4NAWA 1F77A 2EMSA 4AJYB 3RFZB 2JZPA 3N1ZC 2IO0B 4P7IA 3WALA 1P1AA 2N1VA 2REXA 3AEFB 3RNFC 1JROA 4GU2A 2KK8A 4GXBA 1N62A 4JE3B 2MBQA 1C79A 1VJKA 2VH1A 4AJWA 1N5XA 2XN9C 2ZZPB 3PHXB 5TSSA 3W1YA 5L95C 1ZE3D 5HI1A 3E56A 5DPTA 3BIID 4KGRA 4US9A 2LHDA 2DAJA 4DDGD 4BKSD 4IM0A 3P4QB 3AE1B 1MHHE 1UWMA 2RDBC 2WXMA 4WJQA 1C4PA 4WWOA 3AXCA 4KV2A 2BVCA 2CU3A 3RCZA 1HEZE 2ZVOA 1N6ZA 2M1MA 4I6PA 3ZRCA 3RNAC 1P7EA 3AEDB 2L0FA 3BVMA 3TEWA 2KQ7A 4XWWA 2KJHB 2EKIA 5AZHA 2YEPB 2Z8LA 4XC2A 2WYQA 2MH7A 2HD5B 5E6NA 2GLSA 1I35A 2C7HA 2VRRB 1IGCA 3U30A 4JGHB 1AYFA 3B0AA 4L23A 2DLBA 1LM8B 2V4LA 3PZ7A 3SFEB 3R8BA 1VZ8A 2C9WB 3L10B 4HPLB 4AOFA 3N20C 1OFFA 1AWDA 2OHFA 1SB3C 3H7SA 1SJHD 3A1QA 2LZ6A 1VZ7A 4FN2A 1WJUA 1PDXA 1F2RC 1YMHE 3TJPA 1YIWA 3DQVA 3KH0A 3P4PB 3Q3OC 1WMHA 4C56C 4WJNA 1T5XD 3L08A 1WX7A 1JMLA 5G5HA 3PLUA 3DVNU 4J3OD 3DBHI 1WM3A 3PO0A 1VDVA 1L0XB 2J53A 2INCC 4ICUA 4D2KA 2JQRB 2DX5B 4P16A 1TKGA 1SE3A 3DBHB 3ZIMA 3HUIA 2A4ZA 2KTRB 3KUZA 3E9SA 1OEYJ 2G1EA 2K5PA 1V49A 1NYQA 1SE4A 1Z5SB 4HPMB 3Q14C 5KHQA 2G45B 4BOZB 3IHPC 3WA0A 2ZNVC 5D94A 4W9KA 5LXIB 2D10A 3Q8EA 2PPHA 3N32A 4MM3B 3HM3A 1V9JA 5JH5C 2GBNA 4MH8A 1OEYA 1LO5D 3JSVA 3VRAB 1E0ZA 1WMHB 2MBOA 4ZDVA 2YLMA 4PT5A 1L2NA 4M01A 4IWPA 5DPRA 4R3DA 2J42A 4LK0M 1JWMD 2JF5A 3TMPB 2V9HA 4HKZE 2N1WA 2HJ8A 2JU6X 3RNEC 2IJ0A 1ZP0B 4Q2JA 1ZXIA 4EZLA 3A9JA 3ALBA 3TCAA 3MJ5A 2NPTB 3OG5A 3RYTA 1MPEA 1CK1A 2KACA 3NY5A 1TYGB 2RPQA 1TIFA 1OQYA 2WX1A 1VR9A 1L4DB 1V2YA 2KANA 3H7PA 3MC9A 1TZOA 3AU4A 3O65B 4OVVA 2WNMA 4FJYA 2C5LC 1MG8A 2JRHA 4TQ1A 2NVUI 3DWGC 1TGZB 2QSDA 3GZNI 1E7PB 3AE3B 4K7UA 1WYWB 1IBXB 4ZRPA 2ZCBA 1XLQA 2MJ3A 2BS2B 3I57A 4G0NB 1YJJA 3GE8C 1C1YB 4KGTA 3VVWB 3FAHA 4P6VF 2LVPA 2GBKA 1XLPA 1RLFA 2ACZB 3W9CB 3H9DA 1K51A 1DYQA 3EA6A 3GP7A 1J7AA 4E74A 4NAMA 4W9HA 1WGKA 1V97A 2XK5B 4B6WA 3LB8C 4YSXB 2KXJA 4K7WA 4MH0E 4YTPB 3N30A 3T9LA 1YJ1A 4MSQB 3AEAB 1ACCA 1E10A 3NZSA 3DOWA 2DHZA 1A70A 4NQKE 4IWQA 3P2BA 2MJEA 3HM6X 1ESFA 2IO1B 3IAS1 1L5PA 3AE4B 4HVBA 3WCQA 2J4XA 2JSVX 3PRPB 4B0MA 1NVID 1QZEA 4A3OA 2Z0EB 2W54A 4MGYE 1VZ6A 2DZJA 3GZNB 3C8YA 1FXTB 1UBQA 2D3AA 3L16A 2AQ3B 3P63A 1L6UA 1RYJA 2GBRA 2IY1B 1BXTA 1WGRA 4S17A 3P4SB 1NYRA 4RGMA 3VUWA 3LJ3A 4KIKB 2KZRA 2LASA 1UNSA 1XD3B 1J7CA 2KNBA 3DCGA 2C7NB 4PS3A 3FKYA 2N9KA 3MFGA 4KZ0A 3VRBB 5CHWA 1JCKB 3RT3B 2OEDA 3EGRA 4IM2A 1AN8A 2AQ1B 3IAM1 1KJTA 3VDZA 2K8BA 1WY8A 2D07B 5G2NA 1TBEA 1SE9A 1MG4A 2JZZA 2V3NA 1E7VA 1V1PA 1ET6A 2QCZA 2C60A 3HHMA 1X1MA 3RNGC 2QHOA 3QK0A 3UINB 2MHJA 3BYTB 3NVZA 2WGSA 2WX0A 1NDDA 1HE8A 1NI2A 3U7DA 1XQQA 1HQRD 2PW9A 3W1SC 3Q3FA 4UDUC 2KWVB 1WXQA 1QT9A 1L7YA 1FRDA 1P98A 2FAZA 4RM9A 1TTNA 3NVVA 2K3UA 2PMVA 4RH6A 1RFKA 5C2TB 1K53A 4K3CA 3NVYA 3Q3NC 4K1RB 4RF1A 5G55A 4IC7B 3ZUNA 1I42A 2NBUA 3KLSX 2G3QB 2V1YA 1N60A 4JWSC 1D5MC 1AW7A 2MSED 4A8XC 4ZRIA 1J7BA 1KH0A 1DGJA 3MHZA 1WF9A 5AZFA 1MI0A 1QQRA 2ZVNA 2LUEA 2X38A 2YVCA 1B1ZA 2QILA 3VH3B 2AEHA 2KQSA 1IBXA 3RNCC 5C23A 4RGNA 1L0VB 2HE7A 4W9DA 2K8HA 1BUIC 2UU7A 4USAA 3EECA 2L52A 2FBWB 2LUMA 1KLUD 1HTOA 1N63A 3N1YC 5FR6A 3CMMB 2PVGC 4GDLB 5E6OA 4KGSA 3A4RA 2M0AA 2JWUA 3QQ8B 1TS2A 1G6JA 1OQQA 2BWFA 4HROA 3KWLA 1K50A 1GC6A 2V3PA 3APFA 2EKEC 1D4BA 2LEKA 1PGXA 2WXQA 1QKZA 4YT0B 1C77A 3TEZA 2WXHA 1XLNA 2KWUB 2KOXA 2G4SA 3UIPB 4HWIB 3CWIA 1DOIA 4B95A 2KVZA 1NENB 1WWTA 2CS4A 1FXAA 4NJ7A 2R61A 1KRHA 4F7ZA 4IG7B 1C3TA 4P1CC 4BZAA 4W9LA 3B2FA 2JY6A 1QOBA 1UGMA 2BF8B 3BVZA 1WGGA 1ZPSA 2FUHB 3U7ZA 3SEBA 3A4SC 3AN1A 3L17A 1Q0WB 3AI5A 2O6VD 4PYZA 1CQVA 4W9EA 3KWVA 1JW9D 3APCA 1WJNA 2ASQA 2WP9B 2QEJC 3VTUA 4OZBA 1S3SG 2LWPA 1FCLA 3DHIC 3NZUA 3CSTA 4LJPB 4JWUC 2LGXA 3ZKJC 2BB5A 3K9OB 3QWZB 1Q1OA 2RR9A 3ZNGC 1WR1A 1IPGA 2NPTA 1WGYA 3GS2A 3PHWB 4H2AA 4ACFA 1WRIA 1T3QA 1V5TA 1GOZA 2MJDA 3W5UB 3IT4B 2MQJA 1HZ6A 3Q8FA 2CHZA 2AQ2B 1RFAA 1P3QU 2MBBB 3UIOB 2IGGA 4MGIE 1TT5B 4NPNA 4BAXA 3AH7A 2SEBD 2KD0A 3AEBB 4AWJA 5BYQA 2LGYA 1I4RA 1ENFA 3AE7B 3NUHB 3U52E 3TSSA 1RWSA 1ZDXA 3HVDA 1WZ3A 3X23A 3OWEB 3P4RB 2D3GA 2DWQA 3UF8A 4IDIA 3Q2AC 1TS3A 3A1QB 3ZJTA 1ISNA 1YX6B 4RCOA 1AARA 2L00B 1ET9A 3RULA 1TS5A 3AM9A 3ZLZA 2O6VA 4NNJB 3H1UA 2KN4A 2K1FA 2W82A 2ZW0A 4OW0A 3PT2B 4WWPA 5J2RA 2GBMA 3QX1A 1F9JA 2FNJB 4HDOA 1JQ4A 3UI3A 4KKJA 1PFDA 4MGZE 1PGAA 2WXJA 4DHZE 1B9RA 3IVFA 1T0YA 3AB5A 1OQRA 2VH2A 1IYFA 1TY2A 3V61A 3DDCB 3WAMA 3MC0B 1YD8U 3DBRB 3LXFA 1I4GA 2M4NA 1FO4A 4PYUA 4JL9A 3BK1A 4JIOU 3RPFC 3M62B 5T8IA 2L7RA 1M94A 4AS1A 5DPSA 5C1ZA 2MEKA 4WIPA 2FUG1 4I6NB 4ZOHC 5JXVA 2IBIB 3NOBA 4A20A 1UGJA 2JYEA 1WXMA 4BKGA 1T6BX 3U4EG 1XT9B 2ZJDA 2XK5A 1L0YB 1KM7A 2R2OA 3NS8A 1NEKB 4C4VB 4ZHPA 2K9XA 3DBSA 2MRPA 1UF0A 3AMZA 4FA6A 2NTSA 4ANUA 4LCDE 2J0KA 2JZ3B 2QDFA 1Z2MA 2Q5WD 4P1BC 4BOSC 3I3TB 4HEA1 1C4AA 4DHJD 1F1HA 1WXAA 1GG3A 1N61A 3C19A 1LXDA 4KX6B 2DZIA 4FHKA 4RMAA 2BBCA 1BMLC 4WWNA 2WXOA 2WWZA 2NTTA 4DBGA 3I9V1 1HZ5A 3VAWA 3A33B 3VQIA 2DZMA 4G50A 3A9KA 1TZ1A 2L3ZA 2LMCA 2WXFA 2Z59B 4DDID 2IO2B 1PUTA 2KO3A 4N6EB 3ZDMC 4ANXA 5LLIA 3AE9B 5BO4B 1PGBA 1K52A 2JWZA 5GMVA 3IFWB 5JHBA 3SDLC 4WJPA 5HG2A 3DWMA 2G9HD 4GDLA 3U8ZA 5DPWA 2MW5A 1Y56A 4B9KA 4MELA 1WFYA 1R4MI 3L0WB 1HA5A 1EWYC 1GNUA 1RM6C 3PSEB 1GUAB 4LNNA 2MA9B 5EE3A 4XZ4A 5CTRC 3VR8B 1JRUA 1OGWA 1V86A 3MC8A 3DBRI 2OJRA 4WH4A 1Q5WB 1MFWA 1FCCC 5TR5A 2H88B 1TKEA 4RNAA 2M8SA 4KIKA 3IG3A 3JSVB 5CHVC 4WJOA 4EE2A 2V3SA 3N9YC 3EFCA 3I5JC 4ITKA 3B9JA 3KQ4A 2I1JA 4C80A 1FM0D 2NBVB 3NHEB 2WDQB 1QLBB 3V05A 2KJRA 1TS4A 1LQBA 2BGFA 4DXGA 1C78A 1H4RA 4AUQC 4E71A 1WGDA 5D2MB 3H8HA 2V0GA 1I4PA 2MBEA 2K22A 2KMAA 4ANVA 4C00A 2KMMA 2KDBA 4O1NA 2AWTA 5BMIA 4LNFA 4WAFA 5D3DA 3BK2A 3KYCD 2PKOA 2KQ4X 2Y5BB 4JLCA 1KOTA 2KC2A 2NMQA 4S0RA 5EE1A 2DYMA 2BPSA 4HCPB 1NI3A 2IZVB 3TEYA 2K6QA 3M63B 4A6QA 3HVZA 1E7UA 3X0WA 2W9NA 4KSKC 1FNVA 2WDVB 1Q10A 4YTNB 2RSUA 1H8CA 4ZHOA 5AUKA 3IBEA 2LJ5A 2INNE 4RF0A 3HIZA 1TJEA 1YN3A 1E6EB 3BZDB 1YJIA 5FR3A 1XCTL 4FLHA 4ARIA 3CSFA 2L83A 1V80A 3Q69A 3PRZA 4FADA 3J9CA 3NZ3A 5BYRA 2LGIA 