1UEYA

Solution structure of the first fibronectin type iii domain of human kiaa0343 protein
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
127
structure length
127
Chain Sequence
b'GSSGSSGPTPAPVYDVPNPPFDLELTDQLDKSVQLSWTPGDDNNSPITKFIIEYEDAMHKPGLWHHQTEVSGTQTTAQLNLSPYVNYSFRVMAVNSIGKSLPSEASEQYLTKASEPDKNPTSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA0343 protein
molecule tags Cell adhesion
source organism Homo sapiens
publication title Solution Structure of The First Fibronectin Type III Domain of Human KIAA0343 protein
rcsb
total genus 8
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2003-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ueyA00
1TJIH 1Q9OA 3H9YA 4NJ9H 5FHBH 1T6VN 4P3CH 1BFVH 1RZKL 5IW1A 1N2RB 4Z8FH 3LRGA 4PG2A 4P5KB 3TVMD 3QULB 4RFNC 1DFBL 4HDIA 4Z7VF 3QO1B 1JHTB 3QQ4A 5CCKH 3L7FA 2NY1D 4PRPB 2HLAA 4GJTB 1B2WH 4PJIF 1XGRA 4K9EC 2GQHA 1VKXA 4HWNA 3TBTB 2YD4A 3L7EB 4LFHD 1OAKL 4KMTH 2W0FB 1BFOB 1R5WA 4AENB 3K0WA 2NX5B 4CU6A 5I1EH 1RK0B 1KTDB 2WP3O 1WTLA 3FMGL 3MBEB 5EZOL 5C71A 2EYSA 4M93C 1UM6L 2LU3A 3LN4B 4NC1C 1IZJA 4UQ2A 1M71A 3RPIA 4OD1L 5J1SC 3QNZA 3AC0A 2C1PB 5IJVB 4O5LL 1F2XK 5GJTH 3U4EA 3UZQA 4HQQL 2BVQA 1BECA 2HJFA 2Q7YA 3HPJB 4LLYB 3BW9A 5DJDB 3RGVB 3L7EA 1EMTL 1NGPL 2A74B 2BP3A 4MSWA 5KJRH 3VRLE 2KQMA 1XZ0B 3B3IA 3UROR 2D7OA 1UWXH 1NBYA 2ZSWB 1KJ3L 1JZ7A 4CMMA 5J6GB 1BM3H 4PJ9D 1L7IL 4QRUA 4NDMB 3TEUA 3OKMB 3ZZ1A 4GXUM 4JQXA 3TH2T 1XF2A 3CDCA 3HMWL 3W5NA 2A9NH 4O51A 4LHUD 4O9HL 1T3FA 4ACPA 3KDMA 4X7FC 2BY3A 5D6CB 2AEIT 4FHBD 4ZUTA 4KGJA 2JK5A 1HQRB 3VFVA 3SKUD 4PUBL 5BRZE 2EDFA 3G6JA 3MJ7B 1NC2D 1T1ZB 4NN6B 1E4WH 3ISWA 4HMCA 1ZA6B 4WCYL 2G2RA 3SKOB 5FUCC 5I8CB 2I26N 2IAMB 1T1WB 5BZWA 3BEVA 1KC5H 4U05A 4ZD3H 