1UELB

Solution structure of ubiquitin-like domain of hhr23b complexed with ubiquitin-interacting motif of proteasome subunit s5a
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
48
structure length
48
Chain Sequence
GSHMTISQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQGAEFGQAESAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UV excision repair protein RAD23 homolog B
publication title Structure of the Ubiquitin-interacting Motif of S5a Bound to the Ubiquitin-like Domain of HR23B
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation/protein binding
total genus 10
structure length 48
sequence length 48
ec nomenclature
pdb deposition date 2003-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02809 UIM Ubiquitin interaction motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.890 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1uelB00
1UELB 1YX5A
chains in the Genus database with same CATH superfamily
4WK8F 4BE2A 2F5EA 2HOSA 1S5LC 2CUZA 1MBJA 2Z33A 5AIPA 5H6RA 2E1OA 2DFFA 2BGCA 3SQNA 1XSVA 3S1RJ 1QPMA 4R8HA 1U3EM 1RUNA 4KITB 4IO9F 2IW5A 3P9CA 2R7FA 2CW0F 2P0WA 4LFUA 2WY7Q 3QU3A 1TBXA 4LK1F 2F4IA 2B7EA 2EFNA 4BACA 1JKPC 4DIQA 3GMEA 3RCOA 5JI6A 2M7BA 1NH3A 2DT7B 1DGRM 2E1MC 3PSFA 1D8JA 2HQAA 3KZIC 4RBOA 2KIUA 3VOEA 2VE8A 3VPRA 2DCEA 2YX4A 4A12A 2Z3YA 1I39A 1Z7UA 5LGTA 4G94A 2Q8KA 4CZCA 1ZARA 4B47A 1LPQA 4L5EA 1IZ1A 4AU7A 2NXNB 2VJIA 5D8KB 2RDPA 3QOEA 2E60A 3OYFA 2QWWA 4RAZA 2BE5F 1V55H 5FKLA 4Y13A 1BBYA 3CO6C 2MH9A 4IZZA 1J5YA 3HKZA 4DGWB 4LLNA 5E1XA 4EATA 1MKMA 1HCRA 4Y52J 1FJLA 4PSWA 2N8GA 2R7WA 2F5VA 2I8DA 1F43A 4EJTA 4U88A 4EV0A 3E6CC 2IRFG 2XKOA 5E79C 4BEHB 1AWCA 1U8RA 5LD2C 3CP2A 3K69A 4YFXF 5IT9K 2HZTA 5IP9J 4HV6A 1YHQI 1YW7A 1YIOA 2DA2A 1TWFJ 3DPUA 1R5HA 2W85A 4UUSB 3QYFA 2OD5A 1VQOI 4XKVA 2CFOA 4ZDLA 2GIZA 2PX9A 2WAQN 5CVUA 1IJWC 4N4OB 3JRAA 5CLSA 1H0MA 1KU9A 1D5YA 3GW2A 2R7RA 3OR2C 2Y0SN 4PK4A 3IAM2 3RZOJ 4Q47A 2R7DA 2NNYA 2E7WA 4BE0A 2E2JJ 3HM5A 1WFXA 4A3IJ 3S1QJ 3L2WA 3CMYA 2VXDA 3G2BA 3IHUA 1EJ9A 2R7OA 1SAUA 5J8CA 4NQWA 3DFGA 4C9YA 4PSXA 1U5TC 2WTEA 4MO7A 4ZYEA 2ZNZA 2DA6A 2JSPA 4A3BJ 2VKDA 3K2AA 4A6DA 5F0FA 1VQKI 1F36A 3U9GA 2GAUA 3BCBA 4CCNA 1IW7F 1YYVA 2PMUA 2HQNA 5ILUA 2V7FA 2PMZN 3I54A 3CCMI 4C30A 2J5OA 4A3JJ 1B59A 2CO5A 5LHIA 2BVMA 3LA3A 2CFXA 3DF8A 2WAFA 3VFZA 2DLLA 4A3DJ 5LBQA 1A36A 3HB9A 3ZQFA 3IV5A 4Y3OA 1WI9A 4DOZA 1WZ2A 1LVAA 1OPCA 3BR2A 4YRVA 2DA3A 2FXAA 1H9GA 3TOBA 3I58A 4OMZA 5FLXK 1VI0A 2FEZA 4AYBA 2ISZA 3Q5FA 1W36C 1Z67A 1CQTA 1QHGA 2JA8J 4HX8A 2EZLA 4D1QA 1T08B 2XPWA 4CO8A 5L3EA 4AVPA 1H8AC 1MBEA 2V4JC 3I53A 2DA5A 3KP2A 3OYHA 2KJCA 3DP7A 3BT9A 3CDLA 1V3FA 1D1AA 5K7ZA 3KE2A 1HC8A 3ERED 1X1AA 4RGRA 3JW4A 1IF1A 2O7OA 1W5CC 1HSTA 4OOIA 3COAC 2L0KA 4LLGF 3E6DA 1ODDA 2LYCA 2STWA 4HSTA 4LMYA 2HWVA 5ICFA 1ZRFA 3TP0A 3M8EA 4M9SA 3R4KA 1U9OA 2K9SA 3OOUA 5FKNA 2FD5A 2LSOA 4MFEA 1WJEA 4XLCA 3CJTB 1BW6A 1UHSA 5EEHA 3OYAA 3U1DA 3H3VK 1P2FA 1HOMA 1KQ8A 2H1KA 4KJZA 1RETA 1PVEA 1HKSA 3TMOA 4C3JJ 4I02A 2R5YB 3LMMA 2E1CA 1MBGA 3O6BB 1WI3A 3E5QA 2MC3A 1HQCA 4B44A 5A2QK 1MSEC 3OOPA 5IYBJ 1OYYA 4DZPA 1MMGA 2IPQX 5DDGA 1IN6A 5DUKA 2Z5UA 5FGMA 1YG2A 3RI4A 2CUEA 4M3EA 1LKXA 4NNJA 4AC0A 1WGXA 5LRSA 2EA4A 3J7ZI 1QZEA 1MNDA 5HLTA 3L2CA 2VIXA 1GVJA 2XAFA 3O3KA 4NDLA 1G3YA 2L7MP 4UB8C 5CVVA 4QIWN 1MMDA 4D7NA 5J47A 1G59A 3V7SA 1VNDA 1ETYA 2KMUA 1L3LA 2EPFA 3HOYJ 3TDUC 4LG0A 2GA1A 1ETVA 4ZTFA 4ZYHA 3RQ4A 1ZRDA 1UAAA 4OINF 4HLXA 3OIPA 3CLQA 2IS1A 2OQRA 5ICGA 2RN7A 3TGNA 3G1MA 3ONQA 3BOQA 3C3WA 2DO7A 5HDKA 2EB7A 1WRJA 4F52A 2DPDA 2CMPA 1WQ2A 5JVGF 2LC2A 2VQHA 1U5TA 4N4NB 3TW7A 3IUOA 2VXZA 2PBIA 3T8TA 2LY9A 2LY1A 1W5TA 5BQTA 4ZZDA 4KYWA 1ZK8A 2D2WA 1W36D 4M3DA 1BI0A 3W2VA 3IRRA 2H6CA 4RAYA 2RGVA 3S93A 3OR1C 3Q9SA 3ZQCA 3LAPA 3BC8A 3RKQA 1QVUA 1EA3A 5HDGA 2HVSA 1IO2A 4IL6C 3VWBA 1QBJA 3HSRA 4HA8A 5FKKA 4F93B 1E3PA 3C2BA 1ZELA 3EYYA 5E20A 2LF7A 3W3CA 2XF5A 2H8WA 3HGGA 3RSNA 1RR8C 2D1HA 5KAFC 3FXLA 1T6SA 2R7SA 1BA5A 1X4PA 1TLHB 2K40A 1USSA 2TDXA 2WC2A 3KFWX 4I7HA 4RGXA 4Y17A 4A0XA 4UVAA 2JUGA 2QYOA 2IEKA 1ZGAA 2IGNA 2LKSA 1X58A 1Y56A 5E1ZB 2OCCH 4G12A 1MSFC 1B72A 5L3BA 4BQAA 2M9HA 1BIAA 3I3LA 5A2QZ 4HX7A 1ETQA 3RJPA 5EG0A 1DP7P 1ERDA 4ENNA 4W1UA 4NUBA 3WTTC 3BTIA 1DU6A 4E7IA 3UKGA 4C2UA 2IT0A 3HSEA 5H20A 2D1VA 3WTZA 4PJNA 2CQQA 2R5ZA 3VEPA 1B8IA 2VBYA 2D5VA 1UZCA 3KLOA 3QPHA 3KYDB 4II2A 2L9VA 4BDZA 3BJOA 4IPAA 1FPQA 4NQWB 2PMHA 1XPXA 4S05A 3OIOA 2UUZA 1R4MB 1HW1A 3DXJF 3PUBA 4ETSA 4U7DA 3JRIA 1RESA 2Q0OA 3ZQHA 4RA2A 3SEZA 4BL0B 4BY1J 1I3QJ 4XICA 3CZ6A 2I10A 2FBIA 2NOJB 1WJAA 2GOMA 3EETA 2KIQA 2VKVA 2XSJC 3L09A 4M3FA 1P92A 4Z6YA 4XQFA 3GVAA 4UUVA 2DMNA 4UUTA 5IY5H 3GTQJ 2KHMA 1P4WA 1TNSA 1XTAA 1LFBA 2XAGA 2KISA 3H92A 1D0ZA 2JRTA 1S7OA 3SEQA 2IXSA 2R0QC 4J19A 3FXOA 3CD6I 2XGXA 1IUYA 2WWYA 3LA2A 3OWTA 2XAUA 4KNYA 5HDNA 2LREA 4IKFA 4O3MA 1GXQA 1K83J 4V2FA 5K5QA 2E1MB 4OAYA 3C7JA 2BBYA 1FOWA 1J09A 3GWZA 4XL9A 2HQRA 2V1UA 4I76A 3ULQB 2P4WA 3DPTA 4JP0A 3W6JB 4L9TA 5IYCJ 5FLMJ 4ON0A 3MN2A 2L9NA 2CUJA 5FO5A 4BKXA 2ISYA 2IVMA 2EZIA 3FM5A 2K9QA 4G7ZF 2QCOA 2YU9J 2VODA 3OL3A 3WTVC 2JT1A 1YE9A 2MSYA 1KQ9A 4C3IJ 3JRHA 2IGOA 1DGWY 1PUEE 1OLTA 4NC8A 3BCAA 4NC7A 4RM2A 1UG2A 3WTXC 2IS2A 2GBYA 3HG9A 5ILSA 4HZFA 2IAIA 1BC8C 3S32A 2PFBA 1RRJA 2VQLA 1ZG5A 1NG6A 1M1EB 2XF7A 4RB0A 1HBXG 2XGCA 3DU5A 1MJBA 5GPCA 1QRYA 1WVRA 1XDUA 2L7FP 3ISPA 4ZYAA 1X3ZB 5JLXA 3C18A 2O61A 1YTYA 2QSFX 4AM3A 3L9FA 4XBFA 5D5VB 5TGTA 3KP4A 1LFUP 3HOZJ 3F6VA 5E17F 1WJFA 4XLAA 1WKMA 1S72I 3FXJA 5JHFA 3FDYA 4C2MJ 4DYCA 3LSJA 4UB6C 4E4HA 5CVRA 3L2RA 4LG0B 4RB2C 2PJPA 2RNJA 1N75A 3HOUJ 3GFIA 3L1PA 3HZJA 1IC8A 1K79A 5FRMA 2LK2A 2FNPA 5FLVA 3SXYA 2KLOA 1Z3XA 2JK3A 3QWLA 4MFDA 2CV2A 2DDBA 1GHCA 4UV9A 1P4AA 2YS9A 3FMRA 3KZYA 1GUUA 1U5TB 2A05A 4YIRX 2HOTA 4CGZA 4KMUX 5ICCA 2M8GX 2KT0A 3M9AA 2XASA 2JA7J 1ETKA 4NBQA 1Z77A 2P81A 3N4MA 1YQAA 5ICEA 3SFIA 1H89C 1TC3C 1ON2A 3PNTA 5H6QA 4A3GJ 4EQQA 3F23A 2DK5A 4CICA 3VSLA 1YJWI 3ZPLA 2V9KA 5TRDA 2O8KA 3LSPA 2NVUB 3HXLA 4O5VA 2MD0A 3BDDA 4AD9A 1HF0A 5HS9A 3RYPA 1TTYA 2Z1DA 3LSGA 1RR7A 4P55A 4BEHA 2XUBA 4GXOA 2QBYA 1YJ9I 3WTWC 2VL8A 1ENHA 4XKBA 3D5LA 5EYRA 2OJED 3L2VA 3GTPJ 4FASD 2BY1A 1B72B 2W00A 2KRFA 2XV4S 4XORA 3ZRGA 3KCCA 3VYSB 3A03A 2W24A 4KA4A 5EG0B 4XN0A 4XRSA 4XRMA 1YFHA 2NNNA 3GF2A 2ZJPF 1VQ9I 2FQ3A 4IF4A 4M9ZA 1TQMA 2E35A 4FX0A 4HG2A 4I2OA 1VQ6I 2LR8A 3S1NJ 1IV8A 3PUFA 2Q2EA 5E8IA 4QLCU 4FCYA 3CMMA 2R5ZB 4AIKA 1WJBA 1B8IB 1YS6A 2CSOA 3ZMSA 5CVJA 4HF2A 4OU0A 1TWHJ 3E97A 4WF2A 3WU0A 2XROA 1A31A 1BC7C 4X0GA 2HS5A 3D1NI 3PIOF 2Z16A 1IN8A 3BJ6A 3GXOA 1HKTA 2CU7A 2QUFA 1RIOH 1KONA 1O3RA 1YITI 4LK0F 4RLFA 4BHCA 3JRGA 3LSTA 1QO0D 1RPWA 2X4HA 5HLHA 1D5VA 3HUGA 3DLAA 2CJJA 1HLVA 3AG3H 3JTGA 1XX5A 2PI0A 1UMQA 1DPUA 1XCBA 5LFAA 1LB2A 1F1ZA 1I5ZA 3K1PA 3E1SA 2VC1A 2NRAC 4BQNA 1UFMA 3K70C 5M3FJ 3MQ0A 1BI2A 1ETOA 3W2WA 1IRGA 2DYRH 1T8IA 1I6HJ 2JTVA 3O8HA 1VQPI 1FOYA 2BV6A 2CW7A 2HOEA 2Y2ZA 2UZKA 2R7VA 2IGKA 3PO2J 3LAJA 2AQFA 2KJBA 3FF5A 2STTA 2M0MA 5HVQC 5GTHC 4CXFA 1WH5A 2Y9YA 5HNFA 2XKPA 2MFZA 2HPMA 4HYEA 2FOKA 4JQFA 5C4JJ 4LD5A 2R3SA 2Y31A 1ULYA 2AXLA 3ZQIA 2JZYA 1ZR2A 5E18F 4UY8I 1WSUA 1RC9A 5LLQA 3BZKA 1X3UA 3P9IA 1OMIA 3TO7A 3SHFA 4E7KA 4JX4A 1MDMA 2ZNYA 4DJAA 2W84A 2WA0A 1R5ID 4ESFA 3A02A 5EF6A 5BPDA 3AG4H 1R71A 4XRFA 4UNOA 2LP0A 2M1BA 2H1LA 4OIPF 3DEWA 4M74A 1KA8A 4A3CJ 5BS6A 3CCSI 4KN7X 4LITA 1Y39A 3G4SI 1FYKA 4IJAA 4HAMA 