1UELA

Solution structure of ubiquitin-like domain of hhr23b complexed with ubiquitin-interacting motif of proteasome subunit s5a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
95
structure length
95
Chain Sequence
b'MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALKEYKIDEKNFVVVMVTKPKAVSTPAPATLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UV excision repair protein RAD23 homolog B
publication title Structure of the Ubiquitin-interacting Motif of S5a Bound to the Ubiquitin-like Domain of HR23B
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation/protein binding
total genus 23
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2003-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1uelA00
3M63B 2LWPA 3EECA 1SGHA 3ZTDA 3AI5A 2O2VB 3HM3A 4IM0A 2BWFA 3DPDA 1JRUA 1E8WA 1Q1OA 1X1MA 5DPWA 2ZZPB 3PVLA 2V4LA 2WYQA 2J0KA 3U30A 2PEAA 3GZNI 4IWQA 1YJ1A 2RSUA 3DBSA 4EKUA 4WJOA 2CHXA 2I1KA 3LDZE 3PZDA 2ZJDA 2DZIA 3VAWA 5KHQA 3DDCB 4BOZB 2ASQA 4GN1A 3JW0X 4K7UA 2JY6A 2ZVNA 4OVUA 2NVUI 1WGGA 4CHKA 3ZRCA 2G4SA 1LFDA 1K8RB 2GOWA 2L8JA 1V86A 1P98A 2ZPNA 4IW0A 5FR6A 5J17A 2M0XA 1L7YA 4ANWA 2LVQA 2O2VA 4BVUC 1XD3B 2IO3B 2Z59B 1LQBA 2NBUA 1H4RA 4M0WB 4DHZE 4DWFA 3ALBA 4G50A 1E5WA 3UINB 4ICUA 2KX3A 3DCGA 4BOSC 3APFA 1V5OA 3DBLI 3ZW3A 2CS4A 2YVCA 5LLIA 5JHBA 2CHWA 2HD5B 2KOXA 1WR6E 2DYOA 2LUEA 2LD9A 1QZEA 4K7SA 2LVPA 3RULA 1V6EA 4HDOA 2D3GA 3OLMD 3ZNID 2BYEA 2KO3A 3PRZA 3VQIA 2L76A 2KKCA 4AP4C 1I42A 3DVGX 2OJRA 2KMCA 2D10A 4PS7A 3OJ3A 3ZDTA 5JZEB 3D32A 2IO0B 3L17A 1I35A 2PE6B 2KZRA 3PHXB 2ZPYA 5DPSA 3B1LX 3R7QA 2L00B 4KZ0A 3A1QB 4FADA 4I6LB 2N7DA 4WAAA 3WAPA 4HDQA 1WE6A 4URKA 2GBNA 2M17A 1GC6A 2BKFA 3ZNHB 2IYDB 1ISNA 1EUVB 2AL3A 3L10B 2ZVOA 4MJSB 2JVCA 3O65B 3R66C 2AEHA 2NPTB 3ML9A 1WXSA 4FHKA 5C23A 3UF8A 4IM2A 3QK0A 3IVFA 4EZKA 3OJ4B 4F7ZA 4ZDVA 3K9PB 1P1AA 3MHSD 1UBIA 2N1VA 4GIVA 5L83A 2GBMA 2J0MA 3VVWB 1WGRA 4GSWA 1GNUA 1U4AA 1HE8A 2WX0A 3WAOA 4F1SA 1F9JA 2MCNB 2XK5B 3A1QA 3PTFC 1FXTB 2KD0A 2JPHA 2MRPA 3IG3A 3UIOB 2JWZA 2KJHB 5E6OA 2M1MA 4ZRKA 4ZRIA 3A4SC 2REXA 4LDTD 1YIWA 3DBRI 3H6NA 4JIOU 4W9KA 3W1SC 2DZJA 3A9KA 2ZCBA 2NPTA 5IAAC 5D6JB 4W9JA 2PE9A 2Z0EB 3AU4A 5TR5A 1ZKHA 3Q3FA 4BKSA 2C9WB 2A5UA 2DYBA 1PQSA 2K39A 3A9JB 3V61A 3ZLZA 3NZUA 1NBFC 2B3AA 4W9HA 3QCAA 4GGQA 5DPTA 2LXCA 4BFRA 4JL9A 1V5TA 2MA9B 3VFKA 1WJ4A 2CHZA 2XK5A 3W1SA 4A20A 2KMAA 2KLCA 1WFYA 1WY8A 1YX5B 3U8ZA 4MSMB 3NY5A 2M8SA 4N9F4 4DHZB 4TQ0A 1WM3A 1NDDA 2XBBC 4TQ1A 3VH4B 2KC2A 3ZVVA 1WGDA 1RAXA 3QJZA 3VH3B 4LJOB 3T9LA 3DQVA 2FCMA 3QC8B 5AEKB 5LXIB 2DZMA 3A9JA 2FCQA 4HCPB 3HM6X 3L16A 2UYZB 3R7RA 2FCSA 4B6WA 1OQYA 2FUHB 1Q5WB 4GB9A 2K25A 1IPGA 3QHTA 3NS8A 2JZ3B 3TJPA 4B9KA 4FLHA 4NY0A 3H7PB 5D94A 2KNBA 5E6NA 4RM9A 3VTWA 4NAWB 2MBHA 5L95C 4DBGA 5DCNA 5G55A 2KN5A 4AJYB 1CMXB 1R4NI 1WX7A 4EZLA 2IO1B 2R2QA 1UZXB 2FAZA 3W1YA 2LRWA 4KVGB 1V49A 2N9XA 1Z5SB 1WGHA 1E8ZA 2AWTA 3SHQA 2LGYA 2PPHA 2LVOA 2N9EB 3ECIA 4MM3A 2KJRA 3ZIMA 3H7PA 1T0YA 3RUIB 3I3TB 2MSED 3L13A 4PS8A 3BINA 1EF5A 1KJTA 3RYTA 3R3MA 1BT0A 2LI5A 1WXAA 2GBKA 1RFAA 1OTRB 1LM8B 2KFJA 4HPMB 2RGFA 1GG3A 1KLVA 1WM2A 3IBEA 3ZO5B 1WRDB 2L3ZA 3VHTC 2XEWA 3HIZA 1XQQA 3EHVA 2KX0A 2RPQA 1TZ1A 3AU5A 1L2NA 1Y8RC 2BWES 1GC7A 5D7GA 2D2QA 5EDSA 3KYCD 2KC1A 2I1JA 1S3SG 4IUMB 3HK0A 2BYFA 2ZNVB 3ZRFA 1WR1A 3CSTA 2MP2B 1OGWA 4MGZE 2NBVB 2NR2A 2L0TA 3WALA 4ZYNA 1WE7A 3ONSA 2GBJA 2LJ5A 2ZNVC 3QARA 4TUUA 3RT3B 4RMAA 2KTRB 2KDEB 5AZGA 1WGYA 1TGZB 2C5LC 2FCNA 4FN2A 4A3OA 4NQLB 4GDKB 3KW5B 4DHJD 2R2OA 3VTUA 1V81A 4K7WA 2DZKA 4KSKC 3OAWA 4HLEA 4II3B 4EZJA 4FBJB 4HWIB 2JZZA 2WDTB 4PYZA 2V3SA 5CHWA 5GMVA 3RCZA 1E7UA 2O6VD 1V9JA 3U7DA 4IG7B 2JT4B 3PS6A 2DHZA 2C60A 1C1YB 4M8NA 2RR9A 2L7RA 1E7VA 4LDTB 1YQBA 2RD0A 3VTVA 1P0RA 3ENEA 2MBEA 3X23A 2KTFA 2KTRA 2DAFA 4IC7B 3EFUA 2V1YA 1WMHB 3PPAA 4M8MA 3SD5A 3ZTCA 1H8CA 4G0NB 4E74A 2BKRB 2NS5A 2N1WA 4GDKA 3H1UA 3DVGY 1NI2A 4MJSA 3ML8A 3TIXA 4A3PA 4TKNA 3UQAA 1EO6A 2JF5A 3N3KB 4JLCA 1A5RA 5E6PA 3AXCA 2KQSA 3DVNV 3PREA 2N9PC 2WWZA 2HJ8A 2IBIB 2G4DB 4KV2A 3VDZA 2EMTA 4NJ7A 4IWOA 2MBQA 2N4FA 4DDGD 3SDLC 1EF1A 5DPRA 2KWVB 2A4ZA 4EUTA 1IYFA 1UELA 4FULA 3PV1A 3JVZX 1OEYJ 5D2MB 2Z0DB 4MGYE 4BKGA 3P2BA 3MTNB 4XX5A 2AYOB 1KOTA 4K81A 3L54A 5JH5C 2LZ6A 4YL8A 4NQKE 4W9FA 3WA0A 1YD8U 1ZGUB 2JRIB 4FJYA 2BGFA 1UBQA 4JQWC 2LASA 4P7IA 3TMPB 2IZVB 2MX2A 2KK8A 2MBOA 3QA8A 1E8XA 2NCNA 3MJWA 4AUQC 3HHMA 2KLGA 1D3ZA 4II2B 2WX1A 3QWZB 1Z2MA 2DYMA 4AJWA 4NJ6A 4WWOA 4HJKA 2K8CA 3QX1A 4EOYA 2K8HA 4MGIE 2J0JA 1P3QU 3B0AA 2K6QA 4KZCA 2LRUA 3CSFA 4TV3A 2D07B 4I6NB 4W9GA 5C1ZA 1KM7A 1WYWB 4WWPA 3KVFB 3M62B 3PSEB 4EFOA 3AULA 4X57B 2DX5B 3EC8A 3CMMB 1M94A 2CU1A 1G6JA 1WI0A 3NHEB 1GUAB 2VRRB 5LXHA 4AOFA 2W9NA 4K1RB 3X0WA 4ANXA 5CX3A 4W9IA 3V60A 3UQBA 3KUDB 4W9EA 2J7QB 3PLVA 3TL5A 4DK5A 2EKEC 3APDA 4NAWA 2DENB 2HTHA 3B08A 5G2NA 3RD2A 3T8MA 1E8YA 3VXWA 1RRBA 2BF8B 3WANA 4GDLB 3V62A 4KDLB 4ICVA 3UGBB 1WJNA 4ANUA 1WF9A 4KDIC 4NPNA 2LXAA 1J8CA 3RZFA 2KDIA 2AL6A 1VD2A 1UD7A 1AARA 2KDFB 3QAQA 3PLUA 3RZWC 5KHOA 2JUOA 4FJVB 4W9DA 1J0GA 3K9OB 5AZHA 3VUXA 1VCBA 3PRPB 5IA7A 4WQOB 3M3JA 2EMSA 2JXXA 4BKTA 3ZUNA 4IWPA 3PT2B 3V6EB 1R4MI 4GU2A 4MELA 4WJQA 4RM8A 3ZDMC 3DOWA 2KANA 4DHJB 4G3XB 1RLFA 5CHFA 3VUYA 4NNJB 1C3TA 5J2RA 1WH3A 2CKHB 2FIDA 3PRMB 4CYEA 1E90A 3NOBA 4GDLA 3TCAA 2MW5A 3NZSA 4W9LA 3JSVB 4IM3A 2O6VB 3N30A 4KSLC 2ZCCA 4LJPB 1GJZA 1Q0WB 2KFKB 1TBEA 1YX6B 1P9DU 3KUZA 3QQ8B 2MWSB 3L08A 5HKHA 3H9DA 2C7NB 1UH6A 1LXDA 2MP2A 4FHJA 3ZNZB 2FNJB 3Q3JA 3V6CB 3TBLD 2BYVE 2OOBB 3IHPC 2C7HA 2L05A 2K8BA 3VUWA 4B95A 4XC2A 5JHAA 3A9KB 1WZ0A 3JSVA 5BO4B 3DVNU 4F8CB 2KVRA 4MGKE 1MG8A 2O6VA 5AZFA 2KDBA 2N7EA 4DDID 2JRHA 1OEYA 2K1FA 3KH0A 4FJZA 2KFKA 1S1QB 1J19A 2LGXA 3M95A 4W9CA 3WAMA 3ZKJC 4XZ4A 4BBNF 4GMVA 1IP9A 2GBRA 3L0WB 1UGMA 1WXMA 1WX8A 1ZW7A 4GOCA 4PS3A 2C7MB 4BKSD 4G11A 4DXAB 2KHWB 2KJ6A 2PJHA 4JGHB 3UIPB 2G45B 1WJ6A 3WIMA 2HE7A 1V2YA 4HXDA 2L0FA 2KWUB 4EEWA 4OVVA 2GMIC 4HVBA 3QIJA 3DBHI 4HK2A 1WMHA 3A4RA 4CO7A 4HCNB 4WJNA 4HPLB 4E71A 2LGDA 2M4NA 5J18A 2IY1B 1XT9B 3KUCB 4I6PA 2CR5A 3PGEA 4ZRJA 4KIKB 3H7SA 5CHVC 4J6IA 3GOEA 2G3QB 2MQJA 2KWCA 2YLMA 4BBNC 4MEMA 2K6DB 2UWQA 4LCDE 1WX9A 2KQ7A 1V80A 2D11A 4E3CA 3PHWB 3N32A 1TTNA 2ZEQA 4PYUA 2FIFA 4AWJA 4ANVA 4FA6A 3APCA 1SIFA 2IO2B 3ZNGC 4MSQB 2NBWB 5CTRC 3KYDD 3SU8X 2BPSA 3CF6E 1WJUA 4ASWC 4GXBA 4WJPA 2IY0B 2DAJA 2QHOA 1WIAA 2MBBB 2MLBA 3C0RB 3S2AA 2KXJA 3A33B 3BY4B 1SE9A 4MDKE 4KIKA 4WWNA 1WXVA 2Y5BB 1WZ3A 3IFWB 3JYUA 3LJ3A 4MH0E
chains in the Genus database with same CATH superfamily
