1UEXC

Crystal structure of von willebrand factor a1 domain complexed with snake venom bitiscetin
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
202
structure length
202
Chain Sequence
EPPLHDFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVAVVEYHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRIALLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVLSSVDELEQQRDEIVSYLCDLAPEAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of von Willebrand factor A1 domain complexed with snake venom, bitiscetin. Insight into glycoprotein Ibalpha binding mechanism induced by snake venom proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Toxin/blood clotting
molecule keywords bitiscetin alpha chain
total genus 67
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2003-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1uexC00
3EH2A 3EGDB 3K6SB 2NVOA 3TVYA 4G1MB 3EFOA 3F74A 4MMYB 4WFQA 4IXDA 2VDPB 1JV2B 3ZDZB 3ZDYB 1T6BY 2IUEA 4HQNA 4F1JA 3K71B 1QC5B 3EGXA 1PCXA 1V7PC 1FNSA 5E6SA 1Q0PA 3EGXB 2VDOB 4CNBA 3HXOA 2VDKB 5KYXA 4WK2B 1SHTX 3IJEB 5E6UB 4WK0B 4C29A 1M2OA 2XGGA 1U8CB 3BQMB 4HQFA 5E6RB 5KYUA 4C2BA 1XUOA 3HI6A 2NUTB 1RRKA 1SQ0A 1U0OC 3EG9A 3TCXB 1U0NA 1CQPA 2VDRB 1OAKA 3EG9B 3GXBA 3Q3GE 3T3MB 4UM9D 2VDQB 3K6SA 1PT6A 1CK4A 5E6RA 3VI3B 2VDNB 5KYUB 1MQAA 3EFOB 1JEYA 2X5NA 3IBSA 1M2VA 1RS0A 2M32A 2ODPA 3M6FA 3HXQA 4C2AA 4UM8B 3ZE2B 1XDDA 5HGJA 1QC5A 2VDMB 3PPVA 4NENB 5BV8A 2XWJI 4HQLA 4HQOA 1MHPA 3RAGA 4G1EB 1L5GB 1JEQA 1IDN1 3F78A 1ZOOA 1IJBA 2O7NA 4O02B 1YVRA 1LFAA 2NUPA 3PPYA 5LN1A 4NEHB 2WINI 1MJNA 3TW0A 3PPWA 4A0QA 1ATZA 1QCYA 1BHO1 1M1XB 1RD4A 1XDGA 2ADFA 3ZDXB 4F1KA 4Z7QB 2I6SA 2VC2B 4CN8A 3E2MA 4M76B 5HDBB 2NUTA 3FCUB 4UM9B 2NUPB 1ZONA 1M10A 5KYYA 1UEXC 3V4VB 1BHQ1 2XWBF 3N2NA 4Z7OB 2VDLB 2ODQA 3K72B 4HQKA 1IJKA 1M1UA 1T0PA 4WK4B 4IGIA 1TYEB 1NA5A 3NIFB 1ZOPA 2B2XA 1JLMA 4FX5A 3TXAA 2I91A 3EOAI 3NIGB 4MMZB 1JEYB 3QA3E 4XW2A 5KYYB 1PD0A 3ZE0B 5E6UA 5HJ2A 3EH1A 1RTKA 3V4PB 5E6SB 5KYXB 2ICAA 3PPXA 1DZIA 1MF7A 3NIDB 4DMUB 1JEQB 3FCSB 4IHKA 1YVPA 3BN3A 2QTVA 4WJKB 3ZE1B 4PN7A 1N3YA 1SHUX 4Z7NB 1IDOA 1AUQA 1DGQA 3VI4B 4JDUA 2WW8A 4CN9A 5ES4B 1PD1A 1MQ9A 3T3PB 4BJ3A 4NENA 1AOXA 5KYWA 1AO3A 1N9ZA 5KYWB 1MQ8B 2I6QA 1M2VB 5KYNA 3EGDA 3ZQKA 3EOBI 1FE8A 3BQNB 4MMXB
chains in the Genus database with same CATH superfamily
2C7PA 1Z3IX 2WIBA 2XRMA 1GD1O 4K6FA 4UCQA 1ZK2A 1PHPA 1LBQA 4BMXA 1Q1ZA 1VLZA 1Q0UA 4ND8B 2H63A 4PFJA 3S2IA 4BE4A 5JAZA 3WB9A 1KJQA 2B30A 5K3FA 4Z9AA 1IIRA 4LYHA 1CY7A 2GAAA 2UZIR 1ZXBA 3MTAA 2FSIA 3DZDA 4OMFG 4Q3BA 5EJFA 2Z6VA 3HUTA 4HLQB 1X7YB 3E05A 2V98A 3ZWAA 1GIAA 1JIQA 1Y1QA 4YXWA 3ZGNA 3DLIA 4QKQA 3PC8A 2V8BA 4DEXA 2ZJ4A 3I39X 5JYCA 3NORA 3D8BA 5K3FB 5BWLA 4JK3A 1CU1A 4YAJA 1M33A 1U6IA 3RU3A 4F5WA 1KSJA 2I7VA 1G1AA 1GCAA 2VP9A 4TL7A 4WHMA 3P52A 3VGJA 4YK7A 4MP8A 3WHPA 4UVEA 4EY5A 2M6RA 4I19A 3HVKA 1QG6A 3IKMB 4KQGA 3EEIA 3KG2A 4B6OA 2C2KA 2DR3A 1EPUA 3ZZ1A 3NHKA 1MZVA 1PEYA 3D6MA 3HNRA 4IFIA 1JEYA 2Q2WA 4EA6A 4X1IA 2WG2A 2VBGA 1PNTA 4QFCA 5G4KA 3B85A 2BSQA 4XCQA 7ABPA 2I4MA 2KB0A 1A8IA 2XB8A 3QNMA 2AG6A 5BV8A 3LO8A 2G5TA 2SICE 4J7AA 1PYOA 3IOEA 3RSGA 5H5JA 4L51A 1FMFA 2VXCA 2VJCA 1EZZA 2Y1DA 4OY3A 3AR4A 3SY8A 5HPYB 1ZGCA 5I3ZA 5F9HA 1MCZA 2OO5C 2Z30A 1W93A 3WIBA 3WYNA 2H5LA 4J07A 4NU0A 3WMWA 3DOEA 2YC2C 4EDFA 4YX9A 2KQUA 2JB9A 3CVWA 3IMKA 3CVXA 4EX7A 1CY1A 4TWBA 2XQJA 1Z13A 3ZJ5A 3VA7A 2FEWB 3D5EA 2NNLD 1T35A 4X9XA 4TOIA 3TUIC 1Q7CA 2W5UA 3L06A 2I6TA 4B3DA 3C45A 2P9BA 3CUWA 5C4IA 5DYGA 2OCPA 2MWMA 3RW9A 5LCXA 1GQ2A 4QA9A 1WMSA 2EEZA 4CLOB 1AN9A 4G0ZA 3WRYC 1PWYE 2I1WA 2Q29A 3IPRA 3DMDA 2ZZNA 4L4ZA 2PIDA 2QI9C 5FUBA 4UEWA 1RCTE 1KYTA 5BQFA 1PV2A 1PK7A 2PU7A 1TEVA 4QT0A 1IB0A 2ADOA 3OJWA 1G8YA 3RQSA 1JQAA 4UUMA 3RC3A 2B3TA 3K20A 4M9SA 1LPMA 4OVKA 3T54A 4NPAA 4FR2A 3TFQA 1E2LA 3T3OA 4FP9A 4LXHA 3WICA 2IH4A 2F1HA 4OHMA 2ONZA 2YN4A 1I2ZA 4YHBA 2HT6A 4NYMR 3L1KA 4OB8A 5SICE 3ZS8A 5J2UF 2CMDA 1NRIA 3ZLJA 1J9ZA 3EQ7A 3K9WA 4Z8YA 3PCTA 3I52A 2VYFA 3FWZA 4OQLA 4YCSA 4ES6A 1NJ2A 4E3ZA 4P4LA 5K51A 3PNMA 5JZSA 4ZQBA 1OQAA 3AOGA 3S8MA 1VMAA 3KPUA 1NV8A 2OQIA 2LR0A 1DKRA 1W0JD 2GN4A 1ADGA 3FAKA 4L72A 3PDIB 4G1UC 5DRTA 4RKEA 5KAMA 4EG1A 4B3GA 2VSFA 2WKRA 2GK6A 3G2HA 1Z8HA 4FDMA 4MMYB 4MVWA 4E09A 4HS4A 3MD9A 4JZKA 1JF8A 3GVCA 3M6AA 3SR3A 3EVZA 2HU8A 3F7OA 3K05A 1PDWA 4PVDA 3EBLA 3PP8A 4AXBA 1YXMA 3C3YA 2WJJA 3I34X 1Y6FA 2HTFA 4JD5A 4QELA 4C7VA 4ZICA 5B1EA 1ML3A 3ZXYA 4UUPA 4Q7EA 3TQTA 1QQBA 3NETA 2VHQA 3JAWB 3WYCA 2RJNA 2DPHA 2N9UA 3CLUC 4C0JA 2WWIA 1FX0B 4O8CA 4RJKA 5BURA 2ZUVA 3B12A 2C4TA 2BMWA 3BFKA 3IUNA 1U3TA 3GA5A 1C8BA 4L4UA 4FI3C 3PVSA 2X0RA 2H1CA 3Q3GE 3AEQB 2P9QA 4UM9D 2FCRA 1Z8NA 1NY6A 3WGGA 1NVGA 3RIHA 4BEVA 1Y42X 1TYCA 3NHYA 2P8JA 4EGCB 4BXOA 1QOZA 2BELA 3AR9A 2EHDA 1PK9A 2WWVD 2ZRBA 1ORDA 2C92A 3CFYA 4AURA 1UC9A 3O91A 2ZXEA 2EKPA 4HYYA 3Q10A 3W8RA 3T7SA 1V7QA 3FPFA 4FDTA 4CLRB 1EIZA 3QNWA 1BA2A 1SBNE 2CNDA 1XLTC 4E5MA 1NT4A 4MWZA 5A5DA 1R5BA 1X1CA 2D74A 3HEAA 2JKYA 4CIDA 4MVYA 1MJFA 2OGWA 5HX7A 4OAQA 1T1JA 2VZEA 4CNQA 1J20A 1ZCAA 3QBDA 4LRUA 