4BY7J 1LFPA 3E7LA 4MQ9F 4KN4X 1LDDA 2ZXIA 3WGHA 3X2QH 4BHPA 3IL2A 1AKHA 2H6BA 5HLGA 4A5MA 4B43A 1J59A 1GXPA 3CF5F 3CCRI 2BW3A 3D5RC 4IHSA 3DKYA 2Z2SB 3G71I 2YX7A 3GLXA 2CQ7A 1R1TA 3F72A 3DTIA 5GAEJ 1Y8QB 3JSPA 1ZG3A 1VQMI 1FC3A 4DQ2A 2K9LA 2O5RA 2HDCA 5JFRA 1KQ0A 1S7EA 2Y69H 4EJOA 5EGOA 4C2TA 3WTSC 1TW2A 2DFHA 1I27A 3L7WA 4OIRF 2M87A 1IN5A 1LEBA 4DNCA 1RZ4A 5J6XA 4BQQA 2OZUA 4E7SA 2DW4A 3LWFA 3AG1H 1PUFA 5DCMA 2EJRA 5D6EA 2L54A 1XGSA 1SVMA 2BZTA 2DTRA 3K4JA 1Z9CA 1FSEA 5D5UB 5F1RA 1R6RA 3H5AA 4NB5A 1QA6A 2B0LA 2ZSIB 3M3YJ 2FBHA 5E8GA 3ABKH 2Y9ZA 3FBNB 1H9TA 3HYIA 2V6CA 3JRBA 5E1WA 3DU6A 1RI7A 2LG4A 4RS8A 3PNVA 3CTAA 3K70D 3SZTA 4MGRA 3H9GA 4OAZA 3GTGJ 3E6BA 2CYYA 1VFCA 2FE3A 1Y6IA 2EIJH 4M9XA 4LGWA 4ITVA 2QF7A 4OMYA 3HTSB 3S15J 2DOFA 4QPOA 2L2OA 4UHTA 3HOXJ 1XSDA 2QKMB 1MH3A 1G4DA 4BBSJ 5C4XJ 4GFBA 2JPCA 3F8CA 1W1WE 4MLOA 2F5DA 2V26A 3MZ8A 3TBIA 2ESNA 2Q1ZB 3KX2A 4FT8A 5DTDA 2M5WA 4BJ6C 3ZQ7A 3CP8A 2QQAA 4UVBA 5LGNA 3IRQA 1J9IA 1TQIA 4PJ0C 5E3LA 2HR3A 4L9VA 2QBYB 3ZN1A 2ZFWA 4EJWA 1F5TA 2MC4A 2KKOA 2EQRA 2CS3A 1GV5A 1DPRA 1Z3YA 3U21A 1JKOC 1A6QA 1TWCJ 4LOCA 1R22A 2IS4A 4A3EJ 2MGQA 2FMYA 1I6XA 3G3ZA 2NVYJ 2OTJI 4XK4A 3HOTA 1VQ5I 2ZMEC 1QGPA 4FETA 4IXAA 4LG3A 3MWMA 2Q2EB 3HOSA 3IP4B 2V1DA 3WG9A 3JSOA 3ZMZA 1MNEA 3HGYA 2G7HA 3CCEI 1FLIA 3Q0VA 3QQAA 3EPZA 3RZDJ 4G6DA 2XAQA 1T0FC 2R7TA 1OR7A 2YR2A 2QQ8A 3HL2A 4XSXF 2CW8A 4ZYDA 3MKLA 4BU2A 3I5UA 3HUGB 1D1CA 2DOAA 2O9LA 1X4OA 3CESA 1EH7A 3GFJA 1P6RA 3DTEA 2CUFA 5D4RA 3KETA 5IPAA 4BUPA 1X19A 4I0BA 1G3SA 1WJCA 4L18B 1O3SA 3K1MA 2X6OA 3REOA 1EH6A 1I50J 4IVNA 4YFKF 1DU0A 2W7NA 3QYEA 1I1SA 4YG2F 1BJZA 2BXZA 1V5EA 3ABLH 4CHUA 2P6TA 2ADUA 2EBIA 2HI3A 3VODA 2K85A 1LDKB 2FX0A 1GT0C 1ZTRA 2LDUA 1MH4A 4M71A 3DPLC 1SD4A 2K4JA 3BG5A 4W97A 1YO5C 2V1NA 2WADA 3DBHB 2WB1A 4CCKA 1ZREA 1X1BA 3F9KA 2E2IJ 2NS7A 1B9NA 4GO1A 2AXTC 1PJRA 3HBLA 1FYMA 3OY9A 5IT9Z 2P5VA 3M7GA 2JRMA 1Z21A 4XKCA 3H36A 1N78A 4A0YA 2FU4A 3GBGA 4JX6A 1MDMB 4L0ZB 3K9TA 2JPBA 4L9NA 1H88C 2VJJA 4P1WA 2R7QA 1USTA 3DTKA 4P9UA 4ESJA 2W1OA 1JJ8C 2KL4A 5HODA 3CCYA 2XPVA 2V9PA 1IAWA 3S3NA 1VQLI 2FOWA 4XR6A 2PLYA 1D1BA 3HOVJ 2E36A 2X1EA 3CJRB 3LQRA 3HRUA 3BPVA 4OIOF 3CUOA 3DBRB 1AKHB 1FEXA 4BS9A 4UXNA 1FTZA 4ZYGA 4I01A 2BW3B 3QP5A 4DZJA 4EJVA 4V19K 2O3FA 5K1YA 3GO5A 1UJ8A 3AL0C 2WAEA 2WV1A 3ZMUA 2EH3A 4CCOA 2A68F 1FSHA 1G2HA 5EGOB 1HDPA 2VB6A 3NARA 3RPQA 4HNVA 2V6EA 3GYHX 4MTDA 1A04A 4CH7A 5BNGA 3BP8A 2M45A 3IWFA 3OYCA 3HKZN 2IJLA 3I4NJ 1PUFB 5DCMB 1POGA 2ETHA 4MHGA 2M0CA 2ZMEA 2W4SA 3F3XA 3GFLA 3TKYA 3F22A 4FE7A 3RYRA 1Q1VA 3FK7A 3LSRA 5FLXZ 3GZ5A 4GRIA 1S9HA 4WCGA 2B9SA 3GEZA 1U0JA 1YLFA 4MNUA 4R79A 1FWZA 4OIQF 4HNTA 4BYYA 4HDVA 1XS9A 4IRIA 4CSWA 5E3NA 1T0FA 2VPRA 5L3FA 4B8XA 3JTHA 3MAJA 4EM2A 2GQQA 1FMWA 2X0LA 4G7OF 3FXQA 3M07A 2X48A 2D45A 1EF4A 2H27A 1R58A 3ZQGA 2E5ZA 3U2RA 2LY2A 2X51A 1P9QC 1IRZA 3N97A 1J7KA 3ZN0A 5B3SH 3CUQA 3S14J 3EQLF 4PDKA 5IOZA 3JRFA 4RGSA 2X9DA 4A3FJ 3ZMTA 4N9IA 2LH9A 3NWTA 1U8BA 3BTCA 1QQIA 4NHJA 2MABA 3E6MA 1IDYA 4XOTA 5GTIC 2J5PA 4CCJA 3DBLB 1TNTA 2E34A 3QPLA 2IBDA 4BQOA 5KHDA 2RQPA 5K7HA 2VONA 3M4OJ 3KEQA 2X6XA 4D5FA 5B1BH 2VBZA 1HDDC 3F8BA 3R6SA 2GIVA 3S1MJ 3L2QA 2AQEA 3E5UA 4AVZA 5C3EJ 2BXYA 5M5XJ 1VF9A 3LSMA 2K7LA 4I0AA 1XCVA 1EV7A 3OYGA 4ZDOA 4BHBA 4CYCA 4L5JA 5EDNA 5B1AH 3C1DA 1K7AA 1SC7A 1SFUA 2IS6A 2CQNA 4P9FA 3GTLJ 5IOYA 1A6IA 3U1KA 5CQGA 2R7ZJ 1R1VA 3R0JA 4KUMA 4AYBN 1JI8A 2K3FA 3K6GA 2VOPA 1RKTA 1FIAA 2E2HJ 3LA7A 3J81K 5EZGA 1B4AA 5IYDJ 1JT6A 2KZVA 5DEQA 1TW3A 3DKWA 3QAHA 2IGMA 5IP7J 3UR3C 1BI3A 1OCCH 2CWEA 1BOBA 4LB5A 4I98B 2Z99A 4E70A 3SDGA 1OYIA 1MGTA 5HS8A 4DW6A 3BR1A 3DEUA 3RPUD 2QA4I 2L02A 4YIIA 3BR3A 4QPQA 3GTOJ 3JREA 2JVGA 3E3VA 2JA2A 2K4BA 3ABTA 2LLKA 3ZQQA 3CCUI 2BEOA 2DXIA 4EGYA 1JGSA 2ME6A 3GZ6A 2VI6A 5H2FC 4XSZF 2KPMA 1Z0XA 1QZYA 3FXKA 5D4SA 4HF0A 2OV7A 1YRNA 1VQ4I 3SDBA 4D0PA 3BJAA 3K10A 3PM1A 3RPUA 1ZN2A 2MLKA 2HEOA 2O6GE 2HOAA 1OCZH 1UHWA 2KDZA 2DAOA 2DDAA 3FKIJ 3N05A 2L7ZA 2TRTA 4DBQA 5D5WB 1G8XA 2HPIA 2LNBA 3Q0WA 1PDNC 2FSWA 1QPIA 1QZZA 2K3PA 1B6AA 4EJUA 3OV8A 2DJIA 3IKVA 4XMYA 1LEAA 3BR6A 2VJ5A 1BJAA 2A6TA 4U0YA 2BY3A 3PNYA 1U6GA 2HYJA 2VT2A 5EJCA 3MMYB 1XMKA 1SD5A 1W4MA 2ZBKA 3LSKA 3A01A 2OCEA 1KU3A 2XGDA 3FK6A 2BVLA 2DQRA 2ZKZA 5DM7F 5DV5A 2O0YA 2OQGA 1EKEA 2RC4A 2FMLA 3K0LA 1YW8A 4LIUA 2GLOA 3J81Z 3FBIB 2EFWA 1Y0NA 5E3OA 1DDNA 2O03A 3M8FA 1J75A 4Q5SF 3BR5A 5J1RA 3TQNA 2COMA 2ELKA 4E7JA 1YJNI 5F6FA 1R36A 1I1GA 2L5QA 3PJRA 2R4GA 2P7VB 4XN3A 3ZOBA 1WWXA 4M6VA 2IA1A 2ZMEB 2Y30A 1D3YA 2EINH 1WJDA 5J40A 5GAGJ 5ED4A 1E0EA 1FP2A 2XVCA 3BQZA 1SANA 3K4CA 5E3MA 4FX4A 3ZMDA 2M7AA 3PO3J 1ITYA 3S17J 1P7IA 5M5YJ 1ZKGA 4F92B 3OYIA 2EZHA 2VN2A 1JKRC 4M3BA 1VZ0A 3DV8A 4PGGA 2X1DA 2F4OB 2MLGA 4G6TB 5FFZA 2OC6A 4D5CA 3BY6A 4KIGA 1RUOA 2MH2A 5L3DA 2VLAA 4R1HA 4BH9A 1XMAA 4UVCA 1R7JA 2ZXWH 4A5NA 3IWZA 3KYCB 1O3QA 2HKOA 2ICWG 4S04A 2KZGA 3CUQB 2RV8A 4B4CA 2DYSH 5FROA 2PN6A 3GLLA 2R7UA 2EK5A 3KP7A 3R0AA 2A3SA 2C6YA 4H0EA 2Y48A 4A3MJ 2L4MA 1E3OC 1SFEA 4RDUA 4XIDA 4I99C 2F48A 3I59A 3V8LA 2NVXJ 4IQJA 3DCFA 1FBUA 3RQIA 4B09A 5L3CA 2ZFUA 4C3HJ 1YI2I 2K5CA 1Z05A 3K4BA 1G3TA 2TCTA 4CYCB 4PFOA 4JYKA 1P7JA 2X6WA 3ASNH 3HPGA 1BIBA 2ZCWA 2KRHA 3KIOA 3L00A 3LFKA 3HDDA 3RKWA 1ZGWA 4HQEA 3F21A 2LFBA 1LUJB 4HPQA 3VYRB 5GAHJ 4M6XA 2XB0X 1NK3P 5BOXA 4M3GA 5HNHA 2NYXA 2VE9A 3D5SC 4FISA 2QSHX 1KU2A 2EZKA 2QQBA 1OYWA 2HU9A 2L9RA 3KYLA 1E2XA 2DBBA 2QEXI 1PP7U 3ZGKA 5HLIA 2COBA 2EV0A 3FXRA 4A3LJ 4A93J 4PZJA 3HRTA 2HKXA 1JTXA 4HX4A 5LRRA 5KNLA 4HRIA 3BR0A 2W82A 2QQ9A 2XGEA 4G6QA 2GXBA 3FX3A 1UELB 4DYRA 3AL0B 2M34A 4HV5A 1KU7A 1ACIA 4YIFA 3IC7A 4KMFA 4PJMA 5M3MJ 3NEUA 3LL7A 4PUSA 3RDIA 4D9JA 1XB4A 2HDWA 2ZB9A 2LTPA 2XF6A 4ZDPA 3BG6A 2PJRA 3MFKA 4F7ZA 1UHMA 1Z1DA 3I4PA 4BBRJ 1JHFA 3BZCA 4U0WA 1ZQ3P 2QENA 2HZDA 4DBRA 1X1DA 2LD5A 3EUAA 1YRNB 4IHTA 3WU2C 3WU1B 2VQGA 2EIKH 2DMQA 2DODA 3RTRA 1LE8A 3W6VA 3I0TA 3JAMK 4A6EA 1GVDA 1VQ7I 3CF2A 3T8RA 4JBAA 3H5NA 5IP6A 4KIBA 1W5SA 3HPHA 2YUSA 5J3LA 1B1BA 3F0CA 4EVIA 1VTNC 5LGUA 3C2GA 2M8EA 4IOCF 1OR7C 4G7HF 1HA8A 4ENMA 3FWEA 4GCVA 5KCMA 2L01A 5JHUA 3H9JA 2PMZA 2XB5A 5CPRB 2HVRA 5AIQA 2VQCA 3A01B 4IHVA 1IRFA 3HSFA 1T38A 1N25A 5ILVA 2MA3A 3CQZJ 4WWCA 4FQGA 4WXHA 3I56I 2M30A 5F08A 4BDYA 2DPUA 4CZZA 4HSRA 2JWTA 4ZJZA 5FD6A 1SVLA 2EFOA 2QSGX 3OYKA 1K61A 3E0JB 4HNUA 2F6CA 5JLWA 1Y1VJ 3OL4A 3CO7C 2BOLA 2OF7A 3A4CA 2CV1A 1AA7A 2A61A 1MBFA 1HW5A 1RNLA 5DD4A 4P96A 3DEEA 4JK1X 5K5OA 3A1YA 2K02A 3ZQLA 3MZHA 2KDOA 1OJLA 3GCMA 5F0HA 3V42A 2XAJA 5EZHA 4LB6B 4HF1A 3W6KB 1ZLKA 3ESWB 5KK1A 4L5IA 3WE3A 2HNHA 3PSIA 4CCLA 1MMNA 2GM4A 3TW6A 2EV5A 4XKWA 1NG7A 5L3GA 4IRHA 1XGMA 4OWRB 4YELA 5DD8A 4FE4A 3A0HC 3CC7I 3T5XA 1BI1A 3QP6A 3AFHA 4MIMA 1XN7A 1S3JA 3KP3A 1ZR4A 1MW7A 3JAMZ 5B66C 3P7NA 3CMEI 5HOOA 4BGDA 2DMPA 3BZ6A 1JT0A 3IH4A 3OYDA 3NWSA 3OYMA 1OCOH 2FNAA 5F1JA 2DK8A 4QWQA 3PFIA 3WHBA 1SD7A 3ERMA 5J8FA 2KRCA 1TWGJ 2IA2A 3HJEA 2E71A 4ENKA 1JJ6C 1HW2A 2XC7A 1S29A 2MBFA 3DLLF 2VC0A 4BJ5C 1X2MA 2Z9OA 4JX5A 2B63J 5FKOA 4RM3A 4K2EA 2DT6A 2QGUA 1GLNA 4WXDA 4CDGA 2F2EA 3ELKA 1T2KA 1IN7A 3BLYA 1IN4A 2ECBA 2HFHA 2XRLA 3GFMA 3I59B 3FZVA 1QU3A 2E19A 4Q48A 1O7FA 2VKEA 2W25A 4F91B 2W48A 3S2HJ 3IAS2 6PAXA 2LMDA 1IUFA 3HEFA 4NC6A 1GV2A 3BTJA 3BTLA 5CJ9A 2BY2A 1ONVA 3WGGA 3CCVI 1LQ1A 2GA2A 1R49A 4ZTJA 3BWGA 2L3DA 3Q3SA 2V79A 2YSRA 5C44J 1W7PD 2VKHA 2HGCA 1NTCA 3GZNB 4MTEA 3FMQA 1AOYA 1B9MA 2YU3A 1F9NA 4J01A 2LKXA 4MEXF 3NQOA 2DFIA 2HQ5A 