1IKNC 3C09C 4KJWD 4MMZC 1IC4L 4L9LA 3T3PF 5E2TH 4IM8A 2NZ9D 3CMOH 4PREB 4NM4H 1WLHA 4NFBA 3FO1B 2IBBA 4HGKC 1MHPH 5J56B 3SDAC 3UTTB 1HIMH 4EBQH 3HE7A 3CK0L 4PUBH 1A9EA 3WL9B 1D5ZA 2A73B 4XAKE 4KRPD 3LRHA 3OF6D 4Y4FD 3MMEA 4B41A 4XMPH 5TPWH 1AHWB 1ED3B 3FQTA 2NPLX 1J88A 1YUHA 4J12A 1IGCL 2H2SD 5C7XL 2IAMA 2NTFB 2EIBA 4QRSB 4BQBA 5HHMD 3U9PL 5HYQA 5SWZB 4U1JB 3RVXC 2BY2A 1MNUL 4W4NA 4HCRH 4G5ZH 4OSUL 1E4WL 3PP4L 5IB4B 4X6BA 4NYLA 2L7JA 2P1YA 4ZFOA 3Q6FB 4S2SA 5IG7B 4CMHC 1MCNA 1YPZF 1RZGA 2FGZA 4L4VE 1J8HB 4TQEH 1QBAA 1QLEL 3EGSA 2VR4A 1A3RH 2RBLA 1HI6A 2ZKHL 3LN9A 2BJMH 3O3DB 5I9QB 3QDGD 2J8UF 2F53E 5C6TH 4HV8A 1OAUL 3PWPA 4QRRA 3GSOB 4HPYL 4N5ED 3L9RB 2F58L 5CD5D 1MHHA 3GSQA 1KIPA 1A3QA 5HHOA 2Z4QA 4X7TB 4OLVL 3P11L 5HGDB 3WSQL 2GSGB 3JTTA 3FQNB 1CGTA 1WWCA 4LPCA 1YEGL 3N1GC 4OKVB 5D1ZA 3FB6B 5FUOL 2CQVA 4FQXB 1UYWH 1JNHB 1QLRA 4ISVB 4PJCA 4AYFA 3HE6A 5KW9L 1AD9B 4QXGH 1YMMB 4P9HC 3HMXH 1FAKT 1JF1B 1BD2D 2D7QA 5FYLE 4HIEB 4HUNB 1T22B 4FMFA 3CUPA 5JLZA 4WW2F 3AUVA 2BOCA 4HX1B 2Z8WC 5KVGH 3E6HA 3OXSA 4YXHL 2OL3H 1RQ5A 1RUAL 3JTSB 4H0HB 2OK0L 3DO3A 3D0LB 2WW8A 1XF4A 4JKKA 3MLUL 5HDLA 2VYRE 4XC1L 2BVQB 2IH1A 2XTJB 3WNLA 4TNVF 3C8HA 1FZMB 3DPBA 4P4KA 2GTWB 3O11A 4MNGA 3WEXA 5DVOA 3TIEA 4YC2C 1XH3B 5C07A 2MSPA 4MD0A 4MDJA 2EH7H 4WI7A 3MXVL 3VE0A 1FBIL 3D18B 4QRPB 1NANH 3F5WB 5D1QB 2HFEA 2E3VA 3T4AA 1YEJH 4I13B 3ZE2F 1QFUH 1M7DA 1JGEA 4GAYB 4PJFA 1JHLL 1X5LA 1KPUA 4WUKH 4R3SB 1LD9B 5GGSB 5HPMB 3RJDA 1QNZH 2B5IC 2DQUH 1NGZB 3MRDA 5SWQA 3OXRA 5BV7H 4UT6L 5JDSA 4GSDH 3QEQB 5F96L 1YY9D 5SWSB 2XV6B 3GBML 4R7NB 1G7QB 3SHSA 2JE8A 4LPXA 5AYQA 5HHQB 2DM3A 4Z7VE 4XCNA 4BELD 1P5VA 2NXZD 1AXTL 3P4OB 4BUGA 5EZIL 3BT2H 4M7KH 2Q7NA 1B2WL 4QHNA 1YNTA 2C4FU 3RFZC 2NXYB 3QXTA 