1ACLA 2O06A 2QG9A 3ORSA 1B74A 4MV1A 1J0CA 4U63A 3VC2A 1YE5A 1KKMA 2XWQA 2GNAA 4LZNA 3WGJA 1NVVR 3DE5X 3T52A 3SJCA 4IFTA 4C7BA 3GFBA 4EY7A 2O2YA 2XJ9A 5JXGA 5DBOA 4W82A 4C1NA 1L1FA 3MJHA 3BK1A 4IX9A 3E2MA 2PWBA 2EYQA 2IHUA 1UJ5A 3GNLA 4FNGA 2ZYTX 4XWYA 5DGTA 1DTSA 5HTKA 3VKUA 3GZJA 4TMZA 5BO5A 3V1LA 5JECA 4U7TB 3KFVA 4Z1MD 3VUEA 3Q8MA 2BN4A 3O2JA 3R7AA 3JQ7A 1LSUA 4EJ0A 1TPYA 1BH2A 2IU4A 1JHDA 2HO4A 4RLHA 2O2DA 3C5EA 3MINA 3I9V6 1E9BA 1UJ4A 3GUHA 4RZQA 5DXJA 2C1XA 3T7IA 3KP1A 4GNKA 16PKA 1JKJB 1XRLA 2F62A 4DILA 4URUR 4ZPJA 2CXHA 2QORA 5NULA 3UV3A 5K8LA 3N8GA 3BWCA 6Q21A 4MW0A 3CTPA 4J2TA 1H2YA 1L4GA 1U0GA 2W0SA 3G88A 3CH4B 2NZ8A 5IP5A 1L8XA 5EE3A 3TTYA 1AHHA 2CF5A 1NJ8A 2GETA 4QGBA 2EBFX 3KEOA 1BJTA 4EB0A 5IJWA 2Z2IA 4HUJA 5JG7A 3IUQA 5CFOA 3M8KA 2PN1A 2Z2ZA 1B8NA 1M6HA 1WVGA 4PPFA 1YL6A 4CXMA 3SBEA 3SNHA 1TF2A 1UJNA 1Q1GA 2RONA 3D1LA 1U3UA 5KYWA 1QKJA 1N0VC 4MJLA 1AKUA 3C41J 1F1JA 2RHDA 3JQ7B 3JYNA 4ZGBA 3D6JA 3LWNA 2IH5A 3HJFA 2QU8A 3ZHXA 3TD9A 3MERA 1CR2A 2XTZA 1TIBA 3D4PA 1DE0A 1E5TA 3OZXA 5AO9A 3P9RA 5EYPA 4B09A 3KEFA 2C7RA 2G1PA 3MTEA 5T41A 5A5GA 3OFSA 4RCZA 1RWKA 4P5DA 5M04A 1TJPB 1KBOA 1WPRA 2IEIA 3HN6A 1FXSA 4LHSA 4AJ2A 4KSCA 3VDQA 4J9VA 1L7NA 3C3JA 3PWTA 2PL5A 4O08A 2VHUA 5FH9A 2ASVA 2AD1A 5ELXA 4RZ2A 4C76A 3WKDA 2HA0A 4IIBA 4JLVA 3SM9A 4Q82A 2QV7A 1QLWA 3JAKB 3U4MA 5JAOA 3ZWCA 2FN3A 3PEEA 5EE5B 4CV2A 1P29A 4D92A 2QXTA 5IS2A 4G5XA 4CM1A 2JGLA 2OAEA 1DO8A 1RAGA 3DE7X 1H9CA 4WKGA 2C7VA 4MS1A 3FKJA 1X39A 1IHOA 3DMFA 4KRGA 2IQ5A 1VP9A 2LPMA 5EIHA 1KJ8A 1UOQA 2YZ2A 4H7DA 3PENA 3GMTA 2DHRA 1EE9A 1IXKA 1C4OA 1UXGA 1NOJA 5D84A 3FTCA 5I5GA 2OK7A 3OZIA 5K0BA 4NDNE 3BHIA 1QGZA 5CT8A 2FTKE 4RSGA 1LKZA 4R2HA 2A3RA 2EP8A 3C1OA 4GR4A 4X95A 3RIEA 3MT0A 3PGKA 2X5NA 1OXBB 2EGGA 2IYVA 1O6FA 4B80A 3NV9A 5BR1A 3KHUA 1BCSB 1PYGA 1NM5C 2GBLA 1PBNA 1RWXA 3OBIA 3U39A 2MSNA 3H8SA 3L6CA 2IYQA 2RB5A 4NONA 3IBCA 2GNOA 5F3DA 2K5UA 3TPZA 1W0JA 2QLNA 4QRHA 4A8TA 3CO5A 1DAIA 1QDLB 5DBHX 5SY6A 1OU4A 1ZH4A 2I4TA 1PG5A 4KR3A 2VS1A 4YT8A 4ZZ1A 3BAZA 4E2XA 3M4YA 3M6MD 1D4AA 2CB9A 4P33A 4OSPA 7YASA 5K2MA 4TWIA 1N6NA 3HSYA 3K5WA 5G2OA 5JCZA 3JQDA 1Y0BA 5DI3A 5HUQA 3KQPA 1P33A 3E3MA 1M74A 2KI5A 3RK0A 2DH5A 2D5BA 3MTBA 5LNK6 1UBEA 2PL9A 1B26A 3WK7A 3IE1A 1J00A 3IMFA 2CDNA 3HFRA 1E1DA 2JLYA 1F4PA 1A2KC 2P9GA 2CB0A 1RZ3A 4G9GA 4BJHB 5FL7D 3SM3A 3H86A 1RKVA 1ZU5A 4JVOA 3JZFA 4QULA 1CZOA 1LY1A 3TQCA 5H3CA 4P58A 2GA9A 3AFMA 3VH2A 3ZVLA 3KVRA 4CBVA 1CQJB 4I1IA 4QM7A 4R1QA 4D99A 2ZUBA 2ZUFA 1QIJA 1RRFA 5TMBA 2IUYA 2IYYA 1VE7A 1K98A 1NVUQ 2CUNA 3C98A 1SC3A 3GVHA 4JL5A 4YUVA 1U65A 2PX2A 4DG8A 3F6BX 5HUHA 4B8WA 4DADA 2IYWA 3T5CA 1YS7A 1XQXA 3IEIA 1GA1A 1GCUA 3OU7A 3BTVA 3G1UA 4RA9A 4EPYA 2YZNA 1KMHA 1FQJA 1TO2E 4DXAA 1TCCA 2CL5A 1EKXA 2RI0A 2B8NA 2XA1A 1OH7A 3V3TA 4A27A 1NVVQ 2I0FA 2X58A 4NAVA 4HH3C 1K92A 1M66A 1Y98A 3WI7A 5HYVA 2DQZA 3G7SA 3D0OA 4YFVA 3C3PA 2R5NA 3CB4A 2H2IA 3FUVA 5HBGA 4G84A 3B6IA 5ALWA 3IQEA 4JJZA 1L7PA 3PWZA 5EZ6B 3W8EA 4D9EA 2Q5EA 2F9FA 1BE1A 3LYLA 3B9RA 4Z9YA 4ND2A 1SN7A 3G13A 3MRTA 4F9EA 1GPKA 4BBPA 1QZUA 1RAIA 2HADA 2G77B 2JCXA 3GO4A 2PBZA 4RCVA 1I94B 1GQYA 3EGVA 3K1ZA 2VN8A 3IHTA 1J8QA 2AOWA 4RJ2A 1T9GR 1W2WB 3I9V1 3QLTA 1GDHA 1I4WA 1U8AA 2CUKA 3AB8A 2IPXA 1YIDA 3G2MA 3OOHA 3ECCA 2WJ6A 3TTTA 3NJRA 4UUAA 4G8CA 1ZI9A 4A6PA 5JH7F 5JI2E 3F73A 3OURA 4JEHA 3UUGA 2QAJA 3RRMA 1QHNA 4BZPA 1OYVA 2JJ1D 1W44A 3DOFA 4ABYA 2I2FA 3MQ4A 1E7WA 4JSRA 5HP4A 1Q7BA 3HLYA 1SUBA 5AHKA 1VA5A 2BT4A 2P2SA 3DVRX 4LE1A 5LIRA 3IEMA 3VX3A 2QG4A 2ZAGA 4F4DA 5CW2A 4B3XA 1PT7A 2FR8A 1DAMA 4I8IA 5JCXA 1HDOA 4G0YA 4MNTA 4WW0A 4KQHA 2ZR9A 3M6IA 4FGKA 2GLTA 2G9QA 3A6LA 1W2HA 4L8LA 4R31A 1WAMA 2Q4OA 3NXKA 4KPGA 1BWQA 2VT7A 1R0XA 4QTZA 3A0RB 5AHXA 4ARBA 4C0BA 4YUAA 5FJJA 1WUIS 1FP4B 1ECJA 1QTIA 1SKYB 1YA8A 4YUYA 3QJGA 3AVQA 4RD2A 2EFEB 4LVNA 2CFIA 3ZE2B 1STOA 1V2HE 5HEKA 3WK9A 1VIYA 5BNIA 3K9GA 1NKSA 4MV8A 2HA5A 5CX1B 2R1UA 2VNHA 4KKXB 1EM8B 4MWBA 1BJRE 4DM4A 1BS2A 2AD5A 4YP7A 4AKTA 4LG1A 2BM9A 4R7ZA 3ZV7A 1R4NA 1D1SA 4W5HA 1CSEE 3ZU2A 5JFOA 4WVLA 1RI4A 4A0GA 3EZ7A 4A2CA 4DIUA 1E3WA 2C82A 1XD2B 1C3JA 1BTOA 5DW3A 5P8WA 4JBYA 5BN4A 1V39A 4R51A 4V0ME 3W2EA 2XHEA 1PR1A 1WF3A 2REBA 2VL7A 3RU2A 4YMLA 3HVHA 3GZNB 5LA6B 3E8SA 4DPLA 1U6KA 3DZIA 5L4LA 2G1KA 4TKUB 1NE7A 3HUFA 1YE8A 3DFMA 3HRIA 5AIBA 2XQIA 2ZWPA 5H4GA 1LSOA 1O89A 2R6DA 4RXMA 4ID9A 3IDZA 4RABA 3KL4A 4YP1A 5AYVA 4D4MA 1H2AS 3G0BA 1F38A 4NHEA 3Q72A 1FIUA 4QDJA 1JECA 2EQ5A 4MPRA 1VHJA 4JP8A 1XRPA 1H2BA 2VDLB 2R87A 3WNVA 1XEWY 2XUPA 4KN5A 3NEPX 1V7ZA 5EZ5A 3OX3A 3EODA 1LBSA 6AT1A 2YV4A 4Q19A 1UM9B 2CNWA 5ESWA 5DKFA 3KYCB 4X60A 3Q8WA 3J7AC 3M0EA 2YYZA 2ABWA 3EVGA 1OKKD 3PDWA 3X2FA 3UMMA 2BH2A 2J0EA 3SS7X 4KLNA 1NNLA 4MDEA 4TRJA 1W2GA 1UMKA 1ULBA 4MV6A 2OG2A 5F5XA 4OQEA 5HZMA 5TEVA 3AEYA 1K0UA 3BM5A 1RQGA 4JDUA 4P22A 4FYYA 3EPRA 3FG9A 3HXTA 2HU2A 5JVDB 2W11A 4JI3B 3JALA 1I24A 3CINA 3WYGA 3KYJB 1VMKA 2AUMA 3OLVA 2F1IA 1MO3A 4JB0A 2EP7A 4M7WA 2FPRA 1ZLXA 1F0KA 1BEUB 1QFJA 4JKYA 1Z75A 2CLFB 2QUAA 5KAPA 4B32A 1N1GA 5DCYA 1CW2B 1HZZA 2WHPB 4QRDA 4QHYA 2G0NA 1ABEA 2FN4A 3EGDA 