3M63B 4RGNA 2WXHA 3ZTDA 1X1MA 1Q1OA 5DPWA 2ZZPB 1YJ1A 1IGDA 4WJOA 2I1KA 3LDZE 3PZDA 1XXGA 2RMMA 4BOZB 2BB5A 2ZVNA 1WGGA 2N0SB 1K8RB 1FO4A 1YMHE 3HUIA 2M0XA 1L7YA 2LVQA 2GRIA 2O2VA 1XD3B 5BYRA 1H4RA 4M0WB 4DWFA 3UINB 4ICUA 4A90A 4ACFA 1V5OA 2CS4A 1XLQA 5EE3A 2KOXA 1WR6E 1MI0A 1HA5A 2LD9A 1VJKA 4HDOA 3OLMD 3ZNID 3VQIA 2IGGA 2KMCA 2WP9B 3ZDTA 1UNSA 2IO0B 2HTME 2ZPYA 3B1LX 1E9MA 3R7QA 4KZ0A 2D3AA 1YN3A 3A1QB 5TSSA 3WAPA 4URKA 2GBNA 3ZNHB 2BKFA 1ISNA 4JE3B 4RF0A 2WHIA 4ZRPA 1WXSA 4RCOA 1BXTA 2UU7A 5MPOA 2QIEB 1UWMA 2RDHA 3AV8A 1HTOA 2J52A 4ZHOA 3VVWB 2OJWA 2Q5WD 3PTFC 2KD0A 2IJ0A 2MRPA 2M1MA 2NTSA 2LGSA 3A9KA 2ZCBA 2NPTA 5D6JB 5HI1A 3MP9A 1FCLA 1JWAD 2DYBA 1NBFC 3P4QB 4BFRA 1PGXA 4JL9A 3VFKA 1WJ4A 2CHZA 4A20A 2KMAA 2SEBD 3LXFA 2KQ4X 4MSMB 3NY5A 2QC8A 1R4NB 2WXOA 4TQ1A 2WLBA 3ZVVA 3T9LA 5AEKB 5JXVA 3A9JA 4HCPB 1F1HA 1FPYA 1MFWA 1Q5WB 2K25A 1DGJA 2JZ3B 3P63A 4FLHA 2X8XX 5D94A 5I4DA 4XDDA 4N59A 2KACA 1L0VB 2W3SA 1SB3C 4OW0A 2KN5A 4AJYB 1EM7A 2IO1B 1K51A 3ZJUA 4OHJA 3GB1A 3V3XA 1WGHA 2LGYA 3ECIA 3H7PA 1T0YA 3I3TB 2MSED 4J3OD 4PS8A 2AQ3B 3BZDB 2GBKA 3BYYB 3J9CA 1FM0D 1JWBD 1GG3A 1OQQA 1WM2A 2L3ZA 3HIZA 1QOFA 3DHGC 1Y8RC 1GC7A 4HPPA 3KYCD 1TY0A 1DYQA 3HK0A 1QKZA 2QCZA 1F77A 1C9FA 2NR2A 3UI3A 3WALA 3LYYA 2LJ5A 4RMAA 2KDEB 2YEPF 3ETRA 1TGZB 4FN2A 4GDKB 2X38A 1V81A 4HLEA 3OAWA 4C56C 1JMLA 3RNEC 4B0EA 4ZYSA 1Q10A 2C60A 1ZOYB 2BS4B 2MBEA 2KTFA 5FK9C 4ARCA 3DWMA 1RYJA 4JWUC 4E74A 3ML8A 4P1CC 4JLCA 3GS2A 3AXCA 1D5ZC 1WWTA 3OWEB 2WWZA 3VDZA 2HDEA 4IWOA 1F2RC 2BVCA 4XDCA 2A4ZA 1IYFA 1XF5L 3PV1A 1OEYJ 4MGYE 2EELA 3AE1B 5JH5C 4YL8A 4NQKE 3WA0A 1YD8U 1ET9A 2JYEA 2LASA 2MX2A 5BYSA 2NCNA 3MJWA 4AUQC 4LTUA 2KLGA 3QWZB 1DOYA 3AM9A 4WWOA 2K8CA 4EOYA 3B0AA 2K6QA 1HQRD 4I6NB 1SIJA 4ZRQA 5C1ZA 2R61A 4WWPA 3KVFB 2INPE 2K22A 1YN5A 3CMMB 5EE0A 4O1NA 1I4RA 3Q8AA 1GUAB 1JROA 4RF1A 4YT0B 2W9NA 1P7FA 1SE2A 3SEBA 2EKEC 2MHJA 2DENB 2JQRB 5G2NA 4WH4A 3T8MA 1E8YA 3B9JA 2RDBC 1RRBA 4KDLB 2V3NA 2D3CA 1KF6B 5IO9A 4PK1A 3R2IA 4NPNA 1TZOA 3RZFA 2WU5B 2KDIA 2KDFB 2JUOA 4W9DA 1PYWD 3K9OB 1L4DB 3M3JA 3W9CB 4BKTA 3ZUNA 4YTNB 3V6EB 1R4MI 4DHJB 4G3XB 5CHFA 3TEYA 3VUYA 3P42A 4NNJB 5J2RA 1WH3A 3NOBA 2MH7A 2VH2A 3JSVB 4W9LA 4AS1A 4YTMB 2O6VB 3N30A 3HRDD 1YX6B 3KUZA 1TJEA 2LEKA 3NVZA 1ZXHA 2C7NB 2L83A 3VRAB 1ZE3D 2GB1A 3Q3JA 3V6CB 1KFYB 4A8XC 1PFDA 3AE4B 2DBYA 3BK1A 3I9V1 3VUWA 4XC2A 1GOZA 4IOIE 5IP4D 3DVNU 4MGKE 5AZFA 1BMLC 2N7EA 2CJNA 1J19A 4GMVA 2GBRA 3AEFB 3L0WB 1UGMA 1WXMA 1ZW7A 4BKSD 4PS3A 2OHFA 3AEBB 2GI9A 4OVVA 2BBCA 2OEDA 4YSXB 4HK2A 3A4RA 1FXAA 4CO7A 4WJNA 4E71A 2LGDA 5J18A 3PGEA 4C4VB 4MH8A 4ZRJA 4H2AA 2W3RA 4KIKB 1QOAA 4J6IA 3GOEA 2MQJA 2J42A 2KWCA 4MEMA 3EA6A 1WX9A 1QT9A 2QJLA 1TTNA 4AWJA 2IO2B 2ON8A 1JQ4A 2W54A 4ASWC 2BPSA 3ZXVA 1VZ7A 2DAJA 2QSDA 3C0RB 3ZGZA 3HVDA 2WXQA 4PT5A 3JYUA 4M01A 2O2VB 4M02A 1LGRA 4IM0A 3DPDA 3AEGB 3OG5A 3PVLA 2WYQA 1E10A 2NMQA 3DBLB 3U30A 2PEAA 3GZNI 3Q8BA 3DBSA 4N58A 2CHXA 2ZJDA 2JX5A 3VAWA 5KHQA 3TEWA 2ASQA 3DHHC 3Q3NC 4K7UA 2JY6A 5E6JA 3ZRCA 1N63A 2MJEA 1YN4A 3N20C 1V86A 4IW0A 1FD6A 5J17A 1SSNA 4DXFA 4ANWA 4P1BC 4BVUC 2IO3B 1LQBA 4DHZE 3ALBA 1ET6A 1AN8A 1E5WA 4BOSC 1JRPA 2YVCA 5LLIA 1QILA 2HD5B 2DYOA 2LUEA 3RULA 3Q6BA 1JCKB 3NVWA 1YJIA 2JZPA 2KKCA 3U52E 1I42A 3C8YA 2D10A 4PS7A 5JZEB 1SF0A 1L0YB 3L17A 3AE8B 2KZRA 5DPSA 1CZPA 2INNE 4I6LB 2M17A 3IT6B 3W2DA 3EFCA 3O65B 4WIPA 3UF8A 2NPTB 2W82A 3SR6A 1KTKA 5IKCM 4F7ZA 1LO5D 4GIVA 2J0MA 1YJJA 1V97A 2WX0A 1FXTB 2LJIA 2ONQA 2JWZA 4S17A 5E6OA 4LDTD 1YIWA 3DBRI 1TKEA 5HHDG 2WNMA 3H6NA 4JIOU 4W9KA 2DZJA 4W9JA 2PE9A 3AU4A 5TR5A 1ZKHA 4BKSA 2A5UA 3A9JB 1PQSA 3ZLZA 3V61A 4YSZB 3QCAA 4BZAA 1V5TA 1SEBD 2WXFA 1WFYA 1YX5B 2H89B 4REZA 1WM3A 1NDDA 2XBBC 2QEJC 2W55A 3P4SB 2UYZB 2FCSA 4B6WA 4N6EB 4B9KA 3NS8A 3H7PB 2KNBA 3AH7A 3Q2AC 4RM9A 3VTWA 2MBHA 5BYQA 2WXKA 4RGMA 5BMHA 1WX7A 2R2QA 5IN7A 4KVGB 1XO3A 3L4PA 1V49A 3RI7C 1FNUA 1E8ZA 4YTPB 2AWTA 1IUEA 3SHQA 2BTEA 2LVOA 3NVVA 4HKZE 4K3BA 2XNAC 3L13A 3BINA 2V4IB 1I4HA 1BT0A 2LI5A 1UUPA 1WXAA 1RFAA 1OTRB 4HPMB 4Q2JA 1WGKA 1MVKA 3EHVA 2KX0A 2RPQA 3AE2B 3DWGC 3AU5A 2IDYA 4RH6A 4IUMB 1TKGA 3RNFC 1WR1A 2ICIA 5H92C 3CSTA 1OGWA 2PTLA 2NBVB 1JWSD 2L0TA 4DQOC 3ONSA 3RT3B 5BMIA 5AZGA 3AE6B 3KW5B 3VTUA 4EZJA 5CHWA 4YWGG 1EU3A 2LUMA 3KWLA 2RR9A 3VTVA 1P0RA 3ENEA 2BB6A 4M8MA 3PPAA 2NS5A 3SFDB 3UQAA 1BUIC 3DVNV 3PREA 3PZ7A 2IBIB 4A9AA 2EMTA 3AEDB 4DDGD 3AB5A 2KWVB 4ZOHC 4KX6B 2J53A 3MC0B 1RWSA 1VR9A 4XX5A 2AYOB 1KOTA 1NI3A 2BW2A 1XCTL 2LZ6A 3GE3C 2Y3AA 2MBOA 3QA8A 1WYGA 1D3ZA 1ZPSA 2WX1A 1ESFA 1KRHA 4NJ6A 4AJWA 2K8HA 1PUTA 2LMCA 4W9GA 1TS5A 4X57B 2DX5B 3EC8A 3BK2A 1M94A 3NHEB 4AOFA 3X0WA 4ANXA 4W9IA 1T0RC 3KLSX 2J7QB 3TL5A 3VR9B 4DK5A 1AW7A 3CWIA 3FILA 3N1ZC 2HTHA 1V1PA 2BF8B 1WJNA 1WF9A 2LXAA 2WDVB 3PLUA 3RZWC 4FJVB 1J0GA 3VUXA 5IA7A 3PRPB 4WQOB 4HKQA 5C3JB 4ZHPA 2JXXA 2HJ1A 4RM8A 3ZDMC 2KANA 2MJ3A 2GLSA 2CKHB 4NJCA 1E90A 3NZSA 3VR8B 2N9LA 4LJPB 1RFKA 5BMGA 1ZP0B 3QQ8B 5HKHA 3H9DA 1UH6A 4WAFA 3ZNZB 3BVGA 2BYVE 1PGAA 2L05A 1RM6C 1I4GA 1N60A 2K8BA 1WZ0A 2JRHA 3GE8C 3KH0A 4FJZA 2KFKA 3M95A 3ZKJC 4XZ4A 4B0MA 2WQYB 1IP9A 3W5UB 1HZ6A 2KHWB 2KJ6A 1VDVA 4JGHB 3Q3MC 1E0ZA 4HXDA 2L0FA 4EEWA 3QIJA 3DBHI 4OVZA 1DOXA 1WRIA 1ZXIA 1C4CA 4HCNB 3U7ZA 2M4NA 1XT9B 4GLSC 2PVOD 3H7SA 2BS2B 4BBNC 3MHZA 2UWQA 2KQ7A 4C7YA 4E3CA 3PHWB 1E6EB 2KYWA 3MC8A 1SIFA 4MACA 1T3QA 4MSQB 5EE9A 1WJUA 4OZBA 3RNAC 2V3PA 1WIAA 2MBBB 2MLBA 3S2AA 2KXJA 1ROEA 4WWNA 1OQRA 1L0XB 1QLBB 3AECB 3EECA 5EE1A 1SGHA 4MM3B 3AI5A 3HM3A 1YQ4B 1JRUA 1UF0A 2V4LA 2J0KA 4EKUA 4HJGE 4CQNA 2DZIA 2WU2B 3JW0X 2NVUI 4CHKA 2ZPNA 1P98A 3Q8FA 1SE3A 1L6UA 1T5XD 2Z59B 1I7HA 4G50A 2KX3A 3DCGA 3APFA 4FXCA 4R3DA 4TMAB 5JHBA 3FKYA 1QZEA 1YQ3B 1C76A 1I35A 2PE6B 2WDRB 1CJEA 1C79A 4FADA 3MC9A 4HDQA 4LNNA 4YXDB 3VRBB 1GC6A 2PMVA 2WXMA 5H8YE 2ZVOA 2BQQA 2JVCA 3B2FA 2AQ1B 4FHKA 5C23A 4IM2A 3OJ4B 3E9SA 3Q8EA 4ZDVA 3K9PB 3ZJTA 3MHSD 5L83A 1V8CA 4GSWA 1U4AA 1GNUA 4USAA 1HE8A 2AX5A 3WAOA 1QF6A 2MCNB 3IXSA 3IG3A 3UIOB 2K3UA 4ZRIA 3A4SC 2REXA 1WXQA 1I4XA 4WURA 3BVMA 3W1SC 2PW9A 2PLPA 2KMMA 2Z0EB 2C9WB 1MG4A 3ZQ4A 3NZUA 3T3NA 1A70A 1HZ5A 4GGQA 5DPTA 2LXCA 2MA9B 1T0QC 2XK5A 3W1SA 2KLCA 2MJDA 3N1XC 1WY8A 1JALA 3U8ZA 2AQ2B 1MHHE 4D2KA 5LNK1 4N9F4 4DHZB 2WXNA 3AE9B 3VH4B 1RAXA 3VH3B 1SE4A 2L52A 1T0SC 3NG0A 4LJOB 2I2YA 2FCQA 3HM6X 3L16A 3R7RA 2FUHB 1QOBA 3TJPA 4NY0A 2INCC 5E6NA 4KKIA 2FUG1 4IDIA 5G55A 1SBBB 2G9HD 3O13A 1KH0A 1CMXB 2D5GA 1R4NI 1N6ZA 5HG2A 1UZXB 2FAZA 1HTQA 1NVID 2LRWA 2BT6A 1MHXA 3AE5B 2N9XA 1Z5SB 5IOIA 1ZUD2 4MM3A 2KJRA 1EF5A 1KJTA 1L4ZB 2LHEA 1LM8B 2KFJA 1J7CA 3TUOA 1KLVA 1T6BX 3H8HA 4XYCA 3VHTC 2XEWA 3BVZA 1TZ1A 2BWES 5EDSA 2MEKA 2BYFA 2MP2B 5D3IB 1WE7A 3Q8CA 2ZNVC 3QARA 4TUUA 1TT5B 2KDMA 4A3OA 2FCNA 1YOVB 2R2OA 2QDFA 2K9XA 4MT5A 3RPFC 1STEA 2DZKA 3E56A 2CJOA 4FBJB 4HWIB 5GMVA 3RCZA 4C80A 1V9JA 4IG7B 2JT4B 4KKJA 2DHZA 4M8NA 2L7RA 1E7VA 4LDTB 4C7ZA 2RDGA 3X23A 2KVZA 2KTRA 2DAFA 4IC7B 3EFUA 2V1YA 3FAHA 3I63C 4A55A 4NAMA 4G0NB 2TSSA 3H1UA 3DVGY 2Y5CA 4TKNA 2G1EA 5FR3A 1EO6A 3N3KB 4ITKA 1A5RA 2L1AA 1K52A 3I5JC 1ZDXA 5DPRA 3CIRB 4EUTA 1UELA 3MJ5A 1NYRA 4BKGA 3P2BA 3MTNB 2ZW1A 4K81A 1C77A 3P4PB 3L54A 4WWMA 3AEEB 1ZGUB 2JRIB 4JQWC 4FJYA 2BGFA 1UBQA 2PIAA 3AE3B 4P7IA 2KK8A 1E8XA 1L6VA 2WGSA 4II2B 1Z2MA 4RGTA 3N1YC 4MGIE 1P3QU 2LHDA 4KGRA 4KZCA 2LRUA 1NYQA 3FILB 2D07B 2VH1A 1V1PB 1KM7A 1Y56A 4XE0A 4EFOA 1QQRA 1FEHA 1WI0A 3RNBC 4K1RB 5CX3A 3V60A 3KUDB 1R4MB 2M56B 3APDA 3B08A 3WANA 3V62A 4ICVA 3UGBB 3ABVB 1N62A 1J7BA 1J8CA 1UD7A 1AARA 1VD2A 2AL6A 3QAQA 5KHOA 4IWPA 3PT2B 4LNIA 4WJQA 3IAM1 1GPXA 3DOWA 1RLFA 4CYEA 4GDLA 2MW5A 4IM3A 4KSLC 1WSPA 2ZCCA 3Q3OC 1C4PA 1B1ZA 1FRDA 1IGCA 1Q0WB 2KFKB 4UDUC 1P9DU 2MWSB 2LGIA 4M00A 2WXRA 2MP2A 4FHJA 2FNJB 2OOBB 2C7HA 1VZ8A 4B95A 2I38A 5BO4B 4F8CB 2KVRA 4WQMA 1MG8A 2KDBA 4DDID 1OEYA 