4GW1A 1VCAA 3TT1H 4F7TB 3W9DB 3C5ZD 4LLDB 4PJBB 4L3CB 1JHLH 1I9EA 2Y06H 5FGSA 3PDGA 4LNRB 4Y5XB 2AJZA 4QLRA 1CCZA 2ID5A 5CUSL 1AHWA 1OAQL 3DX6B 4NO5A 4Z5RB 3B5GA 4OZGE 4UT9L 4W81A 3DI3B 2Q6WB 3HC0A 3QQ9C 3MGTB 3IFPA 3DVNB 1SQ2N 5GS2D 1AGEA 3PV7A 5ID1A 4UNUA 4MJ5A 1YEIH 2OP4L 4GKSA 2BZDA 1Q0XL 1RHHB 2GITA 3ULUC 1KIRA 5KANG 3MYJA 3A6BL 4IOIB 5EH1A 2D2OA 2HJLA 3W11C 2F53B 1A21A 2AJ3A 1FGNH 5E1AA 4CBPA 4U1NA 3SKOA 4IDJH 2X1PA 5A40E 3FB8B 5SWZD 4N8CH 2Z8RA 5EOQL 2X2YA 1MCWM 4NUJB 3VMPA 2Q6WA 1M6OA 4N0UB 3EOYG 3CFJB 2AGJH 3UTTD 4DTGL 1TETL 5L6YL 3QUZD 3VU2A 3FB6A 2BJML 4HFWA 3HLAB 4HKJA 2E27H 4UOJA 3TO2B 2E9JA 3RWEB 5DD0L 3VXUA 4X98B 3CIQA 5CKGA 4L3EA 1BAFH 3ILPB 3TA3D 1UCBH 4X99A 3N1PC 4OLUH 5F3BA 4U1NB 1XAUA 1WEJH 1A6UL 1WIOA 2I9TB 5E2WH 4M6NL 4QNPF 5GGTH 2ATKA 2K3TA 1A2YB 3RUGF 3V6OE 1BOGB 4JO3L 2C3VB 2C3XA 2FEDC 4HFWB 2P5WB 3L3JA 4F58H 4P5MA 4XGZA 5DFTA 4WI8A 2MKWA 3ARTA 3WHXA 4IS6B 5C0AB 4AJ0A 1E28B 2CJUL 4EN3C 1DDHA 3MSPA 5IMMA 1QPXA 1R5IB 4UNVA 5C6PB 5ESQA 3HA0A 12E8H 1A6UH 5ESVA 1OQOA 3EDKA 3MCLH 1E0OB 2EEAA 4NRXB 5F9WC 3ZSSA 1T6WA 3BHBB 5CWSA 1FORH 5DK0A 1C1EH 2I25N 5KS9A 2Q1EA 4P4KC 1WTGT 3ESVF 1SEQL 3HMXA 5CEYB 2YMXH 1MPAH 4YAQA 4JFEA 1A7PH 1HZHL 3BPCA 3QH3A 5F1KC 2WM0A 3RU8H 1S5HB 3T65A 3LEYH 5GGTL 3CFBB 3FQXB 1JNNH 1F3DH 1J1XL 1N59B 5DJ2A 4P4RA 3ULVF 3KPRE 4LQFH 4FN0A 2ICWJ 4HWBA 4OD2A 3ILQC 4N5UA 1IQWH 4O2FB 4ALAH 1LVEA 3QWOB 1OP5K 2DL9A 2OXGA 4HX1A 3KLAA 5ITBH 2FIRT 3V4UL 1OD9A 1ZVYA 2UY6A 5EOCJ 3UBXB 2D7MA 3MOBH 3OJDA 3ARZA 3SQOH 4M1GH 5D2LE 5IP4A 3MLSL 5HD8D 3TNNB 1YEEH 5C9JB 4EI6A 1YNLL 4JHWL 1QTYT 4WFGE 2AJUH 5ICYB 3FAWA 4LAQL 5KG9B 1U8OB 3UTPD 1SY6L 3NIDF 1OGAE 4PP1D 3VXTA 3UYPA 1EAPB 4OZHA 4XWOD 1A6ZA 4D3CL 2VMFA 4LPUA 4YO0B 2AEPH 2YPLE 1NAML 