4K6MA 3WGLA 1PR5A 4H60A 2C97A 3T95A 2QTTA 3TI9A 2KBEA 2XBLA 4YPVA 1YVDA 4EPRA 4LS3A 1LI7A 5JARA 1M8FA 1KDTA 2PQ2A 2QMUA 2ZRFA 3KBBA 4OXNA 1I3NA 1Z6YA 4TS4A 3I2JA 4EMUA 5CGZA 1RWOA 1TIPA 5A9SB 1XD2A 1C4KA 1KQOA 4R9SA 1KJNA 1P39A 5AM2A 4O5OA 3A25A 1ONPA 3DO5A 3WSWA 4Z53A 4GOND 4DIFA 2WJVA 2X8LA 5I9TA 2K87A 5KJFA 1TYBE 4EFNA 5DWVA 1OX4A 1TMYA 4R2MA 1DHRA 4RTRA 3DT6A 1ODFA 1S2IA 3PVCA 3GFSA 3GLGE 3M2PA 3LQYA 1C4XA 2IYZA 4RJTA 3C3EA 2YY6A 1SVUA 3ASYA 1DG3A 4GPAA 4CKWA 5KDDA 1NR7A 1MB2A 3ON5A 4CMAA 2XQVA 3GJRA 1PGJA 4INPA 4ETNA 1CF9A 1OFTA 1M34A 1BVHA 3CJTA 1X2EA 2B1IA 2CMHA 3P0IA 4HB2A 1IM8A 4XUEA 2BMEA 1IEVA 3S6JA 3AV0B 2RB4A 3T61A 1ACMA 3EBPA 4NYJQ 2EL7A 4DV4B 1B15A 1KH3A 4LZJA 4MKHA 4UNNA 1LFDB 2P9JA 4K1XA 1KO4A 4LMRA 1VMDA 3AR6A 4OLHA 4JSTA 4Q9HA 4YRQA 5CTAA 2C0QA 2I87A 3GFOA 1UINA 5CIQA 1GSIA 4YWHA 2O5EA 1RACA 4CHGA 2JAWA 4ZD6A 1GQFA 4GMXA 1C1HA 2P75A 2VO1A 1S7GA 1SBTA 4RDHA 3VR4D 1R4ZA 1ESCA 3HR7A 1UJMA 2CXQA 1SOVA 3KXLA 2AOXA 4XWKA 5EHXA 4HDMA 4S0ZA 1Z15A 1J7KA 4UAVA 1JSRA 3STWA 3WTCA 3WZ2A 1AA6A 3ND5A 4FDAA 3HN7A 1GAWA 1KSHA 2YN0A 5JZOA 1MDBA 3V80A 5JOQA 1E1NA 2GHIA 1T5LA 1DAHA 1P3JA 1FS6A 1YU6A 5KIAA 3QE2A 4P81A 3WR5A 3D6HA 3LC0A 5JAMA 3KWFA 8MHTA 3DR3A 1AGRA 1QAMA 4R1LA 2ST1A 5LNK1 3L84A 3U26A 1Q2UA 2VSYA 4TQUS 4HRYA 4A3SA 4XYLA 4WLOA 1EVYA 3KJHA 4LMAA 5K0ZA 3IDQA 2NSDA 3KETA 3ESYA 3I5XA 2YX1A 1OHHD 4PRLA 1V8DA 5TQVA 3QX7A 3FGPA 3IB6A 1N6OA 1UR5A 1LF0A 4YAEA 4M1TA 3FSGA 3UM9A 1G6Q1 3QA3E 3D0RA 4PONA 1T4CA 4WZBA 1HDEA 2QM3A 4M55A 4NF2A 3REQB 3IAXA 3U2QA 2HMAA 4OU5A 3DKIA 4UC0A 2EXXA 2PR7A 3AUAA 3W5BA 2HH9A 3EMVA 1MAAA 2HBQA 2R97A 3LC2O 4FQ8A 3JQBA 1CHDA 5AK3A 3HE3A 3ND9A 3VPHA 4B85A 3ZE1B 4EVIA 1JQJC 3TDNA 1JRLA 4KR6A 4QTYA 5A5EA 4HZUB 3AR8A 4YWJA 3FJ1A 3ONEA 4ZU3A 1FSGA 2ZEJA 5HMMA 4KPYA 4L3VA 4Y67A 5HS4A 2PMBA 4ZCMA 2ZAYA 4MQUA 1PT9A 1U6JA 2C58A 4FVTA 1DEHA 2O48X 2EWMA 2IYFA 1GILA 3QKRB 3TNFA 3ZCSA 5A2GA 1OB5A 5LXTF 1QF6A 3MRXA 2CJWA 3COJA 3TLBA 1YS6A 3W9BA 2XNDA 3BMQB 3LWDA 2X0DA 2XQGA 4KQKA 1YB5A 3MLBA 5TQ2B 3EW9A 3OZDA 2J4DA 3UA4A 1T4CB 5JY1A 3V8QA 3VYTB 5A5VA 1EFRD 2RAPA 3T41A 3IQHX 4Z4GA 3ENNA 4E6PA 3KLOA 1AXEA 2R25B 3D2BA 4C88A 1K7SN 4JX9A 5L4SA 5EPUA 3GJSA 1MABB 4BE7B 1E59A 1B00A 1LLCA 3IR6A 3FTNA 3T94A 2F2TA 3Q8KA 4N8EA 1RC8A 1L4KA 3DNPA 4C4SA 3AQ4A 3LXMA 2PD3A 2XUHA 4Y9RA 3SSMA 2A67A 4B9EA 3H8VA 1N5RA 2SNIE 3LVRE 5AKLA 3A1VA 4JQYA 5CGQB 2QRVA 4ED9A 4LV5B 1ULHA 1Z4JA 2XUAA 1GG9A 3LCRA 3AX6A 3KYDB 2EJTA 5JQGF 3P4UA 2FPOA 1A4IA 1UT8A 1ZNQO 3EWNA 4PPYA 3RSSA 4BNYA 1U8YA 1N33B 1QGAA 4DDKA 3F5QA 1Z8DA 3ZXSA 2FPMA 3QFFA 5AICA 2YNMA 3FVWA 3QVOA 1AKEA 3AI7A 2ODPA 2W6ID 3PFWO 4IIHA 2PPLA 3WBKA 1I7QB 1I1QB 3MJTA 4BMCA 2UVDA 4P83A 1Z7EA 3D8HA 2AI3A 3QPUA 2VDMB 5GZ3A 5KYKA 5MN4A 3WGIA 3K6JA 1T8TA 3C0KA 1M5RA 1UWVA 1C41A 3VPSA 3S2FA 4YO7A 2NUAA 3TTWA 5IZCC 1DS6A 1ZOSA 4BZWA 1V9LA 3KAQA 4RV5A 5TEWA 5JEDA 4BU0A 1C7FA 1CG6A 2GM9A 2H4HA 2XNCA 4N6NA 4BASA 1UXJA 1XTZA 1AZTA 2B83A 4E5DA 3SQOA 1KDYA 1QE3A 1FMJA 2VYCA 5AKIA 2R6FA 2K6GA 3INRA 3PQCA 5HJ7A 1QFYA 3EIOA 1E4YA 3W78A 2VNKA 1EDDA 4K46A 1L4EA 5LLTA 3D5QA 4HWOA 4M76B 2PYZA 1C9NA 2ZBVA 1GN9A 1HNXB 5EY5B 1QCZA 3KCQA 2IUUA 5F9MA 4U7FA 4H6XA 1M75A 2BH9A 2Q1UA 4DV5B 5JNWA 1PJ2A 3A1EA 4ARAA 1E1MA 3B1JA 1A9PA 1E4VA 4IIDA 4YCDA 5EP2A 2O3SA 3CU5A 1RABA 3JATA 3V8MA 2E48A 4DSOA 4FIDA 5F78A 1BRMA 2PKRA 3ZY4A 4OV6B 1A82A 2I7CA 3PJFA 5L51A 4KREA 3GLTA 1N2JA 3QU4A 3TBKA 4Z2YA 3RGWS 2J3KA 1ISHA 1YS2X 4XWOA 1HTWA 3AJDA 2F3RA 1Q16A 2VUUA 2QW8A 1NYQA 3GIDA 2UDPA 4TMTA 2ZRCA 1S2LA 4N01A 4K9KA 3WWYA 3BK2A 2G4VA 3O2NA 3OOEA 4PGGA 4Q3CA 3TGWA 4DIEA 3QI2A 4DLBA 1TAQA 5D3MA 5BN5A 2WKQA 3NI2A 3RU9A 5IDYA 3W9YA 3L02A 4X8OA 2ZQ5A 1NTOA 4Q1EA 3EZ9A 5CJPA 3BILA 3UPUA 4NIMA 3IP9A 1OC2A 2I33A 3SBXA 3TIGA 3W79A 2PZBA 2WDPA 5B2FA 1IU9A 2Z83A 2XUJA 4I1YA 2GESA 1MQ9A 3HWWA 1Z0JA 1A7JA 4UDNA 4NDZA 1NWCA 1B14A 1T2DA 3KZOA 1NASA 2OBYA 2QVBA 4ZVQA 3PRKE 2AKEA 2D1RA 5H9VA 3BJMA 5TR9A 3ENWA 3MIIA 1Y5RA 3CEJA 1Z73A 1NDUA 2ZATA 4BHTA 1YD7A 3LUCA 5SYNA 1JFFA 1UAGA 1CUYA 4NESA 5EFZA 4LJKA 3O9MA 3A6PC 2VPQA 4RNDB 2CBXA 3OZFA 4HT3B 1BMTA 3I8XA 2VJMA 1DCKA 2ZBGA 1JQ5A 1JV2B 3HXLA 3DLBA 2O57A 2ZSEA 3KWJA 4OKIA 4BGDA 4I4IA 3THYA 1KYXA 5DK6A 3ZHOA 1UOEA 2JVJA 1PJLA 1U1CA 3OCWA 4XDZA 1QHYA 4GZLA 4C43A 2ATCA 2GX6A 1DOZA 1S4QA 1SC6A 3QEBZ 1HDZA 2RGNA 3F5SA 3O1IC 5JDCC 1U0NA 2J3MA 5EPOA 2SECE 3OM8A 5ELMA 3IODA 3D1JA 3W4KA 1O4WA 4LSWA 4C7XA 4O0LA 2X2EA 5JEEA 3I6MA 3BAFA 3IKVA 2I3GA 4LJSA 3T4XA 3UTCA 4R2JA 4KAAA 3IAS1 3ZU5A 3Q11A 1CUSA 1Y9JA 2Z2JA 3U44A 5AVVA 1T3TA 1H6AA 4O4JF 2OHGA 1PJQA 2DX7A 5CA0A 1Q0SA 2C59A 1GAEO 1RXUA 1ODSA 2LCFA 2YNMD 3PXCX 3IKLA 4I55F 3WKCA 1NG9A 4LY6A 2ZCJA 4OGGA 1Z63A 2Q6KA 2BFOA 3GPIA 2I1LA 4PZAA 1KOLA 2YQ5A 1DIOB 4YCNA 1E2PA 1AZSC 1P74A 3C7AA 3KR9A 3ZGLA 1LFAA 1ULAA 4DGSA 3MBOA 4YRIA 3IVRA 2RC6A 2MJLA 1XVTA 1HUQA 1LBEA 2C4HA 5DN6D 2XT0A 1T24A 2X1VA 3EGOA 3K0HA 4LBZA 3DTVD 1SCKA 5J58A 3H2HA 2ZPTX 1QIEA 5GJCA 2HX1A 5C8YF 2H3HA 5K4AA 1HLFA 1ZIOA 3CNBA 5FOUA 1H2HA 3LY9A 3BHMA 3Q5EA 5DEOA 1Z6PA 4IKPA 2NTJA 3PX3A 4ECAA 5KQSA 1OWNA 4MIYA 1UDXA 3CMMA 1KZ1A 