2K1FA 3WAMA 2JWUA 1TYGB 2N9KA 4GOCA 2C7MB 2PKOA 4G11A 2HE7A 2KWUB 2GMIC 4L1BA 4HPLB 4HRSA 2IY1B 5T8IA 1NENB 4I6PA 2CR5A 1I4PA 4C00A 2YLMA 4LCDE 2BYTA 1GB4A 2D11A 3N32A 4RFBA 2ZEQA 1F0ZA 3RNCC 4ANVA 3GZNB 5D3DA 1J7AA 4LNKA 4S0RA 2NBWB 5CTRC 3SU8X 3CF6E 1P7EA 2QHOA 4JX1C 4HROA 4YSYB 3BY4B 2BS3B 1SJHD 1WXVA 2E6XA 2RPVA 1I4QA 1SXTA 3LJ3A 4MH0E 3EGRA 4P6VF 2LWPA 4JPSA 3DHIC 2BWFA 1E8WA 1TS2A 4IWQA 2RSUA 1JWMD 3RMKC 2JXTA 3DDCB 3RFZB 2L32A 4GN1A 1D4BA 2K0PA 4OVUA 3NUHB 5HFYA 5AUIA 2G4SA 1LFDA 2GOWA 2L8JA 5FR6A 1XLOA 1XCQL 3PZ8A 2NBUA 1TIFA 3P4RB 1SJED 1TY2A 3ZW3A 3DBLI 2WXPA 2CHWA 4K7SA 2LVPA 4RGOS 1V6EA 2D3GA 3AMZA 2BYEA 2KO3A 3PRZA 2L76A 4AP4C 3BYTB 3DVGX 2OJRA 2INDC 3OJ3A 3D32A 3PHXB 4M0WA 2L00B 3TEXA 2PVGC 2N7DA 4HEA1 4WAAA 1WE6A 3DBRB 2LFIA 1XEEA 1FCCC 2IYDB 2AL3A 1EUVB 4A6QA 3L10B 4MJSB 3R66C 2AEHA 3ML9A 3QK0A 3IVFA 4EZKA 2CU3A 3ZJVA 1C4AA 1P1AA 1UBIA 2IGHA 2N1VA 2GBMA 1WGRA 1ENFA 1FMAD 1N5WA 1N61A 4F1SA 2ACZB 1F9JA 1TS4A 2XK5B 3A1QA 2JPHA 3N9YC 3KQ4A 2KJHB 4US9A 4ZRKA 1GAQB 2M19A 1FNVA 4XGAB 1UGJA 5IAAC 3Q3FA 1YNTE 2K39A 4W9HA 2M0AA 2B3AA 5C2TB 1F52A 1CK1A 2M8SA 4JWSC 3R8BA 4TQ0A 2KC2A 1WGDA 3QJZA 2WXLA 3DQVA 2FCMA 1XLPA 3QC8B 5LXIB 3TEZA 2DZMA 2D3BA 1GB1A 1OQYA 4GB9A 1IPGA 3QHTA 2IPKD 4OZCA 3R2TA 2JU6X 4IKGA 4NAWB 5L95C 4DBGA 5DCNA 1R7SA 3U4EG 1FFVA 4EZLA 2Z8LA 3W1YA 1FIQA 1E7PB 2PPHA 3P1MA 2N9EB 3NRZA 3ZIMA 3RUIB 2E3TA 3RYTA 1UWXA 3V05A 3R3MA 2RGFA 3RNGC 1XLNA 3IBEA 3AEAB 3ZO5B 1WRDB 3Q69A 1XQQA 3IAS1 1L2NA 5AUKA 2H88B 2D2QA 5D7GA 2DNFA 1PGBA 2KC1A 2I1JA 1S3SG 3RN9C 3T3OA 2ZNVB 3ZRFA 3AN1A 4MGZE 1MPEA 1VZ6A 4L23A 4BAXA 4ZYNA 3NVYA 1D6EC 2GBJA 2FBWB 4AQ7A 2KTRB 1WGYA 1C78A 2C5LC 3IT4B 4NQLB 4DHJD 3PO0A 1IBXB 4K7WA 4KSKC 4II3B 2KAJA 2JZZA 2WDTB 4PYZA 2V3SA 1E7UA 2O6VD 2YEPB 2ZW0A 3U7DA 3PS6A 3NS1A 3FC4A 1C1YB 1YQBA 2RD0A 2EKIA 4LNFA 3ZTCA 3SD5A 1WMHB 2JYTA 2NTTA 2WXGA 1H8CA 1VRAB 3SFEB 2BKRB 4GDKA 2K5PA 2N1WA 1NI2A 4MJSA 4DXGA 3TIXA 4A3PA 3KWVA 2JF5A 1VLBA 2KN4A 3LB8C 5E6PA 2KQSA 2N9PC 3ZXRA 2HJ8A 4L2YA 2G4DB 4KV2A 2Y5PA 4NJ7A 2MBQA 2N4FA 3SDLC 1EF1A 1ZDVA 1FRRA 2B76B 3ZYYX 3W5VB 3HVZA 4FULA 3JVZX 3I57A 5D2MB 1JW9D 2Z0DB 1D5XC 1V1OA 1KLUD 4ARIA 4W9FA 4XWWA 1F2RI 4KGSA 3TMPB 2IZVB 3HHMA 2DYMA 2WDQB 4HJKA 3QX1A 2J0JA 3CSFA 1TS3A 4TV3A 4EE2A 4US8A 3URYA 1WYWB 3PSEB 3M62B 3AULA 3TSSA 1KLGD 4LK0M 2CU1A 1D5MC 1FXIA 1G6JA 2VRRB 1DOIA 1B9RA 5LXHA 4TSSA 1AYFA 3C19A 3UQBA 4QAYA 4W9EA 3PLVA 4OZAA 1M4VA 1OFFA 2FE8A 1K50A 1FNWA 4NAWA 4LNOA 3RD2A 3VXWA 4GDLB 2DWQA 4ANUA 1AWDA 1EWYC 4KDIC 4XWTA 3U2SC 1HXYD 5AZHA 1VCBA 2EMSA 4GU2A 4MELA 3BIID 1C3TA 1EWCA 5G5GA 2FIDA 3PRMB 3TCAA 1GJZA 1TBEA 3NZ3A 2N7JA 3L08A 5G5HA 4LLGM 1LXDA 1L5PA 2IGDA 3TBLD 3IHPC 3AE7B 1N5XA 1TKYA 3DBHB 2V0GA 2KWDA 3Q14C 1JWUD 1NEKB 5JHAA 3A9KB 3JSVA 2O6VA 1HEZE 1IBXA 2VZKB 1S1QB 1MJDA 2LGXA 4W9CA 4BBNF 3BWUD 2QMTA 1WX8A 3NJTA 2VZKD 4DXAB 2PJHA 3UIPB 2G45B 1WJ6A 3WIMA 1ACCA 1V2YA 2KT7A 4KGTA 2WXIA 3WCQA 3MFGA 3B2GA 4HVBA 4RNAA 2JSVX 1WMHA 2SAKA 5FKAC 4P16A 3KUCB 2V9HA 3GP7A 1CQVA 5CHVC 2G3QB 2J4XA 2K6DB 3EUB2 1V80A 5GXGB 1QOGA 4K3CA 4PYUA 2FIFA 4FA6A 3APCA 3ZNGC 2QILA 3KYDD 2WXJA 1PDXA 4NZLB 4GXBA 4WJPA 2IY0B 1EU4A 3A33B 4C4VA 1SE9A 2DLBA 4MDKE 4KIKA 2Y5BB 1WZ3A 1FFUA 3IFWB 1K53A 2WS3B 2XN9C
chains in the Genus database with same CATH topology
3M63B 2LWPA 3EECA 1SGHA 3ZTDA 3AI5A 2O2VB 3HM3A 4IM0A 2BWFA 3DPDA 1JRUA 1E8WA 1Q1OA 1X1MA 5DPWA 2ZZPB 3PVLA 2V4LA 2WYQA 2J0KA 3U30A 2PEAA 3GZNI 4IWQA 1YJ1A 2RSUA 3DBSA 4EKUA 4WJOA 2CHXA 2I1KA 3LDZE 3PZDA 2ZJDA 2DZIA 3VAWA 5KHQA 3DDCB 4BOZB 2ASQA 4GN1A 3JW0X 4K7UA 2JY6A 2ZVNA 4OVUA 2NVUI 1WGGA 4CHKA 3ZRCA 2G4SA 1LFDA 1K8RB 2GOWA 2L8JA 1V86A 1P98A 2ZPNA 4IW0A 5FR6A 5J17A 2M0XA 1L7YA 4ANWA 2LVQA 2O2VA 4BVUC 1XD3B 2IO3B 2Z59B 1LQBA 2NBUA 1H4RA 4M0WB 4DHZE 4DWFA 3ALBA 4G50A 1E5WA 3UINB 4ICUA 2KX3A 3DCGA 4BOSC 3APFA 1V5OA 3DBLI 3ZW3A 2CS4A 2YVCA 5LLIA 5JHBA 2CHWA 2HD5B 2KOXA 1WR6E 2DYOA 2LUEA 2LD9A 1QZEA 4K7SA 2LVPA 3RULA 1V6EA 4HDOA 2D3GA 3OLMD 3ZNID 2BYEA 2KO3A 3PRZA 3VQIA 2L76A 2KKCA 4AP4C 1I42A 3DVGX 2OJRA 2KMCA 2D10A 4PS7A 3OJ3A 3ZDTA 5JZEB 3D32A 2IO0B 3L17A 1I35A 2PE6B 2KZRA 3PHXB 2ZPYA 5DPSA 3B1LX 3R7QA 2L00B 4KZ0A 3A1QB 4FADA 4I6LB 2N7DA 4WAAA 3WAPA 4HDQA 1WE6A 4URKA 2GBNA 2M17A 1GC6A 2BKFA 3ZNHB 2IYDB 1ISNA 1EUVB 2AL3A 3L10B 2ZVOA 4MJSB 2JVCA 3O65B 3R66C 2AEHA 2NPTB 3ML9A 1WXSA 4FHKA 5C23A 3UF8A 4IM2A 3QK0A 3IVFA 4EZKA 3OJ4B 4F7ZA 4ZDVA 3K9PB 1P1AA 3MHSD 1UBIA 2N1VA 4GIVA 5L83A 2GBMA 2J0MA 3VVWB 1WGRA 4GSWA 1GNUA 1U4AA 1HE8A 2WX0A 3WAOA 4F1SA 1F9JA 2MCNB 2XK5B 3A1QA 3PTFC 1FXTB 2KD0A 2JPHA 2MRPA 3IG3A 3UIOB 2JWZA 2KJHB 5E6OA 2M1MA 4ZRKA 4ZRIA 3A4SC 2REXA 4LDTD 1YIWA 3DBRI 3H6NA 4JIOU 4W9KA 3W1SC 2DZJA 3A9KA 2ZCBA 2NPTA 5IAAC 5D6JB 4W9JA 2PE9A 2Z0EB 3AU4A 5TR5A 1ZKHA 3Q3FA 4BKSA 2C9WB 2A5UA 2DYBA 1PQSA 2K39A 3A9JB 3V61A 3ZLZA 3NZUA 1NBFC 2B3AA 4W9HA 3QCAA 4GGQA 5DPTA 2LXCA 4BFRA 4JL9A 1V5TA 2MA9B 3VFKA 1WJ4A 2CHZA 2XK5A 3W1SA 4A20A 2KMAA 2KLCA 1WFYA 1WY8A 1YX5B 3U8ZA 4MSMB 3NY5A 2M8SA 4N9F4 4DHZB 4TQ0A 1WM3A 1NDDA 2XBBC 4TQ1A 3VH4B 2KC2A 3ZVVA 1WGDA 1RAXA 3QJZA 3VH3B 4LJOB 3T9LA 3DQVA 2FCMA 3QC8B 5AEKB 5LXIB 2DZMA 3A9JA 2FCQA 4HCPB 3HM6X 3L16A 2UYZB 3R7RA 2FCSA 4B6WA 1OQYA 2FUHB 1Q5WB 4GB9A 2K25A 1IPGA 3QHTA 3NS8A 2JZ3B 3TJPA 4B9KA 4FLHA 4NY0A 3H7PB 5D94A 2KNBA 5E6NA 4RM9A 3VTWA 4NAWB 2MBHA 5L95C 4DBGA 5DCNA 5G55A 2KN5A 4AJYB 1CMXB 1R4NI 1WX7A 4EZLA 2IO1B 2R2QA 1UZXB 2FAZA 3W1YA 2LRWA 4KVGB 1V49A 2N9XA 1Z5SB 1WGHA 1E8ZA 2AWTA 3SHQA 2LGYA 2PPHA 2LVOA 2N9EB 3ECIA 4MM3A 2KJRA 3ZIMA 3H7PA 1T0YA 3RUIB 3I3TB 2MSED 3L13A 4PS8A 3BINA 1EF5A 1KJTA 3RYTA 3R3MA 1BT0A 2LI5A 1WXAA 2GBKA 1RFAA 1OTRB 1LM8B 2KFJA 4HPMB 2RGFA 1GG3A 1KLVA 1WM2A 3IBEA 3ZO5B 1WRDB 2L3ZA 3VHTC 2XEWA 3HIZA 1XQQA 3EHVA 2KX0A 2RPQA 1TZ1A 3AU5A 1L2NA 1Y8RC 2BWES 1GC7A 5D7GA 2D2QA 5EDSA 3KYCD 2KC1A 2I1JA 1S3SG 4IUMB 3HK0A 2BYFA 2ZNVB 3ZRFA 1WR1A 3CSTA 2MP2B 1OGWA 4MGZE 2NBVB 2NR2A 2L0TA 3WALA 4ZYNA 1WE7A 3ONSA 2GBJA 2LJ5A 2ZNVC 3QARA 4TUUA 3RT3B 4RMAA 2KTRB 2KDEB 5AZGA 1WGYA 1TGZB 2C5LC 2FCNA 4FN2A 4A3OA 4NQLB 4GDKB 3KW5B 4DHJD 2R2OA 3VTUA 1V81A 4K7WA 2DZKA 4KSKC 3OAWA 4HLEA 4II3B 4EZJA 4FBJB 4HWIB 2JZZA 2WDTB 4PYZA 2V3SA 5CHWA 5GMVA 3RCZA 1E7UA 2O6VD 1V9JA 3U7DA 4IG7B 2JT4B 3PS6A 2DHZA 2C60A 1C1YB 4M8NA 2RR9A 2L7RA 1E7VA 4LDTB 1YQBA 2RD0A 3VTVA 1P0RA 3ENEA 2MBEA 3X23A 2KTFA 2KTRA 2DAFA 4IC7B 3EFUA 2V1YA 1WMHB 3PPAA 4M8MA 3SD5A 3ZTCA 1H8CA 4G0NB 4E74A 2BKRB 2NS5A 2N1WA 4GDKA 3H1UA 3DVGY 1NI2A 4MJSA 3ML8A 3TIXA 4A3PA 4TKNA 3UQAA 1EO6A 2JF5A 3N3KB 4JLCA 1A5RA 5E6PA 3AXCA 2KQSA 3DVNV 3PREA 2N9PC 2WWZA 2HJ8A 2IBIB 2G4DB 4KV2A 3VDZA 2EMTA 4NJ7A 4IWOA 2MBQA 2N4FA 4DDGD 3SDLC 1EF1A 5DPRA 2KWVB 2A4ZA 4EUTA 1IYFA 1UELA 4FULA 3PV1A 3JVZX 1OEYJ 5D2MB 2Z0DB 4MGYE 4BKGA 3P2BA 3MTNB 4XX5A 2AYOB 1KOTA 4K81A 3L54A 5JH5C 2LZ6A 4YL8A 4NQKE 4W9FA 3WA0A 1YD8U 1ZGUB 2JRIB 4FJYA 2BGFA 1UBQA 4JQWC 2LASA 4P7IA 3TMPB 2IZVB 2MX2A 2KK8A 2MBOA 3QA8A 1E8XA 2NCNA 3MJWA 4AUQC 3HHMA 2KLGA 1D3ZA 4II2B 2WX1A 3QWZB 1Z2MA 2DYMA 4AJWA 4NJ6A 4WWOA 4HJKA 2K8CA 3QX1A 4EOYA 2K8HA 4MGIE 2J0JA 1P3QU 3B0AA 2K6QA 4KZCA 2LRUA 3CSFA 4TV3A 2D07B 4I6NB 4W9GA 5C1ZA 1KM7A 1WYWB 4WWPA 3KVFB 3M62B 3PSEB 