4ZH4F 3CCJI 4CA0A 4S0HB 1T95A 4DYQA 3H5RA 1EH8A 1FYLA 2NOGA 4QSHA 2EA2A 2RVCA 4CUGA 1WH7A 3CUQC 4XLFA 3L2UA 1SMYF 4WXCA 1BR4A 3TOAA 1XMXA 3GX4X 4IEJA 1W7PA 2P6SA 3LQQA 2ZJRF 1FBSA 3SFZA 2JN6A 3AAFA 4XONA 2PJRB 4H4KC 1ZRCA 5F04A 3WTYC 5CKTA 2R92J 4KFCA 3EDPA 3H3UA 2VBWA 2FBKA 2A5YB 2GXAA 3B6AA 2WBMA 3ABMH 3FIWA 3P5JA 1C0WA 3H9QA 4IHXA 1LE8B 2NAZA 1SVOA 3F6OA 4B3XA 1FT9A 2UV1A 1R23A 3OYEA 2MYSA 2FF4A 3ZXSA 3S8PA 4L9JA 2RQQA 1BR1A 2L7KA 2H94A 1E3HA 2OUMA 4HLYA 3TP3A 2A07F 4MEYF 3GTKJ 3V8JA 1ZG1A 4ANJA 5KVRA 1X2NA 3JR9A 2KIMA 4BJTA 2UWMA 4U0VA 4L0YB 1O7LA 3PQJA 3S16J 4HQMA 1ETWA 1JTYA 1K4TA 4II3A 1YOVB 5FKMA 4HEA2 4EM0B 1V54H 2OA4A 1X1CA 3AKZA 2PQ8A 3Q0UA 3M1CA 4IHWA 5EEGA 5J4VA 5IT3A 5CVIA 1R5GA 5D5XB 1BL0A 2HXOA 2X85A 3SJMA 5J4YA 2CQKA 2AS5F 3I71A 1Z6RA 3J7AY 3OYJA 4IOAF 1JUMA 1K78B 3MKZA 1MJ9A 2MD5A 1PYVA 3H0GJ 2FUG2 3IH3A 4A3KJ 2ECCA 1KGSA 1TT5B 4EM1A 1U2WA 4WX9A 1S6LA 3GTMJ 3VSKA 3EUHC 1IXCA 1OCPA 3SYTA 1T56A 3TDZC 1Y0UA 2YPRA 4IX7A 1FX7A 3HOWJ 4HW0A 1NHAA 2XAHA 1IDZA 2CQXA 2MW8A 2ZJ2A 2GZWA 3DQVC 2VT3A 2A6EF 2E7XA 2LBFA 1L0OC 3OYLA 3FHZA 3DKXA 3HHGA 3TO6A 2ZXHA 3OS0A 2DMUA 2HVQA 1MIJA 3OYBA 3TEDA 3H35A 3T1BA 4HOBA 2EV6A 1CF7A 1UCRA 1XG1A 1J2XA 4G9YA 4KT6A 2DI3A 2EIMH 1DP3A 1YS7A 5EEAA 5LEKA 1HKQA 1GDTA 4N9HA 1R4NB 3CMAI 3HTUA 3MKWB 1YW9A 4B48A 2VUMJ 1BOAA 2VBXA 4X1EA 2XDVA 4GGGA 3F8MA 3HRMA 4M73A 4O6JA 2W57A 2JQ7A 1J0RA 2FJ1A 5ERIA 3LSHA 1WJ5A 3G1OA 3LNQA 1D0XA 3J7AO 4CYDA 4XOPA 1MJAA 4Y33A 3HIFA 1BN5A 3K2ZA 1MD0A 3R60A 4AWXB 2BY0A 2IP2A 2FQ4A 1SFXA 2EFQA 4XNFA 3PFYA 5F27A 2DA1A 3CC2I 2AO9A 5JR3A 2KQRA 1XGNA 3GTJJ 1UG0A 4BAYA 2DJNA 3BG3A 2ZC2A 2ZO4A 1MMAA 4RAGA 2UXNA 1DQUA 4EMSA 2BHYA 4V2GA 1XDSA 1WPKA 2H09A 1ZAOA 2H8RA 3K4NA 2CGPA 5J1YA 3QODA 1O3TA 1O4XA 3PL8A 2WV0A 2Y0MA 2FRHA 3F8NA 5K5RA 1G3WA 4XLPF 1YX5A 2NS8A 2E1NA 2RKHA 2WB1N 4Y7NJ 1LNWA 3ROUA 1A35A 2HDDA 3W2AA 3KEYA 3GUDA 3A0BC 4EGZA 2XHKA 2KP6A 3AG2H 3M1EA 1MMSA 1SFOJ 1W7PB 1JUPA 1SMTA 4I09A 5GPAA 4RB3C 1W0TA 1WHUA 3EUKL 1CGPA 4BXUA 2EFPA 2XPUA 4HBLA 2DOEA 1D8KA 2R7XA 4KIFA 3BROA 3QOPA 4XLHA 3FM3A 3LFUA 3MKYB 2NS0A 5K7FA 1ON1A 1Q1HA 3EUHA 2QKLB 2OZ6A 2FA5A 2M4KA 3MD2A 4Q4ZF 2MG4A 2OBPA 3WHCA 1APLC 3RIRA 1BW5A 1SEUA 1QHHD 2JMWA 2ELJA 3ECOA 1S8NA 3R61A 4IHYA 1TQPA 2R93J 2L4AA 1T33A 1IV6A 3ZR8X 1NK2P 2DU9A 5DM6F 1AU7A 3IKTA 2RREA 1ZYRF 4XLEA 1KZHA 2DN0A 1X3WB 4YFNF 5TJJA 4A69C 4RB1A 4FTHA 1KYWA 2RNGA 1OKRA 4J00A 2CRGA 3J7YJ 1VQNI 5FD5A 2LVSA 5D6FA 1R9TJ 3SZPA 3RKYA 3BQYA 2OPTA 4BXXJ 5FB2A 1ZGJA 2KFDA 4GYGA 1T39A 3J80K 2ELHA 1OCRH 1TWAJ 3ECHA 3KEOA 2ESHA 2NVQJ 3ML6A 2A6HF 3M8JA 3CCLI 1R00A 4TV7A 3LSIA 2DA4A 4IRGA 4X6AJ 1G6NA 1FZPB 3Q9VA 5TISC 4RLQA 2BHZA 3H0DA 1FIPA 3DWLE 5GP9A 1ZH5A 4ESBA 3OMYA 2M4GA 4AUXA 2HTSA 3B73A 4GYIA 1YX3A 4Z2YA 4AIJA 4RAFA 4MQVA 3PQKA 1R1UA 3KZZA 4F55A 5FJ8J 2JJ7A 3BG9A 2QZ8A 2OAZA 1HSJA 1Z7LA 5M5WJ 4RMNA 3OS1A 2XRNA 3ZCOA 4XM3A 1HXDA 3C2HA 2L9SA 5LHGA 2LBFB 2ID3A 4A0ZA 4D7MA 3CCQI 1REPC 2VOOA 3QPSA 3S2WA 3I64A 3I4MJ 2CH0A 3JRDA 2LKPA 1OISA 1QNTA 1S7AA 4E6KG 2GXGA 2K9NA 4XLNF 5GADJ 1U9NA 3K4MA 5D8LB 1LVKA 4EEFG 4E7ZA 2AHQA 3OIQA 2P7CB 5DYMA 1PP8F 3P9KA 4A2UA 1JXSA 3CJQB 1O57A 1CF7B 3ABUA 1KYZA 2X1CA 1ETXA 3VB2A 4M6YA 2ID6A 3G73A 3TL4X 1Y1WJ 1OCTC 4JOMA 2V9VA 2M3AA 1W0UA 3JCUC 1FMVA 1IGNA 2Y75A 1ZLJA 5B5EC 1VQ8I 3MCZA 2GWRA 1OFCX 3K1NA 4IQ4A 4U87A 4XRSG 4Y4RA 1SFKA 3H3ZA 1JGGA 3WTUC 1DUXC 2E5NA 4N0BA 2JUCA 2I5UA 3K4KA 4LJZF 1K4SA 4B3AA 1V5FA 3QPTA 1JE8A 1FTTA 4PFPA 2K9MA 2XIGA 4G8XA 1BR2A 1JUSA 3VYTB 3MVPA 2P8TA 2ME0A 3MEXA 3T0YA 3E5XA 3J80Z 3HC7A 3WGIA 2VPLA 1SD6A 2HXIA 2OU2A 2PEXA 3KP5A 1STZA 2KIFA 4M72A 2F5CA 5HS7A 2UXXA 2X6YA 3CDIA 3KP6A 1TT0A 4PJLA 4P5OA 1OQYA 3NRVA 4YEJA 3BPXA 4AIHA 4UUSA 3OYNA 3KLNA 5DUIA 4KICA 3ZP5A 2BYVE 1V5GA 3CLOA 1JHHA 1XSXA 2IA0A 3D0SA 1K6YA 2RAEA 3V7CA 3S3OA 3H1CA 4QTRA 2G7UA 3FXMA 3PIPF 4ENJA 5AONA 4PGHA 1SAXA 2PG4A 2M2EA 1X1PA 2DA7A 4AIDA 4KT5C 3V8KA 3ZMVA 2HYFA 3CDHA 3V4GA 1TL8A 2DTZA 4FHTA 2EILH 1XGOA 2DQLA 1IXSB 3O2PE 4F3QA 1TP4A 3FISA 5FFXA 1RKWA 2DFEA 2VJ4A 3JRCA 1F4KA 1XC5A 3LOCA 3G6EI 3OSFA 3G1LA 4PCQA 3B6CA 3SZGA 1UB9A 4U7BA 2DT5A 3IH2A 2A69F 3K7AJ 3S3MA 1LJ9A 2ZSHB 1MZBA 3CC4I 2HYGD 2JVHA 4UV8A 1BM9A 2OTLI 1IXRC 2LRDA 2QVOA 2WY8Q 3TO9A 2G9WA 2WAQA 2P5KA 4KISA 9ANTA 2JSCA 3KPHA 5F0CA 1T98A 3UNGC 3K4LA 2Y0SA 3HRSA 4B1RA 1WCMJ 2LF8A 4CCMA 1K6OA 2EWNA 1Z91A 5LEJA 3FXUA 3OS2A 4HDUA 3VYUB 2O8XA 2V1XA 5J1UA 3EYIA 5FRNA 4LLLA 3VDXA 2HTJA 3O8GA 4RGUA 1V4RA 1FY7A 1QVTA 1ZHFA 2JA6J 1FP1D 1XD7A 1FBQA 3I55I 1ORKA 3B02A 1E17A 3FKJA 4I6ZA 3RKXA 1I3AA 2GOXB 1U78A 3I9V2 4GDFA 1FOXA 1D0YA 5CQEA 4BE1A 5F64A 3QRFF 2DMTA 4ASNA 4E7HA 2F5FA 1P4XA 2NVTJ 2VASA 3V7RA 5KAIC 1Y8RB 4KDPA 4ABZA 1LDJA 4BNCA 3ASOH 4ZZLA 3F8FA 3S2DJ 2G0EA 3QYBA 1FNNA 1FOKA 3QU6A 4ZC3A 2LOOA 1AHDP 1MNMC 3HHHA 3CJNA 2JA5J 1MBKA 1Z6TA 3WODF 5DCFA 1TZLA 1N77A 3FHNA 2ZXJA 4PJJA 3WG7H 5BMZA 1JKQC 1IG7A 2K86A 1A5JA 5CYVA 1K78A 3FMSA 4E7LA 3OSGA 5LHHA 1YIJI 2QM3A 1IRXA 2ZJQF 1MBHA 4Y15A 2A5WA 5BPIA 4BXFA 2P5LC 2QLZA 2K27A 3BG7A 2R5YA 2ACJA 4LIVA 2F4MB 3WE2A 5JVTA 3NAUA 2CV0A 3A2KA 5DS9A 2XSDC 2CG4A 3MZYA
chains in the Genus database with same CATH topology
4BE2A 3ZXSA 3S8PA 3PNTA 2CUZA 2RQQA 1BR1A 2L7KA 2OUMA 3VSLA 2V9KA 2KZVA 4KITB 3HXLA 2IGMA 2MD0A 3UR3C 4ANJA 2P0WA 2WY7Q 1BOBA 2Z1DA 3LSGA 4BJTA 2UWMA 4BEHA 2F4IA 4BACA 4II3A 2VL8A 4DIQA 3RCOA 3RPUD 2M7BA 4XKBA 3D5LA 2DT7B 4HEA2 1DGRM 2E1MC 3L2VA 1X1CA 3PSFA 4FASD 3AKZA 2HQAA 4QPQA 2W00A 3M1CA 2JVGA 4XORA 3ZRGA 3VYSB 2JA2A 2DCEA 4XN0A 3ZQQA 4CZCA 2X85A 4B47A 2DXIA 4HG2A 4AU7A 3J7AY 3OYJA 2KPMA 2VJIA 3MKZA 3QOEA 2E60A 3CMMA 1WJBA 3OYFA 1PYVA 2OV7A 2FUG2 3SDBA 3K10A 4IZZA 3HKZA 3VSKA 3EUHC 4DGWB 4X0GA 3SYTA 2Z16A 4IX7A 4EATA 1KONA 4RLFA 3N05A 4PSWA 3DQVC 4DBQA 2R7WA 1G8XA 2F5VA 2HPIA 2I8DA 2LBFA 2K3PA 3DLAA 3OYLA 3DKXA 3OS0A 2ZXHA 2DJIA 4XMYA 4BEHB 2HVQA 2VJ5A 2A6TA 5LD2C 3CP2A 3OYBA 3PNYA 3H35A 5LFAA 3MMYB 3DPUA 3E1SA 4BQNA 4KT6A 3QYFA 3K70C 3LSKA 1DP3A 3W2WA 4XKVA 2CFOA 4ZDLA 2BVLA 2CW7A 2R7VA 4N4OB 4LIUA 2IGKA 2AQFA 3FBIB 2R7RA 3OR2C 3MKWB 2M0MA 4PK4A 4B48A 5HVQC 3IAM2 2XDVA 4BE0A 5HNFA 1WFXA 3L2WA 4E7JA 2MFZA 3G2BA 2VXDA 3LSHA 2HPMA 2R7OA 1SAUA 1WJ5A 2L5QA 3PJRA 4JQFA 2R4GA 4C9YA 4XN3A 1D0XA 4PSXA 4XOPA 4Y33A 1WJDA 2JSPA 2VKDA 1E0EA 3K4CA 4E7KA 4XNFA 3PFYA 4DJAA 2M7AA 2WA0A 3BCBA 4CCNA 2KQRA 2V7FA 4F92B 3OYIA 1UG0A 4C30A 2BVMA 4LITA 2WAFA 1MMAA 1VZ0A 1DQUA 1LFPA 2X1DA 4Y3OA 4G6TB 2OC6A 4DOZA 4YRVA 2ZXIA 4B43A 3K4NA 3QODA 2BW3A 3D5RC 3DKYA 2VLAA 2Z2SB 3PL8A 4AYBA 3DTIA 1W36C 1YX5A 2K9LA 1QHGA 2O5RA 4D1QA 4C2TA 5FROA 2R7UA 2V4JC 4BQQA 3W2AA 3KEYA 4E7SA 3OYHA 1D1AA 2KP6A 3K4JA 1X1AA 1R6RA 3H5AA 4IQJA 2ZSIB 2LYCA 4HSTA 3EUKL 2ZFUA 3FBNB 3OOUA 2R7XA 4XLHA 2K5CA 3DU6A 3LFUA 3K4BA 1WJEA 3MKYB 4XLCA 2LG4A 4PFOA 2QKLB 2X6WA 3PNVA 3OYAA 3HPGA 3K70D 2KRHA 3H9GA 4OAZA 2M4KA 3MD2A 4KJZA 3TMOA 1Y6IA 1QHHD 4HPQA 4ITVA 3LMMA 3VYRB 2ELJA 4QPOA 2L2OA 4B44A 5HNHA 3ZR8X 2QKMB 3D5SC 1MMGA 2HU9A 3KYLA 4MLOA 2V26A 3ZGKA 3TBIA 2Q1ZB 4NNJA 3KX2A 1LKXA 2RREA 4XLEA 4BJ6C 3CP8A 1MNDA 5HLTA 2VIXA 5KNLA 4HRIA 2W82A 1MMDA 2RNGA 1G59A 1UELB 2KMUA 4J00A 3AL0B 2MC4A 4ZTFA 2CS3A 4PJMA 3RQ4A 1UAAA 1Z3YA 3LL7A 4PUSA 3U21A 4D9JA 3OIPA 2IS4A 2HDWA 2IS1A 2XF6A 4ZDPA 3BG6A 2PJRA 3ONQA 3HOTA 3M8JA 4F52A 4FETA 2CMPA 2HZDA 4LG3A 4DBRA 2Q2EB 2LC2A 1X1DA 3HOSA 2VQHA 3IP4B 3LSIA 4N4NB 3EUAA 3IUOA 2VXZA 3H0DA 4RLQA 1MNEA 3DWLE 2LY1A 3OMYA 2M4GA 2VQGA 1YX3A 3RTRA 