3QPBA 3CSUA 4ZVNA 5LR6A 4BKPA 4ZALA 1V16B 3KTAA 1N77A 3HB9A 1EFRA 4N1AA 2JGDB 4AJEA 1EEXB 2UUCB 1AH2A 1I4DD 2H2WA 3WGHA 2G4LA 1RJEA 3NDJA 4QO7A 3GCGA 3SHVA 4DDUA 4GG1A 2NQTA 2AQKA 4FFMA 4AROA 2FKNA 5THQA 2AHRA 2J59A 3AT1A 4PYOA 3SF0A 5L40A 4JZYA 1A04A 1TTPB 4FUQA 3TM4A 1E8DA 3UJCA 4M1MA 4TM7A 4EBFA 4CT4B 4M0DA 3TTVA 2XWSA 4ANFA 1K0FA 4OPMA 2YWDA 3SIXA 3EY9A 1BCRB 2E4VA 1K66A 2WA2A 3QLVC 4FKBA 4JOCA 5ALMA 3UG6A 5I48A 3UHAA 5BNTA 2HA3A 4B48A 2PL3A 3QBEA 2PZ8A 3EBOA 5HIKA 1W1IA 4RY9A 1L4HA 2GUGA 1CP2A 1YRWA 2YNMC 4F4JA 1G291 4QARA 1DEAA 1XZDA 3SHQA 4CF6A 4NMWA 3F90A 4NZNA 3ABSB 3DM5A 1GG5A 2FI1A 2XDYA 4GKBA 3U31A 1S01A 2Z5LA 3BVPA 3U80A 4MMXB 3LCVB 4M8IA 4JJGA 2VNSA 4O33A 4X1OA 2ZGVA 4RTLA 1URPA 4P7GA 1J70A 4GMDA 3GYGA 3NH6A 1FNCA 1PYDA 4GWGA 1JQEA 1RM3A 1U9CA 4RYLA 1SVKA 2YTZA 2ZFUA 1T6BY 2IUEA 3A36A 1BOOA 3MINB 3PE3A 4LHEA 4ZIRA 3T1YB 5IKXA 2QRGA 1ZL2A 1XHEA 5G41A 2AG0A 4CCYA 4LWQA 4RNCA 2ANCA 1L5WA 2QYSA 5HKKD 5HOQA 4JI4B 2IS6A 2EERA 1G6OA 3T1TA 4G36A 4MV0A 5TMEA 2IGTA 3B2NA 2NO0A 2PWAA 3OTQA 1SY7A 2IYAA 2PH1A 1L6IA 2DECA 1B7GO 1U99A 3HS3A 2AE1A 1HFKA 3HI6A 1ZRHA 4RK6A 3NCTA 2WWXA 5BPHA 1SA0B 4IICA 3SQXA 4GOMD 5FBHA 2JGKA 1XRRA 4NE2A 4BBZA 4KCGA 4KFUA 1T4BA 4MS4B 1T0JB 3NM5A 2CL0X 1VPLA 4IIEA 5B3JA 5TRTA 1QO9A 3A11A 2X13A 3VVBA 4GL2A 3DLHA 1C2YA 2VP0A 2XBMA 3UKJA 1PQUA 2OZLA 5A62A 5F1OA 3T4UA 2HQ1A 3B6MA 4ZYVA 4FN5A 3EXHC 4JELA 4NCXA 4RM2A 1KJZA 1OPRA 1XZJA 1IJBA 2BP7A 2P5YA 2ZYAA 3EY4A 3H1AA 4KQWA 4HB4A 3U5ZB 5AH0A 1SR8A 3B1YA 1FCJA 4XR9A 3VM6A 4AWXA 4BAUA 1HT0A 5AOVA 2GHQA 4RKQA 2G25A 5LLDA 1V6SA 4WCVA 1CPYA 4PG5A 3ASVA 3I5UA 5ALSA 1Z22A 1SZJG 3M9XA 4ZK2A 3ROGA 3JD4A 3ENKA 3E9RA 5AMXA 1EVQA 4BV3A 5T4HA 2JLQA 3H18A 4X85A 1ZZGA 2IKSA 4DGQA 4Q05A 4KH1A 3CRNA 3WLOA 4HGPA 5DP2A 1F7VA 4Q6BA 3W06A 4Z4EA 3BFVA 3VTFA 3B38A 3RFCA 2YZGA 3R0ZA 2D1TA 3RSZA 1P8JA 3WOVA 4AY4A 1HT3A 1HE1C 1G2IA 4AZSA 2NACA 3NT5A 4CIVA 3A1TA 4DC1A 2QN7A 1FYWA 3PXEA 4I9NA 3QEMA 3H65A 4LY0A 3A2LA 4BX3A 4W5RA 2HHHB 3JQ9A 3GEHA 3OC0A 1K89A 4MUMA 4XQEA 2O8CA 3W0LB 4DB2A 2OHOA 2V9ZA 2FWIA 3H4VA 1A76A 3P0EA 3TIVA 1YQ9A 1L2TA 4ZJYA 1LX6A 3UWOA 4BY9E 3KKEA 4QHSA 2QGNA 4AMVA 1MF7A 1P5ZB 4PSCA 1PNQA 4AMUA 1WM1A 2RG1A 1XCPA 3WWEA 3I9MA 3GDFA 1QGUA 2IEBA 3I4LA 5KTSA 2QIOA 4Q00A 5ADUS 3F1LA 3OE5A 2EP5A 4WBSA 3S8YA 2Q6IA 3HVUA 2ZI5A 2YMPA 1L9KA 3C43A 2D2FA 5EWMA 3BJZA 3BFPA 1XRNA 1N4DA 1NBWB 1NAHA 5AJWA 3G89A 4C6TB 3DJFA 2MR5A 3FI0A 1T4MA 2HBYA 1W4LA 2KMLA 3BE6A 2CL6X 2JKVA 4HLUC 1IL0A 4IDHA 4K6KA 1I7LA 1I4OA 1KDVA 3VR1A 2RHRA 3J81A 1NQXA 4B3SB 2ZBEA 1Q0LA 4M1OA 4TUYB 4CGZA 1XKQA 3VU8A 3WHIA 3U40A 3FYSA 2DTXA 2NXNA 4I50B 4G1MB 2C61A 4MQFB 1QRUA 1BNCA 2NQ2C 5E7QA 2NZYA 3LUAA 5HDQA 1UK8A 5IK2A 3ZDZB 4FZJA 1EVLA 1LK5A 1NUHA 1SQFA 4DA7A 1G4UR 1BX1A 1LVUA 1EE1A 4DWWA 3OO0A 5DMHA 1F8XA 2AOTB 1XJCA 3NDIA 5HF8A 1J4AA 3GLQA 3OOSA 1N32B 3O8QA 4MJ7A 4ZANA 3O95A 3RDPA 3SEQA 2DXIA 4LF4B 3O1JC 4ISCA 4Z4HA 3RQIA 1XTVA 4ZV7A 3ZTTA 4S04A 4LF6B 1N9KA 2IGBA 3B1FA 2B9VA 2Y2VA 4HADA 4FSHA 4WBNF 2XAAA 1FP2A 2OP1A 4UOEA 2B3DA 4RH0A 4BFWA 2LXNA 4BAGA 3QHPA 1A71A 3QX8A 1LPNA 3GRRA 1GNTA 1FYFA 4HZGA 3L0DA 3UWPA 3MWYW 4WVFA 2NP7A 4S1WA 5A7FA 5K3BA 3KKOA 3HXQA 5JNSA 1NBOA 3D0KA 3N0RA 3C3MA 1KFBB 2GBPA 4HRVA 1IZZA 1MV8A 3B6ZA 3BK7A 1MG5A 4MH0R 4DV2B 2MINA 1ECLA 2C3OA 4LBVA 4KR0A 4P3OA 1XEWX 2IPMA 1JJIA 3DZHA 2XCLA 4ZMRA 5K0TA 4DSUA 4JMLA 3RS5A 3SZLA 4PGAA 1E89A 4PFSA 2HJGA 1PN3A 2PBFA 1O7JA 3SC3A 3BIXA 1ULZA 2QM0A 3WLIA 3M3PA 2FSVA 5JD3A 4BP3A 1GGKA 1FSSA 4ZP1A 4JYMA 1MJNA 1ZW6A 1IXYA 4JODA 4JYAB 3NRCA 1RLMA 3D81A 3EC2A 1J6UA 2VC2B 3P0RA 3LBAA 2H0QA 5BT9A 1JI0A 2Q3DA 4Z8XA 1GUZA 1ZH0A 2OZVA 2ZYSA 5GJBA 3UA3A 3DBRA 4E2WA 3WSTA 3DVQX 4ZMSA 4ZDIA 1LS1A 3FN4A 4MSUA 3OQ6A 1DC8A 4EZEA 1WWKA 1W36D 1B0ZA 2XMSA 3OMLA 2QUKA 2SHKA 3P9XA 1BQ4A 1VI2A 2VH2A 4R8LA 4XEUA 4D9IA 1E3JA 2ZANA 2NAFA 1GTJ1 4FX5A 3G2OA 1H66A 2IHYA 4PZZA 4F97A 3U4GA 4G0OA 4G5YA 2J6IA 1H1LA 1TFUA 2VOJA 2N46A 3LPNA 3CUTA 3FBGA 2HW8A 1X13A 2LUOA 1GCOA 1SH7A 4FZVA 1LZLA 3LHKA 4DBLC 1TUEA 2PZGA 1PSDA 1ICEA 3ILHA 1PFYA 1TCBA 1UBGA 2CLCX 3QK7A 1RKQA 4TMFA 1IEQA 5EJAA 2C3UA 2Q3CA 1RQ2A 1QAOA 2IBTA 1TZBA 3IEUA 3EWSA 3KHTA 4P82A 4PO8A 3A9WA 3EQ9A 4GOOD 2OFWA 1A9QA 1K2WA 2X2PA 5COQA 1S8FA 3PNOA 1CYEA 2WF6A 3NATA 3GUVA 2IP1A 3KYBA 3LLVA 4GYKA 1AOXA 2YVLA 4UNPA 1Q11A 1UJBA 5JJLA 4D7AA 3SQWA 4W1QA 4QFMA 4QFBA 1XRSB 4R1MA 1E7SA 1TGVA 4DT1B 4EUFA 2B1JA 3GLFB 1RFLA 1RW4A 4B2LA 1G20B 2EWWA 4LWPA 3D3KA 4Y2YA 4EG6A 2XJ4A 2Q2NA 2MT9A 1IVNA 3K70C 3KSUA 3KOXA 4DYHA 1WLSA 3OQOA 1DKUA 3RFFA 2C2ZA 3GP5A 1VJ1A 3HMKA 2C0CA 1L7QA 5CW1A 4GGPA 2ZSBA 3GJQA 1KQNA 3TNYA 2XKJE 4CCWA 4NV3A 4F1JA 1OW3B 5CFNA 4L4YA 3M1IA 1O94D 5IKOA 5KREA 1WOYA 1YL5A 1Y1LA 3OT5A 5E6SA 5HKLA 1A1SA 2X9NA 3AF5A 3U3ZA 5BMVF 3JY6A 5IK2D 5ALZA 3UFXB 2EDAA 3FIJA 4M38A 3PWSA 4GU5A 2BFCB 3O93A 4MS4A 2OK8A 5H3HA 3H5IA 5DH9A 1X1RA 1ML4A 1UC8A 2YQ4A 2ZJ3A 2RHGB 3IP6A 4I6EA 5GJVC 4BNKA 1HG1A 1CB7A 1QGYA 4HDRA 3FROA 1KI8A 5K0NA 4QREA 2EJUA 4GKKB 2YIDA 3RYHB 1XXHB 3ENZA 3UANA 1SEPA 4DCOA 2D2XA 3A27A 2WE7A 4ZHQA 4KGXA 1M1NA 4EBBA 4I55A 2O5CA 5CXQA 2BGGA 