4EFOA 3AULA 4X57B 2DX5B 3EC8A 3CMMB 1M94A 2CU1A 1G6JA 1WI0A 3NHEB 1GUAB 2VRRB 5LXHA 4AOFA 2W9NA 4K1RB 3X0WA 4ANXA 5CX3A 4W9IA 3V60A 3UQBA 3KUDB 4W9EA 2J7QB 3PLVA 3TL5A 4DK5A 2EKEC 3APDA 4NAWA 2DENB 2HTHA 3B08A 5G2NA 3RD2A 3T8MA 1E8YA 3VXWA 1RRBA 2BF8B 3WANA 4GDLB 3V62A 4KDLB 4ICVA 3UGBB 1WJNA 4ANUA 1WF9A 4KDIC 4NPNA 2LXAA 1J8CA 3RZFA 2KDIA 2AL6A 1VD2A 1UD7A 1AARA 2KDFB 3QAQA 3PLUA 3RZWC 5KHOA 2JUOA 4FJVB 4W9DA 1J0GA 3K9OB 5AZHA 3VUXA 1VCBA 3PRPB 5IA7A 4WQOB 3M3JA 2EMSA 2JXXA 4BKTA 3ZUNA 4IWPA 3PT2B 3V6EB 1R4MI 4GU2A 4MELA 4WJQA 4RM8A 3ZDMC 3DOWA 2KANA 4DHJB 4G3XB 1RLFA 5CHFA 3VUYA 4NNJB 1C3TA 5J2RA 1WH3A 2CKHB 2FIDA 3PRMB 4CYEA 1E90A 3NOBA 4GDLA 3TCAA 2MW5A 3NZSA 4W9LA 3JSVB 4IM3A 2O6VB 3N30A 4KSLC 2ZCCA 4LJPB 1GJZA 1Q0WB 2KFKB 1TBEA 1YX6B 1P9DU 3KUZA 3QQ8B 2MWSB 3L08A 5HKHA 3H9DA 2C7NB 1UH6A 1LXDA 2MP2A 4FHJA 3ZNZB 2FNJB 3Q3JA 3V6CB 3TBLD 2BYVE 2OOBB 3IHPC 2C7HA 2L05A 2K8BA 3VUWA 4B95A 4XC2A 5JHAA 3A9KB 1WZ0A 3JSVA 5BO4B 3DVNU 4F8CB 2KVRA 4MGKE 1MG8A 2O6VA 5AZFA 2KDBA 2N7EA 4DDID 2JRHA 1OEYA 2K1FA 3KH0A 4FJZA 2KFKA 1S1QB 1J19A 2LGXA 3M95A 4W9CA 3WAMA 3ZKJC 4XZ4A 4BBNF 4GMVA 1IP9A 2GBRA 3L0WB 1UGMA 1WXMA 1WX8A 1ZW7A 4GOCA 4PS3A 2C7MB 4BKSD 4G11A 4DXAB 2KHWB 2KJ6A 2PJHA 4JGHB 3UIPB 2G45B 1WJ6A 3WIMA 2HE7A 1V2YA 4HXDA 2L0FA 2KWUB 4EEWA 4OVVA 2GMIC 4HVBA 3QIJA 3DBHI 4HK2A 1WMHA 3A4RA 4CO7A 4HCNB 4WJNA 4HPLB 4E71A 2LGDA 2M4NA 5J18A 2IY1B 1XT9B 3KUCB 4I6PA 2CR5A 3PGEA 4ZRJA 4KIKB 3H7SA 5CHVC 4J6IA 3GOEA 2G3QB 2MQJA 2KWCA 2YLMA 4BBNC 4MEMA 2K6DB 2UWQA 4LCDE 1WX9A 2KQ7A 1V80A 2D11A 4E3CA 3PHWB 3N32A 1TTNA 2ZEQA 4PYUA 2FIFA 4AWJA 4ANVA 4FA6A 3APCA 1SIFA 2IO2B 3ZNGC 4MSQB 2NBWB 5CTRC 3KYDD 3SU8X 2BPSA 3CF6E 1WJUA 4ASWC 4GXBA 4WJPA 2IY0B 2DAJA 2QHOA 1WIAA 2MBBB 2MLBA 3C0RB 3S2AA 2KXJA 3A33B 3BY4B 1SE9A 4MDKE 4KIKA 4WWNA 1WXVA 2Y5BB 1WZ3A 3IFWB 3JYUA 3LJ3A 4MH0E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M63 B;  2LWP A;  3EEC A;  1SGH A;  3ZTD A;  3AI5 A;  2O2V B;  3HM3 A;  4IM0 A;  2BWF A;  3DPD A;  1JRU A;  1E8W A;  1Q1O A;  1X1M A;  5DPW A;  2ZZP B;  3PVL A;  2V4L A;  2WYQ A;  2J0K A;  3U30 A;  2PEA A;  3GZN I;  4IWQ A;  1YJ1 A;  2RSU A;  3DBS A;  4EKU A;  4WJO A;  2CHX A;  2I1K A;  3LDZ E;  3PZD A;  2ZJD A;  2DZI A;  3VAW A;  5KHQ A;  3DDC B;  4BOZ B;  2ASQ A;  4GN1 A;  3JW0 X;  4K7U A;  2JY6 A;  2ZVN A;  4OVU A;  2NVU I;  1WGG A;  4CHK A;  3ZRC A;  2G4S A;  1LFD A;  1K8R B;  2GOW A;  2L8J A;  1V86 A;  1P98 A;  2ZPN A;  4IW0 A;  5FR6 A;  5J17 A;  2M0X A;  1L7Y A;  4ANW A;  2LVQ A;  2O2V A;  4BVU C;  1XD3 B;  2IO3 B;  2Z59 B;  1LQB A;  2NBU A;  1H4R A;  4M0W B;  4DHZ E;  4DWF A;  3ALB A;  4G50 A;  1E5W A;  3UIN B;  4ICU A;  2KX3 A;  3DCG A;  4BOS C;  3APF A;  1V5O A;  3DBL I;  3ZW3 A;  2CS4 A;  2YVC A;  5LLI A;  5JHB A;  2CHW A;  2HD5 B;  2KOX A;  1WR6 E;  2DYO A;  2LUE A;  2LD9 A;  1QZE A;  4K7S A;  2LVP A;  3RUL A;  1V6E A;  4HDO A;  2D3G A;  3OLM D;  3ZNI D;  2BYE A;  2KO3 A;  3PRZ A;  3VQI A;  2L76 A;  2KKC A;  4AP4 C;  1I42 A;  3DVG X;  2OJR A;  2KMC A;  2D10 A;  4PS7 A;  3OJ3 A;  3ZDT A;  5JZE B;  3D32 A;  2IO0 B;  3L17 A;  1I35 A;  2PE6 B;  2KZR A;  3PHX B;  2ZPY A;  5DPS A;  3B1L X;  3R7Q A;  2L00 B;  4KZ0 A;  3A1Q B;  4FAD A;  4I6L B;  2N7D A;  4WAA A;  3WAP A;  4HDQ A;  1WE6 A;  4URK A;  2GBN A;  2M17 A;  1GC6 A;  2BKF A;  3ZNH B;  2IYD B;  1ISN A;  1EUV B;  2AL3 A;  3L10 B;  2ZVO A;  4MJS B;  2JVC A;  3O65 B;  3R66 C;  2AEH A;  2NPT B;  3ML9 A;  1WXS A;  4FHK A;  5C23 A;  3UF8 A;  4IM2 A;  3QK0 A;  3IVF A;  4EZK A;  3OJ4 B;  4F7Z A;  4ZDV A;  3K9P B;  1P1A A;  3MHS D;  1UBI A;  2N1V A;  4GIV A;  5L83 A;  2GBM A;  2J0M A;  3VVW B;  1WGR A;  4GSW A;  1GNU A;  1U4A A;  1HE8 A;  2WX0 A;  3WAO A;  4F1S A;  1F9J A;  2MCN B;  2XK5 B;  3A1Q A;  3PTF C;  1FXT B;  2KD0 A;  2JPH A;  2MRP A;  3IG3 A;  3UIO B;  2JWZ A;  2KJH B;  5E6O A;  2M1M A;  4ZRK A;  4ZRI A;  3A4S C;  2REX A;  4LDT D;  1YIW A;  3DBR I;  3H6N A;  4JIO U;  4W9K A;  3W1S C;  2DZJ A;  3A9K A;  2ZCB A;  2NPT A;  5IAA C;  5D6J B;  4W9J A;  2PE9 A;  2Z0E B;  3AU4 A;  5TR5 A;  1ZKH A;  3Q3F A;  4BKS A;  2C9W B;  2A5U A;  2DYB A;  1PQS A;  2K39 A;  3A9J B;  3V61 A;  3ZLZ A;  3NZU A;  1NBF C;  2B3A A;  4W9H A;  3QCA A;  4GGQ A;  5DPT A;  2LXC A;  4BFR A;  4JL9 A;  1V5T A;  2MA9 B;  3VFK A;  1WJ4 A;  2CHZ A;  2XK5 A;  3W1S A;  4A20 A;  2KMA A;  2KLC A;  1WFY A;  1WY8 A;  1YX5 B;  3U8Z A;  4MSM B;  3NY5 A;  2M8S A;  4N9F 4;  4DHZ B;  4TQ0 A;  1WM3 A;  1NDD A;  2XBB C;  4TQ1 A;  3VH4 B;  2KC2 A;  3ZVV A;  1WGD A;  1RAX A;  3QJZ A;  3VH3 B;  4LJO B;  3T9L A;  3DQV A;  2FCM A;  3QC8 B;  5AEK B;  5LXI B;  2DZM A;  3A9J A;  2FCQ A;  4HCP B;  3HM6 X;  3L16 A;  2UYZ B;  3R7R A;  2FCS A;  4B6W A;  1OQY A;  2FUH B;  1Q5W B;  4GB9 A;  2K25 A;  1IPG A;  3QHT A;  3NS8 A;  2JZ3 B;  3TJP A;  4B9K A;  4FLH A;  4NY0 A;  3H7P B;  5D94 A;  2KNB A;  5E6N A;  4RM9 A;  3VTW A;  4NAW B;  2MBH A;  5L95 C;  4DBG A;  5DCN A;  5G55 A;  2KN5 A;  4AJY B;  1CMX B;  1R4N I;  1WX7 A;  4EZL A;  2IO1 B;  2R2Q A;  1UZX B;  2FAZ A;  3W1Y A;  2LRW A;  4KVG B;  1V49 A;  2N9X A;  1Z5S B;  1WGH A;  1E8Z A;  2AWT A;  3SHQ A;  2LGY A;  2PPH A;  2LVO A;  2N9E B;  3ECI A;  4MM3 A;  2KJR A;  3ZIM A;  3H7P A;  1T0Y A;  3RUI B;  3I3T B;  2MSE D;  3L13 A;  4PS8 A;  3BIN A;  1EF5 A;  1KJT A;  3RYT A;  3R3M A;  1BT0 A;  2LI5 A;  1WXA A;  2GBK A;  1RFA A;  1OTR B;  1LM8 B;  2KFJ A;  4HPM B;  2RGF A;  1GG3 A;  1KLV A;  1WM2 A;  3IBE A;  3ZO5 B;  1WRD B;  2L3Z A;  3VHT C;  2XEW A;  3HIZ A;  1XQQ A;  3EHV A;  2KX0 A;  2RPQ A;  1TZ1 A;  3AU5 A;  1L2N A;  1Y8R C;  2BWE S;  1GC7 A;  5D7G A;  2D2Q A;  5EDS A;  3KYC D;  2KC1 A;  2I1J A;  1S3S G;  4IUM B;  3HK0 A;  2BYF A;  2ZNV B;  3ZRF A;  1WR1 A;  3CST A;  2MP2 B;  1OGW A;  4MGZ E;  2NBV B;  2NR2 A;  2L0T A;  3WAL A;  4ZYN A;  1WE7 A;  3ONS A;  2GBJ A;  2LJ5 A;  2ZNV C;  3QAR A;  4TUU A;  3RT3 B;  4RMA A;  2KTR B;  2KDE B;  5AZG A;  1WGY A;  1TGZ B;  2C5L C;  2FCN A;  4FN2 A;  4A3O A;  4NQL B;  4GDK B;  3KW5 B;  4DHJ D;  2R2O A;  3VTU A;  1V81 A;  4K7W A;  2DZK A;  4KSK C;  3OAW A;  4HLE A;  4II3 B;  4EZJ A;  4FBJ B;  4HWI B;  2JZZ A;  2WDT B;  4PYZ A;  2V3S A;  5CHW A;  5GMV A;  3RCZ A;  1E7U A;  2O6V D;  1V9J A;  3U7D A;  4IG7 B;  2JT4 B;  3PS6 A;  2DHZ A;  2C60 A;  1C1Y B;  4M8N A;  2RR9 A;  2L7R A;  1E7V A;  4LDT B;  1YQB A;  2RD0 A;  3VTV A;  1P0R A;  3ENE A;  2MBE A;  3X23 A;  2KTF A;  2KTR A;  2DAF A;  4IC7 B;  3EFU A;  2V1Y A;  1WMH B;  3PPA A;  4M8M A;  3SD5 A;  3ZTC A;  1H8C A;  4G0N B;  4E74 A;  2BKR B;  2NS5 A;  2N1W A;  4GDK A;  3H1U A;  3DVG Y;  1NI2 A;  4MJS A;  3ML8 A;  3TIX A;  4A3P A;  4TKN A;  3UQA A;  1EO6 A;  2JF5 A;  3N3K B;  4JLC A;  1A5R A;  5E6P A;  3AXC A;  2KQS A;  3DVN V;  3PRE A;  2N9P C;  2WWZ A;  2HJ8 A;  2IBI B;  2G4D B;  4KV2 A;  3VDZ A;  2EMT A;  4NJ7 A;  4IWO A;  2MBQ A;  2N4F A;  4DDG D;  3SDL C;  1EF1 A;  5DPR A;  2KWV B;  2A4Z A;  4EUT A;  1IYF A;  1UEL A;  4FUL A;  3PV1 A;  3JVZ X;  1OEY J;  5D2M B;  2Z0D B;  4MGY E;  4BKG A;  3P2B A;  3MTN B;  4XX5 A;  2AYO B;  1KOT A;  4K81 A;  3L54 A;  5JH5 C;  2LZ6 A;  4YL8 