1CD9B 3HCVB 1QSFA 1PG7X 5D2LF 3WN5B 4L4VD 4OD1H 1DQDL 1F42A 2J8UA 3O9WB 4PB9L 1KN4H 3T1FA 5A16A 5IQ7L 2NW3A 5HDQL 3RDTC 1EO8L 1DQQB 4KC3B 5HPMA 2CPCA 5KJRL 4JO2H 3HZMB 3KWWB 1CLOH 2G60L 1JZ2A 1FN4B 5EO0B 5IQ9A 2JJTA 2CR6A 3QFJE 4NKMA 5KSAD 4KI5D 3RPIB 4RNRA 4ZTPL 3IAPA 2ESVB 1M7IB 4ETYA 4TPRL 5DQ9B 5JW4N 1CLYL 3FO0L 4Y19D 3U4BH 1H8SA 1UG9A 1Y18A 3VDAA 4UQ3B 4FQXA 3EFDH 4AENA 4H8WC 5MENE 2XT1B 4MXQC 4L8DA 1DBML 5C0BA 5BCAA 1YECH 2DD8L 4DKFH 1NAMA 3EOAB 5HGDA 4U6HA 1VKXB 1CI5A 3K8LA 5I19H 3VI3F 5ISZE 3NTCH 3BN9D 2DQDH 1TJGL 2M8XA 1I1CA 4U4BA 3MUJA 4XX1E 5F1SA 3QISA 1S7UA 1U91B 4KAQL 3C2AH 3TPUB 3WN5A 1T22A 3LKPB 5BO1H 5E9DD 2DYPD 3ZDYE 3WDHA 5D2NA 3S37X 3D39B 1RU9L 4MDIB 5C3LD 3FJTA 3MRHA 4L5FH 3VFSA 3CXHK 3ZE1E 1WQVT 1CK0H 1ZOXA 3EJJX 4D0DB 4C56E 4JZOB 2O26U 3CVHA 1R3HA 4KK9D 4U1KA 4LLAA 4UBDD 4P5TC 2ITCB 1V7NL 3DIFA 3IU3A 1HILA 2IQ9L 4ZPVB 3B5TA 4IS6A 4U1KB 3HR5A 2FX7L 3DURA 2X4UB 4NJAH 4UBDC 2PTTB 2PXYC 4KK9C 1A7RH 4PJDB 1XF2B 1KLUA 5BQ7A 5I9QC 5E7BA 3T3ME 4G80A 1BD2B 3VXMA 3O2WH 3WFDL 3FOLA 1HN1A 4JFQB 2VLRD 3MREB 3OTTA 4TOYH 1L4IA 2YUZA 4O02L 3EOBA 4K7FA 4JN1L 3KPRD 4JRYB 1Q72H 3BN9C 2IC2A 3ULVD 5TQ2L 3K46A 3MACH 1MJUL 2VDQL 2ICEB 3BIKA 5D2LB 2DI7A 4G8FB 3TO4A 4KHXL 5A2KH 1NGQH 2DI9A 3FT3A 4R0LC 3SDXA 4FMKA 2DLTA 1BIIB 2BSSB 1FSKB 4NQXA 1MQKL 3CSYA 5DQ9A 2YPVL 4WFEE 1S7TA 2H32A 4MAYD 5TDPA 3T04D 1T0NB 1P4LB 1BPVA 1UGNA 4E41B 1ZGLB 3PQYE 1T2QL 4GQ9L 1IGJA 3NN8B 3HKFA 3MX0A 3NMEA 4HJGB 4OLYL 5KSAC 1TJHL 1S7XA 3QEUA 3NA4A 3QDJE 2NY5H 2J3SA 1NBYB 2VLMD 1TQCB 3WJJA 4E5XB 1AY1L 1P4IH 3FKUS 5HYFA 3QQ4B 3ARGB 3MUY1 1IAOB 4MSWB 4HWBH 3SPVB 2QBWA 2AXFA 5EC2B 5DK2A 4ODSL 1RZJH 4IIQA 1UVQB 1FPTL 3TJEH 5ALBH 4KMQA 4C58B 1FH5H 4PBVC 2CRMA 3RHWF 2IH3A 4K71B 1RI8A 1PZ5A 