3TOXA 4BFXA 3RIXA 4EF5A 4HEA6 4GE3A 4PBRA 4PLTA 2M6KA 3RJ9A 5BVHA 1QQ6A 2YJ5A 4C2AA 3J80A 2DY1A 2CVOA 3TKYA 1QQ7A 2AFVA 4KE7A 3UMBA 4CQLA 1DEKA 5L6LB 4XA8A 2GN8A 1NVMB 2RC5A 4GZMA 4AC9A 1UDAA 2Y66A 3NO4A 4Q3AA 1V11A 2E4ZA 3BWXA 5LBUA 2DQYA 1E2NA 2AL7A 1NG1A 1OI7A 1RHJA 1F2DA 3X1MA 1QB7A 1QH1A 2WUVA 5FBZA 4HPWA 2ZXFA 3U3OA 4DR1B 2FK8A 4JBIA 2BY4A 4X44A 2JLZA 3ZCPA 4ZAXA 1PZMA 5CM2Z 1DL5A 1TDJA 2HD4A 3E1KA 4FFLA 1Q7EA 1E9CA 4BNWA 2OSVA 3QWAA 4OYLA 2WUDA 2ZWIA 3NW9A 5IASA 3A1SA 1H0KA 3ZHRA 2JASA 3HA2A 4CMIA 5JQGB 4P32A 1XV5A 2HFKA 2X9LA 1W85A 1CQIB 3HCBA 4HX2A 3GEPA 4JQCA 2VXYA 3TK1A 4TV9F 1SKYE 1UL1X 3KJIA 1P17A 2YWEA 1P0FA 2H9YA 2CMGA 4I9HA 1VSUA 1YJBA 2FP4B 4LA4A 4PLYA 1OYWA 1NM5A 4EW6A 4QOHA 4RVSA 4R0MA 3B36A 5BQXA 4D0SA 2HSJA 3EWAA 4QPNA 2ZB3A 3DEZA 2DPXA 4NH0A 3QV2A 5DDIP 1IWBB 4G1BA 4RZHA 4YJGB 2NVUB 1ZAKA 4RPHA 3ZWYA 3F3KA 3NGMA 1XA3A 4QG3A 2QYHA 2R5WA 3UMGA 1KI9A 1NBMD 2GZ2A 4ZI2A 2A94A 4DR6B 1P0CA 1AB6A 3QVMA 1V26A 2Q2OA 3KYIB 2W22A 1DKNA 4BFCA 2F55A 3K0KA 2ZJZA 3TG8A 2IJGX 3MFQA 1ESNA 1GRQA 4XB2A 1XFAA 2R8OA 3BJRA 4EKNB 1XXHE 2X7XA 3A6HA 3CIFA 3ZWXA 4WGGA 2NO9A 4HC4A 5LBTA 3C3XA 3V8VA 1CETA 1YKFA 1FE8A 1TI7A 3BMOB 4JT2A 2J9XB 4PRYA 4TSRA 4XIFA 2REOA 4HEA1 4Q4CA 1O96B 5K01A 1RYMA 4OXXA 2YYAA 4Q4DA 4II2A 3N2GB 4QTUB 4IJ5A 4X8MA 1J25A 1XCJA 3L77A 4KWEA 4WNAB 5FO1A 4BWYA 4RUKA 5KKNB 2PYDA 4I1SA 3NDBB 1J0XO 1RI1A 2CFSA 3UAXA 1NN3A 4KBFA 3WJ1A 4G8BA 5LIPA 4RIHA 1PSZA 2WJZB 3C24A 2WIFA 4OGKA 2WMOB 1NMYA 2ZETA 4IG4A 4N48A 1AB5A 1TOAA 4C29A 3JQGB 3BCRA 4PVCA 1H2XA 3T7RA 1UJ6A 4ZEOA 2C5AA 4CQMD 1KRWA 3MJEA 2JJ1A 4YFYA 1EAMA 1PW7A 4ZOBA 3PHIA 4B33A 2HM7A 1M8KA 3AHGA 1WXGA 2G63A 1EFAA 5H1YA 3PGMA 1DPGA 2CBZA 4QXOA 1NQUA 2PO5A 4EJSB 1V9SA 4F5ZA 3NANA 4FEAA 3QFTA 4OK3A 5JPDA 4ZXPA 1XTQA 3ABZA 5H80A 2ZPUA 2I2CA 4R2LA 3NP7A 3ZHYA 1NQWA 3ZK8A 3WGVA 2WIDA 1GQOA 4Q9DA 4Y6SA 1W0CA 3D4IA 4ETWA 4ZGGA 2BFMA 4HOYA 4QQNA 3MWEA 4B31A 1QC5A 3E9EA 4FINA 1ST3A 1EGVB 2FPLA 2QRZA 3UGQA 2CHFA 4UPVA 3RRBA 1QCDA 1R3DA 1IDN1 1R8QA 1I2BA 2BFDA 1JLSA 4OB7A 5AUNB 5HRCA 4RMHA 3SIWA 4XLZA 4PN3A 5P21A 3W6UA 2GEJA 3PPYA 1M67A 1J23A 4QIHA 4AMBA 4HLNA 3CX3A 4LJAA 4RTOA 3B9QA 1T36A 1JWAB 4Q1CA 2H00A 3O92A 1EK0A 3PC6A 3PICA 3RYCB 2IXFA 4JLPA 3SVLA 2O5VA 2ZYDA 4D3SA 2BFNA 4XQ9A 1KY4A 3HZZA 4QBTA 2F1OA 4QUDA 1OZHA 3B20A 2OV1A 2GGSA 2AR9A 3DZ8A 4HFRA 3CZQA 1DFGA 2D13A 4IHJA 4BNDA 5CFQA 3EEQA 3KB8A 4K88A 1FFCA 4IGAA 2JRCA 1ENZA 1MEEA 1C3OB 1XZNA 1I4TD 1GL3A 1EDOA 3GZTB 3KUUA 1FOEB 5E2IA 2ZT7A 1JDUA 4ZQCB 1AY0A 3GJXC 1G8HA 1KO5A 1VHQA 2ODTX 2W8BA 2YCLA 4Y6PA 2ZCVA 1F8FA 1ISRA 3PDCA 3BRWA 1U2ZA 3RAFC 3JQ6A 3Q40A 4BFZA 1B42A 2CWDA 3C8MA 4UM5A 5DLPA 1AURA 2PZJA 4FLFA 2H85A 3SI7A 5L53A 4FMDB 4CDNA 3HKCB 1LB1B 1U0EA 4K3UA 2B8WA 1CULC 1DMRA 3ODGA 4YN3A 5SZKB 3ZX5A 5I7UA 3CLTD 2DVMA 1TC2A 1U3CA 1MKYA 3ACDA 4OBBA 5B4TA 2R96A 3OZEA 3ZN2A 1F12A 1QZ3A 3OOJA 2M2IA 3Q0IA 5FF9A 1VCHA 4LPKA 3G2NA 4MZXA 4R01A 2X2FA 1JBEA 1YUMA 3L7IA 4LJYA 4R83A 3UQZA 2BP7B 4BVHA 4MHOA 1JHXA 4IF4A 1X1QA 5EIFA 5K99A 3ND8A 4DLTA 4RWZA 3U17A 1KY3A 2D2VA 3ITDA 4RZSA 5DSTA 2QD1A 1M5TA 1G41A 2BGUA 2LNDA 1RLUA 2XE4A 3G7UA 1ONBA 3I28A 4MVXA 4AJPA 4YUXA 5KKAA 1DJQA 1NW9B 2CNBA 1E3MA 1RHQA 4Q03A 4ON9A 3W8NA 1RHMA 4RMJA 2JK1A 4HQ0A 1ARZA 1FYDA 1QB8A 3K15A 1HPLA 1UOOA 1X80B 1U4NA 3E4CA 3V4OA 4DCPA 2P2CA 2PJDA 3UPDA 2ID7A 2GF9A 3KELA 5K8JB 1LSJA 3OT1A 4D6YA 1TJ3A 2GCNA 1UAAA 1A7KA 2OBXA 1DAKA 3K53A 4D4GA 1FRNA 2OBNA 3EXIA 1NI3A 1SMKA 2IBMA 1F0PA 1JZTA 3IIMA 3JRWA 1Y5NA 3CG4A 4R7TA 1RWBA 2NTVA 3LA8A 4ZO9A 5GVRA 3V97A 3ADKA 4F21A 3KQUA 4LF8B 2A1TS 3R3XA 3V4ZA 2Y77A 4XSGA 1C30B 1MPTA 2AYXA 5KSOA 1XU7A 2WLTA 5IVDA 3ZDFA 2JCGA 1UC4B 2IXAA 3H2KA 3NRJA 4TV9A 3IQFA 4Y2QA 2VQEB 3WKAA 1L5QA 3OLCX 2FXVA 1ZC3A 3T9AA 4MV7A 4REQA 4QJIA 1BHJA 3EISA 4MV9A 1VE3A 3VNBA 1L8OA 3V7UA 5IUJC 3OEHD 1WB5A 4YROA 2GYWA 3VZQA 1A9XB 1Q0TA 5JMPA 3VNVA 1GYPA 4RSRA 2QMOA 1RQRA 2F3SA 1CX9B 2NO1A 3C3BA 3H6HA 3PKJA 4B40A 3FWHA 1MOSA 1XMXA 4OK6A 2QW0X 5LP1A 5C52B 3MJRA 4I2NA 1W59A 2VRNA 3EUWA 4M2LA 4PR3A 4UAJA 4WZAE 4D45A 5ED0A 5KMGB 3THWA 3IBFA 2PO7A 5EYPB 4CM9D 1YB2A 4H1WA 1IYZA 3NGXA 3JQ8B 3GT4A 3S3TA 4Y98A 1J2TA 4EY3A 4Q9JA 5HG0A 1LNZA 4EL0A 3AUXA 5JI3E 2R0QC 4B3RB 3L4JA 2FGKA 5EMLA 2LBPA 1D2GA 4RWEA 5LZ8A 1N4AA 3R7BA 4M1QA 4MWSA 2AX4A 1FJHA 2CL7X 3AHEA 2AJLI 1S2GA 2R11A 3OZAA 2HXGA 3LG2A 1Z39A 3QJYA 4B3HA 1G7RA 2P2YA 3L46A 3FSGD 3PA8A 3ACCA 5F64A 4TSKA 3BSFA 2Q5JA 5T6MA 3G0CA 2FPIB 4B6FA 3PNKA 1DZ3A 2IUSA 3VVCA 5KYGA 1I36A 3OJFA 1NXXA 3NTVA 5A0TA 1RXWA 4E4RA 1ZRSA 2B37A 1JLMA 1SU6A 1M8GA 3TSCA 1QBKC 2WNIA 5EINA 3WQRA 1QYCA 1DOHA 2G9ZA 3V34A 4ESHA 2NU8A 2XCIA 1UT6A 3W5HA 1XEFA 1WHSA 1F4LA 2VTVA 5C32A 5BW5A 4C1BA 2VDWA 3KT0A 5LOVF 4W6QA 1FXWF 4GOKA 2R8ZA 2SBTA 3LLUA 3WLAA 1VI6A 3V48A 3IV6A 3KXIA 1XMQB 1YH3A 1ZUWA 3OQIB 4KXXA 4FC6A 4MRAA 1PTJA 4P3NA 4PXSA 4CJXA 3EFEA 5JD6A 1X38A 2NXJA 2WWHA 2W2PA 1VI5A 3BTOA 2GBFA 5A6SA 2ERXA 4A91A 4Z4QA 3SYLA 1XJWA 2FGJA 5CG1A 3WA6A 4U5QA 1NMEA 4NC9A 4JVLA 1JQBA 1NULA 1I2MA 2ZE7A 4CR7A 4FEYA 4ACAA 2HRCA 1NE2A 3VNAA 3ZBTA 2TYSB 3NT4A 2Q3EA 1Z2NX 3DBVO 