2PLPA 3Q8CA 1PQSA 4BFRA 3T3OA 3O13A 4CHKA 4HJKA 4GSWA 2I38A 3ML8A 1LGRA 2ZNVB 3KUDB 3T3NA 4IWOA 4GN1A 3VTWA 4GIVA 3KVFB 4NY0A 5MPOA 2CJNA 2C7MB 1NBFC 5EE0A 4YSZB 3V6EB 1IUEA 1QOGA 4HCNB 2NS5A 1A5RA 3AU5A 1WRDB 3OLMD 4DHJB 1ZXHA 2DAFA 3ZGZA 3PPAA 4GDKA 4EKUA 4LDTB 3TEXA 4ZYSA 3SHQA 2KAJA 4LNKA 1JWAD 3B1LX 1XEEA 2K6DB 3KUCB 2N7DA 2WS3B 2UWQA 1E90A 2W55A 4TKNA 4IM3A 3WANA 3C0RB 1KLGD 2PE9A 3DBLI 1BT0A 3AV8A 4LJOB 4DQOC 4JX1C 2M17A 2KDMA 2WXNA 2PEAA 2WXKA 4A90A 2KYWA 4W9CA 2N9PC 1D5ZC 2BKFA 3ECIA 2GI9A 4B0EA 4OZCA 3FILA 3PZDA 1WYGA 2RDHA 3Q6BA 1WE6A 3ZDTA 4NJCA 4C7YA 2QJLA 2FCQA 3I63C 2N9LA 2KLGA 2GMIC 2WDTB 4PS7A 3PS6A 2JRIB 5E6JA 1CMXB 4ZYNA 1EO6A 5LNK1 1J0GA 1N5WA 1I4XA 1M4VA 1JWSD 3TBLD 2L32A 1WH3A 2BYVE 1YNTE 1C9FA 1E8ZA 2MBHA 5I4DA 2CHWA 3SR6A 3L54A 4JQWC 3R3MA 3MP9A 1I4QA 4GOCA 4ZRJA 3IXSA 2GB1A 3V6CB 4IUMB 1P7FA 1EU4A 1ZOYB 1EF1A 5D6JB 3EFUA 3GB1A 2WXRA 1XLOA 2INPE 4GLSC 2H89B 4TSSA 1ROEA 3NG0A 3VUXA 2PIAA 3M95A 4X57B 3AEGB 3ZW3A 4AQ7A 4BKTA 4L1BA 4TMAB 3D32A 4FHJA 2CR5A 1DOXA 1HXYD 3UQAA 3GE3C 2QC8A 3W1SA 4DK5A 1ZUD2 2I2YA 2ZEQA 2KVRA 2L1AA 4PS8A 2N9XA 2AL3A 2FIFA 1U4AA 1V6EA 2WXGA 2J0JA 4M0WA 4RGOS 2WXPA 3RN9C 3A9JB 2N0SB 1V1PB 1GAQB 4YSYB 2AL6A 4CYEA 1KLVA 1I4HA 4L2YA 1D5XC 4N59A 5IO9A 4F8CB 1JWUD 2BW2A 4G11A 4KKIA 3ZVVA 2XBBC 2MP2A 4A9AA 2GOWA 2ZCCA 3PREA 2JUOA 2TSSA 4MGKE 2DYBA 4N9F4 1QILA 3N3KB 1I7HA 4EUTA 2PE6B 4DXAB 2WU2B 4AP4C 4K3BA 3EUB2 2QIEB 3DVGX 2Z0DB 3BWUD 3MHSD 2Y5PA 5IN7A 1EF5A 3H6NA 1Y8RC 1UUPA 2GBJA 2M0XA 3QC8B 3Q8AA 4W9FA 4YTMB 2D2QA 1YX5B 3ETRA 2PJHA 3LDZE 3EC8A 3AE5B 1ZKHA 1R4MB 2KDIA 3TL5A 1KFYB 2K8CA 2L0TA 4QAYA 3T8MA 2K25A 4F1SA 2KFKB 1YQBA 3NS1A 2JT4B 2W3RA 1YOVB 3R2IA 2KX0A 3AEEB 2LD9A 4C4VA 5BMHA 3BY4B 4MEMA 4XDDA 4TQ0A 3SD5A 3ZNZB 2WHIA
chains in the Genus database with same CATH topology
5GMVA 2KN5A 4IM2A 4M8MA 2G4DB 3IFWB 3ZRFA 5JHBA 1E5WA 1KJTA 2CKHB 3VDZA 2K8BA 4KSLC 3GOEA 1WY8A 2D07B 1WXVA 5G2NA 3SDLC 1TBEA 4WJPA 1SE9A 2D11A 3MJWA 1SIFA 2JZZA 4GDLA 3TIXA 3U8ZA 4NJ6A 5DPWA 4MSMB 2MW5A 3PLVA 4MJSB 1E7VA 3VH4B 4B9KA 4BVUC 4MELA 2N9EB 1WFYA 1R4MI 3L0WB 2DYOA 4FJZA 4BBNC 1GNUA 3PSEB 1GUAB 1R4NI 4KVGB 2LVQA 2MA9B 4XZ4A 5CTRC 4GGQA 4KDLB 1JRUA 1OGWA 2C60A 3HHMA 1V86A 1X1MA 3VXWA 1S1QB 3DBRI 2OJRA 2QHOA 1WE7A 3QK0A 2L76A 3UINB 2NCNA 1Q5WB 3JW0X 4WQOB 2WX0A 4FJVB 1NDDA 1HE8A 2MCNB 1NI2A 1K8RB 2KHWB 3KW5B 5TR5A 3U7DA 1WXSA 3A9KB 1XQQA 4CO7A 3QA8A 2M8SA 4KIKA 3IG3A 3K9PB 2ZPYA 3JSVB 5CHVC 3W1SC 5IA7A 1ZW7A 3Q3FA 3PTFC 4WJOA 2V3SA 4MDKE 2KWVB 2I1JA 1UBIA 1L7YA 2NBVB 3NHEB 4GB9A 1IP9A 1P98A 2FAZA 4HXDA 4RM9A 1TTNA 2KJRA 1LQBA 2BGFA 3EHVA 2LXCA 2IO3B 1H4RA 4AUQC 4E71A 1WGDA 3ONSA 5D2MB 2DENB 3JVZX 4ASWC 2KDEB 3V60A 2O6VB 4HLEA 2MBEA 2KMAA 4ANVA 2KC1A 2ZPNA 4K1RB 4NAWB 5G55A 2KDBA 4IC7B 4G3XB 4MJSA 4GMVA 2AWTA 2MP2B 3ZO5B 1J8CA 3ZUNA 1I42A 2NBUA 2J0MA 1P9DU 3KYCD 3JYUA 4NAWA 2Y5BB 2EMSA 2G3QB 4JLCA 2V1YA 4AJYB 2LRWA 1KOTA 2KC2A 2KFJA 2DYMA 2IO0B 4P7IA 5CX3A 3WALA 1P1AA 2MSED 2N1VA 2BPSA 2REXA 4HCPB 5E6PA 4ZRIA 3OJ4B 2IZVB 4GU2A 1WF9A 2K6QA 2KK8A 3M63B 5AZFA 4GXBA 5J17A 1E7UA 3X0WA 2W9NA 2MBQA 4KSKC 2NBWB 2ZVNA 2LUEA 4AJWA 1LFDA 4EFOA 4BBNF 2YVCA 4J6IA 2RSUA 2ZZPB 1H8CA 3PHXB 3IBEA 3W1YA 5L95C 4NQLB 3VH3B 2I1KA 3L13A 2AEHA 2KQSA 5CHFA 5DPTA 2LJ5A 3HIZA 2DAJA 5C23A 4BKSD 4IM0A 4DDGD 1WX9A 2HE7A 4W9DA 2K8HA 4WJQA 4FLHA 4WWOA 3AXCA 4TUUA 4KV2A 3EECA 5EDSA 3RCZA 3CSFA 4URKA 1WX8A 2ZVOA 1V80A 5FR6A 2M1MA 3PRZA 2LRUA 2O2VB 4I6PA 4FADA 3CMMB 3ZRCA 4GDLB 5E6OA 1PQSA 4BFRA 3ZNHB 3A4RA 3R7QA 2BYEA 2L0FA 2IY0B 2UYZB 3B08A 4CHKA 2KQ7A 4HJKA 2KJHB 4GSWA 3ML8A 2ZNVB 2BYFA 3KUDB 3QQ8B 5AZHA 4IWOA 4A3PA 4GN1A 1G6JA 2BWFA 3VTWA 3AULA 4XC2A 2WYQA 4GIVA 2JPHA 2KMCA 3KVFB 2HD5B 2FCNA 4NY0A 1WI0A 1GC6A 3APFA 1E8XA 5E6NA 2C7MB 2EKEC 4EZKA 1NBFC 1I35A 2C7HA 1UD7A 2VRRB 3V6EB 2KWUB 2KOXA 2G4SA 4HCNB 4HWIB 2NS5A 2KKCA 3U30A 3UIPB 1A5RA 4B95A 2KTRA 4JGHB 5JHAA 3AU5A 1WRDB 3B0AA 3OLMD 4DHJB 3APDA 4TV3A 1WZ0A 2DAFA 3M3JA 4ZRKA 1LM8B 2V4LA 3PPAA 4GDKA 4EKUA 2C9WB 2KX3A 2CS4A 4LDTB 4ANWA 3SHQA 4NJ7A 5IAAC 3L10B 2FIDA 4HPLB 4AOFA 4F7ZA 3B1LX 4IG7B 1C3TA 4DHZB 5J18A 3H7SA 2K6DB 1J19A 3KUCB 3A1QA 2LZ6A 4W9LA 2JY6A 1UGMA 4FULA 2BF8B 2N7DA 1GJZA 1WGGA 4FN2A 1WJUA 2UWQA 1E90A 3UGBB 2FUHB 4TKNA 2IYDB 4IM3A 4KZCA 3VHTC 2MX2A 3WANA 3CF6E 4HDQA 5D7GA 3C0RB 2K39A 1WJ4A 2PE9A 1D3ZA 3TJPA 1YIWA 3ML9A 3DQVA 3A4SC 3KH0A 3DBLI 1BT0A 3MTNB 1ZGUB 3L17A 1Q0WB 4LJOB 3AI5A 1WMHA 2O6VD 4PYZA 2M17A 4WJNA 3L08A 4II2B 1WX7A 2PEAA 4W9EA 3PLUA 1V5OA 3DVNU 3APCA 1WJNA 2ASQA 3PGEA 4W9CA 4KDIC 2N9PC 2BKFA 3DBHI 1WM3A 5AZGA 4BKSA 3ECIA 4ICUA 2JVCA 3H7PB 4II3B 3VTUA 3ZTDA 3PZDA 3R7RA 2DX5B 1S3SG 2LWPA 5L83A 1WE6A 5JZEB 3ZDTA 3PRMB 3ZIMA 3DPDA 2A4ZA 2KTRB 3KUZA 3NZUA 2NR2A 4HK2A 3CSTA 4LJPB 1OEYJ 1VCBA 2LGXA 2LXAA 1V49A 4K7SA 3RD2A 3ZKJC 5HKHA 2FCQA 3K9OB 3QWZB 1Q1OA 2KLGA 2GMIC 2WDTB 1Z5SB 2RR9A 4HPMB 4GDKB 1WR1A 3ZNGC 1IPGA 1E8WA 4PS7A 3PS6A 1GC7A 2L8JA 2NPTA 2N7EA 2JRIB 3QJZA 1CMXB 4ZYNA 1WGYA 5KHQA 1EO6A 3PHWB 1WM2A 2G45B 1J0GA 5DCNA 3WIMA 4BOZB 3IHPC 1V5TA 3SU8X 3WA0A 2ZNVC 1WGHA 1WJ6A 4IW0A 2MQJA 2DZKA 2KDFB 4OVUA 5D94A 3TBLD 4W9KA 2CHZA 5LXIB 2D10A 3DVGY 1RFAA 1RRBA 1WH3A 2PPHA 2BYVE 5AEKB 2A5UA 4ICVA 3N32A 1P3QU 2MBBB 3HM3A 3UIOB 1V9JA 4MGIE 5JH5C 2GBNA 3QAQA 4FBJB 3BINA 1E8ZA 4NPNA 1OEYA 3QCAA 3ZNID 3JSVA 2KD0A 2MBHA 2R2QA 3QIJA 1WMHB 2CHWA 4AWJA 3L54A 2AYOB 2LGYA 3RUIB 2MBOA 4JQWC 2J7QB 3R3MA 4GOCA 4ZRJA 2FCMA 4ZDVA 3V6CB 3RZWC 2YLMA 2KWCA 1L2NA 4IUMB 4IWPA 5DPRA 1WZ3A 3VFKA 3X23A 1EF1A 2JF5A 3TMPB 5D6JB 3EFUA 2N1WA 2HJ8A 2D3GA 3UF8A 4EZJA 3A1QB 3S2AA 3VTVA 5LXHA 1ISNA 4EZLA 3A9JA 1YX6B 3KYDD 3ENEA 3ALBA 3TCAA 3QARA 1WR6E 1AARA 3VUYA 2NPTB 3RYTA 2L00B 3VUXA 3RULA 2KLCA 3M95A 2L05A 4X57B 3ZLZA 2O6VA 4NNJB 3NY5A 3H1UA 2K1FA 2RPQA 1OQYA 2WX1A 3R66C 3OJ3A 4YL8A 3ZW3A 1OTRB 4BKTA 3WAPA 3PT2B 4WWPA 3D32A 4FHJA 5J2RA 2CR5A 1V2YA 2GBMA 3QX1A 1F9JA 4I6LB 2FNJB 2KANA 2BWES 1V81A 4HDOA 3H7PA 