1W36D 3EPZA 3W2VA 4F55A 3CF2A 1T0FC 2R7TA 3S93A 3OR1C 3H5NA 1Z7LA 3BC8A 4RMNA 3OS1A 1EA3A 3ZCOA 3HPHA 3HL2A 2HVSA 2CW8A 4XM3A 3C2HA 2L9SA 2LBFB 3VWBA 4BU2A 3HUGB 3C2GA 4F93B 1D1CA 2DOAA 1ZELA 2CH0A 1OR7C 3W3CA 1HA8A 1X4OA 2XF5A 3CESA 4E6KG 3RSNA 4E7ZA 3K4MA 1LVKA 3OIQA 5KCMA 2R7SA 3DTEA 1X4PA 3H9JA 2PMZA 4BUPA 1X19A 3CJQB 1WJCA 2JUGA 5CPRB 2HVRA 2IGNA 2VQCA 1Y56A 2X1CA 2W7NA 3QYEA 3TL4X 3I3LA 1V5EA 4JOMA 1ERDA 2M3AA 4NUBA 4E7IA 1FMVA 4BDYA 1LDKB 4C2UA 4HSRA 4ZJZA 4PJNA 3DPLC 4IQ4A 2V1NA 3OYKA 4U87A 2WADA 2WB1A 4CCKA 1X1BA 3E0JB 3F9KA 4Y4RA 4II2A 1SFKA 4HNUA 1PJRA 2F6CA 4BDZA 3OL4A 2BOLA 2E5NA 4NQWB 3OY9A 3A4CA 2CV1A 1AA7A 2UUZA 3K4KA 1Z21A 4XKCA 1N78A 1V5FA 3PUBA 3DEEA 3A1YA 2KDOA 3GBGA 4PFPA 2K9MA 3SEZA 4BL0B 1BR2A 3VYTB 2VJJA 4P1WA 2R7QA 3V42A 3DTKA 2W1OA 3CZ6A 3HC7A 2KL4A 2NOJB 2VPLA 1WJAA 2GOMA 2HNHA 2XSJC 3PSIA 3S3NA 4CCLA 1MMNA 2X6YA 4XQFA 4XR6A 4XKWA 1D1BA 1NG7A 1TT0A 4PJLA 2KHMA 4P5OA 4OWRB 2X1EA 4YELA 3CJRB 4YEJA 1D0ZA 3OYNA 4BS9A 3AFHA 3SEQA 2IXSA 1V5GA 2BW3B 1MW7A 1K6YA 5HOOA 4BGDA 3AL0C 3OWTA 3S3OA 2WAEA 3OYDA 2XAUA 3NWSA 4CCOA 3OYMA 2LREA 4IKFA 2VB6A 2V6EA 4CH7A 2KRCA 2E1MB 3OYCA 4OAYA 2XC7A 1J09A 4XL9A 4BJ5C 4F3QA 2VJ4A 3DPTA 4RM3A 2DT6A 1GLNA 3SZGA 2L9NA 2CUJA 3BLYA 4U7BA 2W4SA 1QU3A 3OL3A 3S3MA 2ZSHB 1YE9A 4F91B 2JVHA 2IGOA 1DGWY 1S9HA 4GRIA 1OLTA 3IAS2 4NC8A 3BCAA 2LRDA 1U0JA 4NC7A 2WY8Q 4R79A 2WAQA 4KISA 4HNTA 4RM2A 2IS2A 3UNGC 3HG9A 3K4LA 4CSWA 2Y0SA 4CCMA 3S32A 1FMWA 2VQLA 3OS2A 1NG6A 2XF7A 4ZTJA 3VYUB 5FRNA 2E5ZA 3DU5A 2LY2A 2X51A 2VKHA 3VDXA 1P9QC 4ZYAA 4J01A 3FKJA 4CA0A 1T95A 5TGTA 2GOXB 3H5RA 3I9V2 2LH9A 3NWTA 1D0YA 5CQEA 4BE1A 1WJFA 4XLAA 2MABA 4XOTA 4CUGA 5JHFA 3FDYA 4XLFA 4E7HA 4CCJA 3L2UA 4E4HA 2VASA 3L2RA 1BR4A 5KHDA 4BQOA 1N75A 2X6XA 3QYBA 4ZC3A 5FRMA 3L2QA 2LOOA 2AQEA 4AVZA 4XONA 2PJRB 2KLOA 3LSMA 4H4KC 1TZLA 1Z3XA 5CKTA 3FHNA 4PJJA 3OYGA 1N77A 2CV2A 4ZDOA 2WBMA 4E7LA 1IRXA 2A5WA 2IS6A 4BXFA 3BG7A 3H9QA 4LIVA 5CQGA 3OYEA 4B3XA 2UV1A 1JI8A 2CV0A 3A2KA 3K6GA 2MYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UEL B;  1YX5 A; 
#chains in the Genus database with same CATH topology
 4WK8 F;  4BE2 A;  2F5E A;  2HOS A;  1S5L C;  2CUZ A;  1MBJ A;  2Z33 A;  5AIP A;  5H6R A;  2E1O A;  2DFF A;  2BGC A;  3SQN A;  1XSV A;  3S1R J;  1QPM A;  4R8H A;  1U3E M;  1RUN A;  4KIT B;  4IO9 F;  2IW5 A;  3P9C A;  2R7F A;  2CW0 F;  2P0W A;  4LFU A;  2WY7 Q;  3QU3 A;  1TBX A;  4LK1 F;  2F4I A;  2B7E A;  2EFN A;  4BAC A;  1JKP C;  4DIQ A;  3GME A;  3RCO A;  5JI6 A;  2M7B A;  1NH3 A;  2DT7 B;  1DGR M;  2E1M C;  3PSF A;  1D8J A;  2HQA A;  3KZI C;  4RBO A;  2KIU A;  3VOE A;  2VE8 A;  3VPR A;  2DCE A;  2YX4 A;  4A12 A;  2Z3Y A;  1I39 A;  1Z7U A;  5LGT A;  4G94 A;  2Q8K A;  4CZC A;  1ZAR A;  4B47 A;  1LPQ A;  4L5E A;  1IZ1 A;  4AU7 A;  2NXN B;  2VJI A;  5D8K B;  2RDP A;  3QOE A;  2E60 A;  3OYF A;  2QWW A;  4RAZ A;  2BE5 F;  1V55 H;  5FKL A;  4Y13 A;  1BBY A;  3CO6 C;  2MH9 A;  4IZZ A;  1J5Y A;  3HKZ A;  4DGW B;  4LLN A;  5E1X A;  4EAT A;  1MKM A;  1HCR A;  4Y52 J;  1FJL A;  4PSW A;  2N8G A;  2R7W A;  2F5V A;  2I8D A;  1F43 A;  4EJT A;  4U88 A;  4EV0 A;  3E6C C;  2IRF G;  2XKO A;  5E79 C;  4BEH B;  1AWC A;  1U8R A;  5LD2 C;  3CP2 A;  3K69 A;  4YFX F;  5IT9 K;  2HZT A;  5IP9 J;  4HV6 A;  1YHQ I;  1YW7 A;  1YIO A;  2DA2 A;  1TWF J;  3DPU A;  1R5H A;  2W85 A;  4UUS B;  3QYF A;  2OD5 A;  1VQO I;  4XKV A;  2CFO A;  4ZDL A;  2GIZ A;  2PX9 A;  2WAQ N;  5CVU A;  1IJW C;  4N4O B;  3JRA A;  5CLS A;  1H0M A;  1KU9 A;  1D5Y A;  3GW2 A;  2R7R A;  3OR2 C;  2Y0S N;  4PK4 A;  3IAM 2;  3RZO J;  4Q47 A;  2R7D A;  2NNY A;  2E7W A;  4BE0 A;  2E2J J;  3HM5 A;  1WFX A;  4A3I J;  3S1Q J;  3L2W A;  3CMY A;  2VXD A;  3G2B A;  3IHU A;  1EJ9 A;  2R7O A;  1SAU A;  5J8C A;  4NQW A;  3DFG A;  4C9Y A;  4PSX A;  1U5T C;  2WTE A;  4MO7 A;  4ZYE A;  2ZNZ A;  2DA6 A;  2JSP A;  4A3B J;  2VKD A;  3K2A A;  4A6D A;  5F0F A;  1VQK I;  1F36 A;  3U9G A;  2GAU A;  3BCB A;  4CCN A;  1IW7 F;  1YYV A;  2PMU A;  2HQN A;  5ILU A;  2V7F A;  2PMZ N;  3I54 A;  3CCM I;  4C30 A;  2J5O A;  4A3J J;  1B59 A;  2CO5 A;  5LHI A;  2BVM A;  3LA3 A;  2CFX A;  3DF8 A;  2WAF A;  3VFZ A;  2DLL A;  4A3D J;  5LBQ A;  1A36 A;  3HB9 A;  3ZQF A;  3IV5 A;  4Y3O A;  1WI9 A;  4DOZ A;  1WZ2 A;  1LVA A;  1OPC A;  3BR2 A;  4YRV A;  2DA3 A;  2FXA A;  1H9G A;  3TOB A;  3I58 A;  4OMZ A;  5FLX K;  1VI0 A;  2FEZ A;  4AYB A;  2ISZ A;  3Q5F A;  1W36 C;  1Z67 A;  1CQT A;  1QHG A;  2JA8 J;  4HX8 A;  2EZL A;  4D1Q A;  1T08 B;  2XPW A;  4CO8 A;  5L3E A;  4AVP A;  1H8A C;  1MBE A;  2V4J C;  3I53 A;  2DA5 A;  3KP2 A;  3OYH A;  2KJC A;  3DP7 A;  3BT9 A;  3CDL A;  1V3F A;  1D1A A;  5K7Z A;  3KE2 A;  1HC8 A;  3ERE D;  1X1A A;  4RGR A;  3JW4 A;  1IF1 A;  2O7O A;  1W5C C;  1HST A;  4OOI A;  3COA C;  2L0K A;  4LLG F;  3E6D A;  1ODD A;  2LYC A;  2STW A;  4HST A;  4LMY A;  2HWV A;  5ICF A;  1ZRF A;  3TP0 A;  3M8E A;  4M9S A;  3R4K A;  1U9O A;  2K9S A;  3OOU A;  5FKN A;  2FD5 A;  2LSO A;  4MFE A;  1WJE A;  4XLC A;  3CJT B;  1BW6 A;  1UHS A;  5EEH A;  3OYA A;  3U1D A;  3H3V K;  1P2F A;  1HOM A;  1KQ8 A;  2H1K A;  4KJZ A;  1RET A;  1PVE A;  1HKS A;  3TMO A;  4C3J J;  4I02 A;  2R5Y B;  3LMM A;  2E1C A;  1MBG A;  3O6B B;  1WI3 A;  3E5Q A;  2MC3 A;  1HQC A;  4B44 A;  5A2Q K;  1MSE C;  3OOP A;  5IYB J;  1OYY A;  4DZP A;  1MMG A;  2IPQ X;  5DDG A;  1IN6 A;  5DUK A;  2Z5U A;  5FGM A;  1YG2 A;  3RI4 A;  2CUE A;  4M3E A;  1LKX A;  4NNJ A;  4AC0 A;  1WGX A;  5LRS A;  2EA4 A;  3J7Z I;  1QZE A;  1MND A;  5HLT A;  3L2C A;  2VIX A;  1GVJ A;  2XAF A;  3O3K A;  4NDL A;  1G3Y A;  2L7M P;  4UB8 C;  5CVV A;  4QIW N;  1MMD A;  4D7N A;  5J47 A;  1G59 A;  3V7S A;  1VND A;  1ETY A;  2KMU A;  1L3L A;  2EPF A;  3HOY J;  3TDU C;  4LG0 A;  2GA1 A;  1ETV A;  4ZTF A;  4ZYH A;  3RQ4 A;  1ZRD A;  1UAA A;  4OIN F;  4HLX A;  3OIP A;  3CLQ A;  2IS1 A;  2OQR A;  5ICG A;  2RN7 A;  3TGN A;  3G1M A;  3ONQ A;  3BOQ A;  3C3W A;  2DO7 A;  5HDK A;  2EB7 A;  1WRJ A;  4F52 A;  2DPD A;  2CMP A;  1WQ2 A;  5JVG F;  2LC2 A;  2VQH A;  1U5T A;  4N4N B;  3TW7 A;  3IUO A;  2VXZ A;  2PBI A;  3T8T A;  2LY9 A;  2LY1 A;  1W5T A;  5BQT A;  4ZZD A;  4KYW A;  1ZK8 A;  2D2W A;  1W36 D;  4M3D A;  1BI0 A;  3W2V A;  3IRR A;  2H6C A;  4RAY A;  2RGV A;  3S93 A;  3OR1 C;  3Q9S A;  3ZQC A;  3LAP A;  3BC8 A;  3RKQ A;  1QVU A;  1EA3 A;  5HDG A;  2HVS A;  1IO2 A;  4IL6 C;  3VWB A;  1QBJ A;  3HSR A;  4HA8 A;  5FKK A;  4F93 B;  1E3P A;  3C2B A;  1ZEL A;  3EYY A;  5E20 A;  2LF7 A;  3W3C A;  2XF5 A;  2H8W A;  3HGG A;  3RSN A;  1RR8 C;  2D1H A;  5KAF C;  3FXL A;  1T6S A;  2R7S A;  1BA5 A;  1X4P A;  1TLH B;  2K40 A;  1USS A;  2TDX A;  2WC2 A;  3KFW X;  4I7H A;  4RGX A;  4Y17 A;  4A0X A;  4UVA A;  2JUG A;  2QYO A;  2IEK A;  1ZGA A;  2IGN A;  2LKS A;  1X58 A;  1Y56 A;  5E1Z B;  2OCC H;  4G12 A;  1MSF C;  1B72 A;  5L3B A;  4BQA A;  2M9H A;  1BIA A;  3I3L A;  5A2Q Z;  4HX7 A;  1ETQ A;  3RJP A;  5EG0 A;  1DP7 P;  1ERD A;  4ENN A;  4W1U A;  4NUB A;  3WTT C;  3BTI A;  1DU6 A;  4E7I A;  3UKG A;  4C2U A;  2IT0 A;  3HSE A;  5H20 A;  2D1V A;  3WTZ A;  4PJN A;  2CQQ A;  2R5Z A;  3VEP A;  1B8I A;  2VBY A;  2D5V A;  1UZC A;  3KLO A;  3QPH A;  3KYD B;  4II2 A;  2L9V A;  4BDZ A;  3BJO A;  4IPA A;  1FPQ A;  4NQW B;  2PMH A;  1XPX A;  4S05 A;  3OIO A;  2UUZ A;  1R4M B;  1HW1 A;  3DXJ F;  3PUB A;  4ETS A;  4U7D A;  3JRI A;  