A;  4NQK E;  4W9F A;  3WA0 A;  1YD8 U;  1ZGU B;  2JRI B;  4FJY A;  2BGF A;  1UBQ A;  4JQW C;  2LAS A;  4P7I A;  3TMP B;  2IZV B;  2MX2 A;  2KK8 A;  2MBO A;  3QA8 A;  1E8X A;  2NCN A;  3MJW A;  4AUQ C;  3HHM A;  2KLG A;  1D3Z A;  4II2 B;  2WX1 A;  3QWZ B;  1Z2M A;  2DYM A;  4AJW A;  4NJ6 A;  4WWO A;  4HJK A;  2K8C A;  3QX1 A;  4EOY A;  2K8H A;  4MGI E;  2J0J A;  1P3Q U;  3B0A A;  2K6Q A;  4KZC A;  2LRU A;  3CSF A;  4TV3 A;  2D07 B;  4I6N B;  4W9G A;  5C1Z A;  1KM7 A;  1WYW B;  4WWP A;  3KVF B;  3M62 B;  3PSE B;  4EFO A;  3AUL A;  4X57 B;  2DX5 B;  3EC8 A;  3CMM B;  1M94 A;  2CU1 A;  1G6J A;  1WI0 A;  3NHE B;  1GUA B;  2VRR B;  5LXH A;  4AOF A;  2W9N A;  4K1R B;  3X0W A;  4ANX A;  5CX3 A;  4W9I A;  3V60 A;  3UQB A;  3KUD B;  4W9E A;  2J7Q B;  3PLV A;  3TL5 A;  4DK5 A;  2EKE C;  3APD A;  4NAW A;  2DEN B;  2HTH A;  3B08 A;  5G2N A;  3RD2 A;  3T8M A;  1E8Y A;  3VXW A;  1RRB A;  2BF8 B;  3WAN A;  4GDL B;  3V62 A;  4KDL B;  4ICV A;  3UGB B;  1WJN A;  4ANU A;  1WF9 A;  4KDI C;  4NPN A;  2LXA A;  1J8C A;  3RZF A;  2KDI A;  2AL6 A;  1VD2 A;  1UD7 A;  1AAR A;  2KDF B;  3QAQ A;  3PLU A;  3RZW C;  5KHO A;  2JUO A;  4FJV B;  4W9D A;  1J0G A;  3K9O B;  5AZH A;  3VUX A;  1VCB A;  3PRP B;  5IA7 A;  4WQO B;  3M3J A;  2EMS A;  2JXX A;  4BKT A;  3ZUN A;  4IWP A;  3PT2 B;  3V6E B;  1R4M I;  4GU2 A;  4MEL A;  4WJQ A;  4RM8 A;  3ZDM C;  3DOW A;  2KAN A;  4DHJ B;  4G3X B;  1RLF A;  5CHF A;  3VUY A;  4NNJ B;  1C3T A;  5J2R A;  1WH3 A;  2CKH B;  2FID A;  3PRM B;  4CYE A;  1E90 A;  3NOB A;  4GDL A;  3TCA A;  2MW5 A;  3NZS A;  4W9L A;  3JSV B;  4IM3 A;  2O6V B;  3N30 A;  4KSL C;  2ZCC A;  4LJP B;  1GJZ A;  1Q0W B;  2KFK B;  1TBE A;  1YX6 B;  1P9D U;  3KUZ A;  3QQ8 B;  2MWS B;  3L08 A;  5HKH A;  3H9D A;  2C7N B;  1UH6 A;  1LXD A;  2MP2 A;  4FHJ A;  3ZNZ B;  2FNJ B;  3Q3J A;  3V6C B;  3TBL D;  2BYV E;  2OOB B;  3IHP C;  2C7H A;  2L05 A;  2K8B A;  3VUW A;  4B95 A;  4XC2 A;  5JHA A;  3A9K B;  1WZ0 A;  3JSV A;  5BO4 B;  3DVN U;  4F8C B;  2KVR A;  4MGK E;  1MG8 A;  2O6V A;  5AZF A;  2KDB A;  2N7E A;  4DDI D;  2JRH A;  1OEY A;  2K1F A;  3KH0 A;  4FJZ A;  2KFK A;  1S1Q B;  1J19 A;  2LGX A;  3M95 A;  4W9C A;  3WAM A;  3ZKJ C;  4XZ4 A;  4BBN F;  4GMV A;  1IP9 A;  2GBR A;  3L0W B;  1UGM A;  1WXM A;  1WX8 A;  1ZW7 A;  4GOC A;  4PS3 A;  2C7M B;  4BKS D;  4G11 A;  4DXA B;  2KHW B;  2KJ6 A;  2PJH A;  4JGH B;  3UIP B;  2G45 B;  1WJ6 A;  3WIM A;  2HE7 A;  1V2Y A;  4HXD A;  2L0F A;  2KWU B;  4EEW A;  4OVV A;  2GMI C;  4HVB A;  3QIJ A;  3DBH I;  4HK2 A;  1WMH A;  3A4R A;  4CO7 A;  4HCN B;  4WJN A;  4HPL B;  4E71 A;  2LGD A;  2M4N A;  5J18 A;  2IY1 B;  1XT9 B;  3KUC B;  4I6P A;  2CR5 A;  3PGE A;  4ZRJ A;  4KIK B;  3H7S A;  5CHV C;  4J6I A;  3GOE A;  2G3Q B;  2MQJ A;  2KWC A;  2YLM A;  4BBN C;  4MEM A;  2K6D B;  2UWQ A;  4LCD E;  1WX9 A;  2KQ7 A;  1V80 A;  2D11 A;  4E3C A;  3PHW B;  3N32 A;  1TTN A;  2ZEQ A;  4PYU A;  2FIF A;  4AWJ A;  4ANV A;  4FA6 A;  3APC A;  1SIF A;  2IO2 B;  3ZNG C;  4MSQ B;  2NBW B;  5CTR C;  3KYD D;  3SU8 X;  2BPS A;  3CF6 E;  1WJU A;  4ASW C;  4GXB A;  4WJP A;  2IY0 B;  2DAJ A;  2QHO A;  1WIA A;  2MBB B;  2MLB A;  3C0R B;  3S2A A;  2KXJ A;  3A33 B;  3BY4 B;  1SE9 A;  4MDK E;  4KIK A;  4WWN A;  1WXV A;  2Y5B B;  1WZ3 A;  3IFW B;  3JYU A;  3LJ3 A;  4MH0 E; 
#chains in the Genus database with same CATH topology
 3M63 B;  4RGN A;  2WXH A;  3ZTD A;  1X1M A;  1Q1O A;  5DPW A;  2ZZP B;  1YJ1 A;  1IGD A;  4WJO A;  2I1K A;  3LDZ E;  3PZD A;  1XXG A;  2RMM A;  4BOZ B;  2BB5 A;  2ZVN A;  1WGG A;  2N0S B;  1K8R B;  1FO4 A;  1YMH E;  3HUI A;  2M0X A;  1L7Y A;  2LVQ A;  2GRI A;  2O2V A;  1XD3 B;  5BYR A;  1H4R A;  4M0W B;  4DWF A;  3UIN B;  4ICU A;  4A90 A;  4ACF A;  1V5O A;  2CS4 A;  1XLQ A;  5EE3 A;  2KOX A;  1WR6 E;  1MI0 A;  1HA5 A;  2LD9 A;  1VJK A;  4HDO A;  3OLM D;  3ZNI D;  3VQI A;  2IGG A;  2KMC A;  2WP9 B;  3ZDT A;  1UNS A;  2IO0 B;  2HTM E;  2ZPY A;  3B1L X;  1E9M A;  3R7Q A;  4KZ0 A;  2D3A A;  1YN3 A;  3A1Q B;  5TSS A;  3WAP A;  4URK A;  2GBN A;  3ZNH B;  2BKF A;  1ISN A;  4JE3 B;  4RF0 A;  2WHI A;  4ZRP A;  1WXS A;  4RCO A;  1BXT A;  2UU7 A;  5MPO A;  2QIE B;  1UWM A;  2RDH A;  3AV8 A;  1HTO A;  2J52 A;  4ZHO A;  3VVW B;  2OJW A;  2Q5W D;  3PTF C;  2KD0 A;  2IJ0 A;  2MRP A;  2M1M A;  2NTS A;  2LGS A;  3A9K A;  2ZCB A;  2NPT A;  5D6J B;  5HI1 A;  3MP9 A;  1FCL A;  1JWA D;  2DYB A;  1NBF C;  3P4Q B;  4BFR A;  1PGX A;  4JL9 A;  3VFK A;  1WJ4 A;  2CHZ A;  4A20 A;  2KMA A;  2SEB D;  3LXF A;  2KQ4 X;  4MSM B;  3NY5 A;  2QC8 A;  1R4N B;  2WXO A;  4TQ1 A;  2WLB A;  3ZVV A;  3T9L A;  5AEK B;  5JXV A;  3A9J A;  4HCP B;  1F1H A;  1FPY A;  1MFW A;  1Q5W B;  2K25 A;  1DGJ A;  2JZ3 B;  3P63 A;  4FLH A;  2X8X X;  5D94 A;  5I4D A;  4XDD A;  4N59 A;  2KAC A;  1L0V B;  2W3S A;  1SB3 C;  4OW0 A;  2KN5 A;  4AJY B;  1EM7 A;  2IO1 B;  1K51 A;  3ZJU A;  4OHJ A;  3GB1 A;  3V3X A;  1WGH A;  2LGY A;  3ECI A;  3H7P A;  1T0Y A;  3I3T B;  2MSE D;  4J3O D;  4PS8 A;  2AQ3 B;  3BZD B;  2GBK A;  3BYY B;  3J9C A;  1FM0 D;  1JWB D;  1GG3 A;  1OQQ A;  1WM2 A;  2L3Z A;  3HIZ A;  1QOF A;  3DHG C;  1Y8R C;  1GC7 A;  4HPP A;  3KYC D;  1TY0 A;  1DYQ A;  3HK0 A;  1QKZ A;  2QCZ A;  1F77 A;  1C9F A;  2NR2 A;  3UI3 A;  3WAL A;  3LYY A;  2LJ5 A;  4RMA A;  2KDE B;  2YEP F;  3ETR A;  1TGZ B;  4FN2 A;  4GDK B;  2X38 A;  1V81 A;  4HLE A;  3OAW A;  4C56 C;  1JML A;  3RNE C;  4B0E A;  4ZYS A;  1Q10 A;  2C60 A;  1ZOY B;  2BS4 B;  2MBE A;  2KTF A;  5FK9 C;  4ARC A;  3DWM A;  1RYJ A;  4JWU C;  4E74 A;  3ML8 A;  4P1C C;  4JLC A;  3GS2 A;  3AXC A;  1D5Z C;  1WWT A;  3OWE B;  2WWZ A;  3VDZ A;  2HDE A;  4IWO A;  1F2R C;  2BVC A;  4XDC A;  2A4Z A;  1IYF A;  1XF5 L;  3PV1 A;  1OEY J;  4MGY E;  2EEL A;  3AE1 B;  5JH5 C;  4YL8 A;  4NQK E;  3WA0 A;  1YD8 U;  1ET9 A;  2JYE A;  2LAS A;  2MX2 A;  5BYS A;  2NCN A;  3MJW A;  4AUQ C;  4LTU A;  2KLG A;  3QWZ B;  1DOY A;  3AM9 A;  4WWO A;  2K8C A;  4EOY A;  3B0A A;  2K6Q A;  1HQR D;  4I6N B;  1SIJ A;  4ZRQ A;  5C1Z A;  2R61 A;  4WWP A;  3KVF B;  2INP E;  2K22 A;  1YN5 A;  3CMM B;  5EE0 A;  4O1N A;  1I4R A;  3Q8A A;  1GUA B;  1JRO A;  4RF1 A;  4YT0 B;  2W9N A;  1P7F A;  1SE2 A;  3SEB A;  2EKE C;  2MHJ A;  2DEN B;  2JQR B;  5G2N A;  4WH4 A;  3T8M A;  1E8Y A;  3B9J A;  2RDB C;  1RRB A;  4KDL B;  2V3N A;  2D3C A;  1KF6 B;  5IO9 A;  4PK1 A;  3R2I A;  4NPN A;  1TZO A;  3RZF A;  2WU5 B;  2KDI A;  2KDF B;  2JUO A;  4W9D A;  1PYW D;  3K9O B;  1L4D B;  3M3J A;  3W9C B;  4BKT A;  3ZUN A;  4YTN B;  3V6E B;  1R4M I;  4DHJ B;  4G3X B;  5CHF A;  3TEY A;  3VUY A;  3P42 A;  4NNJ B;  5J2R A;  1WH3 A;  3NOB A;  2MH7 A;  2VH2 A;  3JSV B;  4W9L A;  4AS1 A;  4YTM B;  2O6V B;  3N30 A;  3HRD D;  1YX6 B;  3KUZ A;  1TJE A;  2LEK A;  3NVZ A;  1ZXH A;  2C7N B;  2L83 A;  3VRA B;  1ZE3 D;  2GB1 A;  3Q3J A;  3V6C B;  1KFY B;  4A8X C;  1PFD A;  3AE4 B;  2DBY A;  3BK1 A;  3I9V 1;  3VUW A;  4XC2 A;  1GOZ A;  4IOI E;  5IP4 D;  3DVN U;  4MGK E;  5AZF A;  1BML C;  2N7E A;  2CJN A;  1J19 A;  4GMV A;  2GBR A;  3AEF B;  3L0W B;  1UGM A;  1WXM A;  1ZW7 A;  4BKS D;  4PS3 A;  2OHF A;  3AEB