3UQAA 3AU4A 4MGZE 3O65B 4OVVA 3W1SA 4FJYA 2C5LC 1MG8A 4XX5A 3V62A 4DHZE 2JRHA 3IVFA 4TQ1A 1T0YA 4DK5A 2ZEQA 2NVUI 2KVRA 1TGZB 1IYFA 3GZNI 4PS8A 2N9XA 2B3AA 2XEWA 1WYWB 3DDCB 4K7UA 3V61A 3WAMA 2ZCBA 4K81A 2AL3A 1YD8U 2FIFA 1U4AA 4G0NB 1C1YB 3VVWB 1V6EA 2HTHA 2M4NA 1P0RA 2J0JA 4PYUA 4JL9A 2LVPA 2GBKA 3A9JB 4JIOU 1RLFA 2O2VA 3M62B 1UZXB 2AL6A 4CYEA 2L7RA 1KLVA 2MLBA 4E3CA 3H9DA 1M94A 4F8CB 4MM3A 5DPSA 4EOYA 4E74A 4RM8A 4W9HA 5C1ZA 4G11A 1WIAA 3QHTA 3ZVVA 2XBBC 2MP2A 2XK5B 2GOWA 4I6NB 2ZCCA 2IBIB 2KFKA 3NOBA 4A20A 4B6WA 2OOBB 3PREA 2JUOA 2KXJA 1WXMA 4K7WA 4MH0E 4MGKE 4BKGA 2FCSA 2DYBA 4DWFA 1UH6A 1XT9B 2ZJDA 3ZTCA 4N9F4 2XK5A 3N30A 3N3KB 2LI5A 1KM7A 3T9LA 2R2OA 1YJ1A 4MSQB 2KJ6A 3RZFA 3NS8A 4EUTA 2PE6B 4W9IA 4DXAB 2LGDA 3DBSA 2MRPA 2CU1A 3NZSA 4AP4C 4FA6A 3DOWA 2DHZA 4ANUA 4LCDE 3DVGX 2RD0A 2J0KA 2Z0DB 2MWSB 4LDTD 3DVNV 4NQKE 3UQBA 2JZ3B 2RGFA 3MHSD 4IWQA 3P2BA 1Z2MA 1EF5A 3HM6X 4M0WB 3H6NA 4M8NA 4BOSC 1Y8RC 2GBJA 2M0XA 3I3TB 3QC8B 2IO1B 1VD2A 4DHJD 4W9FA 4EEWA 3WAOA 2D2QA 4HVBA 1YX5B 1WXAA 4WAAA 2BKRB 2PJHA 4W9JA 3PRPB 1GG3A 3LDZE 1LXDA 4W9GA 3OAWA 2LVOA 2DZIA 1QZEA 3EC8A 4A3OA 4FHKA 2CHXA 2Z0EB 4MGYE 1ZKHA 2DZJA 1RAXA 2KDIA 4RMAA 4WWNA 3TL5A 1FXTB 2JXXA 1UBQA 5KHOA 2WWZA 2K8CA 2L0TA 3L16A 4DBGA 3T8MA 2K25A 3A33B 3VAWA 3VQIA 2DZMA 4F1SA 2KFKB 1YQBA 4G50A 2GBRA 2IY1B 3A9KA 3PVLA 3Q3JA 2JT4B 1TZ1A 1WGRA 2L3ZA 3VUWA 3LJ3A 2KTFA 4KIKB 3HK0A 2EMTA 2Z59B 4DDID 2IO2B 1UELA 2KX0A 1EUVB 2KO3A 2KZRA 2LASA 1XD3B 2KNBA 3DCGA 3ZDMC 2LD9A 5LLIA 4ANXA 2C7NB 4PS3A 4KZ0A 5CHWA 3BY4B 4MEMA 3RT3B 1SGHA 2N4FA 4TQ0A 5BO4B 3SD5A 3PV1A 1E8YA 3ZNZB 2JWZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GMV A;  2KN5 A;  4IM2 A;  4M8M A;  2G4D B;  3IFW B;  3ZRF A;  5JHB A;  1E5W A;  1KJT A;  2CKH B;  3VDZ A;  2K8B A;  4KSL C;  3GOE A;  1WY8 A;  2D07 B;  1WXV A;  5G2N A;  3SDL C;  1TBE A;  4WJP A;  1SE9 A;  2D11 A;  3MJW A;  1SIF A;  2JZZ A;  4GDL A;  3TIX A;  3U8Z A;  4NJ6 A;  5DPW A;  4MSM B;  2MW5 A;  3PLV A;  4MJS B;  1E7V A;  3VH4 B;  4B9K A;  4BVU C;  4MEL A;  2N9E B;  1WFY A;  1R4M I;  3L0W B;  2DYO A;  4FJZ A;  4BBN C;  1GNU A;  3PSE B;  1GUA B;  1R4N I;  4KVG B;  2LVQ A;  2MA9 B;  4XZ4 A;  5CTR C;  4GGQ A;  4KDL B;  1JRU A;  1OGW A;  2C60 A;  3HHM A;  1V86 A;  1X1M A;  3VXW A;  1S1Q B;  3DBR I;  2OJR A;  2QHO A;  1WE7 A;  3QK0 A;  2L76 A;  3UIN B;  2NCN A;  1Q5W B;  3JW0 X;  4WQO B;  2WX0 A;  4FJV B;  1NDD A;  1HE8 A;  2MCN B;  1NI2 A;  1K8R B;  2KHW B;  3KW5 B;  5TR5 A;  3U7D A;  1WXS A;  3A9K B;  1XQQ A;  4CO7 A;  3QA8 A;  2M8S A;  4KIK A;  3IG3 A;  3K9P B;  2ZPY A;  3JSV B;  5CHV C;  3W1S C;  5IA7 A;  1ZW7 A;  3Q3F A;  3PTF C;  4WJO A;  2V3S A;  4MDK E;  2KWV B;  2I1J A;  1UBI A;  1L7Y A;  2NBV B;  3NHE B;  4GB9 A;  1IP9 A;  1P98 A;  2FAZ A;  4HXD A;  4RM9 A;  1TTN A;  2KJR A;  1LQB A;  2BGF A;  3EHV A;  2LXC A;  2IO3 B;  1H4R A;  4AUQ C;  4E71 A;  1WGD A;  3ONS A;  5D2M B;  2DEN B;  3JVZ X;  4ASW C;  2KDE B;  3V60 A;  2O6V B;  4HLE A;  2MBE A;  2KMA A;  4ANV A;  2KC1 A;  2ZPN A;  4K1R B;  4NAW B;  5G55 A;  2KDB A;  4IC7 B;  4G3X B;  4MJS A;  4GMV A;  2AWT A;  2MP2 B;  3ZO5 B;  1J8C A;  3ZUN A;  1I42 A;  2NBU A;  2J0M A;  1P9D U;  3KYC D;  3JYU A;  4NAW A;  2Y5B B;  2EMS A;  2G3Q B;  4JLC A;  2V1Y A;  4AJY B;  2LRW A;  1KOT A;  2KC2 A;  2KFJ A;  2DYM A;  2IO0 B;  4P7I A;  5CX3 A;  3WAL A;  1P1A A;  2MSE D;  2N1V A;  2BPS A;  2REX A;  4HCP B;  5E6P A;  4ZRI A;  3OJ4 B;  2IZV B;  4GU2 A;  1WF9 A;  2K6Q A;  2KK8 A;  3M63 B;  5AZF A;  4GXB A;  5J17 A;  1E7U A;  3X0W A;  2W9N A;  2MBQ A;  4KSK C;  2NBW B;  2ZVN A;  2LUE A;  4AJW A;  1LFD A;  4EFO A;  4BBN F;  2YVC A;  4J6I A;  2RSU A;  2ZZP B;  1H8C A;  3PHX B;  3IBE A;  3W1Y A;  5L95 C;  4NQL B;  3VH3 B;  2I1K A;  3L13 A;  2AEH A;  2KQS A;  5CHF A;  5DPT A;  2LJ5 A;  3HIZ A;  2DAJ A;  5C23 A;  4BKS D;  4IM0 A;  4DDG D;  1WX9 A;  2HE7 A;  4W9D A;  2K8H A;  4WJQ A;  4FLH A;  4WWO A;  3AXC A;  4TUU A;  4KV2 A;  3EEC A;  5EDS A;  3RCZ A;  3CSF A;  4URK A;  1WX8 A;  2ZVO A;  1V80 A;  5FR6 A;  2M1M A;  3PRZ A;  2LRU A;  2O2V B;  4I6P A;  4FAD A;  3CMM B;  3ZRC A;  4GDL B;  5E6O A;  1PQS A;  4BFR A;  3ZNH B;  3A4R A;  3R7Q A;  2BYE A;  2L0F A;  2IY0 B;  2UYZ B;  3B08 A;  4CHK A;  2KQ7 A;  4HJK A;  2KJH B;  4GSW A;  3ML8 A;  2ZNV B;  2BYF A;  3KUD B;  3QQ8 B;  5AZH A;  4IWO A;  4A3P A;  4GN1 A;  1G6J A;  2BWF A;  3VTW A;  3AUL A;  4XC2 A;  2WYQ A;  4GIV A;  2JPH A;  2KMC A;  3KVF B;  2HD5 B;  2FCN A;  4NY0 A;  1WI0 A;  1GC6 A;  3APF A;  1E8X A;  5E6N A;  2C7M B;  2EKE C;  4EZK A;  1NBF C;  1I35 A;  2C7H A;  1UD7 A;  2VRR B;  3V6E B;  2KWU B;  2KOX A;  2G4S A;  4HCN B;  4HWI B;  2NS5 A;  2KKC A;  3U30 A;  3UIP B;  1A5R A;  4B95 A;  2KTR A;  4JGH B;  5JHA A;  3AU5 A;  1WRD B;  3B0A A;  3OLM D;  4DHJ B;  3APD A;  4TV3 A;  1WZ0 A;  2DAF A;  3M3J A;  4ZRK A;  1LM8 B;  2V4L A;  3PPA A;  4GDK A;  4EKU A;  2C9W B;  2KX3 A;  2CS4 A;  4LDT B;  4ANW A;  3SHQ A;  4NJ7 A;  5IAA C;  3L10 B;  2FID A;  4HPL B;  4AOF A;  4F7Z A;  3B1L X;  4IG7 B;  1C3T A;  4DHZ B;  5J18 A;  3H7S A;  2K6D B;  1J19 A;  3KUC B;  3A1Q A;  2LZ6 A;  4W9L A;  2JY6 A;  1UGM A;  4FUL A;  2BF8 B;  2N7D A;  1GJZ A;  1WGG A;  4FN2 A;  1WJU A;  2UWQ A;  1E90 A;  3UGB B;  2FUH B;  4TKN A;  2IYD B;  4IM3 A;  4KZC A;  3VHT C;  2MX2 A;  3WAN A;  3CF6 E;  4HDQ A;  5D7G A;  3C0R B;  2K39 A;  1WJ4 A;  2PE9 A;  1D3Z A;  3TJP A;  1YIW A;  3ML9 A;  3DQV A;  3A4S C;  3KH0 A;  3DBL I;  1BT0 A;  3MTN B;  1ZGU B;  3L17 A;  1Q0W B;  4LJO B;  3AI5 A;  1WMH A;  2O6V D;  4PYZ A;  2M17 A;  4WJN A;  3L08 A;  4II2 B;  1WX7 A;  2PEA A;  4W9E A;  3PLU A;  1V5O A;  3DVN U;  3APC A;  1WJN A;  2ASQ A;  3PGE A;  4W9C A;  4KDI C;  2N9P C;  2BKF A;  3DBH I;  1WM3 A;  5AZG A;  4BKS A;  3ECI A;  4ICU A;  2JVC A;  3H7P B;  4II3 B;  3VTU A;  3ZTD A;  3PZD A;  3R7R A;  2DX5 B;  1S3S G;  2LWP A;  5L83 A;  