4XCCH 2DN7A 3WJLA 4LSVH 5BRZB 3OAZK 2K7QA 3P4MB 3OG4B 2ZNWA 4JPIB 4X4YA 5B8CC 1S3KH 4PJGE 4DK3A 4XI5D 3SCMA 3U36B 3Q1SH 4UU9B 2NY0C 5A2LH 1FL3B 3MOAH 2C26A 5CEZD 1JPFA 4P2OB 5HD8C 1XZ0A 3QYCA 1HHHA 1TIUA 2X4QA 4XAKD 3QDJD 5GRVK 4YIQB 3UBXG 1ROWA 1ZA3B 5HI3D 4LLYA 2ZSVB 3T0EA 3UTZB 4NHUB 2A6JA 3N9GL 3CFEB 2DQUL 3MZGB 3CFBA 1QSFB 2CKBL 4JRXB 4M7ZB 4IRJB 1WCQA 5ICXA 3VI4F 4OM0L 4G43B 2ICWI 2AEQL 2ESVD 3GIZH 3TO4D 1TTGA 3GM8A 5JNYA 4NC2B 2EYTA 4UAOB 1LQSR 4Y19E 1EEYB 1OTUD 1N6QH 2VLJB 4E42A 4AM0B 3UDWC 2YHGA 4ZXBB 2NLJA 4M5YL 5DFWH 3HC4L 4BJLA 3RTQC 4OQTL 4P2RE 1NC2A 1H8OA 4WHDA 2EDJA 3GHEH 4YDJB 5GGQL 2XA8H 4EUPG 1I7UA 2W60B 5JHDE 5C0EA 2CUHA 5C0AA 4Z7WE 3KR3L 4RGNE 1TXKA 3TCXA 2VIRB 3IRZA 4YLQT 3WIHA 2JIXA 5SWSE 3GO1L 1AGBB 5EN2B 2BRRL 3HI6L 5TFSH 4Z7WB 2V2TB 4BH8B 3TYFA 2DQFA 4UV4L 4APQB 3I50L 3GBMH 4M1CC 2VZSA 1AXSA 3W0WB 2NYYD 2ZOKB 2R1XA 4L8BB 1R5VA 4FP8H 3DYMA 5KSUB 3DROB 3U0TB 2CDGB 4Y0GA 3SDYH 5CZXC 4AEHH 2QSCH 1A1NB 1JNHA 2OR7A 3MRGB 4F7PA 4HIJA 5MHSE 1XH3A 1EPFA 2AW2A 4PTTA 5C07B 5F6IB 3D69B 3D2UB 3FN9A 4DN3H 3ULVL 1M6OB 2EZ0D 5KVFH 2UYLA 1RZKC 3J8F7 5DJCB 3QI9B 4X5WA 4IHOB 4WWID 2NY7H 4JPVH 3IJSB 5KN5B 3BKCL 1VA9A 5E24E 3GI8L 1U93A 1KYOK 1SBSH 1FCCA 5GRVL 4U31A 4JHZA 3GIVA 4FG6C 4V1DA 4ODVL 3CXDL 4R4FH 4OD3L 4LAJH 4RWYL 4H26A 5MEQA 2JELH 1A5FL 2E7BA 3GMLA 1QQDA 4Q7DA 1TQBC 3JZ7A 1PLGH 5KZCB 1TENA 4X6CE 5EUKA 4XBPA 4ISVA 5KSAA 2EYRA 2X41A 4R4ND 3Q2CA 4LSQH 5IFJB 2B5IB 3CFKA 1VFBB 3DSNA 5DHVH 4BM7A 4NO3B 4P57A 2UZXB 3R0NA 1F11B 2ITCA 2D0HA 4TVPH 3V5DA 2Y07L 4FXGB 4FQ1H 5CP3A 1QFOA 4L4VA 3RWIA 1HNGA 5HHNA 1FNSL 3LS5L 5F96H 1SHMA 2OZ4A 2FIKB 2OI9C 1MFCL 1ORQB 5FK9B 5I1AA 3ULSB 4HC1L 2KKQA 1D6EB 3C5SB 4E41A 3E2HB 3U7YH 2D03H 3WO3B 4OCSL 1HSAA 1DN0B 