B;  2GI9 A;  4OVV A;  2BBC A;  2OED A;  4YSX B;  4HK2 A;  3A4R A;  1FXA A;  4CO7 A;  4WJN A;  4E71 A;  2LGD A;  5J18 A;  3PGE A;  4C4V B;  4MH8 A;  4ZRJ A;  4H2A A;  2W3R A;  4KIK B;  1QOA A;  4J6I A;  3GOE A;  2MQJ A;  2J42 A;  2KWC A;  4MEM A;  3EA6 A;  1WX9 A;  1QT9 A;  2QJL A;  1TTN A;  4AWJ A;  2IO2 B;  2ON8 A;  1JQ4 A;  2W54 A;  4ASW C;  2BPS A;  3ZXV A;  1VZ7 A;  2DAJ A;  2QSD A;  3C0R B;  3ZGZ A;  3HVD A;  2WXQ A;  4PT5 A;  3JYU A;  4M01 A;  2O2V B;  4M02 A;  1LGR A;  4IM0 A;  3DPD A;  3AEG B;  3OG5 A;  3PVL A;  2WYQ A;  1E10 A;  2NMQ A;  3DBL B;  3U30 A;  2PEA A;  3GZN I;  3Q8B A;  3DBS A;  4N58 A;  2CHX A;  2ZJD A;  2JX5 A;  3VAW A;  5KHQ A;  3TEW A;  2ASQ A;  3DHH C;  3Q3N C;  4K7U A;  2JY6 A;  5E6J A;  3ZRC A;  1N63 A;  2MJE A;  1YN4 A;  3N20 C;  1V86 A;  4IW0 A;  1FD6 A;  5J17 A;  1SSN A;  4DXF A;  4ANW A;  4P1B C;  4BVU C;  2IO3 B;  1LQB A;  4DHZ E;  3ALB A;  1ET6 A;  1AN8 A;  1E5W A;  4BOS C;  1JRP A;  2YVC A;  5LLI A;  1QIL A;  2HD5 B;  2DYO A;  2LUE A;  3RUL A;  3Q6B A;  1JCK B;  3NVW A;  1YJI A;  2JZP A;  2KKC A;  3U52 E;  1I42 A;  3C8Y A;  2D10 A;  4PS7 A;  5JZE B;  1SF0 A;  1L0Y B;  3L17 A;  3AE8 B;  2KZR A;  5DPS A;  1CZP A;  2INN E;  4I6L B;  2M17 A;  3IT6 B;  3W2D A;  3EFC A;  3O65 B;  4WIP A;  3UF8 A;  2NPT B;  2W82 A;  3SR6 A;  1KTK A;  5IKC M;  4F7Z A;  1LO5 D;  4GIV A;  2J0M A;  1YJJ A;  1V97 A;  2WX0 A;  1FXT B;  2LJI A;  2ONQ A;  2JWZ A;  4S17 A;  5E6O A;  4LDT D;  1YIW A;  3DBR I;  1TKE A;  5HHD G;  2WNM A;  3H6N A;  4JIO U;  4W9K A;  2DZJ A;  4W9J A;  2PE9 A;  3AU4 A;  5TR5 A;  1ZKH A;  4BKS A;  2A5U A;  3A9J B;  1PQS A;  3ZLZ A;  3V61 A;  4YSZ B;  3QCA A;  4BZA A;  1V5T A;  1SEB D;  2WXF A;  1WFY A;  1YX5 B;  2H89 B;  4REZ A;  1WM3 A;  1NDD A;  2XBB C;  2QEJ C;  2W55 A;  3P4S B;  2UYZ B;  2FCS A;  4B6W A;  4N6E B;  4B9K A;  3NS8 A;  3H7P B;  2KNB A;  3AH7 A;  3Q2A C;  4RM9 A;  3VTW A;  2MBH A;  5BYQ A;  2WXK A;  4RGM A;  5BMH A;  1WX7 A;  2R2Q A;  5IN7 A;  4KVG B;  1XO3 A;  3L4P A;  1V49 A;  3RI7 C;  1FNU A;  1E8Z A;  4YTP B;  2AWT A;  1IUE A;  3SHQ A;  2BTE A;  2LVO A;  3NVV A;  4HKZ E;  4K3B A;  2XNA C;  3L13 A;  3BIN A;  2V4I B;  1I4H A;  1BT0 A;  2LI5 A;  1UUP A;  1WXA A;  1RFA A;  1OTR B;  4HPM B;  4Q2J A;  1WGK A;  1MVK A;  3EHV A;  2KX0 A;  2RPQ A;  3AE2 B;  3DWG C;  3AU5 A;  2IDY A;  4RH6 A;  4IUM B;  1TKG A;  3RNF C;  1WR1 A;  2ICI A;  5H92 C;  3CST A;  1OGW A;  2PTL A;  2NBV B;  1JWS D;  2L0T A;  4DQO C;  3ONS A;  3RT3 B;  5BMI A;  5AZG A;  3AE6 B;  3KW5 B;  3VTU A;  4EZJ A;  5CHW A;  4YWG G;  1EU3 A;  2LUM A;  3KWL A;  2RR9 A;  3VTV A;  1P0R A;  3ENE A;  2BB6 A;  4M8M A;  3PPA A;  2NS5 A;  3SFD B;  3UQA A;  1BUI C;  3DVN V;  3PRE A;  3PZ7 A;  2IBI B;  4A9A A;  2EMT A;  3AED B;  4DDG D;  3AB5 A;  2KWV B;  4ZOH C;  4KX6 B;  2J53 A;  3MC0 B;  1RWS A;  1VR9 A;  4XX5 A;  2AYO B;  1KOT A;  1NI3 A;  2BW2 A;  1XCT L;  2LZ6 A;  3GE3 C;  2Y3A A;  2MBO A;  3QA8 A;  1WYG A;  1D3Z A;  1ZPS A;  2WX1 A;  1ESF A;  1KRH A;  4NJ6 A;  4AJW A;  2K8H A;  1PUT A;  2LMC A;  4W9G A;  1TS5 A;  4X57 B;  2DX5 B;  3EC8 A;  3BK2 A;  1M94 A;  3NHE B;  4AOF A;  3X0W A;  4ANX A;  4W9I A;  1T0R C;  3KLS X;  2J7Q B;  3TL5 A;  3VR9 B;  4DK5 A;  1AW7 A;  3CWI A;  3FIL A;  3N1Z C;  2HTH A;  1V1P A;  2BF8 B;  1WJN A;  1WF9 A;  2LXA A;  2WDV B;  3PLU A;  3RZW C;  4FJV B;  1J0G A;  3VUX A;  5IA7 A;  3PRP B;  4WQO B;  4HKQ A;  5C3J B;  4ZHP A;  2JXX A;  2HJ1 A;  4RM8 A;  3ZDM C;  2KAN A;  2MJ3 A;  2GLS A;  2CKH B;  4NJC A;  1E90 A;  3NZS A;  3VR8 B;  2N9L A;  4LJP B;  1RFK A;  5BMG A;  1ZP0 B;  3QQ8 B;  5HKH A;  3H9D A;  1UH6 A;  4WAF A;  3ZNZ B;  3BVG A;  2BYV E;  1PGA A;  2L05 A;  1RM6 C;  1I4G A;  1N60 A;  2K8B A;  1WZ0 A;  2JRH A;  3GE8 C;  3KH0 A;  4FJZ A;  2KFK A;  3M95 A;  3ZKJ C;  4XZ4 A;  4B0M A;  2WQY B;  1IP9 A;  3W5U B;  1HZ6 A;  2KHW B;  2KJ6 A;  1VDV A;  4JGH B;  3Q3M C;  1E0Z A;  4HXD A;  2L0F A;  4EEW A;  3QIJ A;  3DBH I;  4OVZ A;  1DOX A;  1WRI A;  1ZXI A;  1C4C A;  4HCN B;  3U7Z A;  2M4N A;  1XT9 B;  4GLS C;  2PVO D;  3H7S A;  2BS2 B;  4BBN C;  3MHZ A;  2UWQ A;  2KQ7 A;  4C7Y A;  4E3C A;  3PHW B;  1E6E B;  2KYW A;  3MC8 A;  1SIF A;  4MAC A;  1T3Q A;  4MSQ B;  5EE9 A;  1WJU A;  4OZB A;  3RNA C;  2V3P A;  1WIA A;  2MBB B;  2MLB A;  3S2A A;  2KXJ A;  1ROE A;  4WWN A;  1OQR A;  1L0X B;  1QLB B;  3AEC B;  3EEC A;  5EE1 A;  1SGH A;  4MM3 B;  3AI5 A;  3HM3 A;  1YQ4 B;  1JRU A;  1UF0 A;  2V4L A;  2J0K A;  4EKU A;  4HJG E;  4CQN A;  2DZI A;  2WU2 B;  3JW0 X;  2NVU I;  4CHK A;  2ZPN A;  1P98 A;  3Q8F A;  1SE3 A;  1L6U A;  1T5X D;  2Z59 B;  1I7H A;  4G50 A;  2KX3 A;  3DCG A;  3APF A;  4FXC A;  4R3D A;  4TMA B;  5JHB A;  3FKY A;  1QZE A;  1YQ3 B;  1C76 A;  1I35 A;  2PE6 B;  2WDR B;  1CJE A;  1C79 A;  4FAD A;  3MC9 A;  4HDQ A;  4LNN A;  4YXD B;  3VRB B;  1GC6 A;  2PMV A;  2WXM A;  5H8Y E;  2ZVO A;  2BQQ A;  2JVC A;  3B2F A;  2AQ1 B;  4FHK A;  5C23 A;  4IM2 A;  3OJ4 B;  3E9S A;  3Q8E A;  4ZDV A;  3K9P B;  3ZJT A;  3MHS D;  5L83 A;  1V8C A;  4GSW A;  1U4A A;  1GNU A;  4USA A;  1HE8 A;  2AX5 A;  3WAO A;  1QF6 A;  2MCN B;  3IXS A;  3IG3 A;  3UIO B;  2K3U A;  4ZRI A;  3A4S C;  2REX A;  1WXQ A;  1I4X A;  4WUR A;  3BVM A;  3W1S C;  2PW9 A;  2PLP A;  2KMM A;  2Z0E B;  2C9W B;  1MG4 A;  3ZQ4 A;  3NZU A;  3T3N A;  1A70 A;  1HZ5 A;  4GGQ A;  5DPT A;  2LXC A;  2MA9 B;  1T0Q C;  2XK5 A;  3W1S A;  2KLC A;  2MJD A;  3N1X C;  1WY8 A;  1JAL A;  3U8Z A;  2AQ2 B;  1MHH E;  4D2K A;  5LNK 1;  4N9F 4;  4DHZ B;  2WXN A;  3AE9 B;  3VH4 B;  1RAX A;  3VH3 B;  1SE4 A;  2L52 A;  1T0S C;  3NG0 A;  4LJO B;  2I2Y A;  2FCQ A;  3HM6 X;  3L16 A;  3R7R A;  2FUH B;  1QOB A;  3TJP A;  4NY0 A;  2INC C;  5E6N A;  4KKI A;  2FUG 1;  4IDI A;  5G55 A;  1SBB B;  2G9H D;  3O13 A;  1KH0 A;  1CMX B;  2D5G A;  1R4N I;  1N6Z A;  5HG2 A;  1UZX B;  2FAZ A;  1HTQ A;  1NVI D;  2LRW A;  2BT6 A;  1MHX A;  3AE5 B;  2N9X A;  1Z5S B;  5IOI A;  1ZUD 2;  4MM3 A;  2KJR A;  1EF5 A;  1KJT A;  1L4Z B;  2LHE A;  1LM8 B;  2KFJ A;  1J7C A;  3TUO A;  1KLV A;  1T6B X;  3H8H A;  4XYC A;  3VHT C;  2XEW A;  3BVZ A;  1TZ1 A;  2BWE S;  5EDS A;  2MEK A;  2BYF A;  2MP2 B;  5D3I B;  1WE7 A;  3Q8C A;  2ZNV C;  3QAR A;  4TUU A;  1TT5 B;  2KDM A;  4A3O A;  2FCN A;  1YOV B;  2R2O A;  2QDF A;  2K9X A;  4MT5 A;  3RPF C;  1STE A;  2DZK A;  3E56 A;  2CJO A;  4FBJ B;  4HWI B;  5GMV A;  3RCZ A;  4C80 A;  1V9J A;  4IG7 B;  2JT4 B;  4KKJ A;  2DHZ A;  4M8N A;  2L7R A;  1E7V A;  4LDT B;  4C7Z A;  2RDG A;  3X23 A;  2KVZ A;  2KTR A;  2DAF A;  4IC7 B;  3EFU A;  2V1Y A;  3FAH A;  3I63 C;  4A55 A;  4NAM A;  4G0N B;  2TSS A;  3H1U A;  3DVG Y;  2Y5C A;  4TKN A;  2G1E A;  5FR3 A;  1EO6 A;  3N3K B;  4ITK A;  1A5R A;  2L1A A;  1K52 A;  3I5J C;  1ZDX A;  5DPR A;  3CIR B;  4EUT A;  1UEL A;  3MJ5 A;  1NYR A;  4BKG A;  3P2B A;  3MTN B;  2ZW1 A;  4K81 A;  1C77 A;  3P4P B;  3L54 A;  4WWM A;  3AEE B;  1ZGU B;  2JRI B;  4JQW C;  4FJY A;  2BGF A;  1UBQ A;  2PIA A;  3AE3 B;  4P7I A;  2KK8 A;  1E8X A;  1L6V A;  2WGS A;  4II2 B;  1Z2M A;  4RGT A;  3N1Y C;  4MGI E;  1P3Q U;  2LHD A;  4KGR A;  4KZC A;  2LRU