1WE6 A;  5JZE B;  3ZDT A;  3PRM B;  3ZIM A;  3DPD A;  2A4Z A;  2KTR B;  3KUZ A;  3NZU A;  2NR2 A;  4HK2 A;  3CST A;  4LJP B;  1OEY J;  1VCB A;  2LGX A;  2LXA A;  1V49 A;  4K7S A;  3RD2 A;  3ZKJ C;  5HKH A;  2FCQ A;  3K9O B;  3QWZ B;  1Q1O A;  2KLG A;  2GMI C;  2WDT B;  1Z5S B;  2RR9 A;  4HPM B;  4GDK B;  1WR1 A;  3ZNG C;  1IPG A;  1E8W A;  4PS7 A;  3PS6 A;  1GC7 A;  2L8J A;  2NPT A;  2N7E A;  2JRI B;  3QJZ A;  1CMX B;  4ZYN A;  1WGY A;  5KHQ A;  1EO6 A;  3PHW B;  1WM2 A;  2G45 B;  1J0G A;  5DCN A;  3WIM A;  4BOZ B;  3IHP C;  1V5T A;  3SU8 X;  3WA0 A;  2ZNV C;  1WGH A;  1WJ6 A;  4IW0 A;  2MQJ A;  2DZK A;  2KDF B;  4OVU A;  5D94 A;  3TBL D;  4W9K A;  2CHZ A;  5LXI B;  2D10 A;  3DVG Y;  1RFA A;  1RRB A;  1WH3 A;  2PPH A;  2BYV E;  5AEK B;  2A5U A;  4ICV A;  3N32 A;  1P3Q U;  2MBB B;  3HM3 A;  3UIO B;  1V9J A;  4MGI E;  5JH5 C;  2GBN A;  3QAQ A;  4FBJ B;  3BIN A;  1E8Z A;  4NPN A;  1OEY A;  3QCA A;  3ZNI D;  3JSV A;  2KD0 A;  2MBH A;  2R2Q A;  3QIJ A;  1WMH B;  2CHW A;  4AWJ A;  3L54 A;  2AYO B;  2LGY A;  3RUI B;  2MBO A;  4JQW C;  2J7Q B;  3R3M A;  4GOC A;  4ZRJ A;  2FCM A;  4ZDV A;  3V6C B;  3RZW C;  2YLM A;  2KWC A;  1L2N A;  4IUM B;  4IWP A;  5DPR A;  1WZ3 A;  3VFK A;  3X23 A;  1EF1 A;  2JF5 A;  3TMP B;  5D6J B;  3EFU A;  2N1W A;  2HJ8 A;  2D3G A;  3UF8 A;  4EZJ A;  3A1Q B;  3S2A A;  3VTV A;  5LXH A;  1ISN A;  4EZL A;  3A9J A;  1YX6 B;  3KYD D;  3ENE A;  3ALB A;  3TCA A;  3QAR A;  1WR6 E;  1AAR A;  3VUY A;  2NPT B;  3RYT A;  2L00 B;  3VUX A;  3RUL A;  2KLC A;  3M95 A;  2L05 A;  4X57 B;  3ZLZ A;  2O6V A;  4NNJ B;  3NY5 A;  3H1U A;  2K1F A;  2RPQ A;  1OQY A;  2WX1 A;  3R66 C;  3OJ3 A;  4YL8 A;  3ZW3 A;  1OTR B;  4BKT A;  3WAP A;  3PT2 B;  4WWP A;  3D32 A;  4FHJ A;  5J2R A;  2CR5 A;  1V2Y A;  2GBM A;  3QX1 A;  1F9J A;  4I6L B;  2FNJ B;  2KAN A;  2BWE S;  1V81 A;  4HDO A;  3H7P A;  3UQA A;  3AU4 A;  4MGZ E;  3O65 B;  4OVV A;  3W1S A;  4FJY A;  2C5L C;  1MG8 A;  4XX5 A;  3V62 A;  4DHZ E;  2JRH A;  3IVF A;  4TQ1 A;  1T0Y A;  4DK5 A;  2ZEQ A;  2NVU I;  2KVR A;  1TGZ B;  1IYF A;  3GZN I;  4PS8 A;  2N9X A;  2B3A A;  2XEW A;  1WYW B;  3DDC B;  4K7U A;  3V61 A;  3WAM A;  2ZCB A;  4K81 A;  2AL3 A;  1YD8 U;  2FIF A;  1U4A A;  4G0N B;  1C1Y B;  3VVW B;  1V6E A;  2HTH A;  2M4N A;  1P0R A;  2J0J A;  4PYU A;  4JL9 A;  2LVP A;  2GBK A;  3A9J B;  4JIO U;  1RLF A;  2O2V A;  3M62 B;  1UZX B;  2AL6 A;  4CYE A;  2L7R A;  1KLV A;  2MLB A;  4E3C A;  3H9D A;  1M94 A;  4F8C B;  4MM3 A;  5DPS A;  4EOY A;  4E74 A;  4RM8 A;  4W9H A;  5C1Z A;  4G11 A;  1WIA A;  3QHT A;  3ZVV A;  2XBB C;  2MP2 A;  2XK5 B;  2GOW A;  4I6N B;  2ZCC A;  2IBI B;  2KFK A;  3NOB A;  4A20 A;  4B6W A;  2OOB B;  3PRE A;  2JUO A;  2KXJ A;  1WXM A;  4K7W A;  4MH0 E;  4MGK E;  4BKG A;  2FCS A;  2DYB A;  4DWF A;  1UH6 A;  1XT9 B;  2ZJD A;  3ZTC A;  4N9F 4;  2XK5 A;  3N30 A;  3N3K B;  2LI5 A;  1KM7 A;  3T9L A;  2R2O A;  1YJ1 A;  4MSQ B;  2KJ6 A;  3RZF A;  3NS8 A;  4EUT A;  2PE6 B;  4W9I A;  4DXA B;  2LGD A;  3DBS A;  2MRP A;  2CU1 A;  3NZS A;  4AP4 C;  4FA6 A;  3DOW A;  2DHZ A;  4ANU A;  4LCD E;  3DVG X;  2RD0 A;  2J0K A;  2Z0D B;  2MWS B;  4LDT D;  3DVN V;  4NQK E;  3UQB A;  2JZ3 B;  2RGF A;  3MHS D;  4IWQ A;  3P2B A;  1Z2M A;  1EF5 A;  3HM6 X;  4M0W B;  3H6N A;  4M8N A;  4BOS C;  1Y8R C;  2GBJ A;  2M0X A;  3I3T B;  3QC8 B;  2IO1 B;  1VD2 A;  4DHJ D;  4W9F A;  4EEW A;  3WAO A;  2D2Q A;  4HVB A;  1YX5 B;  1WXA A;  4WAA A;  2BKR B;  2PJH A;  4W9J A;  3PRP B;  1GG3 A;  3LDZ E;  1LXD A;  4W9G A;  3OAW A;  2LVO A;  2DZI A;  1QZE A;  3EC8 A;  4A3O A;  4FHK A;  2CHX A;  2Z0E B;  4MGY E;  1ZKH A;  2DZJ A;  1RAX A;  2KDI A;  4RMA A;  4WWN A;  3TL5 A;  1FXT B;  2JXX A;  1UBQ A;  5KHO A;  2WWZ A;  2K8C A;  2L0T A;  3L16 A;  4DBG A;  3T8M A;  2K25 A;  3A33 B;  3VAW A;  3VQI A;  2DZM A;  4F1S A;  2KFK B;  1YQB A;  4G50 A;  2GBR A;  2IY1 B;  3A9K A;  3PVL A;  3Q3J A;  2JT4 B;  1TZ1 A;  1WGR A;  2L3Z A;  3VUW A;  3LJ3 A;  2KTF A;  4KIK B;  3HK0 A;  2EMT A;  2Z59 B;  4DDI D;  2IO2 B;  1UEL A;  2KX0 A;  1EUV B;  2KO3 A;  2KZR A;  2LAS A;  1XD3 B;  2KNB A;  3DCG A;  3ZDM C;  2LD9 A;  5LLI A;  4ANX A;  2C7N B;  4PS3 A;  4KZ0 A;  5CHW A;  3BY4 B;  4MEM A;  3RT3 B;  1SGH A;  2N4F A;  4TQ0 A;  5BO4 B;  3SD5 A;  3PV1 A;  1E8Y A;  3ZNZ B;  2JWZ A; 
#chains in the Genus database with same CATH topology
 2KN5 A;  4M8M A;  2BYT A;  2G4D B;  1E5W A;  1C76 A;  4RGT A;  3MJW A;  1SIF A;  4N58 A;  4YWG G;  2AX5 A;  4NJ6 A;  3VR9 B;  2RDG A;  4MSM B;  3PLV A;  4MJS B;  3VH4 B;  4FBJ B;  2N9E B;  2DYO A;  4BBN C;  3AE2 B;  1R4N I;  1T0S C;  5GXG B;  2LVQ A;  1XF5 L;  2EEL A;  3VXW A;  4OVZ A;  1YQ4 B;  2L76 A;  2NCN A;  3JW0 X;  2RMM A;  3L4P A;  2IDY A;  2D5G A;  2MCN B;  3KW5 B;  3A9K B;  2LGS A;  5IOI A;  3QA8 A;  3W2D A;  1QOA A;  2ZPY A;  1GB1 A;  1ZDV A;  5IA7 A;  1QF6 A;  5H8Y E;  1MVK A;  4MDK E;  4LNO A;  5FKA C;  1KTK A;  4OZA A;  3EHV A;  2IO3 B;  1L6V A;  3ONS A;  2DEN B;  4MAC A;  3JVZ X;  4ASW C;  2KDE B;  2O6V B;  4HPP A;  2VZK D;  2Y3A A;  2KC1 A;  4NAW B;  2FE8 A;  1IGD A;  3W5V B;  4GMV A;  2MP2 B;  3ZO5 B;  1J8C A;  3PZ8 A;  2J0M A;  3JYU A;  1XO3 A;  4NZL B;  2B76 B;  2WLB A;  2LRW A;  2KFJ A;  3U2S C;  3N1X C;  5CX3 A;  2X8X X;  5E6P A;  1FFV A;  1PYW D;  3OJ4 B;  4OHJ A;  3IT6 B;  2BB6 A;  5J17 A;  4RFB A;  4IKG A;  2NBW B;  2K0P A;  1LFD A;  4EFO A;  4BBN F;  2J52 A;  4J6I A;  4NQL B;  2I1K A;  3L13 A;  4LTU A;  5CHF A;  3ZYY X;  2VZK B;  1FPY A;  1DOY A;  2HDE A;  1WX9 A;  3SFD B;  4TUU A;  4LLG M;  5EDS A;  2OJW A;  4URK A;  1WX8 A;  2LRU A;  2O2V B;  1JWB D;  1V1O A;  2JYT A;  3ZNH B;  3R7Q A;  2BYE A;  2WU5 B;  2LFI A;  2IY0 B;  2UYZ B;  3B08 A;  3BVG A;  5BMG A;  2BYF A;  4A3P A;  5H92 C;  3AUL A;  4MT5 A;  2JPH A;  2KMC A;  2WDR B;  2FCN A;  1WI0 A;  1E8X A;  4EZK A;  3RMK C;  1T0R C;  3FIL B;  4XE0 A;  1UD7 A;  2ON8 