1RES A;  2Q0O A;  3ZQH A;  4RA2 A;  3SEZ A;  4BL0 B;  4BY1 J;  1I3Q J;  4XIC A;  3CZ6 A;  2I10 A;  2FBI A;  2NOJ B;  1WJA A;  2GOM A;  3EET A;  2KIQ A;  2VKV A;  2XSJ C;  3L09 A;  4M3F A;  1P92 A;  4Z6Y A;  4XQF A;  3GVA A;  4UUV A;  2DMN A;  4UUT A;  5IY5 H;  3GTQ J;  2KHM A;  1P4W A;  1TNS A;  1XTA A;  1LFB A;  2XAG A;  2KIS A;  3H92 A;  1D0Z A;  2JRT A;  1S7O A;  3SEQ A;  2IXS A;  2R0Q C;  4J19 A;  3FXO A;  3CD6 I;  2XGX A;  1IUY A;  2WWY A;  3LA2 A;  3OWT A;  2XAU A;  4KNY A;  5HDN A;  2LRE A;  4IKF A;  4O3M A;  1GXQ A;  1K83 J;  4V2F A;  5K5Q A;  2E1M B;  4OAY A;  3C7J A;  2BBY A;  1FOW A;  1J09 A;  3GWZ A;  4XL9 A;  2HQR A;  2V1U A;  4I76 A;  3ULQ B;  2P4W A;  3DPT A;  4JP0 A;  3W6J B;  4L9T A;  5IYC J;  5FLM J;  4ON0 A;  3MN2 A;  2L9N A;  2CUJ A;  5FO5 A;  4BKX A;  2ISY A;  2IVM A;  2EZI A;  3FM5 A;  2K9Q A;  4G7Z F;  2QCO A;  2YU9 J;  2VOD A;  3OL3 A;  3WTV C;  2JT1 A;  1YE9 A;  2MSY A;  1KQ9 A;  4C3I J;  3JRH A;  2IGO A;  1DGW Y;  1PUE E;  1OLT A;  4NC8 A;  3BCA A;  4NC7 A;  4RM2 A;  1UG2 A;  3WTX C;  2IS2 A;  2GBY A;  3HG9 A;  5ILS A;  4HZF A;  2IAI A;  1BC8 C;  3S32 A;  2PFB A;  1RRJ A;  2VQL A;  1ZG5 A;  1NG6 A;  1M1E B;  2XF7 A;  4RB0 A;  1HBX G;  2XGC A;  3DU5 A;  1MJB A;  5GPC A;  1QRY A;  1WVR A;  1XDU A;  2L7F P;  3ISP A;  4ZYA A;  1X3Z B;  5JLX A;  3C18 A;  2O61 A;  1YTY A;  2QSF X;  4AM3 A;  3L9F A;  4XBF A;  5D5V B;  5TGT A;  3KP4 A;  1LFU P;  3HOZ J;  3F6V A;  5E17 F;  1WJF A;  4XLA A;  1WKM A;  1S72 I;  3FXJ A;  5JHF A;  3FDY A;  4C2M J;  4DYC A;  3LSJ A;  4UB6 C;  4E4H A;  5CVR A;  3L2R A;  4LG0 B;  4RB2 C;  2PJP A;  2RNJ A;  1N75 A;  3HOU J;  3GFI A;  3L1P A;  3HZJ A;  1IC8 A;  1K79 A;  5FRM A;  2LK2 A;  2FNP A;  5FLV A;  3SXY A;  2KLO A;  1Z3X A;  2JK3 A;  3QWL A;  4MFD A;  2CV2 A;  2DDB A;  1GHC A;  4UV9 A;  1P4A A;  2YS9 A;  3FMR A;  3KZY A;  1GUU A;  1U5T B;  2A05 A;  4YIR X;  2HOT A;  4CGZ A;  4KMU X;  5ICC A;  2M8G X;  2KT0 A;  3M9A A;  2XAS A;  2JA7 J;  1ETK A;  4NBQ A;  1Z77 A;  2P81 A;  3N4M A;  1YQA A;  5ICE A;  3SFI A;  1H89 C;  1TC3 C;  1ON2 A;  3PNT A;  5H6Q A;  4A3G J;  4EQQ A;  3F23 A;  2DK5 A;  4CIC A;  3VSL A;  1YJW I;  3ZPL A;  2V9K A;  5TRD A;  2O8K A;  3LSP A;  2NVU B;  3HXL A;  4O5V A;  2MD0 A;  3BDD A;  4AD9 A;  1HF0 A;  5HS9 A;  3RYP A;  1TTY A;  2Z1D A;  3LSG A;  1RR7 A;  4P55 A;  4BEH A;  2XUB A;  4GXO A;  2QBY A;  1YJ9 I;  3WTW C;  2VL8 A;  1ENH A;  4XKB A;  3D5L A;  5EYR A;  2OJE D;  3L2V A;  3GTP J;  4FAS D;  2BY1 A;  1B72 B;  2W00 A;  2KRF A;  2XV4 S;  4XOR A;  3ZRG A;  3KCC A;  3VYS B;  3A03 A;  2W24 A;  4KA4 A;  5EG0 B;  4XN0 A;  4XRS A;  4XRM A;  1YFH A;  2NNN A;  3GF2 A;  2ZJP F;  1VQ9 I;  2FQ3 A;  4IF4 A;  4M9Z A;  1TQM A;  2E35 A;  4FX0 A;  4HG2 A;  4I2O A;  1VQ6 I;  2LR8 A;  3S1N J;  1IV8 A;  3PUF A;  2Q2E A;  5E8I A;  4QLC U;  4FCY A;  3CMM A;  2R5Z B;  4AIK A;  1WJB A;  1B8I B;  1YS6 A;  2CSO A;  3ZMS A;  5CVJ A;  4HF2 A;  4OU0 A;  1TWH J;  3E97 A;  4WF2 A;  3WU0 A;  2XRO A;  1A31 A;  1BC7 C;  4X0G A;  2HS5 A;  3D1N I;  3PIO F;  2Z16 A;  1IN8 A;  3BJ6 A;  3GXO A;  1HKT A;  2CU7 A;  2QUF A;  1RIO H;  1KON A;  1O3R A;  1YIT I;  4LK0 F;  4RLF A;  4BHC A;  3JRG A;  3LST A;  1QO0 D;  1RPW A;  2X4H A;  5HLH A;  1D5V A;  3HUG A;  3DLA A;  2CJJ A;  1HLV A;  3AG3 H;  3JTG A;  1XX5 A;  2PI0 A;  1UMQ A;  1DPU A;  1XCB A;  5LFA A;  1LB2 A;  1F1Z A;  1I5Z A;  3K1P A;  3E1S A;  2VC1 A;  2NRA C;  4BQN A;  1UFM A;  3K70 C;  5M3F J;  3MQ0 A;  1BI2 A;  1ETO A;  3W2W A;  1IRG A;  2DYR H;  1T8I A;  1I6H J;  2JTV A;  3O8H A;  1VQP I;  1FOY A;  2BV6 A;  2CW7 A;  2HOE A;  2Y2Z A;  2UZK A;  2R7V A;  2IGK A;  3PO2 J;  3LAJ A;  2AQF A;  2KJB A;  3FF5 A;  2STT A;  2M0M A;  5HVQ C;  5GTH C;  4CXF A;  1WH5 A;  2Y9Y A;  5HNF A;  2XKP A;  2MFZ A;  2HPM A;  4HYE A;  2FOK A;  4JQF A;  5C4J J;  4LD5 A;  2R3S A;  2Y31 A;  1ULY A;  2AXL A;  3ZQI A;  2JZY A;  1ZR2 A;  5E18 F;  4UY8 I;  1WSU A;  1RC9 A;  5LLQ A;  3BZK A;  1X3U A;  3P9I A;  1OMI A;  3TO7 A;  3SHF A;  4E7K A;  4JX4 A;  1MDM A;  2ZNY A;  4DJA A;  2W84 A;  2WA0 A;  1R5I D;  4ESF A;  3A02 A;  5EF6 A;  5BPD A;  3AG4 H;  1R71 A;  4XRF A;  4UNO A;  2LP0 A;  2M1B A;  2H1L A;  4OIP F;  3DEW A;  4M74 A;  1KA8 A;  4A3C J;  5BS6 A;  3CCS I;  4KN7 X;  4LIT A;  1Y39 A;  3G4S I;  1FYK A;  4IJA A;  4HAM A;  4BY7 J;  1LFP A;  3E7L A;  4MQ9 F;  4KN4 X;  1LDD A;  2ZXI A;  3WGH A;  3X2Q H;  4BHP A;  3IL2 A;  1AKH A;  2H6B A;  5HLG A;  4A5M A;  4B43 A;  1J59 A;  1GXP A;  3CF5 F;  3CCR I;  2BW3 A;  3D5R C;  4IHS A;  3DKY A;  2Z2S B;  3G71 I;  2YX7 A;  3GLX A;  2CQ7 A;  1R1T A;  3F72 A;  3DTI A;  5GAE J;  1Y8Q B;  3JSP A;  1ZG3 A;  1VQM I;  1FC3 A;  4DQ2 A;  2K9L A;  2O5R A;  2HDC A;  5JFR A;  1KQ0 A;  1S7E A;  2Y69 H;  4EJO A;  5EGO A;  4C2T A;  3WTS C;  1TW2 A;  2DFH A;  1I27 A;  3L7W A;  4OIR F;  2M87 A;  1IN5 A;  1LEB A;  4DNC A;  1RZ4 A;  5J6X A;  4BQQ A;  2OZU A;  4E7S A;  2DW4 A;  3LWF A;  3AG1 H;  1PUF A;  5DCM A;  2EJR A;  5D6E A;  2L54 A;  1XGS A;  1SVM A;  2BZT A;  2DTR A;  3K4J A;  1Z9C A;  1FSE A;  5D5U B;  5F1R A;  1R6R A;  3H5A A;  4NB5 A;  1QA6 A;  2B0L A;  2ZSI B;  3M3Y J;  2FBH A;  5E8G A;  3ABK H;  2Y9Z A;  3FBN B;  1H9T A;  3HYI A;  2V6C A;  3JRB A;  5E1W A;  3DU6 A;  1RI7 A;  2LG4 A;  4RS8 A;  3PNV A;  3CTA A;  3K70 D;  3SZT A;  4MGR A;  3H9G A;  4OAZ A;  3GTG J;  3E6B A;  2CYY A;  1VFC A;  2FE3 A;  1Y6I A;  2EIJ H;  4M9X A;  4LGW A;  4ITV A;  2QF7 A;  4OMY A;  3HTS B;  3S15 J;  2DOF A;  4QPO A;  2L2O A;  4UHT A;  3HOX J;  1XSD A;  2QKM B;  1MH3 A;  1G4D A;  4BBS J;  5C4X J;  4GFB A;  2JPC A;  3F8C A;  1W1W E;  4MLO A;  2F5D A;  2V26 A;  3MZ8 A;  3TBI A;  2ESN A;  2Q1Z B;  3KX2 A;  4FT8 A;  5DTD A;  2M5W A;  4BJ6 C;  3ZQ7 A;  3CP8 A;  2QQA A;  4UVB A;  5LGN A;  3IRQ A;  1J9I A;  1TQI A;  4PJ0 C;  5E3L A;  2HR3 A;  4L9V A;  2QBY B;  3ZN1 A;  2ZFW A;  4EJW A;  1F5T A;  2MC4 A;  2KKO A;  2EQR A;  2CS3 A;  1GV5 A;  1DPR A;  1Z3Y A;  3U21 A;  1JKO C;  1A6Q A;  1TWC J;  4LOC A;  1R22 A;  2IS4 A;  4A3E J;  2MGQ A;  2FMY A;  1I6X A;  3G3Z A;  2NVY J;  2OTJ I;  4XK4 A;  3HOT A;  1VQ5 I;  2ZME C;  1QGP A;  4FET A;  4IXA A;  4LG3 A;  3MWM A;  2Q2E B;  3HOS A;  3IP4 B;  2V1D A;  3WG9 A;  3JSO A;  3ZMZ A;  1MNE A;  3HGY A;  2G7H A;  3CCE I;  1FLI A;  3Q0V A;  3QQA A;  3EPZ A;  3RZD J;  4G6D A;  2XAQ A;  1T0F C;  2R7T A;  1OR7 A;  2YR2 A;  2QQ8 A;  3HL2 A;  4XSX F;  2CW8 A;  4ZYD A;  3MKL A;  4BU2 A;  3I5U A;  3HUG B;  1D1C A;  2DOA A;  2O9L A;  1X4O A;  3CES A;  1EH7 A;  3GFJ A;  1P6R A;  3DTE A;  2CUF A;  5D4R A;  3KET A;  5IPA A;  4BUP A;  1X19 A;  4I0B A;  1G3S A;  1WJC A;  4L18 B;  1O3S A;  3K1M A;  2X6O A;  3REO A;  1EH6 A;  1I50 J;  4IVN A;  4YFK F;  1DU0 A;  2W7N A;  3QYE A;  1I1S A;  4YG2 F;  1BJZ A;  2BXZ A;  1V5E A;  3ABL H;  4CHU A;  2P6T A;  2ADU A;  2EBI A;  2HI3 A;  3VOD A;  2K85 A;  1LDK B;  2FX0 A;  1GT0 C;  1ZTR A;  2LDU A;  1MH4 A;  4M71 A;  3DPL C;  1SD4 A;  2K4J A;  3BG5 A;  4W97 A;  1YO5 C;  2V1N A;  2WAD A;  3DBH B;  2WB1 A;  4CCK A;  1ZRE A;  1X1B A;  3F9K A;  2E2I J;  2NS7 A;  1B9N A;  4GO1 A;  2AXT C;  1PJR A;  3HBL A;  1FYM A;  3OY9 A;  5IT9 Z;  2P5V A;  3M7G A;  2JRM A;  1Z21 A;  4XKC A;  3H36 A;  1N78 A;  4A0Y A;  2FU4 A;  3GBG A;  4JX6 A;  1MDM B;  4L0Z B;  3K9T A;  2JPB A;  4L9N A;  1H88 C;  2VJJ A;  4P1W A;  2R7Q A;  1UST A;  3DTK A;  