A;  1NYQ A;  3FIL B;  2D07 B;  2VH1 A;  1V1P B;  1KM7 A;  1Y56 A;  4XE0 A;  4EFO A;  1QQR A;  1FEH A;  1WI0 A;  3RNB C;  4K1R B;  5CX3 A;  3V60 A;  3KUD B;  1R4M B;  2M56 B;  3APD A;  3B08 A;  3WAN A;  3V62 A;  4ICV A;  3UGB B;  3ABV B;  1N62 A;  1J7B A;  1J8C A;  1UD7 A;  1AAR A;  1VD2 A;  2AL6 A;  3QAQ A;  5KHO A;  4IWP A;  3PT2 B;  4LNI A;  4WJQ A;  3IAM 1;  1GPX A;  3DOW A;  1RLF A;  4CYE A;  4GDL A;  2MW5 A;  4IM3 A;  4KSL C;  1WSP A;  2ZCC A;  3Q3O C;  1C4P A;  1B1Z A;  1FRD A;  1IGC A;  1Q0W B;  2KFK B;  4UDU C;  1P9D U;  2MWS B;  2LGI A;  4M00 A;  2WXR A;  2MP2 A;  4FHJ A;  2FNJ B;  2OOB B;  2C7H A;  1VZ8 A;  4B95 A;  2I38 A;  5BO4 B;  4F8C B;  2KVR A;  4WQM A;  1MG8 A;  2KDB A;  4DDI D;  1OEY A;  2K1F A;  3WAM A;  2JWU A;  1TYG B;  2N9K A;  4GOC A;  2C7M B;  2PKO A;  4G11 A;  2HE7 A;  2KWU B;  2GMI C;  4L1B A;  4HPL B;  4HRS A;  2IY1 B;  5T8I A;  1NEN B;  4I6P A;  2CR5 A;  1I4P A;  4C00 A;  2YLM A;  4LCD E;  2BYT A;  1GB4 A;  2D11 A;  3N32 A;  4RFB A;  2ZEQ A;  1F0Z A;  3RNC C;  4ANV A;  3GZN B;  5D3D A;  1J7A A;  4LNK A;  4S0R A;  2NBW B;  5CTR C;  3SU8 X;  3CF6 E;  1P7E A;  2QHO A;  4JX1 C;  4HRO A;  4YSY B;  3BY4 B;  2BS3 B;  1SJH D;  1WXV A;  2E6X A;  2RPV A;  1I4Q A;  1SXT A;  3LJ3 A;  4MH0 E;  3EGR A;  4P6V F;  2LWP A;  4JPS A;  3DHI C;  2BWF A;  1E8W A;  1TS2 A;  4IWQ A;  2RSU A;  1JWM D;  3RMK C;  2JXT A;  3DDC B;  3RFZ B;  2L32 A;  4GN1 A;  1D4B A;  2K0P A;  4OVU A;  3NUH B;  5HFY A;  5AUI A;  2G4S A;  1LFD A;  2GOW A;  2L8J A;  5FR6 A;  1XLO A;  1XCQ L;  3PZ8 A;  2NBU A;  1TIF A;  3P4R B;  1SJE D;  1TY2 A;  3ZW3 A;  3DBL I;  2WXP A;  2CHW A;  4K7S A;  2LVP A;  4RGO S;  1V6E A;  2D3G A;  3AMZ A;  2BYE A;  2KO3 A;  3PRZ A;  2L76 A;  4AP4 C;  3BYT B;  3DVG X;  2OJR A;  2IND C;  3OJ3 A;  3D32 A;  3PHX B;  4M0W A;  2L00 B;  3TEX A;  2PVG C;  2N7D A;  4HEA 1;  4WAA A;  1WE6 A;  3DBR B;  2LFI A;  1XEE A;  1FCC C;  2IYD B;  2AL3 A;  1EUV B;  4A6Q A;  3L10 B;  4MJS B;  3R66 C;  2AEH A;  3ML9 A;  3QK0 A;  3IVF A;  4EZK A;  2CU3 A;  3ZJV A;  1C4A A;  1P1A A;  1UBI A;  2IGH A;  2N1V A;  2GBM A;  1WGR A;  1ENF A;  1FMA D;  1N5W A;  1N61 A;  4F1S A;  2ACZ B;  1F9J A;  1TS4 A;  2XK5 B;  3A1Q A;  2JPH A;  3N9Y C;  3KQ4 A;  2KJH B;  4US9 A;  4ZRK A;  1GAQ B;  2M19 A;  1FNV A;  4XGA B;  1UGJ A;  5IAA C;  3Q3F A;  1YNT E;  2K39 A;  4W9H A;  2M0A A;  2B3A A;  5C2T B;  1F52 A;  1CK1 A;  2M8S A;  4JWS C;  3R8B A;  4TQ0 A;  2KC2 A;  1WGD A;  3QJZ A;  2WXL A;  3DQV A;  2FCM A;  1XLP A;  3QC8 B;  5LXI B;  3TEZ A;  2DZM A;  2D3B A;  1GB1 A;  1OQY A;  4GB9 A;  1IPG A;  3QHT A;  2IPK D;  4OZC A;  3R2T A;  2JU6 X;  4IKG A;  4NAW B;  5L95 C;  4DBG A;  5DCN A;  1R7S A;  3U4E G;  1FFV A;  4EZL A;  2Z8L A;  3W1Y A;  1FIQ A;  1E7P B;  2PPH A;  3P1M A;  2N9E B;  3NRZ A;  3ZIM A;  3RUI B;  2E3T A;  3RYT A;  1UWX A;  3V05 A;  3R3M A;  2RGF A;  3RNG C;  1XLN A;  3IBE A;  3AEA B;  3ZO5 B;  1WRD B;  3Q69 A;  1XQQ A;  3IAS 1;  1L2N A;  5AUK A;  2H88 B;  2D2Q A;  5D7G A;  2DNF A;  1PGB A;  2KC1 A;  2I1J A;  1S3S G;  3RN9 C;  3T3O A;  2ZNV B;  3ZRF A;  3AN1 A;  4MGZ E;  1MPE A;  1VZ6 A;  4L23 A;  4BAX A;  4ZYN A;  3NVY A;  1D6E C;  2GBJ A;  2FBW B;  4AQ7 A;  2KTR B;  1WGY A;  1C78 A;  2C5L C;  3IT4 B;  4NQL B;  4DHJ D;  3PO0 A;  1IBX B;  4K7W A;  4KSK C;  4II3 B;  2KAJ A;  2JZZ A;  2WDT B;  4PYZ A;  2V3S A;  1E7U A;  2O6V D;  2YEP B;  2ZW0 A;  3U7D A;  3PS6 A;  3NS1 A;  3FC4 A;  1C1Y B;  1YQB A;  2RD0 A;  2EKI A;  4LNF A;  3ZTC A;  3SD5 A;  1WMH B;  2JYT A;  2NTT A;  2WXG A;  1H8C A;  1VRA B;  3SFE B;  2BKR B;  4GDK A;  2K5P A;  2N1W A;  1NI2 A;  4MJS A;  4DXG A;  3TIX A;  4A3P A;  3KWV A;  2JF5 A;  1VLB A;  2KN4 A;  3LB8 C;  5E6P A;  2KQS A;  2N9P C;  3ZXR A;  2HJ8 A;  4L2Y A;  2G4D B;  4KV2 A;  2Y5P A;  4NJ7 A;  2MBQ A;  2N4F A;  3SDL C;  1EF1 A;  1ZDV A;  1FRR A;  2B76 B;  3ZYY X;  3W5V B;  3HVZ A;  4FUL A;  3JVZ X;  3I57 A;  5D2M B;  1JW9 D;  2Z0D B;  1D5X C;  1V1O A;  1KLU D;  4ARI A;  4W9F A;  4XWW A;  1F2R I;  4KGS A;  3TMP B;  2IZV B;  3HHM A;  2DYM A;  2WDQ B;  4HJK A;  3QX1 A;  2J0J A;  3CSF A;  1TS3 A;  4TV3 A;  4EE2 A;  4US8 A;  3URY A;  1WYW B;  3PSE B;  3M62 B;  3AUL A;  3TSS A;  1KLG D;  4LK0 M;  2CU1 A;  1D5M C;  1FXI A;  1G6J A;  2VRR B;  1DOI A;  1B9R A;  5LXH A;  4TSS A;  1AYF A;  3C19 A;  3UQB A;  4QAY A;  4W9E A;  3PLV A;  4OZA A;  1M4V A;  1OFF A;  2FE8 A;  1K50 A;  1FNW A;  4NAW A;  4LNO A;  3RD2 A;  3VXW A;  4GDL B;  2DWQ A;  4ANU A;  1AWD A;  1EWY C;  4KDI C;  4XWT A;  3U2S C;  1HXY D;  5AZH A;  1VCB A;  2EMS A;  4GU2 A;  4MEL A;  3BII D;  1C3T A;  1EWC A;  5G5G A;  2FID A;  3PRM B;  3TCA A;  1GJZ A;  1TBE A;  3NZ3 A;  2N7J A;  3L08 A;  5G5H A;  4LLG M;  1LXD A;  1L5P A;  2IGD A;  3TBL D;  3IHP C;  3AE7 B;  1N5X A;  1TKY A;  3DBH B;  2V0G A;  2KWD A;  3Q14 C;  1JWU D;  1NEK B;  5JHA A;  3A9K B;  3JSV A;  2O6V A;  1HEZ E;  1IBX A;  2VZK B;  1S1Q B;  1MJD A;  2LGX A;  4W9C A;  4BBN F;  3BWU D;  2QMT A;  1WX8 A;  3NJT A;  2VZK D;  4DXA B;  2PJH A;  3UIP B;  2G45 B;  1WJ6 A;  3WIM A;  1ACC A;  1V2Y A;  2KT7 A;  4KGT A;  2WXI A;  3WCQ A;  3MFG A;  3B2G A;  4HVB A;  4RNA A;  2JSV X;  1WMH A;  2SAK A;  5FKA C;  4P16 A;  3KUC B;  2V9H A;  3GP7 A;  1CQV A;  5CHV C;  2G3Q B;  2J4X A;  2K6D B;  3EUB 2;  1V80 A;  5GXG B;  1QOG A;  4K3C A;  4PYU A;  2FIF A;  4FA6 A;  3APC A;  3ZNG C;  2QIL A;  3KYD D;  2WXJ A;  1PDX A;  4NZL B;  4GXB A;  4WJP A;  2IY0 B;  1EU4 A;  3A33 B;  4C4V A;  1SE9 A;  2DLB A;  4MDK E;  4KIK A;  2Y5B B;  1WZ3 A;  1FFU A;  3IFW B;  1K53 A;  2WS3 B;  2XN9 C; 
#chains in the Genus database with same CATH homology
 3M63 B;  2LWP A;  3EEC A;  1SGH A;  3ZTD A;  3AI5 A;  2O2V B;  3HM3 A;  4IM0 A;  2BWF A;  3DPD A;  1JRU A;  1E8W A;  1Q1O A;  1X1M A;  5DPW A;  2ZZP B;  3PVL A;  2V4L A;  2WYQ A;  2J0K A;  3U30 A;  2PEA A;  3GZN I;  4IWQ A;  1YJ1 A;  2RSU A;  3DBS A;  4EKU A;  4WJO A;  2CHX A;  2I1K A;  3LDZ E;  3PZD A;  2ZJD A;  2DZI A;  3VAW A;  5KHQ A;  3DDC B;  4BOZ B;  2ASQ A;  4GN1 A;  3JW0 X;  4K7U A;  2JY6 A;  2ZVN A;  4OVU A;  2NVU I;  1WGG A;  4CHK A;  3ZRC A;  2G4S A;  1LFD A;  1K8R B;  2GOW A;  2L8J A;  1V86 A;  1P98 A;  2ZPN A;  4IW0 A;  5FR6 A;  5J17 A;  2M0X A;  1L7Y A;  4ANW A;  2LVQ A;  2O2V A;  4BVU C;  1XD3 B;  2IO3 B;  2Z59 B;  1LQB A;  2NBU A;  1H4R A;  4M0W B;  4DHZ E;  4DWF A;  3ALB A;  4G50 A;  1E5W A;  3UIN B;  4ICU A;  2KX3 A;  3DCG A;  4BOS C;  3APF A;  1V5O A;  3DBL I;  3ZW3 A;  2CS4 A;  2YVC A;  5LLI A;  5JHB A;  2CHW A;  2HD5 B;  2KOX A;  1WR6 E;  2DYO A;  2LUE A;  2LD9 A;  1QZE A;  4K7S A;  2LVP A;  3RUL A;  1V6E A;  4HDO A;  2D3G A;  3OLM D;  3ZNI D;  2BYE A;  2KO3 A;  3PRZ A;  3VQI A;  2L76 A;  2KKC A;  4AP4 C;  1I42 A;  3DVG X;  2OJR A;  2KMC A;  2D10 A;  4PS7 A;  3OJ3 A;  3ZDT A;  5JZE B;  3D32 A;  2IO0 B;  3L17 A;  1I35 A;  2PE6 B;  2KZR A;  3PHX B;  2ZPY A;  5DPS A;  3B1L X;  3R7Q A;  2L00 B;  4KZ0 A;  3A1Q B;  4FAD A;  4I6L B;  2N7D A;  4WAA A;  3WAP A;  4HDQ A;  1WE6 A;  4URK A;  2GBN A;  2M17 A;  1GC6 A;  2BKF A;  3ZNH B;  2IYD B;  1ISN A;  1EUV B;  2AL3 A;  3L10 