A;  2KKC A;  1FXI A;  5JHA A;  2KTR A;  1JRP A;  2D3C A;  1F2R I;  3APD A;  4TV3 A;  1WZ0 A;  1L4Z B;  1D6E C;  3M3J A;  4ZRK A;  3B2G A;  1QOF A;  5BYS A;  2KX3 A;  4DXF A;  1SE2 A;  4ANW A;  1SF0 A;  5IAA C;  2FID A;  4ZRQ A;  1FMA D;  4DHZ B;  5J18 A;  1J19 A;  1EU3 A;  2D3B A;  4FUL A;  3FC4 A;  1GJZ A;  1T0Q C;  3UGB B;  1MJD A;  2IYD B;  4KZC A;  3VHT C;  2MX2 A;  3CF6 E;  4HDQ A;  5D7G A;  2BT6 A;  1WJ4 A;  2K39 A;  1D3Z A;  1FNW A;  3ML9 A;  1YN4 A;  1R7S A;  3TUO A;  3MTN B;  1VRA B;  1ZGU B;  2RPV A;  1E9M A;  3LYY A;  4II2 B;  1F0Z A;  2V4I B;  1V5O A;  3PGE A;  2DNF A;  4KDI C;  1EWC A;  2N7J A;  1SIJ A;  2Y5C A;  5AZG A;  1VLB A;  4BKS A;  4II3 B;  2JVC A;  3AEC B;  3H7P B;  3ZTD A;  3R7R A;  2LHE A;  5L83 A;  5JZE B;  2LJI A;  3PRM B;  3DPD A;  3AE8 B;  3RNB C;  4HK2 A;  1HTQ A;  2NR2 A;  2IGD A;  1VCB A;  4K7S A;  2LXA A;  3RD2 A;  3DHG C;  5HKH A;  3R2T A;  1XCQ L;  4WQM A;  4GDK B;  1E8W A;  1GC7 A;  2L8J A;  4YXD B;  2BS4 B;  2N7E A;  1SSN A;  3QJZ A;  1WM2 A;  3NJT A;  5DCN A;  3WIM A;  3SU8 X;  3NVW A;  1WGH A;  1WJ6 A;  4IW0 A;  2DZK A;  2KDF B;  3P1M A;  4HJG E;  4OVU A;  1GB4 A;  2E6X A;  2WXI A;  3DVG Y;  5AEK B;  1RRB A;  1FIQ A;  2A5U A;  4ICV A;  1UWX A;  4XDC A;  3QAQ A;  3BIN A;  4IOI E;  1SEB D;  5HFY A;  1YN5 A;  2PVO D;  3QCA A;  3Q3M C;  3ZNI D;  2IND C;  2R2Q A;  3QIJ A;  1SJE D;  2AYO B;  5HHD G;  3RUI B;  1SXT A;  2J7Q B;  2YEP F;  2FCM A;  3RZW C;  2KWC A;  1R4N B;  2ONQ A;  3VFK A;  2ICI A;  2KWD A;  1FNU A;  2BS3 B;  3NRZ A;  1CJE A;  4EZJ A;  3S2A A;  2KT7 A;  3VTV A;  5LXH A;  3KYD D;  3ENE A;  3QAR A;  1WR6 E;  3VUY A;  2IPK D;  2KLC A;  2L05 A;  1V8C A;  3R66 C;  4YL8 A;  3OJ3 A;  2GRI A;  1OTR B;  3WAP A;  1WSP A;  1YQ3 B;  2QMT A;  1FRR A;  4CQN A;  2HTM E;  4I6L B;  2BWE S;  1V81 A;  3V62 A;  1MHX A;  4XX5 A;  3ZJU A;  1EM7 A;  2XEW A;  2B3A A;  4K81 A;  3ZXV A;  4XGA B;  2HTH A;  1P0R A;  5FK9 C;  2O2V A;  4WWM A;  1UZX B;  4C7Z A;  1TY0 A;  4M00 A;  2MLB A;  4E3C A;  5G5G A;  4MM3 A;  4EOY A;  4RM8 A;  1WIA A;  3QHT A;  4REZ A;  2KFK A;  2OOB B;  4A55 A;  2FCS A;  2JX5 A;  4FXC A;  4DWF A;  1UH6 A;  3ZTC A;  2WXL A;  2BTE A;  4PK1 A;  2LI5 A;  5EE9 A;  2KJ6 A;  5IKC M;  3RZF A;  2DBY A;  4W9I A;  2LGD A;  4XWT A;  2CU1 A;  2SAK A;  2RD0 A;  3Q8B A;  2MWS B;  2CJO A;  3DVN V;  3AE6 B;  4LDT D;  2RGF A;  1TKY A;  3UQB A;  4JPS A;  3P42 A;  4M0W B;  4M8N A;  2M56 B;  1VD2 A;  2BQQ A;  4EEW A;  3WAO A;  2WQY B;  1SBB B;  3ABV B;  4WAA A;  2BKR B;  3ZQ4 A;  4W9J A;  4W9G A;  1FEH A;  2LVO A;  1CZP A;  3OAW A;  4M02 A;  2CHX A;  1RAX A;  2JXX A;  5KHO A;  3Q3J A;  1C4C A;  3PVL A;  3ZXR A;  4LNI A;  1GPX A;  3ZJV A;  2KTF A;  3HK0 A;  2EMT A;  3HRD D;  1UEL A;  1EUV B;  3URY A;  4US8 A;  1SGH A;  5IP4 D;  2N4F A;  3PV1 A;  1E8Y A;  3BYY B;  3ZRF A;  1FFU A;  2CKH B;  4KSL C;  3GOE A;  1WXV A;  4WUR A;  2D11 A;  4XYC A;  5AUI A;  2PTL A;  3TIX A;  4BVU C;  4HKQ A;  4FJZ A;  4KVG B;  1FD6 A;  2JXT A;  1JAL A;  4GGQ A;  4KDL B;  1S1Q B;  1WE7 A;  3DBL B;  4WQO B;  4FJV B;  1K8R B;  2KHW B;  1WXS A;  1XXG A;  4CO7 A;  3K9P B;  1ZW7 A;  2HJ1 A;  3PTF C;  2E3T A;  3RI7 C;  2W3S A;  1UBI A;  2XNA C;  4GB9 A;  1IP9 A;  3DHH C;  4HXD A;  1KF6 B;  2LXC A;  2IGH A;  5D3I B;  3CIR B;  1STE A;  3V60 A;  4HLE A;  2ZW1 A;  2ZPN A;  4G3X B;  4ARC A;  4MJS A;  3V3X A;  4HRS A;  1P9D U;  2M19 A;  1F52 A;  5C3J B;  4NAW A;  1F77 A;  2EMS A;  4AJY B;  3RFZ B;  2JZP A;  3N1Z C;  2IO0 B;  4P7I A;  3WAL A;  1P1A A;  2N1V A;  2REX A;  3AEF B;  3RNF C;  1JRO A;  4GU2 A;  2KK8 A;  4GXB A;  1N62 A;  4JE3 B;  2MBQ A;  1C79 A;  1VJK A;  2VH1 A;  4AJW A;  1N5X A;  2XN9 C;  2ZZP B;  3PHX B;  5TSS A;  3W1Y A;  5L95 C;  1ZE3 D;  5HI1 A;  3E56 A;  5DPT A;  3BII D;  4KGR A;  4US9 A;  2LHD A;  2DAJ A;  4DDG D;  4BKS D;  4IM0 A;  3P4Q B;  3AE1 B;  1MHH E;  1UWM A;  2RDB C;  2WXM A;  4WJQ A;  1C4P A;  4WWO A;  3AXC A;  4KV2 A;  2BVC A;  2CU3 A;  3RCZ A;  1HEZ E;  2ZVO A;  1N6Z A;  2M1M A;  4I6P A;  3ZRC A;  3RNA C;  1P7E A;  3AED B;  2L0F A;  3BVM A;  3TEW A;  2KQ7 A;  4XWW A;  2KJH B;  2EKI A;  5AZH A;  2YEP B;  2Z8L A;  4XC2 A;  2WYQ A;  2MH7 A;  2HD5 B;  5E6N A;  2GLS A;  1I35 A;  2C7H A;  2VRR B;  1IGC A;  3U30 A;  4JGH B;  1AYF A;  3B0A A;  4L23 A;  2DLB A;  1LM8 B;  2V4L A;  3PZ7 A;  3SFE B;  3R8B A;  1VZ8 A;  2C9W B;  3L10 B;  4HPL B;  4AOF A;  3N20 C;  1OFF A;  1AWD A;  2OHF A;  1SB3 C;  3H7S A;  1SJH D;  3A1Q A;  2LZ6 A;  1VZ7 A;  4FN2 A;  1WJU A;  1PDX A;  1F2R C;  1YMH E;  3TJP A;  1YIW A;  3DQV A;  3KH0 A;  3P4P B;  3Q3O C;  1WMH A;  4C56 C;  4WJN A;  1T5X D;  3L08 A;  1WX7 A;  1JML A;  5G5H A;  3PLU A;  3DVN U;  4J3O D;  3DBH I;  1WM3 A;  3PO0 A;  1VDV A;  1L0X B;  2J53 A;  2INC C;  4ICU A;  4D2K A;  2JQR B;  2DX5 B;  4P16 A;  1TKG A;  1SE3 A;  3DBH B;  3ZIM A;  3HUI A;  2A4Z A;  2KTR B;  3KUZ A;  3E9S A;  1OEY J;  2G1E A;  2K5P A;  1V49 A;  1NYQ A;  1SE4 A;  1Z5S B;  4HPM B;  3Q14 C;  5KHQ A;  2G45 B;  4BOZ B;  3IHP C;  3WA0 A;  2ZNV C;  5D94 A;  4W9K A;  5LXI B;  2D10 A;  3Q8E A;  2PPH A;  3N32 A;  4MM3 B;  3HM3 A;  1V9J A;  5JH5 C;  2GBN A;  4MH8 A;  1OEY A;  1LO5 D;  3JSV A;  3VRA B;  1E0Z A;  1WMH B;  2MBO A;  4ZDV A;  2YLM A;  4PT5 A;  1L2N A;  4M01 A;  4IWP A;  5DPR A;  4R3D A;  2J42 A;  4LK0 M;  1JWM D;  2JF5 A;  3TMP B;  2V9H A;  4HKZ E;  2N1W A;  2HJ8 A;  2JU6 X;  3RNE C;  2IJ0 A;  1ZP0 B;  4Q2J A;  1ZXI A;  4EZL A;  3A9J A;  3ALB A;  3TCA A;  3MJ5 A;  2NPT B;  3OG5 A;  3RYT A;  1MPE A;  1CK1 A;  2KAC A;  3NY5 A;  1TYG B;  2RPQ A;  1TIF A;  1OQY A;  2WX1 A;  1VR9 A;  1L4D B;  1V2Y A;  2KAN A;  3H7P A;  3MC9 A;  1TZO A;  3AU4 A;  3O65 B;  4OVV A;  2WNM A;  4FJY A;  2C5L C;  1MG8 A;  2JRH A;  4TQ1 A;  2NVU I;  3DWG C;  1TGZ B;  2QSD A;  3GZN I;  1E7P B;  3AE3 B;  4K7U A;  1WYW B;  1IBX B;  4ZRP A;  2ZCB A;  1XLQ A;  2MJ3 