4P9U A;  4ESJ A;  2W1O A;  1JJ8 C;  2KL4 A;  5HOD A;  3CCY A;  2XPV A;  2V9P A;  1IAW A;  3S3N A;  1VQL I;  2FOW A;  4XR6 A;  2PLY A;  1D1B A;  3HOV J;  2E36 A;  2X1E A;  3CJR B;  3LQR A;  3HRU A;  3BPV A;  4OIO F;  3CUO A;  3DBR B;  1AKH B;  1FEX A;  4BS9 A;  4UXN A;  1FTZ A;  4ZYG A;  4I01 A;  2BW3 B;  3QP5 A;  4DZJ A;  4EJV A;  4V19 K;  2O3F A;  5K1Y A;  3GO5 A;  1UJ8 A;  3AL0 C;  2WAE A;  2WV1 A;  3ZMU A;  2EH3 A;  4CCO A;  2A68 F;  1FSH A;  1G2H A;  5EGO B;  1HDP A;  2VB6 A;  3NAR A;  3RPQ A;  4HNV A;  2V6E A;  3GYH X;  4MTD A;  1A04 A;  4CH7 A;  5BNG A;  3BP8 A;  2M45 A;  3IWF A;  3OYC A;  3HKZ N;  2IJL A;  3I4N J;  1PUF B;  5DCM B;  1POG A;  2ETH A;  4MHG A;  2M0C A;  2ZME A;  2W4S A;  3F3X A;  3GFL A;  3TKY A;  3F22 A;  4FE7 A;  3RYR A;  1Q1V A;  3FK7 A;  3LSR A;  5FLX Z;  3GZ5 A;  4GRI A;  1S9H A;  4WCG A;  2B9S A;  3GEZ A;  1U0J A;  1YLF A;  4MNU A;  4R79 A;  1FWZ A;  4OIQ F;  4HNT A;  4BYY A;  4HDV A;  1XS9 A;  4IRI A;  4CSW A;  5E3N A;  1T0F A;  2VPR A;  5L3F A;  4B8X A;  3JTH A;  3MAJ A;  4EM2 A;  2GQQ A;  1FMW A;  2X0L A;  4G7O F;  3FXQ A;  3M07 A;  2X48 A;  2D45 A;  1EF4 A;  2H27 A;  1R58 A;  3ZQG A;  2E5Z A;  3U2R A;  2LY2 A;  2X51 A;  1P9Q C;  1IRZ A;  3N97 A;  1J7K A;  3ZN0 A;  5B3S H;  3CUQ A;  3S14 J;  3EQL F;  4PDK A;  5IOZ A;  3JRF A;  4RGS A;  2X9D A;  4A3F J;  3ZMT A;  4N9I A;  2LH9 A;  3NWT A;  1U8B A;  3BTC A;  1QQI A;  4NHJ A;  2MAB A;  3E6M A;  1IDY A;  4XOT A;  5GTI C;  2J5P A;  4CCJ A;  3DBL B;  1TNT A;  2E34 A;  3QPL A;  2IBD A;  4BQO A;  5KHD A;  2RQP A;  5K7H A;  2VON A;  3M4O J;  3KEQ A;  2X6X A;  4D5F A;  5B1B H;  2VBZ A;  1HDD C;  3F8B A;  3R6S A;  2GIV A;  3S1M J;  3L2Q A;  2AQE A;  3E5U A;  4AVZ A;  5C3E J;  2BXY A;  5M5X J;  1VF9 A;  3LSM A;  2K7L A;  4I0A A;  1XCV A;  1EV7 A;  3OYG A;  4ZDO A;  4BHB A;  4CYC A;  4L5J A;  5EDN A;  5B1A H;  3C1D A;  1K7A A;  1SC7 A;  1SFU A;  2IS6 A;  2CQN A;  4P9F A;  3GTL J;  5IOY A;  1A6I A;  3U1K A;  5CQG A;  2R7Z J;  1R1V A;  3R0J A;  4KUM A;  4AYB N;  1JI8 A;  2K3F A;  3K6G A;  2VOP A;  1RKT A;  1FIA A;  2E2H J;  3LA7 A;  3J81 K;  5EZG A;  1B4A A;  5IYD J;  1JT6 A;  2KZV A;  5DEQ A;  1TW3 A;  3DKW A;  3QAH A;  2IGM A;  5IP7 J;  3UR3 C;  1BI3 A;  1OCC H;  2CWE A;  1BOB A;  4LB5 A;  4I98 B;  2Z99 A;  4E70 A;  3SDG A;  1OYI A;  1MGT A;  5HS8 A;  4DW6 A;  3BR1 A;  3DEU A;  3RPU D;  2QA4 I;  2L02 A;  4YII A;  3BR3 A;  4QPQ A;  3GTO J;  3JRE A;  2JVG A;  3E3V A;  2JA2 A;  2K4B A;  3ABT A;  2LLK A;  3ZQQ A;  3CCU I;  2BEO A;  2DXI A;  4EGY A;  1JGS A;  2ME6 A;  3GZ6 A;  2VI6 A;  5H2F C;  4XSZ F;  2KPM A;  1Z0X A;  1QZY A;  3FXK A;  5D4S A;  4HF0 A;  2OV7 A;  1YRN A;  1VQ4 I;  3SDB A;  4D0P A;  3BJA A;  3K10 A;  3PM1 A;  3RPU A;  1ZN2 A;  2MLK A;  2HEO A;  2O6G E;  2HOA A;  1OCZ H;  1UHW A;  2KDZ A;  2DAO A;  2DDA A;  3FKI J;  3N05 A;  2L7Z A;  2TRT A;  4DBQ A;  5D5W B;  1G8X A;  2HPI A;  2LNB A;  3Q0W A;  1PDN C;  2FSW A;  1QPI A;  1QZZ A;  2K3P A;  1B6A A;  4EJU A;  3OV8 A;  2DJI A;  3IKV A;  4XMY A;  1LEA A;  3BR6 A;  2VJ5 A;  1BJA A;  2A6T A;  4U0Y A;  2BY3 A;  3PNY A;  1U6G A;  2HYJ A;  2VT2 A;  5EJC A;  3MMY B;  1XMK A;  1SD5 A;  1W4M A;  2ZBK A;  3LSK A;  3A01 A;  2OCE A;  1KU3 A;  2XGD A;  3FK6 A;  2BVL A;  2DQR A;  2ZKZ A;  5DM7 F;  5DV5 A;  2O0Y A;  2OQG A;  1EKE A;  2RC4 A;  2FML A;  3K0L A;  1YW8 A;  4LIU A;  2GLO A;  3J81 Z;  3FBI B;  2EFW A;  1Y0N A;  5E3O A;  1DDN A;  2O03 A;  3M8F A;  1J75 A;  4Q5S F;  3BR5 A;  5J1R A;  3TQN A;  2COM A;  2ELK A;  4E7J A;  1YJN I;  5F6F A;  1R36 A;  1I1G A;  2L5Q A;  3PJR A;  2R4G A;  2P7V B;  4XN3 A;  3ZOB A;  1WWX A;  4M6V A;  2IA1 A;  2ZME B;  2Y30 A;  1D3Y A;  2EIN H;  1WJD A;  5J40 A;  5GAG J;  5ED4 A;  1E0E A;  1FP2 A;  2XVC A;  3BQZ A;  1SAN A;  3K4C A;  5E3M A;  4FX4 A;  3ZMD A;  2M7A A;  3PO3 J;  1ITY A;  3S17 J;  1P7I A;  5M5Y J;  1ZKG A;  4F92 B;  3OYI A;  2EZH A;  2VN2 A;  1JKR C;  4M3B A;  1VZ0 A;  3DV8 A;  4PGG A;  2X1D A;  2F4O B;  2MLG A;  4G6T B;  5FFZ A;  2OC6 A;  4D5C A;  3BY6 A;  4KIG A;  1RUO A;  2MH2 A;  5L3D A;  2VLA A;  4R1H A;  4BH9 A;  1XMA A;  4UVC A;  1R7J A;  2ZXW H;  4A5N A;  3IWZ A;  3KYC B;  1O3Q A;  2HKO A;  2ICW G;  4S04 A;  2KZG A;  3CUQ B;  2RV8 A;  4B4C A;  2DYS H;  5FRO A;  2PN6 A;  3GLL A;  2R7U A;  2EK5 A;  3KP7 A;  3R0A A;  2A3S A;  2C6Y A;  4H0E A;  2Y48 A;  4A3M J;  2L4M A;  1E3O C;  1SFE A;  4RDU A;  4XID A;  4I99 C;  2F48 A;  3I59 A;  3V8L A;  2NVX J;  4IQJ A;  3DCF A;  1FBU A;  3RQI A;  4B09 A;  5L3C A;  2ZFU A;  4C3H J;  1YI2 I;  2K5C A;  1Z05 A;  3K4B A;  1G3T A;  2TCT A;  4CYC B;  4PFO A;  4JYK A;  1P7J A;  2X6W A;  3ASN H;  3HPG A;  1BIB A;  2ZCW A;  2KRH A;  3KIO A;  3L00 A;  3LFK A;  3HDD A;  3RKW A;  1ZGW A;  4HQE A;  3F21 A;  2LFB A;  1LUJ B;  4HPQ A;  3VYR B;  5GAH J;  4M6X A;  2XB0 X;  1NK3 P;  5BOX A;  4M3G A;  5HNH A;  2NYX A;  2VE9 A;  3D5S C;  4FIS A;  2QSH X;  1KU2 A;  2EZK A;  2QQB A;  1OYW A;  2HU9 A;  2L9R A;  3KYL A;  1E2X A;  2DBB A;  2QEX I;  1PP7 U;  3ZGK A;  5HLI A;  2COB A;  2EV0 A;  3FXR A;  4A3L J;  4A93 J;  4PZJ A;  3HRT A;  2HKX A;  1JTX A;  4HX4 A;  5LRR A;  5KNL A;  4HRI A;  3BR0 A;  2W82 A;  2QQ9 A;  2XGE A;  4G6Q A;  2GXB A;  3FX3 A;  1UEL B;  4DYR A;  3AL0 B;  2M34 A;  4HV5 A;  1KU7 A;  1ACI A;  4YIF A;  3IC7 A;  4KMF A;  4PJM A;  5M3M J;  3NEU A;  3LL7 A;  4PUS A;  3RDI A;  4D9J A;  1XB4 A;  2HDW A;  2ZB9 A;  2LTP A;  2XF6 A;  4ZDP A;  3BG6 A;  2PJR A;  3MFK A;  4F7Z A;  1UHM A;  1Z1D A;  3I4P A;  4BBR J;  1JHF A;  3BZC A;  4U0W A;  1ZQ3 P;  2QEN A;  2HZD A;  4DBR A;  1X1D A;  2LD5 A;  3EUA A;  1YRN B;  4IHT A;  3WU2 C;  3WU1 B;  2VQG A;  2EIK H;  2DMQ A;  2DOD A;  3RTR A;  1LE8 A;  3W6V A;  3I0T A;  3JAM K;  4A6E A;  1GVD A;  1VQ7 I;  3CF2 A;  3T8R A;  4JBA A;  3H5N A;  5IP6 A;  4KIB A;  1W5S A;  3HPH A;  2YUS A;  5J3L A;  1B1B A;  3F0C A;  4EVI A;  1VTN C;  5LGU A;  3C2G A;  2M8E A;  4IOC F;  1OR7 C;  4G7H F;  1HA8 A;  4ENM A;  3FWE A;  4GCV A;  5KCM A;  2L01 A;  5JHU A;  3H9J A;  2PMZ A;  2XB5 A;  5CPR B;  2HVR A;  5AIQ A;  2VQC A;  3A01 B;  4IHV A;  1IRF A;  3HSF A;  1T38 A;  1N25 A;  5ILV A;  2MA3 A;  3CQZ J;  4WWC A;  4FQG A;  4WXH A;  3I56 I;  2M30 A;  5F08 A;  4BDY A;  2DPU A;  4CZZ A;  4HSR A;  2JWT A;  4ZJZ A;  5FD6 A;  1SVL A;  2EFO A;  2QSG X;  3OYK A;  1K61 A;  3E0J B;  4HNU A;  2F6C A;  5JLW A;  1Y1V J;  3OL4 A;  3CO7 C;  2BOL A;  2OF7 A;  3A4C A;  2CV1 A;  1AA7 A;  2A61 A;  1MBF A;  1HW5 A;  1RNL A;  5DD4 A;  4P96 A;  3DEE A;  4JK1 X;  5K5O A;  3A1Y A;  2K02 A;  3ZQL A;  3MZH A;  2KDO A;  1OJL A;  3GCM A;  5F0H A;  3V42 A;  2XAJ A;  5EZH A;  4LB6 B;  4HF1 A;  3W6K B;  1ZLK A;  3ESW B;  5KK1 A;  4L5I A;  3WE3 A;  2HNH A;  3PSI A;  4CCL A;  1MMN A;  2GM4 A;  3TW6 A;  2EV5 A;  4XKW A;  1NG7 A;  5L3G A;  4IRH A;  1XGM A;  4OWR B;  4YEL A;  5DD8 A;  4FE4 A;  3A0H C;  3CC7 I;  3T5X A;  1BI1 A;  3QP6 A;  3AFH A;  4MIM A;  1XN7 A;  1S3J A;  3KP3 A;  1ZR4 A;  1MW7 A;  3JAM Z;  5B66 C;  3P7N A;  3CME I;  5HOO A;  4BGD A;  2DMP A;  3BZ6 A;  1JT0 A;  3IH4 A;  3OYD A;  3NWS A;  3OYM A;  1OCO H;  2FNA A;  5F1J A;  2DK8 A;  4QWQ A;  3PFI A;  3WHB A;  1SD7 A;  3ERM A;  5J8F A;  2KRC A;  1TWG J;  2IA2 A;  3HJE A;  2E71 A;  4ENK A;  1JJ6 C;  1HW2 A;  2XC7 A;  1S29 A;  2MBF A;  3DLL F;  2VC0 A;  4BJ5 C;  1X2M A;  2Z9O A;  4JX5 A;  2B63 J;  5FKO