1IZ7A 4RF2A 1WY5A 1LPPA 4J0DA 3NTUA 3CW9A 5YASA 1A9OA 2PSHA 5AXAA 4HWGA 1PFGA 3NYRA 3NOOA 3AGQA 2Y0CA 1N3IA 4JGIA 1CLUA 1CYDA 1Q0QA 2QBYA 2BHSA 5GJWC 1JR3D 1VRCA 2RBEA 2WWFA 5AI4A 2OORC 3SE0A 1POWA 3UYLA 1DCFA 4XZ3A 1GPLA 3WOHA 3CT6A 2ZI6A 4JLNA 1TK2A 3HLKA 4P80A 1N75A 3N07A 4I6JA 1X1AA 2I2BA 4RAOA 3RTGA 4EJSA 3MEQA 2NU6A 1SXGA 5CUQA 4OXRA 1HA3A 1A8SA 1FX0A 1PL7A 2J07A 3O8OB 4KLRA 3R7LA 5FBVB 3KDSE 4J7UA 4X1IB 1AUPA 2WF9A 2RI6A 3M49A 4OMCA 4Y6GB 4MGHA 4OUDA 4BWGA 4XGNA 2ZM5A 1G8MA 3IT3A 1XT6A 1V95A 3ED5A 1OSNA 3AC0A 4RY8A 5GPBA 1TM2A 4F45A 3NPAA 2Z5VA 4G0XA 4GSLA 4TLDA 1JU4A 3T3EA 3TZQA 4O4HF 4BMVA 1ZUNB 3AFOA 2PYIA 3EVNA 1WNTA 3JD0A 1FSPA 4G2TA 4MJ3A 4TWRA 3AB3A 2QLJA 5TPZA 5IXSA 3OJCA 3IRVA 3CKLA 4GGOA 1TVMA 2DGDA 3QVGB 1IQPA 3PE4A 4R1SA 3IJPA 1H2EA 3DO8A 4L07A 4LGYA 4IKOA 2ZBQA 4LX0A 4PYKA 2NP6A 5AVOA 4DT1A 1R0ZA 1NLFA 3NBYC 4U2CA 3SX0A 5IMSA 2IDZA 3E61A 2IS4A 4BBAA 3GUZA 1P0QA 2Z56A 2IYPA 3AY7A 4LC0A 1Z4MA 3BZBA 3Q8XB 4K2HA 1KDRA 1ONSA 3N2EA 1K63A 1TKAA 3RUHA 3JPWA 4V02A 4HDKB 3EF3A 2PWYA 2OEPA 3VSDA 3UT6A 1SFRA 3G2IA 3MPUA 2FE1A 4H7EA 3O7WA 4EKIA 1CNFA 3B5IA 3S2UA 3BXXA 4IDQA 5EIAA 1Y33E 2DCMA 2PT5A 5IWAB 5B36A 5A9TA 2CZQA 2OOSA 4URXR 1Y6RA 1CQWA 4X61A 3WLJA 5FNVB 2IHKA 1VJ0A 3GPCA 2DP4E 3LL4A 2DLCX 3AZOA 2QVZX 2XD9A 4F85A 4JNKA 2V45A 1H3EA 1NUUA 4FPXA 3KSRA 1JE1A 3GGDA 4IMRA 5KNCA 3KKZA 3AVOA 4HB0A 5TQ2A 1XP5A 4EHNA 1VL0A 4DLPA 4NMLA 5TV2A 3X1YA 4H7PA 2QLLA 4G8JA 5KYXB 3LX6A 4V24A 1EJ0A 1WKBA 1IHUA 4P4SA 4WJKB 3OCUA 2CVPA 3U1TA 3AONB 4F5DA 1US8A 1FDVA 2PKQP 3QVUA 4N8SA 4B45A 1C7ZA 3IAHA 4KFRA 3RG8A 3F7MA 2V59A 3WYFA 1W47A 4KH0A 1X2BA 2OILA 1PJTA 3VDMA 5LPNA 4LV8B 2X5XA 4FGJA 3RRNA 3ZV5A 4CVNA 1AS2A 1F60A 1TE2A 2JJ2D 4BWFB 3LUKA 5IT0A 4PZ9A 4BX9A 2BKLA 3IP8A 3P4XA 3AM3A 4PZEA 4QDOA 1RKBA 2FU5C 3PQDA 5FB3A 3EOBI 2IHVA 3ZQKA 2LWIA 1UBSB 1KXZA 2YJTD 3G5UA 2QZ9A 1E5DA 1WMAA 3M4ZA 4MKIA 3ZQ6A 2D8AA 1KZ4A 2VSNA 2FZKA 3EFOA 3OF2A 5DXAA 1T8SA 4DBLE 1YAJA 2ARKA 9LDTA 3V33A 3GRFA 2ZR8A 2BEUA 4U7PB 3EVEA 4Q7MB 2XVZA 3ZVMA 3M5WA 1IHYA 2UYQA 1ADBA 3L0ZA 4L28A 4QDKA 4AZ3A 4LXYA 5FTMA 4J75A 2WWRA 5CVEA 3UMFA 2D5AA 4K9MA 1VHWA 3COSA 1J97A 2VDKB 2PUTA 1JHAA 3AH8A 5TNXA 4HTFA 3CLTC 4HNAA 1V25A 2ORYA 2QY9A 5GONF 4WD3A 3CW8X 4UFNA 1EI9A 1YHNA 3TQOA 2HA4A 1CUDA 3UJ7A 2FH5B 2NAPA 3QEOA 1HM5A 3G23A 4EABA 4JGBA 2XXAA 3NASA 4BNLA 4ZYLA 4H4DA 2WJWA 3BQ9A 3R09A 3P2MA 4FMBB 4YJ3B 2KYRA 5D86A 4D8VA 4ZYZA 2VDNB 3OHSX 4M36A 2E2WA 4FQ7A 1QUFA 3U49A 5KQRA 4TUYF 3NHWA 3K2BA 4A4DA 3HL4A 3EWIA 3WDMA 2V9PA 2XE8A 2GZHA 3LCCA 3GI1A 5DWDA 5HF6A 1RE1A 1X7WA 3QEMB 1IXSB 4AG6A 4LYJA 1O97C 1FTWA 3PQ3A 1YC2A 2XMGA 3EZ2A 1F51E 3H11A 3LRTA 3NWBA 1GUAA 3B48A 3M1YA 2NM0A 2P6RA 1TTHA 1IG0A 2C4VA 4WTOA 1ODLA 2EQAA 1A5BB 3NGLA 4RVNA 4X24A 3RS9A 1XA0A 1H2ZA 3OTHA 3T7TA 4I8XA 3DO6A 3TLXA 2Y8EA 3UAVA 3R5SA 3QPCA 4L3OA 2ZSUA 3GHHA 4N9WA 3EOZA 5HHTA 4D80A 1R12A 4X63A 3DV0A 3MB5A 4MUAA 4O3MA 5FBWB 2R1TB 1XZCA 3LZCA 4JQSA 1CTQA 2G1JA 3GRAA 2NU8B 1Z25A 3A9TA 4H3HB 3ZEIA 1TZMA 4P0PB 5DNWA 4JEMA 5DTJA 4U2FA 1ORTA 3P94A 5A4AA 3EZYA 4FC7A 2AKYA 4M7OA 3WTBA 4EFDA 4X8HA 1KYWA 3FR7A 4FX2A 3S28A 3B1WA 4FGZA 3PHJA 1Y1TA 2PAFA 1C3XA 1GPJA 2HLHA 3OTGA 2P67A 2NN3C 4KIWA 3OWXA 4LDAA 5D6NA 2FEAA 3R8FA 2C7QA 4KR7A 1UZLA 1T5TA 2ID4A 2KE5A 3QQ5A 1FJ2A 1H9BA 4OP1A 3ISTA 2IIBA 3K0AB 5LA6A 4YRAA 3ONWA 2GPTA 2Y3IA 1Z18A 3CNOA 3W9SA 2QRVB 3I9OA 2YJ6A 3FRHA 4DJ5X 1E3IA 2ODWA 5DGIA 1JR3E 3AHIA 1LS6A 3OHMA 1IRXA 4EM6A 1RVDA 3K0CA 5MN5A 2FQYA 3GDGA 1C1XB 2C77A 3PCRB 4NARA 4FW9A 2J7PD 5E3JA 3E70C 2ORED 1AO3A 3CX8A 4CV1A 3P8ZA 1P5FA 1NPDA 3E23A 1NATA 1SURA 4IY1A 5B7GA 2PUDA 4E07A 3AFNA 5CMLA 1PLJA 3Q41A 5AI6A 5D51S 4BQQA 3I9LA 4NBNA 5KVCA 3SVTA 4OI1A 4REQB 1YU9A 2PMCA 2VBIA 5EQDA 1T29A 4PO9A 4R8RA 1UF9A 1NGSA 2EAUA 1XCLA 2VF8A 3HHPA 3FVQA 3UMSA 1II8B 1ZN8A 4JXJA 3K0AA 3PDHA 1T1IA 2IV7A 1XXLA 1BW9A 2G6TA 1UEJA 1DAOA 3B52X 5GADl 4PYMA 1CDEA 4PPGA 4C78A 3WK5A 1KYIA 4JUAA 3C8ZA 3E7XA 3SMVA 3W1WA 5E4YA 1OUMA 2O19A 1NBMA 1U80A 2PS1A 3A9UA 4D4IA 2P35A 4XJSA 2J1LA 4FR5A 4R2KA 3RVDA 3DVAA 4C08A 1YDEA 2F67A 4JROA 1IN4A 2HLPA 5D3ZA 5DV9A 4ZT4A 1OGYA 4NXNB 4OYRA 1OAKA 4NATA 1RCUA 5BOVA 5DNUA 2PRZA 3HJUA 3DP7A 2M6LA 3UMYA 3B3GA 3BWEA 5ALOA 1JQLB 3CKMA 4Q1AA 4RJLA 3TX2A 4RTQA 4KEAA 5BUCA 5KOJA 1XTKA 2IY7A 5LB4A 3IQDB 1EFTA 3OUTA 3T1OA 4V2IA 1ZO8A 2WBLC 4GIBA 2H8GA 3U7QA 2J9ZB 2J0SA 4F72A 2A88A 1KFCB 4QDXA 4CL2A 2UZ1B 2PJRA 1I0IA 2B2NA 4G07A 4XWTA 2C42A 4TVOA 3M9LA 1L5VA 4HXGA 3ZY2A 3H99A 1OJ7A 1SKQA 3V46A 2CLIB 1WO8A 1OXSC 2R5FA 4QTXA 1F6DA 2ZRLA 1KZ7B 1GTZA 2PIAA 5EJ6A 3NVKI 4IO1A 1D0SA 2NSYA 2NZ2A 3PC2A 4B3CA 1NPTO 2BUCA 1DINA 2CD9A 3E9DA 1H4VB 1JIVA 1KO7A 2H11A 2W6QA 2FQXA 1H2RS 2OUIA 3NT2A 4OAOA 3SQNA 3VO9A 3VNRA 1L7EA 5BMOA 4RPJA 3WAKA 5I4BA 3THXA 4MUHA 1ZQ9A 2ZS9A 4BZZA 2Z8ZA 1XRMA 1Y3HA 5DOZA 1VGQA 1Y3CE 4YJFA 3IEXA 1WHTA 3UHJA 5FUQA 1W29A 2PGDA 1N7JA 3STVA 3KZVA 4RV9A 1BE6A 1USVA 2XYPA 1KGSA 4FHEA 4BB9A 1Y8CA 2AI2A 2IX9A 2IY9A 1IJKA 2D1FA 1KEVA 1QH9A 3G59A 4R16A 3SICE 3SSAA 3E3OA 1M73E 3TOVA 3BH7A 1M0EA 3ADBA 2OYCA 2LP4Y 2H5IA 3HY3A 1UJ2A 3VMFA 2XOEA 5E6UA 