A;  2BS2 B;  3I57 A;  4G0N B;  1YJJ A;  3GE8 C;  1C1Y B;  4KGT A;  3VVW B;  3FAH A;  4P6V F;  2LVP A;  2GBK A;  1XLP A;  1RLF A;  2ACZ B;  3W9C B;  3H9D A;  1K51 A;  1DYQ A;  3EA6 A;  3GP7 A;  1J7A A;  4E74 A;  4NAM A;  4W9H A;  1WGK A;  1V97 A;  2XK5 B;  4B6W A;  3LB8 C;  4YSX B;  2KXJ A;  4K7W A;  4MH0 E;  4YTP B;  3N30 A;  3T9L A;  1YJ1 A;  4MSQ B;  3AEA B;  1ACC A;  1E10 A;  3NZS A;  3DOW A;  2DHZ A;  1A70 A;  4NQK E;  4IWQ A;  3P2B A;  2MJE A;  3HM6 X;  1ESF A;  2IO1 B;  3IAS 1;  1L5P A;  3AE4 B;  4HVB A;  3WCQ A;  2J4X A;  2JSV X;  3PRP B;  4B0M A;  1NVI D;  1QZE A;  4A3O A;  2Z0E B;  2W54 A;  4MGY E;  1VZ6 A;  2DZJ A;  3GZN B;  3C8Y A;  1FXT B;  1UBQ A;  2D3A A;  3L16 A;  2AQ3 B;  3P63 A;  1L6U A;  1RYJ A;  2GBR A;  2IY1 B;  1BXT A;  1WGR A;  4S17 A;  3P4S B;  1NYR A;  4RGM A;  3VUW A;  3LJ3 A;  4KIK B;  2KZR A;  2LAS A;  1UNS A;  1XD3 B;  1J7C A;  2KNB A;  3DCG A;  2C7N B;  4PS3 A;  3FKY A;  2N9K A;  3MFG A;  4KZ0 A;  3VRB B;  5CHW A;  1JCK B;  3RT3 B;  2OED A;  3EGR A;  4IM2 A;  1AN8 A;  2AQ1 B;  3IAM 1;  1KJT A;  3VDZ A;  2K8B A;  1WY8 A;  2D07 B;  5G2N A;  1TBE A;  1SE9 A;  1MG4 A;  2JZZ A;  2V3N A;  1E7V A;  1V1P A;  1ET6 A;  2QCZ A;  2C60 A;  3HHM A;  1X1M A;  3RNG C;  2QHO A;  3QK0 A;  3UIN B;  2MHJ A;  3BYT B;  3NVZ A;  2WGS A;  2WX0 A;  1NDD A;  1HE8 A;  1NI2 A;  3U7D A;  1XQQ A;  1HQR D;  2PW9 A;  3W1S C;  3Q3F A;  4UDU C;  2KWV B;  1WXQ A;  1QT9 A;  1L7Y A;  1FRD A;  1P98 A;  2FAZ A;  4RM9 A;  1TTN A;  3NVV A;  2K3U A;  2PMV A;  4RH6 A;  1RFK A;  5C2T B;  1K53 A;  4K3C A;  3NVY A;  3Q3N C;  4K1R B;  4RF1 A;  5G55 A;  4IC7 B;  3ZUN A;  1I42 A;  2NBU A;  3KLS X;  2G3Q B;  2V1Y A;  1N60 A;  4JWS C;  1D5M C;  1AW7 A;  2MSE D;  4A8X C;  4ZRI A;  1J7B A;  1KH0 A;  1DGJ A;  3MHZ A;  1WF9 A;  5AZF A;  1MI0 A;  1QQR A;  2ZVN A;  2LUE A;  2X38 A;  2YVC A;  1B1Z A;  2QIL A;  3VH3 B;  2AEH A;  2KQS A;  1IBX A;  3RNC C;  5C23 A;  4RGN A;  1L0V B;  2HE7 A;  4W9D A;  2K8H A;  1BUI C;  2UU7 A;  4USA A;  3EEC A;  2L52 A;  2FBW B;  2LUM A;  1KLU D;  1HTO A;  1N63 A;  3N1Y C;  5FR6 A;  3CMM B;  2PVG C;  4GDL B;  5E6O A;  4KGS A;  3A4R A;  2M0A A;  2JWU A;  3QQ8 B;  1TS2 A;  1G6J A;  1OQQ A;  2BWF A;  4HRO A;  3KWL A;  1K50 A;  1GC6 A;  2V3P A;  3APF A;  2EKE C;  1D4B A;  2LEK A;  1PGX A;  2WXQ A;  1QKZ A;  4YT0 B;  1C77 A;  3TEZ A;  2WXH A;  1XLN A;  2KWU B;  2KOX A;  2G4S A;  3UIP B;  4HWI B;  3CWI A;  1DOI A;  4B95 A;  2KVZ A;  1NEN B;  1WWT A;  2CS4 A;  1FXA A;  4NJ7 A;  2R61 A;  1KRH A;  4F7Z A;  4IG7 B;  1C3T A;  4P1C C;  4BZA A;  4W9L A;  3B2F A;  2JY6 A;  1QOB A;  1UGM A;  2BF8 B;  3BVZ A;  1WGG A;  1ZPS A;  2FUH B;  3U7Z A;  3SEB A;  3A4S C;  3AN1 A;  3L17 A;  1Q0W B;  3AI5 A;  2O6V D;  4PYZ A;  1CQV A;  4W9E A;  3KWV A;  1JW9 D;  3APC A;  1WJN A;  2ASQ A;  2WP9 B;  2QEJ C;  3VTU A;  4OZB A;  1S3S G;  2LWP A;  1FCL A;  3DHI C;  3NZU A;  3CST A;  4LJP B;  4JWU C;  2LGX A;  3ZKJ C;  2BB5 A;  3K9O B;  3QWZ B;  1Q1O A;  2RR9 A;  3ZNG C;  1WR1 A;  1IPG A;  2NPT A;  1WGY A;  3GS2 A;  3PHW B;  4H2A A;  4ACF A;  1WRI A;  1T3Q A;  1V5T A;  1GOZ A;  2MJD A;  3W5U B;  3IT4 B;  2MQJ A;  1HZ6 A;  3Q8F A;  2CHZ A;  2AQ2 B;  1RFA A;  1P3Q U;  2MBB B;  3UIO B;  2IGG A;  4MGI E;  1TT5 B;  4NPN A;  4BAX A;  3AH7 A;  2SEB D;  2KD0 A;  3AEB B;  4AWJ A;  5BYQ A;  2LGY A;  1I4R A;  1ENF A;  3AE7 B;  3NUH B;  3U52 E;  3TSS A;  1RWS A;  1ZDX A;  3HVD A;  1WZ3 A;  3X23 A;  3OWE B;  3P4R B;  2D3G A;  2DWQ A;  3UF8 A;  4IDI A;  3Q2A C;  1TS3 A;  3A1Q B;  3ZJT A;  1ISN A;  1YX6 B;  4RCO A;  1AAR A;  2L00 B;  1ET9 A;  3RUL A;  1TS5 A;  3AM9 A;  3ZLZ A;  2O6V A;  4NNJ B;  3H1U A;  2KN4 A;  2K1F A;  2W82 A;  2ZW0 A;  4OW0 A;  3PT2 B;  4WWP A;  5J2R A;  2GBM A;  3QX1 A;  1F9J A;  2FNJ B;  4HDO A;  1JQ4 A;  3UI3 A;  4KKJ A;  1PFD A;  4MGZ E;  1PGA A;  2WXJ A;  4DHZ E;  1B9R A;  3IVF A;  1T0Y A;  3AB5 A;  1OQR A;  2VH2 A;  1IYF A;  1TY2 A;  3V61 A;  3DDC B;  3WAM A;  3MC0 B;  1YD8 U;  3DBR B;  3LXF A;  1I4G A;  2M4N A;  1FO4 A;  4PYU A;  4JL9 A;  3BK1 A;  4JIO U;  3RPF C;  3M62 B;  5T8I A;  2L7R A;  1M94 A;  4AS1 A;  5DPS A;  5C1Z A;  2MEK A;  4WIP A;  2FUG 1;  4I6N B;  4ZOH C;  5JXV A;  2IBI B;  3NOB A;  4A20 A;  1UGJ A;  2JYE A;  1WXM A;  4BKG A;  1T6B X;  3U4E G;  1XT9 B;  2ZJD A;  2XK5 A;  1L0Y B;  1KM7 A;  2R2O A;  3NS8 A;  1NEK B;  4C4V B;  4ZHP A;  2K9X A;  3DBS A;  2MRP A;  1UF0 A;  3AMZ A;  4FA6 A;  2NTS A;  4ANU A;  4LCD E;  2J0K A;  2JZ3 B;  2QDF A;  1Z2M A;  2Q5W D;  4P1B C;  4BOS C;  3I3T B;  4HEA 1;  1C4A A;  4DHJ D;  1F1H A;  1WXA A;  1GG3 A;  1N61 A;  3C19 A;  1LXD A;  4KX6 B;  2DZI A;  4FHK A;  4RMA A;  2BBC A;  1BML C;  4WWN A;  2WXO A;  2WWZ A;  2NTT A;  4DBG A;  3I9V 1;  1HZ5 A;  3VAW A;  3A33 B;  3VQI A;  2DZM A;  4G50 A;  3A9K A;  1TZ1 A;  2L3Z A;  2LMC A;  2WXF A;  2Z59 B;  4DDI D;  2IO2 B;  1PUT A;  2KO3 A;  4N6E B;  3ZDM C;  4ANX A;  5LLI A;  3AE9 B;  5BO4 B;  1PGB A;  1K52 A;  2JWZ A;  5GMV A;  3IFW B;  5JHB A;  3SDL C;  4WJP A;  5HG2 A;  3DWM A;  2G9H D;  4GDL A;  3U8Z A;  5DPW A;  2MW5 A;  1Y56 A;  4B9K A;  4MEL A;  1WFY A;  1R4M I;  3L0W B;  1HA5 A;  1EWY C;  1GNU A;  1RM6 C;  3PSE B;  1GUA B;  4LNN A;  2MA9 B;  5EE3 A;  4XZ4 A;  5CTR C;  3VR8 B;  1JRU A;  1OGW A;  1V86 A;  3MC8 A;  3DBR I;  2OJR A;  4WH4 A;  1Q5W B;  1MFW A;  1FCC C;  5TR5 A;  2H88 B;  1TKE A;  4RNA A;  2M8S A;  4KIK A;  3IG3 A;  3JSV B;  5CHV C;  4WJO A;  4EE2 A;  2V3S A;  3N9Y C;  3EFC A;  3I5J C;  4ITK A;  3B9J A;  3KQ4 A;  2I1J A;  4C80 A;  1FM0 D;  2NBV B;  3NHE B;  2WDQ B;  1QLB B;  3V05 A;  2KJR A;  1TS4 A;  1LQB A;  2BGF A;  4DXG A;  1C78 A;  1H4R A;  4AUQ C;  4E71 A;  1WGD A;  5D2M B;  3H8H A;  2V0G A;  1I4P A;  2MBE A;  2K22 A;  2KMA A;  4ANV A;  4C00 A;  2KMM A;  2KDB A;  4O1N A;  2AWT A;  5BMI A;  4LNF A;  4WAF A;  5D3D A;  3BK2 A;  3KYC D;  2PKO A;  2KQ4 X;  2Y5B B;  