A;  4RM3 A;  4K2E A;  2DT6 A;  2QGU A;  1GLN A;  4WXD A;  4CDG A;  2F2E A;  3ELK A;  1T2K A;  1IN7 A;  3BLY A;  1IN4 A;  2ECB A;  2HFH A;  2XRL A;  3GFM A;  3I59 B;  3FZV A;  1QU3 A;  2E19 A;  4Q48 A;  1O7F A;  2VKE A;  2W25 A;  4F91 B;  2W48 A;  3S2H J;  3IAS 2;  6PAX A;  2LMD A;  1IUF A;  3HEF A;  4NC6 A;  1GV2 A;  3BTJ A;  3BTL A;  5CJ9 A;  2BY2 A;  1ONV A;  3WGG A;  3CCV I;  1LQ1 A;  2GA2 A;  1R49 A;  4ZTJ A;  3BWG A;  2L3D A;  3Q3S A;  2V79 A;  2YSR A;  5C44 J;  1W7P D;  2VKH A;  2HGC A;  1NTC A;  3GZN B;  4MTE A;  3FMQ A;  1AOY A;  1B9M A;  2YU3 A;  1F9N A;  4J01 A;  2LKX A;  4MEX F;  3NQO A;  2DFI A;  2HQ5 A;  4ZH4 F;  3CCJ I;  4CA0 A;  4S0H B;  1T95 A;  4DYQ A;  3H5R A;  1EH8 A;  1FYL A;  2NOG A;  4QSH A;  2EA2 A;  2RVC A;  4CUG A;  1WH7 A;  3CUQ C;  4XLF A;  3L2U A;  1SMY F;  4WXC A;  1BR4 A;  3TOA A;  1XMX A;  3GX4 X;  4IEJ A;  1W7P A;  2P6S A;  3LQQ A;  2ZJR F;  1FBS A;  3SFZ A;  2JN6 A;  3AAF A;  4XON A;  2PJR B;  4H4K C;  1ZRC A;  5F04 A;  3WTY C;  5CKT A;  2R92 J;  4KFC A;  3EDP A;  3H3U A;  2VBW A;  2FBK A;  2A5Y B;  2GXA A;  3B6A A;  2WBM A;  3ABM H;  3FIW A;  3P5J A;  1C0W A;  3H9Q A;  4IHX A;  1LE8 B;  2NAZ A;  1SVO A;  3F6O A;  4B3X A;  1FT9 A;  2UV1 A;  1R23 A;  3OYE A;  2MYS A;  2FF4 A;  3ZXS A;  3S8P A;  4L9J A;  2RQQ A;  1BR1 A;  2L7K A;  2H94 A;  1E3H A;  2OUM A;  4HLY A;  3TP3 A;  2A07 F;  4MEY F;  3GTK J;  3V8J A;  1ZG1 A;  4ANJ A;  5KVR A;  1X2N A;  3JR9 A;  2KIM A;  4BJT A;  2UWM A;  4U0V A;  4L0Y B;  1O7L A;  3PQJ A;  3S16 J;  4HQM A;  1ETW A;  1JTY A;  1K4T A;  4II3 A;  1YOV B;  5FKM A;  4HEA 2;  4EM0 B;  1V54 H;  2OA4 A;  1X1C A;  3AKZ A;  2PQ8 A;  3Q0U A;  3M1C A;  4IHW A;  5EEG A;  5J4V A;  5IT3 A;  5CVI A;  1R5G A;  5D5X B;  1BL0 A;  2HXO A;  2X85 A;  3SJM A;  5J4Y A;  2CQK A;  2AS5 F;  3I71 A;  1Z6R A;  3J7A Y;  3OYJ A;  4IOA F;  1JUM A;  1K78 B;  3MKZ A;  1MJ9 A;  2MD5 A;  1PYV A;  3H0G J;  2FUG 2;  3IH3 A;  4A3K J;  2ECC A;  1KGS A;  1TT5 B;  4EM1 A;  1U2W A;  4WX9 A;  1S6L A;  3GTM J;  3VSK A;  3EUH C;  1IXC A;  1OCP A;  3SYT A;  1T56 A;  3TDZ C;  1Y0U A;  2YPR A;  4IX7 A;  1FX7 A;  3HOW J;  4HW0 A;  1NHA A;  2XAH A;  1IDZ A;  2CQX A;  2MW8 A;  2ZJ2 A;  2GZW A;  3DQV C;  2VT3 A;  2A6E F;  2E7X A;  2LBF A;  1L0O C;  3OYL A;  3FHZ A;  3DKX A;  3HHG A;  3TO6 A;  2ZXH A;  3OS0 A;  2DMU A;  2HVQ A;  1MIJ A;  3OYB A;  3TED A;  3H35 A;  3T1B A;  4HOB A;  2EV6 A;  1CF7 A;  1UCR A;  1XG1 A;  1J2X A;  4G9Y A;  4KT6 A;  2DI3 A;  2EIM H;  1DP3 A;  1YS7 A;  5EEA A;  5LEK A;  1HKQ A;  1GDT A;  4N9H A;  1R4N B;  3CMA I;  3HTU A;  3MKW B;  1YW9 A;  4B48 A;  2VUM J;  1BOA A;  2VBX A;  4X1E A;  2XDV A;  4GGG A;  3F8M A;  3HRM A;  4M73 A;  4O6J A;  2W57 A;  2JQ7 A;  1J0R A;  2FJ1 A;  5ERI A;  3LSH A;  1WJ5 A;  3G1O A;  3LNQ A;  1D0X A;  3J7A O;  4CYD A;  4XOP A;  1MJA A;  4Y33 A;  3HIF A;  1BN5 A;  3K2Z A;  1MD0 A;  3R60 A;  4AWX B;  2BY0 A;  2IP2 A;  2FQ4 A;  1SFX A;  2EFQ A;  4XNF A;  3PFY A;  5F27 A;  2DA1 A;  3CC2 I;  2AO9 A;  5JR3 A;  2KQR A;  1XGN A;  3GTJ J;  1UG0 A;  4BAY A;  2DJN A;  3BG3 A;  2ZC2 A;  2ZO4 A;  1MMA A;  4RAG A;  2UXN A;  1DQU A;  4EMS A;  2BHY A;  4V2G A;  1XDS A;  1WPK A;  2H09 A;  1ZAO A;  2H8R A;  3K4N A;  2CGP A;  5J1Y A;  3QOD A;  1O3T A;  1O4X A;  3PL8 A;  2WV0 A;  2Y0M A;  2FRH A;  3F8N A;  5K5R A;  1G3W A;  4XLP F;  1YX5 A;  2NS8 A;  2E1N A;  2RKH A;  2WB1 N;  4Y7N J;  1LNW A;  3ROU A;  1A35 A;  2HDD A;  3W2A A;  3KEY A;  3GUD A;  3A0B C;  4EGZ A;  2XHK A;  2KP6 A;  3AG2 H;  3M1E A;  1MMS A;  1SFO J;  1W7P B;  1JUP A;  1SMT A;  4I09 A;  5GPA A;  4RB3 C;  1W0T A;  1WHU A;  3EUK L;  1CGP A;  4BXU A;  2EFP A;  2XPU A;  4HBL A;  2DOE A;  1D8K A;  2R7X A;  4KIF A;  3BRO A;  3QOP A;  4XLH A;  3FM3 A;  3LFU A;  3MKY B;  2NS0 A;  5K7F A;  1ON1 A;  1Q1H A;  3EUH A;  2QKL B;  2OZ6 A;  2FA5 A;  2M4K A;  3MD2 A;  4Q4Z F;  2MG4 A;  2OBP A;  3WHC A;  1APL C;  3RIR A;  1BW5 A;  1SEU A;  1QHH D;  2JMW A;  2ELJ A;  3ECO A;  1S8N A;  3R61 A;  4IHY A;  1TQP A;  2R93 J;  2L4A A;  1T33 A;  1IV6 A;  3ZR8 X;  1NK2 P;  2DU9 A;  5DM6 F;  1AU7 A;  3IKT A;  2RRE A;  1ZYR F;  4XLE A;  1KZH A;  2DN0 A;  1X3W B;  4YFN F;  5TJJ A;  4A69 C;  4RB1 A;  4FTH A;  1KYW A;  2RNG A;  1OKR A;  4J00 A;  2CRG A;  3J7Y J;  1VQN I;  5FD5 A;  2LVS A;  5D6F A;  1R9T J;  3SZP A;  3RKY A;  3BQY A;  2OPT A;  4BXX J;  5FB2 A;  1ZGJ A;  2KFD A;  4GYG A;  1T39 A;  3J80 K;  2ELH A;  1OCR H;  1TWA J;  3ECH A;  3KEO A;  2ESH A;  2NVQ J;  3ML6 A;  2A6H F;  3M8J A;  3CCL I;  1R00 A;  4TV7 A;  3LSI A;  2DA4 A;  4IRG A;  4X6A J;  1G6N A;  1FZP B;  3Q9V A;  5TIS C;  4RLQ A;  2BHZ A;  3H0D A;  1FIP A;  3DWL E;  5GP9 A;  1ZH5 A;  4ESB A;  3OMY A;  2M4G A;  4AUX A;  2HTS A;  3B73 A;  4GYI A;  1YX3 A;  4Z2Y A;  4AIJ A;  4RAF A;  4MQV A;  3PQK A;  1R1U A;  3KZZ A;  4F55 A;  5FJ8 J;  2JJ7 A;  3BG9 A;  2QZ8 A;  2OAZ A;  1HSJ A;  1Z7L A;  5M5W J;  4RMN A;  3OS1 A;  2XRN A;  3ZCO A;  4XM3 A;  1HXD A;  3C2H A;  2L9S A;  5LHG A;  2LBF B;  2ID3 A;  4A0Z A;  4D7M A;  3CCQ I;  1REP C;  2VOO A;  3QPS A;  3S2W A;  3I64 A;  3I4M J;  2CH0 A;  3JRD A;  2LKP A;  1OIS A;  1QNT A;  1S7A A;  4E6K G;  2GXG A;  2K9N A;  4XLN F;  5GAD J;  1U9N A;  3K4M A;  5D8L B;  1LVK A;  4EEF G;  4E7Z A;  2AHQ A;  3OIQ A;  2P7C B;  5DYM A;  1PP8 F;  3P9K A;  4A2U A;  1JXS A;  3CJQ B;  1O57 A;  1CF7 B;  3ABU A;  1KYZ A;  2X1C A;  1ETX A;  3VB2 A;  4M6Y A;  2ID6 A;  3G73 A;  3TL4 X;  1Y1W J;  1OCT C;  4JOM A;  2V9V A;  2M3A A;  1W0U A;  3JCU C;  1FMV A;  1IGN A;  2Y75 A;  1ZLJ A;  5B5E C;  1VQ8 I;  3MCZ A;  2GWR A;  1OFC X;  3K1N A;  4IQ4 A;  4U87 A;  4XRS G;  4Y4R A;  1SFK A;  3H3Z A;  1JGG A;  3WTU C;  1DUX C;  2E5N A;  4N0B A;  2JUC A;  2I5U A;  3K4K A;  4LJZ F;  1K4S A;  4B3A A;  1V5F A;  3QPT A;  1JE8 A;  1FTT A;  4PFP A;  2K9M A;  2XIG A;  4G8X A;  1BR2 A;  1JUS A;  3VYT B;  3MVP A;  2P8T A;  2ME0 A;  3MEX A;  3T0Y A;  3E5X A;  3J80 Z;  3HC7 A;  3WGI A;  2VPL A;  1SD6 A;  2HXI A;  2OU2 A;  2PEX A;  3KP5 A;  1STZ A;  2KIF A;  4M72 A;  2F5C A;  5HS7 A;  2UXX A;  2X6Y A;  3CDI A;  3KP6 A;  1TT0 A;  4PJL A;  4P5O A;  1OQY A;  3NRV A;  4YEJ A;  3BPX A;  4AIH A;  4UUS A;  3OYN A;  3KLN A;  5DUI A;  4KIC A;  3ZP5 A;  2BYV E;  1V5G A;  3CLO A;  1JHH A;  1XSX A;  2IA0 A;  3D0S A;  1K6Y A;  2RAE A;  3V7C A;  3S3O A;  3H1C A;  4QTR A;  2G7U A;  3FXM A;  3PIP F;  4ENJ A;  5AON A;  4PGH A;  1SAX A;  2PG4 A;  2M2E A;  1X1P A;  2DA7 A;  4AID A;  4KT5 C;  3V8K A;  3ZMV A;  2HYF A;  3CDH A;  3V4G A;  1TL8 A;  2DTZ A;  4FHT A;  2EIL H;  1XGO A;  2DQL A;  1IXS B;  3O2P E;  4F3Q A;  1TP4 A;  3FIS A;  5FFX A;  1RKW A;  2DFE A;  2VJ4 A;  3JRC A;  1F4K A;  1XC5 A;  3LOC A;  3G6E I;  3OSF A;  3G1L A;  4PCQ A;  3B6C A;  3SZG A;  1UB9 A;  4U7B A;  2DT5 A;  3IH2 A;  2A69 F;  3K7A J;  3S3M A;  1LJ9 A;  2ZSH B;  1MZB A;  3CC4 I;  2HYG D;  2JVH A;  4UV8 A;  1BM9 A;  2OTL I;  1IXR C;  2LRD A;  2QVO A;  2WY8 Q;  3TO9 A;  2G9W A;  2WAQ A;  2P5K A;  4KIS A;  9ANT A;  2JSC A;  3KPH A;  5F0C A;  1T98 A;  3UNG C;  3K4L A;  2Y0S A;  3HRS A;  4B1R A;  1WCM J;  2LF8 A;  4CCM A;  1K6O A;  2EWN A;  1Z91 A;  5LEJ A;  3FXU A;  3OS2 A;  4HDU A;  3VYU B;  2O8X A;  2V1X A;  5J1U A;  3EYI A;  5FRN A;  4LLL A;  3VDX A;  2HTJ A;  3O8G A;  4RGU A;  1V4R A;  1FY7 A;  1QVT A;  1ZHF A;  2JA6 J;  1FP1 D;  1XD7 A;  1FBQ A;  3I55 I;  1ORK A;  3B02 A;  1E17 A;  3FKJ A;  4I6Z A;  3RKX A;  1I3A A;  2GOX B;  1U78 A;  3I9V 2;  4GDF A;  1FOX A;  1D0Y A;  5CQE A;  4BE1 A;  5F64 A;  3QRF F;  2DMT A;  4ASN A;  4E7H A;  2F5F A;  1P4X A;  2NVT J;  2VAS A;  3V7R A;  5KAI C;  1Y8R B;  4KDP A;  4ABZ A;  1LDJ A;  4BNC A;  3ASO H;  4ZZL A;  3F8F A;  3S2D J;  2G0E A;  3QYB A;  1FNN A;  1FOK A;  3QU6 A;  4ZC3 A;  2LOO A;  1AHD P;  1MNM C;  3HHH A;  3CJN A;  2JA5 J;  1MBK A;  1Z6T A;  3WOD F;  5DCF A;  1TZL A;  1N77 A;  3FHN A;  2ZXJ A;  4PJJ A;  3WG7 H;  5BMZ A;  1JKQ C;  1IG7 A;  2K86 A;  1A5J A;  5CYV A;  1K78 A;  3FMS A;  4E7L A;  3OSG A;  5LHH A;  1YIJ I;  2QM3 A;  1IRX A;  2ZJQ F;  1MBH A;  4Y15 A;  2A5W A;  5BPI A;  4BXF A;  2P5L C;  2QLZ A;  2K27 A;  3BG7 A;  2R5Y A;  2ACJ A;  4LIV A;  2F4M B;  3WE2 A;  5JVT A;  3NAU A;  2CV0 A;  3A2K A;  5DS9 A;  2XSD C;  2CG4 A;  3MZY A; 