4E31A 3LQ4A 1PHRA 1MFPA 2GCIA 5ADHA 1XDBA 4XE5A 2JH9A 1SWVA 1KA9H 5EJIA 4B6SA 4RD6A 5AQEA 3HJHA 5EJEA 1XHLA 3VTKA 1YHZA 3E7FA 3NVMB 3LUJA 4TLMB 5G0UA 4ZVVA 5BYAA 2GILA 4NR0A 3LQKA 3NJ8A 1N3BA 3C2QA 3U5TA 1PR4A 3KZCA 1A9ZA 4LZPA 3N05A 5U1PA 3LDGA 4I2VA 2IEAA 2R79A 3EVDA 3QE0A 3KZ1E 4QUAA 1BKDR 3VJLA 1MQ8B 1FFEA 3EEFA 2UYHA 3BQNB 2ZTHA 3CVUA 3B82A 2C5GA 4GI7A 3UB2A 3UATA 4C5CA 3K6SB 2BI8A 5HFAA 1XZGA 3A31A 3AEKB 3HU2A 1JLKA 2QTLA 3VH1A 1P2SA 3HH8A 1DCTA 4AUEA 3PD0A 4YH1A 1PV4A 1HYHA 2Q5FA 1B93A 3BOSA 4F60A 2ZRDA 3JR7A 4ZGWA 3O5AA 5CVDA 5B3AA 2J09A 4GGMX 1VKJA 4EW1A 1E8MA 4LPSA 3FOEC 1SG6A 1RYZA 3E3LA 4A6XA 1THMA 4M0LA 3W7VA 3BA1A 3L4EA 4JR1A 3VU3A 1S3IA 1NXTA 2IIVA 2O2SA 1P75A 3V7FA 5IYZA 4LHXA 3FTQA 4QNRA 3FB4A 3VZDA 2BW0A 1WDMA 2OXRA 1NF3A 1B8UA 1WMFA 2W6OA 1TLTA 1IQUA 3F9IA 3PSAA 2GLXA 4WESB 4AZTA 1Q91A 1VHLA 4D1YA 4ER3A 4L7VA 4U0KA 5IKEA 2QNBA 3VKWA 2P5SA 4MEAA 1J9EA 1Q1QA 3PR2B 1FP7A 4ND3A 3KPJA 5BN1A 1KYYA 4QE3A 3NNDA 1SXJC 4LVUA 1T9CA 4MRMA 3RK4A 3RS7A 3QWBA 4F3NA 1WXIA 4QXPA 2B5OA 4HAYA 3T0IA 2BGTA 2E55A 2X8WA 2V6GA 3GJTA 4FXPA 4QYIB 5B64A 4LFBB 1L3BA 1YIAA 1JILA 3FOAA 3LUHA 4K9PA 1KFJB 1NMSA 4M49A 3UXEA 2LKDA 2GJSA 4F9TA 4FWIB 4LWZA 1NUTA 3ZVRA 5B1DA 3IDOA 5B55A 3AWIA 4NBUA 1E3TA 5FV7A 1BCRA 3QUBA 1A5TA 2HF9A 4RPGA 2H7YA 3TKAA 4BLWA 1ECFA 2W83A 4TS9A 1YZTA 3F5DA 4Y9DA 3CGWA 3H04A 3RIMA 5CD1A 3HDHA 1NX6A 1UMBB 1YC5A 1YV9A 2OCAA 2VJOA 2A1UA 3NNSA 4V0MA 4AJ9A 1OFUX 2IL1A 4KWIA 3NVDA 2R1VA 4MW7A 1CXZA 2ZRGA 3HPQA 4Y0AA 5I4KA 3VJRA 4M1WA 4PNZA 1UQRA 1JKFA 1NU6A 3P9YA 1DWUA 4Q3NA 3CEPB 1PRYA 4LGCA 5F73A 3RRXA 1VMIA 4DAOA 3OA0A 1WBDA 2YRXA 1WCIB 1VZ2A 3ZJTA 1DQSA 5FUYA 2B2XA 4M8SA 3WGNA 2C54A 2V55B 2YJ4A 4B4KA 5ALEA 5C1DA 4NKRA 5ESDA 4AZ3B 2DSTA 3HCAA 5T6BA 3N3BC 2NMVA 2ICAA 4ZOLF 3AW9A 4TRMA 5I7VA 1PVOA 4FFBA 2IH2A 3AUKA 4FNAA 1RPNA 3GAMA 3SDSA 2ENUA 4D74A 1DXYA 1KK1A 3MXOA 5AQ1A 2BFDB 3DEFA 4Z4FA 4KPFC 1SOWA 3OWOA 2A86A 4R81A 5EKTA 3MZ0A 3RWMB 3MC1A 4EATA 1RQNA 3U0BA 1PD1A 4LF7B 1D7AA 3NWOA 3A3YA 1E2QA 2RJ3A 3QOXA 1TO1E 3FI9A 1A8UA 3L0YA 2BR4A 5TY0A 3T5TA 4EENA 1Z28A 4LYDA 3L5KA 3CTMA 4LCBA 1NFFA 3ZDEA 5LC1A 3UXHA 1FNNA 3DDCA 2EIXA 3DV2A 5TPWA 2QJRA 2W2VA 3WVNA 1XEXB 7GPBA 3S2EA 2O14A 2DFKB 4GMGA 1A77A 1A9RA 1QHXA 3VO8A 1EEHA 3OIDA 2RIPA 1GY8A 3IXQA 2VHCA 2Z3WA 3ONFA 1PL6A 3I1JA 3LPMA 1RP7A 1DIAA 4IUBS 3VR2A 2DFPA 2NTEA 3GU3A 1L7DA 3DUFA 1L5KA 3NTOA 2VHWA 3CLUD 1P73A 5EGNA 4UFPA 3KJZA 1KORA 2BRUA 4IDDA 2WMYA 3NHMA 1FMLA 1ZJ6A 3QM1A 3QWIA 1FUEA 3HSKA 1IWOA 3OAAA 4H18A 4NBRA 4YRPA 3AM1A 5B58T 3QUCA 2Z5GA 4PQYA 1I1HA 1T0IA 2JA2A 4KAXA 4NPCA 1GO2A 5E0KB 4KQ1A 4L02A 3AVYA 4NVRA 4PNPA 2I62A 3VPGA 1LQ2A 4N0EA 1O96A 1PT6A 5AJZA 1QIIA 1BQEA 3I2YX 1IEWA 3VI3B 4DWOA 4KFCA 4MW5A 2GTIA 3GH1A 2PVSA 4EVRA 2CV1A 1DHTA 3DW1X 4KE9A 1I3LA 3WIEA 1FTGA 3SEFA 9ATCA 1H94A 1M2JA 5TXGA 4OQPA 3W2IA 1IVYA 1S3GA 4F5EA 5KS2A 2XSZD 2H4XA 4K87A 5JSYA 5KVSA 5AVZA 4WBXC 2HQSA 1QS0B 1OYYA 4U7WA 2B20A 2PMEA 2GJKA 1PZEA 1R10A 2VUIB 5F12A 4EHIA 2H07A 2CNNA 4UUQA 5JISA 3DGEC 2NT4A 1Z12A 3F6PA 3HRKA 2ZRQA 2GAOA 3H84A 4NL4H 1OREA 4CMGA 1LGYA 4GVLA 1TMGE 3AIMA 4QWWA 3TF5A 1M76A 2J9FA 4XYGA 2OM2A 2ZE6A 1C3OA 2OGSA 4W99A 1W25A 4BMNA 2Q3BA 2ET6A 1XQ9A 3E1SA 1HRKA 2IZ6A 2XVMA 4ZQHA 4DWVA 3P2KA 2XUIA 3RTEA 4JJAA 5DO9A 5ICMA 1T9BA 4ZC1A 3IEPA 1A8HA 2ERCA 3EQ8A 2HN9A 4UCXA 1Y7LA 1YDWA 2VDUE 1N2IA 3L7MA 4HQKA 3HVIA 5ECYA 5EHZA 1V8ZA 4M83A 1SC4A 5K3OA 3PUHA 3UT5A 2JPDA 1WDTA 3F49S 4B0OA 2ZCUA 4BVEA 3ZDBA 1VPEA 3A04A 3MUNA 2WJGA 3TD6A 5IF3A 1N6LA 3WLFA 3I58A 3P0HA 3JXEA 3GT3A 2IP2A 3OECA 4R68A 1R8JA 3IQZA 1C3EA 3NIDB 4YALA 3RSQA 1RYYA 3FCSB 2OA0A 4EA8A 3QTBA 3RS8A 5HE8A 1G5RA 3KJQA 2VF2A 2AEMA 1X8LA 4RFSA 3G2QA 1PJBA 2XZLA 4AO6A 3GWGA 3Q4GA 3GB9A 4NENA 1GGNA 2GJ8A 2A1TR 1PR6A 1TTTA 1VA4A 3F5FA 4CU2A 1E5VA 3LT0A 2Q46A 1WA5A 4E7OA 3GJ8A 4E5KA 1X77A 1MABA 1UOPA 1A97A 1XO1A 2I54A 1HETA 2JAPA 3F78A 4FK8A 4LXUA 2VJKA 4PHCA 4REMA 4B7AA 4DRYA 4OQFA 3EH2A 2DBQA 4Q0MA 5IUNC 2DETA 2IU6A 2P77A 2G4CA 3VU9B 4GX5A 3DQZA 3IOBA 1IN1A 4K40A 2J32A 1FYVA 1NWHA 1UBTS 2ZIUB 3MRVA 4WN3A 1AGPA 4P38A 3U6KA 4B43A 3KSMA 1WXQA 3HKCA 2QM8A 5CURA 1L4BA 2OGTA 3BEDA 3PEUA 3DAYA 2IA5A 5ARDA 5JSKA 4IDNA 3SGLA 3VR5D 4CKEB 4R1PA 1YMVA 1VLLA 1A9SA 1C2TA 2C2XA 3A7EA 4KB5A 3UWSA 2AEJA 2JGNA 2Q4DA 4UULA 4WADA 1JR6A 1USUA 2F48A 1AKWA 1SUFA 1XUOA 1KH2A 1NLUA 1ZY2A 1F9EA 3GGCA 4J43A 3DDOA 4PPNA 1G20E 3OFNA 4YCCA 3URKA 2P4UA 3T35A 4F9GA 1HR0B 4ZCTA 2PTGA 4LXQA 2G09A 4MA4A 1W6UA 4FUTA 3BBPA 3TEFA 1UAYA 2EWVA 5CITA 5LMUB 2QTAA 3LPCA 2XTJA 1QVVA 1GL9B 1KVRA 2R65A 1CDDA 2H5EA 3C3AA 3ELYA 4H27A 4J49A 4RK7A 2PGXA 3F3YA 3Q3EA 4QJ5A 3WLMA 2PZEA 1ESEA 3H5AA 4PAQA 4TZKA 4UTOA 2WPDA 1KARA 4FDLA 1BXZA 3T15A 4GMHA 5AJXA 4MQFA 421PA 1W9HA 2G36A 3OE1A 3HCPA 4MRNA 1BC5A 4ZK6A 3PLNA 2Q49A 1G3MA 1XIVA 3ZKWB 2D0OB 1CNMA 4HX9A 4C6TA 2CDBA 3DAGA 1ZIYA 4HAOA 1FW8A 1GUYA 1M0TA 2QNIA 4KQ6A 1UZUA 4PFKA 4B7CA 4F46A 5JVDF 1OXKB 4A0HA 1YVRA 3VGPA 3W6NA 1OA0A 5LN1A 2C5FA 3CVJA 2OFPA 1GU1A 1IMOA 1ZWKA 3TW0A 1RSZA 1CUJA 2G1UA 3SDBA 4ZCRA 3HQ4O 3UMJA 2P3SA 2BMFA 3PS9A 1QQTA 3UHOA 1ZZEA 4QOSA 