4JLC A;  1KOT A;  2KC2 A;  2NMQ A;  4S0R A;  5EE1 A;  2DYM A;  2BPS A;  4HCP B;  1NI3 A;  2IZV B;  3TEY A;  2K6Q A;  3M63 B;  4A6Q A;  3HVZ A;  1E7U A;  3X0W A;  2W9N A;  4KSK C;  1FNV A;  2WDV B;  1Q10 A;  4YTN B;  2RSU A;  1H8C A;  4ZHO A;  5AUK A;  3IBE A;  2LJ5 A;  2INN E;  4RF0 A;  3HIZ A;  1TJE A;  1YN3 A;  1E6E B;  3BZD B;  1YJI A;  5FR3 A;  1XCT L;  4FLH A;  4ARI A;  3CSF A;  2L83 A;  1V80 A;  3Q69 A;  3PRZ A;  4FAD A;  3J9C A;  3NZ3 A;  5BYR A;  2LGI A;  2PLP A;  3Q8C A;  1PQS A;  4BFR A;  3T3O A;  3O13 A;  4CHK A;  4HJK A;  4GSW A;  2I38 A;  3ML8 A;  1LGR A;  2ZNV B;  3KUD B;  3T3N A;  4IWO A;  4GN1 A;  3VTW A;  4GIV A;  3KVF B;  4NY0 A;  5MPO A;  2CJN A;  2C7M B;  1NBF C;  5EE0 A;  4YSZ B;  3V6E B;  1IUE A;  1QOG A;  4HCN B;  2NS5 A;  1A5R A;  3AU5 A;  1WRD B;  3OLM D;  4DHJ B;  1ZXH A;  2DAF A;  3ZGZ A;  3PPA A;  4GDK A;  4EKU A;  4LDT B;  3TEX A;  4ZYS A;  3SHQ A;  2KAJ A;  4LNK A;  1JWA D;  3B1L X;  1XEE A;  2K6D B;  3KUC B;  2N7D A;  2WS3 B;  2UWQ A;  1E90 A;  2W55 A;  4TKN A;  4IM3 A;  3WAN A;  3C0R B;  1KLG D;  2PE9 A;  3DBL I;  1BT0 A;  3AV8 A;  4LJO B;  4DQO C;  4JX1 C;  2M17 A;  2KDM A;  2WXN A;  2PEA A;  2WXK A;  4A90 A;  2KYW A;  4W9C A;  2N9P C;  1D5Z C;  2BKF A;  3ECI A;  2GI9 A;  4B0E A;  4OZC A;  3FIL A;  3PZD A;  1WYG A;  2RDH A;  3Q6B A;  1WE6 A;  3ZDT A;  4NJC A;  4C7Y A;  2QJL A;  2FCQ A;  3I63 C;  2N9L A;  2KLG A;  2GMI C;  2WDT B;  4PS7 A;  3PS6 A;  2JRI B;  5E6J A;  1CMX B;  4ZYN A;  1EO6 A;  5LNK 1;  1J0G A;  1N5W A;  1I4X A;  1M4V A;  1JWS D;  3TBL D;  2L32 A;  1WH3 A;  2BYV E;  1YNT E;  1C9F A;  1E8Z A;  2MBH A;  5I4D A;  2CHW A;  3SR6 A;  3L54 A;  4JQW C;  3R3M A;  3MP9 A;  1I4Q A;  4GOC A;  4ZRJ A;  3IXS A;  2GB1 A;  3V6C B;  4IUM B;  1P7F A;  1EU4 A;  1ZOY B;  1EF1 A;  5D6J B;  3EFU A;  3GB1 A;  2WXR A;  1XLO A;  2INP E;  4GLS C;  2H89 B;  4TSS A;  1ROE A;  3NG0 A;  3VUX A;  2PIA A;  3M95 A;  4X57 B;  3AEG B;  3ZW3 A;  4AQ7 A;  4BKT A;  4L1B A;  4TMA B;  3D32 A;  4FHJ A;  2CR5 A;  1DOX A;  1HXY D;  3UQA A;  3GE3 C;  2QC8 A;  3W1S A;  4DK5 A;  1ZUD 2;  2I2Y A;  2ZEQ A;  2KVR A;  2L1A A;  4PS8 A;  2N9X A;  2AL3 A;  2FIF A;  1U4A A;  1V6E A;  2WXG A;  2J0J A;  4M0W A;  4RGO S;  2WXP A;  3RN9 C;  3A9J B;  2N0S B;  1V1P B;  1GAQ B;  4YSY B;  2AL6 A;  4CYE A;  1KLV A;  1I4H A;  4L2Y A;  1D5X C;  4N59 A;  5IO9 A;  4F8C B;  1JWU D;  2BW2 A;  4G11 A;  4KKI A;  3ZVV A;  2XBB C;  2MP2 A;  4A9A A;  2GOW A;  2ZCC A;  3PRE A;  2JUO A;  2TSS A;  4MGK E;  2DYB A;  4N9F 4;  1QIL A;  3N3K B;  1I7H A;  4EUT A;  2PE6 B;  4DXA B;  2WU2 B;  4AP4 C;  4K3B A;  3EUB 2;  2QIE B;  3DVG X;  2Z0D B;  3BWU D;  3MHS D;  2Y5P A;  5IN7 A;  1EF5 A;  3H6N A;  1Y8R C;  1UUP A;  2GBJ A;  2M0X A;  3QC8 B;  3Q8A A;  4W9F A;  4YTM B;  2D2Q A;  1YX5 B;  3ETR A;  2PJH A;  3LDZ E;  3EC8 A;  3AE5 B;  1ZKH A;  1R4M B;  2KDI A;  3TL5 A;  1KFY B;  2K8C A;  2L0T A;  4QAY A;  3T8M A;  2K25 A;  4F1S A;  2KFK B;  1YQB A;  3NS1 A;  2JT4 B;  2W3R A;  1YOV B;  3R2I A;  2KX0 A;  3AEE B;  2LD9 A;  4C4V A;  5BMH A;  3BY4 B;  4MEM A;  4XDD A;  4TQ0 A;  3SD5 A;  3ZNZ B;  2WHI A; 
#chains in the Genus database with same CATH homology
 5GMV A;  2KN5 A;  4IM2 A;  4M8M A;  2G4D B;  3IFW B;  3ZRF A;  5JHB A;  1E5W A;  1KJT A;  2CKH B;  3VDZ A;  2K8B A;  4KSL C;  3GOE A;  1WY8 A;  2D07 B;  1WXV A;  5G2N A;  3SDL C;  1TBE A;  4WJP A;  1SE9 A;  2D11 A;  3MJW A;  1SIF A;  2JZZ A;  4GDL A;  3TIX A;  3U8Z A;  4NJ6 A;  5DPW A;  4MSM B;  2MW5 A;  3PLV A;  4MJS B;  1E7V A;  3VH4 B;  4B9K A;  4BVU C;  4MEL A;  2N9E B;  1WFY A;  1R4M I;  3L0W B;  2DYO A;  4FJZ A;  4BBN C;  1GNU A;  3PSE B;  1GUA B;  1R4N I;  4KVG B;  2LVQ A;  2MA9 B;  4XZ4 A;  5CTR C;  4GGQ A;  4KDL B;  1JRU A;  1OGW A;  2C60 A;  3HHM A;  1V86 A;  1X1M A;  3VXW A;  1S1Q B;  3DBR I;  2OJR A;  2QHO A;  1WE7 A;  3QK0 A;  2L76 A;  3UIN B;  2NCN A;  1Q5W B;  3JW0 X;  4WQO B;  2WX0 A;  4FJV B;  1NDD A;  1HE8 A;  2MCN B;  1NI2 A;  1K8R B;  2KHW B;  3KW5 B;  5TR5 A;  3U7D A;  1WXS A;  3A9K B;  1XQQ A;  4CO7 A;  3QA8 A;  2M8S A;  4KIK A;  3IG3 A;  3K9P B;  2ZPY A;  3JSV B;  5CHV C;  3W1S C;  5IA7 A;  1ZW7 A;  3Q3F A;  3PTF C;  4WJO A;  2V3S A;  4MDK E;  2KWV B;  2I1J A;  1UBI A;  1L7Y A;  2NBV B;  3NHE B;  4GB9 A;  1IP9 A;  1P98 A;  2FAZ A;  4HXD A;  4RM9 A;  1TTN A;  2KJR A;  1LQB A;  2BGF A;  3EHV A;  2LXC A;  2IO3 B;  1H4R A;  4AUQ C;  4E71 A;  1WGD A;  3ONS A;  5D2M B;  2DEN B;  3JVZ X;  4ASW C;  2KDE B;  3V60 A;  2O6V B;  4HLE A;  2MBE A;  2KMA A;  4ANV A;  2KC1 A;  2ZPN A;  4K1R B;  4NAW B;  5G55 A;  2KDB A;  4IC7 B;  4G3X B;  4MJS A;  4GMV A;  2AWT A;  2MP2 B;  3ZO5 B;  1J8C A;  3ZUN A;  1I42 A;  2NBU A;  2J0M A;  1P9D U;  3KYC D;  3JYU A;  4NAW A;  2Y5B B;  2EMS A;  2G3Q B;  4JLC A;  2V1Y A;  4AJY B;  2LRW A;  1KOT A;  2KC2 A;  2KFJ A;  2DYM A;  2IO0 B;  4P7I A;  5CX3 A;  3WAL A;  1P1A A;  2MSE D;  2N1V A;  2BPS A;  2REX A;  4HCP B;  5E6P A;  4ZRI A;  3OJ4 B;  2IZV B;  4GU2 A;  1WF9 A;  2K6Q A;  2KK8 A;  3M63 B;  5AZF A;  4GXB A;  5J17 A;  1E7U A;  3X0W A;  2W9N A;  2MBQ A;  4KSK C;  2NBW B;  2ZVN A;  2LUE A;  4AJW A;  1LFD A;  4EFO A;  4BBN F;  2YVC A;  4J6I A;  2RSU A;  2ZZP B;  1H8C A;  3PHX B;  3IBE A;  3W1Y A;  5L95 C;  4NQL B;  3VH3 B;  2I1K A;  3L13 A;  2AEH A;  2KQS A;  5CHF A;  5DPT A;  2LJ5 A;  3HIZ A;  2DAJ A;  5C23 A;  4BKS D;  4IM0 A;  4DDG D;  1WX9 A;  2HE7 A;  4W9D A;  2K8H A;  4WJQ A;  4FLH A;  4WWO A;  3AXC A;  4TUU A;  4KV2 A;  3EEC A;  5EDS A;  3RCZ A;  3CSF A;  4URK A;  1WX8 A;  2ZVO A;  1V80 A;  5FR6 A;  2M1M A;  3PRZ A;  2LRU A;  2O2V B;  4I6P A;  4FAD A;  3CMM B;  3ZRC A;  4GDL B;  5E6O A;  1PQS A;  4BFR A;  3ZNH B;  3A4R A;  3R7Q A;  2BYE A;  2L0F A;  2IY0 B;  2UYZ B;  3B08 A;  4CHK A;  2KQ7 A;  4HJK A;  2KJH B;  4GSW A;  3ML8 A;  2ZNV B;  2BYF A;  3KUD B;  3QQ8 B;  5AZH A;  4IWO A;  4A3P A;  4GN1 