B;  2ZVO A;  4MJS B;  2JVC A;  3O65 B;  3R66 C;  2AEH A;  2NPT B;  3ML9 A;  1WXS A;  4FHK A;  5C23 A;  3UF8 A;  4IM2 A;  3QK0 A;  3IVF A;  4EZK A;  3OJ4 B;  4F7Z A;  4ZDV A;  3K9P B;  1P1A A;  3MHS D;  1UBI A;  2N1V A;  4GIV A;  5L83 A;  2GBM A;  2J0M A;  3VVW B;  1WGR A;  4GSW A;  1GNU A;  1U4A A;  1HE8 A;  2WX0 A;  3WAO A;  4F1S A;  1F9J A;  2MCN B;  2XK5 B;  3A1Q A;  3PTF C;  1FXT B;  2KD0 A;  2JPH A;  2MRP A;  3IG3 A;  3UIO B;  2JWZ A;  2KJH B;  5E6O A;  2M1M A;  4ZRK A;  4ZRI A;  3A4S C;  2REX A;  4LDT D;  1YIW A;  3DBR I;  3H6N A;  4JIO U;  4W9K A;  3W1S C;  2DZJ A;  3A9K A;  2ZCB A;  2NPT A;  5IAA C;  5D6J B;  4W9J A;  2PE9 A;  2Z0E B;  3AU4 A;  5TR5 A;  1ZKH A;  3Q3F A;  4BKS A;  2C9W B;  2A5U A;  2DYB A;  1PQS A;  2K39 A;  3A9J B;  3V61 A;  3ZLZ A;  3NZU A;  1NBF C;  2B3A A;  4W9H A;  3QCA A;  4GGQ A;  5DPT A;  2LXC A;  4BFR A;  4JL9 A;  1V5T A;  2MA9 B;  3VFK A;  1WJ4 A;  2CHZ A;  2XK5 A;  3W1S A;  4A20 A;  2KMA A;  2KLC A;  1WFY A;  1WY8 A;  1YX5 B;  3U8Z A;  4MSM B;  3NY5 A;  2M8S A;  4N9F 4;  4DHZ B;  4TQ0 A;  1WM3 A;  1NDD A;  2XBB C;  4TQ1 A;  3VH4 B;  2KC2 A;  3ZVV A;  1WGD A;  1RAX A;  3QJZ A;  3VH3 B;  4LJO B;  3T9L A;  3DQV A;  2FCM A;  3QC8 B;  5AEK B;  5LXI B;  2DZM A;  3A9J A;  2FCQ A;  4HCP B;  3HM6 X;  3L16 A;  2UYZ B;  3R7R A;  2FCS A;  4B6W A;  1OQY A;  2FUH B;  1Q5W B;  4GB9 A;  2K25 A;  1IPG A;  3QHT A;  3NS8 A;  2JZ3 B;  3TJP A;  4B9K A;  4FLH A;  4NY0 A;  3H7P B;  5D94 A;  2KNB A;  5E6N A;  4RM9 A;  3VTW A;  4NAW B;  2MBH A;  5L95 C;  4DBG A;  5DCN A;  5G55 A;  2KN5 A;  4AJY B;  1CMX B;  1R4N I;  1WX7 A;  4EZL A;  2IO1 B;  2R2Q A;  1UZX B;  2FAZ A;  3W1Y A;  2LRW A;  4KVG B;  1V49 A;  2N9X A;  1Z5S B;  1WGH A;  1E8Z A;  2AWT A;  3SHQ A;  2LGY A;  2PPH A;  2LVO A;  2N9E B;  3ECI A;  4MM3 A;  2KJR A;  3ZIM A;  3H7P A;  1T0Y A;  3RUI B;  3I3T B;  2MSE D;  3L13 A;  4PS8 A;  3BIN A;  1EF5 A;  1KJT A;  3RYT A;  3R3M A;  1BT0 A;  2LI5 A;  1WXA A;  2GBK A;  1RFA A;  1OTR B;  1LM8 B;  2KFJ A;  4HPM B;  2RGF A;  1GG3 A;  1KLV A;  1WM2 A;  3IBE A;  3ZO5 B;  1WRD B;  2L3Z A;  3VHT C;  2XEW A;  3HIZ A;  1XQQ A;  3EHV A;  2KX0 A;  2RPQ A;  1TZ1 A;  3AU5 A;  1L2N A;  1Y8R C;  2BWE S;  1GC7 A;  5D7G A;  2D2Q A;  5EDS A;  3KYC D;  2KC1 A;  2I1J A;  1S3S G;  4IUM B;  3HK0 A;  2BYF A;  2ZNV B;  3ZRF A;  1WR1 A;  3CST A;  2MP2 B;  1OGW A;  4MGZ E;  2NBV B;  2NR2 A;  2L0T A;  3WAL A;  4ZYN A;  1WE7 A;  3ONS A;  2GBJ A;  2LJ5 A;  2ZNV C;  3QAR A;  4TUU A;  3RT3 B;  4RMA A;  2KTR B;  2KDE B;  5AZG A;  1WGY A;  1TGZ B;  2C5L C;  2FCN A;  4FN2 A;  4A3O A;  4NQL B;  4GDK B;  3KW5 B;  4DHJ D;  2R2O A;  3VTU A;  1V81 A;  4K7W A;  2DZK A;  4KSK C;  3OAW A;  4HLE A;  4II3 B;  4EZJ A;  4FBJ B;  4HWI B;  2JZZ A;  2WDT B;  4PYZ A;  2V3S A;  5CHW A;  5GMV A;  3RCZ A;  1E7U A;  2O6V D;  1V9J A;  3U7D A;  4IG7 B;  2JT4 B;  3PS6 A;  2DHZ A;  2C60 A;  1C1Y B;  4M8N A;  2RR9 A;  2L7R A;  1E7V A;  4LDT B;  1YQB A;  2RD0 A;  3VTV A;  1P0R A;  3ENE A;  2MBE A;  3X23 A;  2KTF A;  2KTR A;  2DAF A;  4IC7 B;  3EFU A;  2V1Y A;  1WMH B;  3PPA A;  4M8M A;  3SD5 A;  3ZTC A;  1H8C A;  4G0N B;  4E74 A;  2BKR B;  2NS5 A;  2N1W A;  4GDK A;  3H1U A;  3DVG Y;  1NI2 A;  4MJS A;  3ML8 A;  3TIX A;  4A3P A;  4TKN A;  3UQA A;  1EO6 A;  2JF5 A;  3N3K B;  4JLC A;  1A5R A;  5E6P A;  3AXC A;  2KQS A;  3DVN V;  3PRE A;  2N9P C;  2WWZ A;  2HJ8 A;  2IBI B;  2G4D B;  4KV2 A;  3VDZ A;  2EMT A;  4NJ7 A;  4IWO A;  2MBQ A;  2N4F A;  4DDG D;  3SDL C;  1EF1 A;  5DPR A;  2KWV B;  2A4Z A;  4EUT A;  1IYF A;  1UEL A;  4FUL A;  3PV1 A;  3JVZ X;  1OEY J;  5D2M B;  2Z0D B;  4MGY E;  4BKG A;  3P2B A;  3MTN B;  4XX5 A;  2AYO B;  1KOT A;  4K81 A;  3L54 A;  5JH5 C;  2LZ6 A;  4YL8 A;  4NQK E;  4W9F A;  3WA0 A;  1YD8 U;  1ZGU B;  2JRI B;  4FJY A;  2BGF A;  1UBQ A;  4JQW C;  2LAS A;  4P7I A;  3TMP B;  2IZV B;  2MX2 A;  2KK8 A;  2MBO A;  3QA8 A;  1E8X A;  2NCN A;  3MJW A;  4AUQ C;  3HHM A;  2KLG A;  1D3Z A;  4II2 B;  2WX1 A;  3QWZ B;  1Z2M A;  2DYM A;  4AJW A;  4NJ6 A;  4WWO A;  4HJK A;  2K8C A;  3QX1 A;  4EOY A;  2K8H A;  4MGI E;  2J0J A;  1P3Q U;  3B0A A;  2K6Q A;  4KZC A;  2LRU A;  3CSF A;  4TV3 A;  2D07 B;  4I6N B;  4W9G A;  5C1Z A;  1KM7 A;  1WYW B;  4WWP A;  3KVF B;  3M62 B;  3PSE B;  4EFO A;  3AUL A;  4X57 B;  2DX5 B;  3EC8 A;  3CMM B;  1M94 A;  2CU1 A;  1G6J A;  1WI0 A;  3NHE B;  1GUA B;  2VRR B;  5LXH A;  4AOF A;  2W9N A;  4K1R B;  3X0W A;  4ANX A;  5CX3 A;  4W9I A;  3V60 A;  3UQB A;  3KUD B;  4W9E A;  2J7Q B;  3PLV A;  3TL5 A;  4DK5 A;  2EKE C;  3APD A;  4NAW A;  2DEN B;  2HTH A;  3B08 A;  5G2N A;  3RD2 A;  3T8M A;  1E8Y A;  3VXW A;  1RRB A;  2BF8 B;  3WAN A;  4GDL B;  3V62 A;  4KDL B;  4ICV A;  3UGB B;  1WJN A;  4ANU A;  1WF9 A;  4KDI C;  4NPN A;  2LXA A;  1J8C A;  3RZF A;  2KDI A;  2AL6 A;  1VD2 A;  1UD7 A;  1AAR A;  2KDF B;  3QAQ A;  3PLU A;  3RZW C;  5KHO A;  2JUO A;  4FJV B;  4W9D A;  1J0G A;  3K9O B;  5AZH A;  3VUX A;  1VCB A;  3PRP B;  5IA7 A;  4WQO B;  3M3J A;  2EMS A;  2JXX A;  4BKT A;  3ZUN A;  4IWP A;  3PT2 B;  3V6E B;  1R4M I;  4GU2 A;  4MEL A;  4WJQ A;  4RM8 A;  3ZDM C;  3DOW A;  2KAN A;  4DHJ B;  4G3X B;  1RLF A;  5CHF A;  3VUY A;  4NNJ B;  1C3T A;  5J2R A;  1WH3 A;  2CKH B;  2FID A;  3PRM B;  4CYE A;  1E90 A;  3NOB A;  4GDL A;  3TCA A;  2MW5 A;  3NZS A;  4W9L A;  3JSV B;  4IM3 A;  2O6V B;  3N30 A;  4KSL C;  2ZCC A;  4LJP B;  1GJZ A;  1Q0W B;  2KFK B;  1TBE A;  1YX6 B;  1P9D U;  3KUZ A;  3QQ8 B;  2MWS B;  3L08 A;  5HKH A;  3H9D A;  2C7N B;  1UH6 A;  1LXD A;  2MP2 A;  4FHJ A;  3ZNZ B;  2FNJ B;  3Q3J A;  3V6C B;  3TBL D;  2BYV E;  2OOB B;  3IHP C;  2C7H A;  2L05 A;  2K8B A;  3VUW A;  4B95 A;  4XC2 A;  5JHA A;  3A9K B;  1WZ0 A;  3JSV A;  5BO4 B;  3DVN U;  4F8C B;  2KVR A;  4MGK E;  1MG8 A;  2O6V A;  5AZF A;  2KDB A;  2N7E A;  4DDI D;  2JRH A;  1OEY A;  2K1F A;  3KH0 A;  4FJZ A;  2KFK A;  1S1Q B;  1J19 A;  2LGX A;  3M95 A;  4W9C A;  3WAM A;  3ZKJ C;  4XZ4 A;  4BBN F;  4GMV A;  1IP9 A;  2GBR A;  3L0W B;  1UGM A;  1WXM A;  1WX8 A;  1ZW7 A;  4GOC A;  4PS3 A;  2C7M B;  4BKS D;  4G11 A;  4DXA B;  2KHW B;  2KJ6 A;  2PJH A;  4JGH B;  3UIP B;  2G45 B;  1WJ6 A;  3WIM A;  2HE7 A;  1V2Y A;  4HXD A;  2L0F A;  2KWU B;  4EEW A;  4OVV A;  2GMI C;  4HVB A;  3QIJ A;  3DBH I;  4HK2 A;  1WMH A;  3A4R A;  4CO7 A;  4HCN B;  4WJN A;  4HPL B;  4E71 A;  2LGD A;  2M4N A;  5J18 A;  2IY1 B;  1XT9 B;  3KUC B;  4I6P A;  2CR5 A;  3PGE A;  4ZRJ A;  4KIK B;  3H7S A;  5CHV C;  4J6I A;  3GOE A;  2G3Q B;  2MQJ A;  2KWC A;  2YLM A;  4BBN C;  4MEM A;  2K6D B;  2UWQ A;  4LCD E;  1WX9 A;  2KQ7 A;  1V80 A;  2D11 A;  4E3C A;  3PHW B;  3N32 A;  1TTN A;  2ZEQ A;  4PYU A;  2FIF A;  4AWJ A;  4ANV A;  4FA6 A;  3APC A;  1SIF A;  2IO2 B;  3ZNG C;  4MSQ B;  2NBW B;  5CTR C;  3KYD D;  3SU8 X;  2BPS A;  3CF6 E;  1WJU A;  4ASW C;  4GXB A;  4WJP A;  2IY0 B;  2DAJ A;  2QHO A;  1WIA A;  2MBB B;  2MLB A;  3C0R B;  3S2A A;  2KXJ A;  3A33 B;  3BY4 B;  1SE9 A;  4MDK E;  4KIK A;  4WWN A;  1WXV A;  2Y5B B;  1WZ3 A;  3IFW B;  3JYU A;  3LJ3 A;  4MH0 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...