#chains in the Genus database with same CATH homology
 4BE2 A;  3ZXS A;  3S8P A;  3PNT A;  2CUZ A;  2RQQ A;  1BR1 A;  2L7K A;  2OUM A;  3VSL A;  2V9K A;  2KZV A;  4KIT B;  3HXL A;  2IGM A;  2MD0 A;  3UR3 C;  4ANJ A;  2P0W A;  2WY7 Q;  1BOB A;  2Z1D A;  3LSG A;  4BJT A;  2UWM A;  4BEH A;  2F4I A;  4BAC A;  4II3 A;  2VL8 A;  4DIQ A;  3RCO A;  3RPU D;  2M7B A;  4XKB A;  3D5L A;  2DT7 B;  4HEA 2;  1DGR M;  2E1M C;  3L2V A;  1X1C A;  3PSF A;  4FAS D;  3AKZ A;  2HQA A;  4QPQ A;  2W00 A;  3M1C A;  2JVG A;  4XOR A;  3ZRG A;  3VYS B;  2JA2 A;  2DCE A;  4XN0 A;  3ZQQ A;  4CZC A;  2X85 A;  4B47 A;  2DXI A;  4HG2 A;  4AU7 A;  3J7A Y;  3OYJ A;  2KPM A;  2VJI A;  3MKZ A;  3QOE A;  2E60 A;  3CMM A;  1WJB A;  3OYF A;  1PYV A;  2OV7 A;  2FUG 2;  3SDB A;  3K10 A;  4IZZ A;  3HKZ A;  3VSK A;  3EUH C;  4DGW B;  4X0G A;  3SYT A;  2Z16 A;  4IX7 A;  4EAT A;  1KON A;  4RLF A;  3N05 A;  4PSW A;  3DQV C;  4DBQ A;  2R7W A;  1G8X A;  2F5V A;  2HPI A;  2I8D A;  2LBF A;  2K3P A;  3DLA A;  3OYL A;  3DKX A;  3OS0 A;  2ZXH A;  2DJI A;  4XMY A;  4BEH B;  2HVQ A;  2VJ5 A;  2A6T A;  5LD2 C;  3CP2 A;  3OYB A;  3PNY A;  3H35 A;  5LFA A;  3MMY B;  3DPU A;  3E1S A;  4BQN A;  4KT6 A;  3QYF A;  3K70 C;  3LSK A;  1DP3 A;  3W2W A;  4XKV A;  2CFO A;  4ZDL A;  2BVL A;  2CW7 A;  2R7V A;  4N4O B;  4LIU A;  2IGK A;  2AQF A;  3FBI B;  2R7R A;  3OR2 C;  3MKW B;  2M0M A;  4PK4 A;  4B48 A;  5HVQ C;  3IAM 2;  2XDV A;  4BE0 A;  5HNF A;  1WFX A;  3L2W A;  4E7J A;  2MFZ A;  3G2B A;  2VXD A;  3LSH A;  2HPM A;  2R7O A;  1SAU A;  1WJ5 A;  2L5Q A;  3PJR A;  4JQF A;  2R4G A;  4C9Y A;  4XN3 A;  1D0X A;  4PSX A;  4XOP A;  4Y33 A;  1WJD A;  2JSP A;  2VKD A;  1E0E A;  3K4C A;  4E7K A;  4XNF A;  3PFY A;  4DJA A;  2M7A A;  2WA0 A;  3BCB A;  4CCN A;  2KQR A;  2V7F A;  4F92 B;  3OYI A;  1UG0 A;  4C30 A;  2BVM A;  4LIT A;  2WAF A;  1MMA A;  1VZ0 A;  1DQU A;  1LFP A;  2X1D A;  4Y3O A;  4G6T B;  2OC6 A;  4DOZ A;  4YRV A;  2ZXI A;  4B43 A;  3K4N A;  3QOD A;  2BW3 A;  3D5R C;  3DKY A;  2VLA A;  2Z2S B;  3PL8 A;  4AYB A;  3DTI A;  1W36 C;  1YX5 A;  2K9L A;  1QHG A;  2O5R A;  4D1Q A;  4C2T A;  5FRO A;  2R7U A;  2V4J C;  4BQQ A;  3W2A A;  3KEY A;  4E7S A;  3OYH A;  1D1A A;  2KP6 A;  3K4J A;  1X1A A;  1R6R A;  3H5A A;  4IQJ A;  2ZSI B;  2LYC A;  4HST A;  3EUK L;  2ZFU A;  3FBN B;  3OOU A;  2R7X A;  4XLH A;  2K5C A;  3DU6 A;  3LFU A;  3K4B A;  1WJE A;  3MKY B;  4XLC A;  2LG4 A;  4PFO A;  2QKL B;  2X6W A;  3PNV A;  3OYA A;  3HPG A;  3K70 D;  2KRH A;  3H9G A;  4OAZ A;  2M4K A;  3MD2 A;  4KJZ A;  3TMO A;  1Y6I A;  1QHH D;  4HPQ A;  4ITV A;  3LMM A;  3VYR B;  2ELJ A;  4QPO A;  2L2O A;  4B44 A;  5HNH A;  3ZR8 X;  2QKM B;  3D5S C;  1MMG A;  2HU9 A;  3KYL A;  4MLO A;  2V26 A;  3ZGK A;  3TBI A;  2Q1Z B;  4NNJ A;  3KX2 A;  1LKX A;  2RRE A;  4XLE A;  4BJ6 C;  3CP8 A;  1MND A;  5HLT A;  2VIX A;  5KNL A;  4HRI A;  2W82 A;  1MMD A;  2RNG A;  1G59 A;  1UEL B;  2KMU A;  4J00 A;  3AL0 B;  2MC4 A;  4ZTF A;  2CS3 A;  4PJM A;  3RQ4 A;  1UAA A;  1Z3Y A;  3LL7 A;  4PUS A;  3U21 A;  4D9J A;  3OIP A;  2IS4 A;  2HDW A;  2IS1 A;  2XF6 A;  4ZDP A;  3BG6 A;  2PJR A;  3ONQ A;  3HOT A;  3M8J A;  4F52 A;  4FET A;  2CMP A;  2HZD A;  4LG3 A;  4DBR A;  2Q2E B;  2LC2 A;  1X1D A;  3HOS A;  2VQH A;  3IP4 B;  3LSI A;  4N4N B;  3EUA A;  3IUO A;  2VXZ A;  3H0D A;  4RLQ A;  1MNE A;  3DWL E;  2LY1 A;  3OMY A;  2M4G A;  2VQG A;  1YX3 A;  3RTR A;  1W36 D;  3EPZ A;  3W2V A;  4F55 A;  3CF2 A;  1T0F C;  2R7T A;  3S93 A;  3OR1 C;  3H5N A;  1Z7L A;  3BC8 A;  4RMN A;  3OS1 A;  1EA3 A;  3ZCO A;  3HPH A;  3HL2 A;  2HVS A;  2CW8 A;  4XM3 A;  3C2H A;  2L9S A;  2LBF B;  3VWB A;  4BU2 A;  3HUG B;  3C2G A;  4F93 B;  1D1C A;  2DOA A;  1ZEL A;  2CH0 A;  1OR7 C;  3W3C A;  1HA8 A;  1X4O A;  2XF5 A;  3CES A;  4E6K G;  3RSN A;  4E7Z A;  3K4M A;  1LVK A;  3OIQ A;  5KCM A;  2R7S A;  3DTE A;  1X4P A;  3H9J A;  2PMZ A;  4BUP A;  1X19 A;  3CJQ B;  1WJC A;  2JUG A;  5CPR B;  2HVR A;  2IGN A;  2VQC A;  1Y56 A;  2X1C A;  2W7N A;  3QYE A;  3TL4 X;  3I3L A;  1V5E A;  4JOM A;  1ERD A;  2M3A A;  4NUB A;  4E7I A;  1FMV A;  4BDY A;  1LDK B;  4C2U A;  4HSR A;  4ZJZ A;  4PJN A;  3DPL C;  4IQ4 A;  2V1N A;  3OYK A;  4U87 A;  2WAD A;  2WB1 A;  4CCK A;  1X1B A;  3E0J B;  3F9K A;  4Y4R A;  4II2 A;  1SFK A;  4HNU A;  1PJR A;  2F6C A;  4BDZ A;  3OL4 A;  2BOL A;  2E5N A;  4NQW B;  3OY9 A;  3A4C A;  2CV1 A;  1AA7 A;  2UUZ A;  3K4K A;  1Z21 A;  4XKC A;  1N78 A;  1V5F A;  3PUB A;  3DEE A;  3A1Y A;  2KDO A;  3GBG A;  4PFP A;  2K9M A;  3SEZ A;  4BL0 B;  1BR2 A;  3VYT B;  2VJJ A;  4P1W A;  2R7Q A;  3V42 A;  3DTK A;  2W1O A;  3CZ6 A;  3HC7 A;  2KL4 A;  2NOJ B;  2VPL A;  1WJA A;  2GOM A;  2HNH A;  2XSJ C;  3PSI A;  3S3N A;  4CCL A;  1MMN A;  2X6Y A;  4XQF A;  4XR6 A;  4XKW A;  1D1B A;  1NG7 A;  1TT0 A;  4PJL A;  2KHM A;  4P5O A;  4OWR B;  2X1E A;  4YEL A;  3CJR B;  4YEJ A;  1D0Z A;  3OYN A;  4BS9 A;  3AFH A;  3SEQ A;  2IXS A;  1V5G A;  2BW3 B;  1MW7 A;  1K6Y A;  5HOO A;  4BGD A;  3AL0 C;  3OWT A;  3S3O A;  2WAE A;  3OYD A;  2XAU A;  3NWS A;  4CCO A;  3OYM A;  2LRE A;  4IKF A;  2VB6 A;  2V6E A;  4CH7 A;  2KRC A;  2E1M B;  3OYC A;  4OAY A;  2XC7 A;  1J09 A;  4XL9 A;  4BJ5 C;  4F3Q A;  2VJ4 A;  3DPT A;  4RM3 A;  2DT6 A;  1GLN A;  3SZG A;  2L9N A;  2CUJ A;  3BLY A;  4U7B A;  2W4S A;  1QU3 A;  3OL3 A;  3S3M A;  2ZSH B;  1YE9 A;  4F91 B;  2JVH A;  2IGO A;  1DGW Y;  1S9H A;  4GRI A;  1OLT A;  3IAS 2;  4NC8 A;  3BCA A;  2LRD A;  1U0J A;  4NC7 A;  2WY8 Q;  4R79 A;  2WAQ A;  4KIS A;  4HNT A;  4RM2 A;  2IS2 A;  3UNG C;  3HG9 A;  3K4L A;  4CSW A;  2Y0S A;  4CCM A;  3S32 A;  1FMW A;  2VQL A;  3OS2 A;  1NG6 A;  2XF7 A;  4ZTJ A;  3VYU B;  5FRN A;  2E5Z A;  3DU5 A;  2LY2 A;  2X51 A;  2VKH A;  3VDX A;  1P9Q C;  4ZYA A;  4J01 A;  3FKJ A;  4CA0 A;  1T95 A;  5TGT A;  2GOX B;  3H5R A;  3I9V 2;  2LH9 A;  3NWT A;  1D0Y A;  5CQE A;  4BE1 A;  1WJF A;  4XLA A;  2MAB A;  4XOT A;  4CUG A;  5JHF A;  3FDY A;  4XLF A;  4E7H A;  4CCJ A;  3L2U A;  4E4H A;  2VAS A;  3L2R A;  1BR4 A;  5KHD A;  4BQO A;  1N75 A;  2X6X A;  3QYB A;  4ZC3 A;  5FRM A;  3L2Q A;  2LOO A;  2AQE A;  4AVZ A;  4XON A;  2PJR B;  2KLO A;  3LSM A;  4H4K C;  1TZL A;  1Z3X A;  5CKT A;  3FHN A;  4PJJ A;  3OYG A;  1N77 A;  2CV2 A;  4ZDO A;  2WBM A;  4E7L A;  1IRX A;  2A5W A;  2IS6 A;  4BXF A;  3BG7 A;  3H9Q A;  4LIV A;  5CQG A;  3OYE A;  4B3X A;  2UV1 A;  1JI8 A;  2CV0 A;  3A2K A;  3K6G A;  2MYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...