A;  1G6J A;  2BWF A;  3VTW A;  3AUL A;  4XC2 A;  2WYQ A;  4GIV A;  2JPH A;  2KMC A;  3KVF B;  2HD5 B;  2FCN A;  4NY0 A;  1WI0 A;  1GC6 A;  3APF A;  1E8X A;  5E6N A;  2C7M B;  2EKE C;  4EZK A;  1NBF C;  1I35 A;  2C7H A;  1UD7 A;  2VRR B;  3V6E B;  2KWU B;  2KOX A;  2G4S A;  4HCN B;  4HWI B;  2NS5 A;  2KKC A;  3U30 A;  3UIP B;  1A5R A;  4B95 A;  2KTR A;  4JGH B;  5JHA A;  3AU5 A;  1WRD B;  3B0A A;  3OLM D;  4DHJ B;  3APD A;  4TV3 A;  1WZ0 A;  2DAF A;  3M3J A;  4ZRK A;  1LM8 B;  2V4L A;  3PPA A;  4GDK A;  4EKU A;  2C9W B;  2KX3 A;  2CS4 A;  4LDT B;  4ANW A;  3SHQ A;  4NJ7 A;  5IAA C;  3L10 B;  2FID A;  4HPL B;  4AOF A;  4F7Z A;  3B1L X;  4IG7 B;  1C3T A;  4DHZ B;  5J18 A;  3H7S A;  2K6D B;  1J19 A;  3KUC B;  3A1Q A;  2LZ6 A;  4W9L A;  2JY6 A;  1UGM A;  4FUL A;  2BF8 B;  2N7D A;  1GJZ A;  1WGG A;  4FN2 A;  1WJU A;  2UWQ A;  1E90 A;  3UGB B;  2FUH B;  4TKN A;  2IYD B;  4IM3 A;  4KZC A;  3VHT C;  2MX2 A;  3WAN A;  3CF6 E;  4HDQ A;  5D7G A;  3C0R B;  2K39 A;  1WJ4 A;  2PE9 A;  1D3Z A;  3TJP A;  1YIW A;  3ML9 A;  3DQV A;  3A4S C;  3KH0 A;  3DBL I;  1BT0 A;  3MTN B;  1ZGU B;  3L17 A;  1Q0W B;  4LJO B;  3AI5 A;  1WMH A;  2O6V D;  4PYZ A;  2M17 A;  4WJN A;  3L08 A;  4II2 B;  1WX7 A;  2PEA A;  4W9E A;  3PLU A;  1V5O A;  3DVN U;  3APC A;  1WJN A;  2ASQ A;  3PGE A;  4W9C A;  4KDI C;  2N9P C;  2BKF A;  3DBH I;  1WM3 A;  5AZG A;  4BKS A;  3ECI A;  4ICU A;  2JVC A;  3H7P B;  4II3 B;  3VTU A;  3ZTD A;  3PZD A;  3R7R A;  2DX5 B;  1S3S G;  2LWP A;  5L83 A;  1WE6 A;  5JZE B;  3ZDT A;  3PRM B;  3ZIM A;  3DPD A;  2A4Z A;  2KTR B;  3KUZ A;  3NZU A;  2NR2 A;  4HK2 A;  3CST A;  4LJP B;  1OEY J;  1VCB A;  2LGX A;  2LXA A;  1V49 A;  4K7S A;  3RD2 A;  3ZKJ C;  5HKH A;  2FCQ A;  3K9O B;  3QWZ B;  1Q1O A;  2KLG A;  2GMI C;  2WDT B;  1Z5S B;  2RR9 A;  4HPM B;  4GDK B;  1WR1 A;  3ZNG C;  1IPG A;  1E8W A;  4PS7 A;  3PS6 A;  1GC7 A;  2L8J A;  2NPT A;  2N7E A;  2JRI B;  3QJZ A;  1CMX B;  4ZYN A;  1WGY A;  5KHQ A;  1EO6 A;  3PHW B;  1WM2 A;  2G45 B;  1J0G A;  5DCN A;  3WIM A;  4BOZ B;  3IHP C;  1V5T A;  3SU8 X;  3WA0 A;  2ZNV C;  1WGH A;  1WJ6 A;  4IW0 A;  2MQJ A;  2DZK A;  2KDF B;  4OVU A;  5D94 A;  3TBL D;  4W9K A;  2CHZ A;  5LXI B;  2D10 A;  3DVG Y;  1RFA A;  1RRB A;  1WH3 A;  2PPH A;  2BYV E;  5AEK B;  2A5U A;  4ICV A;  3N32 A;  1P3Q U;  2MBB B;  3HM3 A;  3UIO B;  1V9J A;  4MGI E;  5JH5 C;  2GBN A;  3QAQ A;  4FBJ B;  3BIN A;  1E8Z A;  4NPN A;  1OEY A;  3QCA A;  3ZNI D;  3JSV A;  2KD0 A;  2MBH A;  2R2Q A;  3QIJ A;  1WMH B;  2CHW A;  4AWJ A;  3L54 A;  2AYO B;  2LGY A;  3RUI B;  2MBO A;  4JQW C;  2J7Q B;  3R3M A;  4GOC A;  4ZRJ A;  2FCM A;  4ZDV A;  3V6C B;  3RZW C;  2YLM A;  2KWC A;  1L2N A;  4IUM B;  4IWP A;  5DPR A;  1WZ3 A;  3VFK A;  3X23 A;  1EF1 A;  2JF5 A;  3TMP B;  5D6J B;  3EFU A;  2N1W A;  2HJ8 A;  2D3G A;  3UF8 A;  4EZJ A;  3A1Q B;  3S2A A;  3VTV A;  5LXH A;  1ISN A;  4EZL A;  3A9J A;  1YX6 B;  3KYD D;  3ENE A;  3ALB A;  3TCA A;  3QAR A;  1WR6 E;  1AAR A;  3VUY A;  2NPT B;  3RYT A;  2L00 B;  3VUX A;  3RUL A;  2KLC A;  3M95 A;  2L05 A;  4X57 B;  3ZLZ A;  2O6V A;  4NNJ B;  3NY5 A;  3H1U A;  2K1F A;  2RPQ A;  1OQY A;  2WX1 A;  3R66 C;  3OJ3 A;  4YL8 A;  3ZW3 A;  1OTR B;  4BKT A;  3WAP A;  3PT2 B;  4WWP A;  3D32 A;  4FHJ A;  5J2R A;  2CR5 A;  1V2Y A;  2GBM A;  3QX1 A;  1F9J A;  4I6L B;  2FNJ B;  2KAN A;  2BWE S;  1V81 A;  4HDO A;  3H7P A;  3UQA A;  3AU4 A;  4MGZ E;  3O65 B;  4OVV A;  3W1S A;  4FJY A;  2C5L C;  1MG8 A;  4XX5 A;  3V62 A;  4DHZ E;  2JRH A;  3IVF A;  4TQ1 A;  1T0Y A;  4DK5 A;  2ZEQ A;  2NVU I;  2KVR A;  1TGZ B;  1IYF A;  3GZN I;  4PS8 A;  2N9X A;  2B3A A;  2XEW A;  1WYW B;  3DDC B;  4K7U A;  3V61 A;  3WAM A;  2ZCB A;  4K81 A;  2AL3 A;  1YD8 U;  2FIF A;  1U4A A;  4G0N B;  1C1Y B;  3VVW B;  1V6E A;  2HTH A;  2M4N A;  1P0R A;  2J0J A;  4PYU A;  4JL9 A;  2LVP A;  2GBK A;  3A9J B;  4JIO U;  1RLF A;  2O2V A;  3M62 B;  1UZX B;  2AL6 A;  4CYE A;  2L7R A;  1KLV A;  2MLB A;  4E3C A;  3H9D A;  1M94 A;  4F8C B;  4MM3 A;  5DPS A;  4EOY A;  4E74 A;  4RM8 A;  4W9H A;  5C1Z A;  4G11 A;  1WIA A;  3QHT A;  3ZVV A;  2XBB C;  2MP2 A;  2XK5 B;  2GOW A;  4I6N B;  2ZCC A;  2IBI B;  2KFK A;  3NOB A;  4A20 A;  4B6W A;  2OOB B;  3PRE A;  2JUO A;  2KXJ A;  1WXM A;  4K7W A;  4MH0 E;  4MGK E;  4BKG A;  2FCS A;  2DYB A;  4DWF A;  1UH6 A;  1XT9 B;  2ZJD A;  3ZTC A;  4N9F 4;  2XK5 A;  3N30 A;  3N3K B;  2LI5 A;  1KM7 A;  3T9L A;  2R2O A;  1YJ1 A;  4MSQ B;  2KJ6 A;  3RZF A;  3NS8 A;  4EUT A;  2PE6 B;  4W9I A;  4DXA B;  2LGD A;  3DBS A;  2MRP A;  2CU1 A;  3NZS A;  4AP4 C;  4FA6 A;  3DOW A;  2DHZ A;  4ANU A;  4LCD E;  3DVG X;  2RD0 A;  2J0K A;  2Z0D B;  2MWS B;  4LDT D;  3DVN V;  4NQK E;  3UQB A;  2JZ3 B;  2RGF A;  3MHS D;  4IWQ A;  3P2B A;  1Z2M A;  1EF5 A;  3HM6 X;  4M0W B;  3H6N A;  4M8N A;  4BOS C;  1Y8R C;  2GBJ A;  2M0X A;  3I3T B;  3QC8 B;  2IO1 B;  1VD2 A;  4DHJ D;  4W9F A;  4EEW A;  3WAO A;  2D2Q A;  4HVB A;  1YX5 B;  1WXA A;  4WAA A;  2BKR B;  2PJH A;  4W9J A;  3PRP B;  1GG3 A;  3LDZ E;  1LXD A;  4W9G A;  3OAW A;  2LVO A;  2DZI A;  1QZE A;  3EC8 A;  4A3O A;  4FHK A;  2CHX A;  2Z0E B;  4MGY E;  1ZKH A;  2DZJ A;  1RAX A;  2KDI A;  4RMA A;  4WWN A;  3TL5 A;  1FXT B;  2JXX A;  1UBQ A;  5KHO A;  2WWZ A;  2K8C A;  2L0T A;  3L16 A;  4DBG A;  3T8M A;  2K25 A;  3A33 B;  3VAW A;  3VQI A;  2DZM A;  4F1S A;  2KFK B;  1YQB A;  4G50 A;  2GBR A;  2IY1 B;  3A9K A;  3PVL A;  3Q3J A;  2JT4 B;  1TZ1 A;  1WGR A;  2L3Z A;  3VUW A;  3LJ3 A;  2KTF A;  4KIK B;  3HK0 A;  2EMT A;  2Z59 B;  4DDI D;  2IO2 B;  1UEL A;  2KX0 A;  1EUV B;  2KO3 A;  2KZR A;  2LAS A;  1XD3 B;  2KNB A;  3DCG A;  3ZDM C;  2LD9 A;  5LLI A;  4ANX A;  2C7N B;  4PS3 A;  4KZ0 A;  5CHW A;  3BY4 B;  4MEM A;  3RT3 B;  1SGH A;  2N4F A;  4TQ0 A;  5BO4 B;  3SD5 A;  3PV1 A;  1E8Y A;  3ZNZ B;  2JWZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...