4TX1A 1MB9A 1KZ6A 3UXYA 2D3TA 4KTVE 5BYKA 1L4YA 1ZWLA 3AV3A 4BOYA 2NUPB 3ETJA 5EG5A 1Y6ZA 4PCVA 1RWMA 1FLVA 3C4JA 1C29B 1ZPDA 4ZREA 4NMXB 5LU9A 1YOVA 1C8KA 3EDQA 1UP4A 5ENZA 3E9CA 4YMTA 2DR2A 2OKCA 1DEOA 1B0AA 2WJYA 4NABA 5BSVA 1JEDA 1FUKA 3BPSA 4H08A 2G76A 5IN5A 4G5HA 1UZAA 1E4EA 2PLWA 3P9IA 5I7AA 5IBPA 5AUOB 3NCHA 2WY2D 2J6BA 3IPYA 5MHTA 2O8BA 2YIVX 3NOXA 3R5XA 4OJYA 4IDEA 4V0LA 1QR2A 4GSYA 3EULA 4MVCA 4PC2A 3H5RA 1TPZA 1HLGA 5EE1A 4TZ0A 2V5VA 2C99A 4FFOA 1DDGA 1U28A 2YV3A 3H5LA 3U7QB 3UFBA 5BSFA 2BJHA 1X1TA 1OX4B 3LYAA 3P0FA 1VB5A 2E18A 2C2WA 2LDBA 4QUHA 3Q9LA 1JHOA 1BQ3A 2WYWA 4RHUA 4B3IA 1JT2A 3LTEA 5DNVA 4E4TA 3AZQA 1Z2PX 4IGFA 4U9HS 2HJRA 2BC9A 3QVJA 1V1MB 4LZAA 3FUWA 1P4RA 1GSHA 1TM1E 2AN4A 2ZOSA 1YJ5A 3SF8A 3CJQA 3T9FA 5CB6A 4B79A 3WLLA 1H3NA 1QHSA 2VAWA 3CX4A 1EM8A 2QU7A 3T99A 1F14A 2H9IA 5TQ0A 1EUCA 3CF4G 2V6JA 5KSWB 1YK0A 2JJ8A 2VJLA 3NHFA 4O2BB 4XSHA 2DUJA 3LCJA 1TQ6A 1WVIA 4W9RA 1GG2A 3TSAA 5FPTA 1E63A 4CDRA 1G8KA 1MGOA 2W2QA 4NU5A 4IYJA 5CD9A 4I5EA 3PFHA 4RHXA 3USZA 5KQGA 2YASA 1AQIA 1K4YA 1U7HA 2BJVA 2WIAA 3AF1A 3EVTA 1L5RA 1RBYA 3IUSA 5HCIA 3A7DA 1JJAA 4C14A 3DOIA 3KTOA 4WDRA 3MWLA 5B58C 3ONDA 3COZA 4L8WB 3RAJA 3EYAA 4KRYA 5EHNA 5IANA 2GN6A 3DZFA 5DSZA 4OQDA 4HXFB 1P3Y1 4WCDA 2OWDA 3SDZA 1U0SY 1XDSA 3AFGA 4FOPA 2H9AA 3HKDA 4RA9B 3RYCA 1U5BB 1JSLA 1EQ2A 1O87A 2YS6A 3FPJA 5EXPA 3WLNA 1M72A 1EDZA 3ZKAA 3WYDA 4K9NA 3SG0A 3FFTA 3O0TA 5E95A 5AVRA 2QPOA 1NNI1 1O5TA 2AWOA 4GRDA 3UAYA 4W7HA 5DGCA 3ZNNA 4IDCA 4DY6A 2PKXA 3TXYA 2H06A 2HAEA 2WC1A 3H75A 4I5IA 3V1UA 3NG1A 3TG2A 1T8UA 2G72A 2VQ6A 2A33A 4AS3A 2AQ8A 3LOQA 5DHPA 3L6OO 2PKCA 5A06A 1V3TA 2V7QD 4PTYA 3RUIA 1UFVA 2CKDA 2J0UA 2I4NA 2DHQA 3V32A 2V5UA 1YZUA 4XH9B 1P1KA 1QNLA 1KNXA 2QJTA 4C4OA 4P2GA 5DF1A 4FOTA 3RV4A 3NPMA 4NJMA 1KPHA 3F47A 3MOSA 5CLIA 4F8YA 1O0CA 3ZJUA 1Z6GA 3HZRA 4B8ZA 1CUIA 2F6RA 4B6EA 4CHTA 5A4KA 3U9SA 5TIIA 3GP8A 3N87A 4O1IA 1NP7A 2HMUA 3CVOA 3PTLA 1UKVY 1XMSA 1OV4A 1UPCA 2QLTA 2UU9B 3JCZA 7AT1A 5ICEA 1RQ7A 1P4GA 4BECA 1LI5A 1ZS9A 4OHBA 2XXAB 1G21E 3QU2A 4C7KA 4IGIA 3RFTA 4P1ZA 4OJTA 1SUPA 2FWBA 3FKQA 3DKVA 1OR8A 1EUDA 1FQKA 2HUNA 2I34A 2YYYA 2PT7A 2ZYGA 4UNIA 3ES9A 4XW2A 2JCVA 4GBED 3HDTA 3EUEA 1Y34E 4L6CA 1JXMA 2QLBA 2NSHA 2ZUWA 1Z0IA 2YV1A 3JYQA 3PQ4A 5K0JA 1P5RA 4XTCS 5AUQA 2BONA 3RG2A 1X0XA 2RHTA 3E9NA 1QTNA 3VJKA 1R0YA 2QI9F 1HBJA 5TC4A 3G79A 4D5GA 3EPKA 1IDOA 2XZDA 4DVJA 1ENPA 3BGOS 4UVGA 4D4LA 3PGA1 5BN4B 5E1MA 3RS4A 3KB6A 3HKEA 2CHQA 5IEBA 1LNSA 2VHJA 3NOVA 5B3KA 1IOZA 4BVJA 3S2SA 4PZCA 4YMUA 3ZDDA 5DT9A 1R6AA 1LZKA 2HDWA 2IYSA 4GC9A 2HGSA 1U04A 2YHBA 1JFVA 1IK4A 3MNFA 5BSEA 2WICA 1XHFA 2ZAMA 1AUVA 2CVQA 1Q20A 4L5BA 2GFHA 4E5SA 1S8NA 1N2SA 1DADA 3I30X 4QUEA 4O1MA 4LMBA 1YBFA 4RPCA 5JR3A 3CLKA 1T34A 3FDIA 2GKGA 3JQCA 4WCFB 2OC4A 4D0GA 5IARA 1WF6A 3ZCXA 1MVNA 1JJBA 4L22A 2ZIZA 1SVOA 1S3SA 4MUYA 1GXSA 1LPOA 1W30A 1Z07A 2NW6A 1UIRA 2JVKA 2UV8A 3CEMA 1D1QA 3HU5A 4RZXA 4FFPA 4EYQA 4R71A 3PDUA 3PV0A 2WD9A 5E2BA 4YUWA 3IHKA 4POOA 1I6KA 4RK5A 4S1PA 1CJBA 3FX2A 2D59A 1JLLA 1BX3A 3PCXA 2IOQA 1HT2E 5TVKA 3UNXA 4TYPA 2WHQA 1Y3AA 4P35A 5A0VA 5CFRA 4UZEA 1MVOA 1RRGA 1LTQA 1OZFA 4IH4A 1XA4A 1J2JA 5FWXA 2CXNA 4M87A 2ACWA 2AZDA 2R2AA 3IPAA 5M7EA 2CYCA 2YW2A 2BCEA 3E84A 3K1JA 4HPJB 4LDNA 3ZR4B 4O4HA 4PHFA 4BLSA 5IKPA 2I03A 4N12A 2I3DA 3KV1A 4KN6A 4PZ0A 1VKRA 2C83A 4PTLA 5ALNA 2PJZA 1Q1AA 4DZRA 2VWPA 3N59A 4OBXA 3L41A 4K6OA 1UQTA 3DTVB 3NYQA 4UPDA 1ECGA 1U8EA 4G5FA 4PQFA 3GLHA 4L2IA 2ADMA 1FDTA 2IVFA 3ZTYA 3ITNA 5IH3A 1X7GA 4R1OA 4W4TA 4WAUA 1D1TA 2FRDC 2WSIA 4UMFA 3TIIA 1YGPA 3UZUA 4TN5A 3L7OA 2GPNA 2JI7A 3GUCA 1GRCA 4XAQA 5GIOE 1VYUA 1R37A 5EXXA 1YB4A 1II9A 3FWYA 3S44A 2DWOA 1I0LA 4IWXA 1FFGA 5KPJA 4FZ3A 1TJ5A 5CK5A 2VDWB 1XU4A 3QMPA 1BYIA 1IC6A 4WY8A 1TM3E 2PS3A 4Y9UA 5ALQA 1AZLA 3SWWA 2QAGC 4IYRA 1XXHA 2IWHA 4ZTZB 3R0QA 4FGSA 2JLWA 3OIYA 4UJ5A 4F2PA 4F91B 3IOMA 1CCWA 2VCHA 3D6FA 3LDFA 4TLCA 2YOHA 3CZMA 4BFSA 4QICA 3WWZA 4JXXA 2RH8A 4LDQA 1UBCA 2VP2A 5JNTA 4OAPA 4IJMA 1OILA 3VJMA 3O6VA 1OMOA 2JBHA 2QN6A 4RFLA 4TXMA 4XLLA 3W5AA 1L5HB 4RGYA 4ZQEA 4AL4A 4P98A 2GM4A 4IV0A 3FFBA 1NRXA 3ITKA 4I81A 1RT9A 1KFEB 2WIJA 1KMMA 4IOKA 5HJ2A 2KW5A 4QEZA 2FRDA 1PGOA 3C1AA 4TQAA 3OPYA 4P54A 3ABIA 1P31A 2OPBA 4HAWA 1S1CA 2PNFA 5KC9A 3TGLA 3LQRA 3VOBA 3AWDA 2CUZA 1U2QA 3D59A 3D7MA 3H13A 1E7RA 1LPSA 5CA1F 1BWRA 3QPDA 4KU4A 3PFGA 1XTBA 1DCMA 3OLZA 3QVKA 1CZHA 4I50A 2H2AA 4MVJD 1JB9A 1E2GA 3TZLA 5JY6A 4C89A 4CTKA 4KQ9A 5DI3B 3QPWA 1SBIA 1EWKA 4OLJA 3OZ7A 2NV6A 5J43A 5KYNA 4IDGA 5HR5A 2HA6A 3RROA 2VQ3A 3WIDA 5KJ6A 4L57A 2R62A 1V3UA 3VAZA 1AMNA 2ZS8A 2JGMA 5IAKA 4CKCA 4BKUA 4DPKA 1GSAA 1UBFA 1YTLA 2PSFA 2QTZA 1R5NA 1E3SA 2YWJA 1T5OA 2OAQ1 3IA2A 3JQFA 4KO2S 4ARSA 3OTOB 3QUTA 3CRRA 1BCSA 1JJFA 3LUDA 3ND7A 3OESA 5CIWA 4MW9A 2UYCA 2NU7B 2G40A 3E5MA 3P9SA 2VSXA 1QKKA 1ZIDA 4ZN6A 1H1LB 4JDPA 3TDKA 4NG5A 4QYSA 4PG4A 1QX3A 2ATIA 2VPZA 3VR6A 1K8ZB 1QVRA 3BRWD 4Y30A 1QYWA 5E6UB 1B0UA 4CM6A 4ERXA 3WHLA 1O94A 1O54A 1WV0A 4UE6A 1E2FA 1HDRA 5A03A 1Q6YA 3B3QA 3GRKA 3Q0TA 4GBGA 5C4GB 3TCKA 4CT5A 2O59A 2F64A 1U5CA 4F1WA 3T1HB 4G1VA 1JAX