3NFPB 1ONQB 5GJTL 4JQXC 5DVLA 43CAA 1IL1B 1INDL 1NL0L 2OR8A 5JDSB 1DQML 4X6BB 1G1CA 1VHPA 4MNHA 5DJ6A 1WBXA 3U79A 1P7KB 5DQDL 5K93A 5DHVB 1Y6MR 2BNRA 1E4KC 1S7SA 4OJFL 4FRWA 3ARSA 1KB9K 5KS9E 3CVHB 1Z9OA 3BP6A 4AEIH 3V6FB 1D9KB 5D1QA 4AG4H 3QUYB 3N0PB 3OKLA 3DLQR 3HI1B 1URLA 5KVEH 5ALCL 5DJXB 1JTOA 4KY1H 4P23B 5T3XL 1V8HA 3ARED 2VR9A 3S35L 2J8OA 4WTZA 5FYJD 4CU7A 5C0CB 3EOAA 4Z76B 5T33H 3WFBL 4YR6A 3GMPA 4OCNC 1T0MA 3MLRL 1K6QH 4HKXA 2AQ3A 2OBGA 1ZLWH 3O3AA 3EYUH 4HS3A 5C0BE 2A6IA 4R4NC 4PTTB 2EH8H 4MQSB 2EYSB 2AJYL 4JZJA 3D2UD 5ISZA 2EDXA 4H5SA 2V5SA 3QZWG 1MJ8L 3QRFM 1Z0NA 5C2BL 3PNWA 4Q0XL 3KWWA 3WFHA 1JWUA 3VFPB 4YX2H 1MWAH 1BQUA 2LVCA 1TZGL 3NIGE 1YYLH 2ED7A 5A1AA 4KVNH 3RL1A 2GJ6D 3GSVB 1RPQA 2FYYA 3EIFA 3WKML 4U6HB 3PGFH 5SV4A 3VFPA 3OKDA 3AXLB 1IILE 5J11B 1U8NA 4XVUC 1DQJB 3MNWA 3ZTJG 5I6XC 1GGCL 5FM5M 4DAGL 5C0EB 2A77L 3IDUA 3LAFA 3TJHC 1GSMA 1SM3L 4TUOB 5CZXD 3JSSA 1AO7A 1OSZB 3P77B 3BDYL 5BS0B 5DQJA 5D96C 2H2PC 2XFXB 4XNYL 1V7ML 5DJYB 1AQKH 2GCYA 3S98A 1FVDB 1Z9MA 3ABZA 1MJJB 5D2LA 3TO4B 2VLJA 2NY7L 3RVTC 4G8IA 1LO0L 1JYVA 1TFHA 1FO0A 4WNQA 1ZHKB 2CMRL 1VEMA 4TSAL 3RVXD 3WFEL 3UPRB 3OB0H 4YBHA 3CDGB 3EOTL 4YHMH 2VITB 2V9RA 1QO3A 1A9EB 3QO1A 4KHTL 4YBQC 3S4SB 3OHXA 4JRXD 5IIEA 1IT9H 2IG2H 2OMNA 1TETH 1AFVL 1EEQA 4PTUA 4GRWH 3KNBA 1V7MH 5I1AB 5FYLD 4UMGA 1XGYL 3VFGL 2BVEA 2NZ9C 2APWA 5E1HB 3V4UH 4WU5B 2NXYD 1CXLA 2O61B 5E8NA 3MTRA 1CE6A 3X14A 2APXA 1NUFA 4NZDA 5EU7E 3VGFA 2AXJA 1BOYA 2WWKO 2BVTA 3PQYA 2BNUB 3V2AR 3NCBB 3HMWH 3OJMB 2P48B 5ETUA 5JQHC 3TO4C 1FGVL 4R8WH 4RIRB 1GC1H 3GJEB 3U7WH 4IMLA 3IVKA 4ZTOL 1IT9L 3OB8A 3CH1B 4OM0H 1VACA 3ZDZE 3FFCA 1U41A 2WZPD 3MBXH 2EC8A 3O4LA 3K8KA 2KDGA 3A67H 3OGCA 4K7PY 4XPFH 4U7KA 5ERWA 2ERJB 3LKSA 5C0AD 3RDTB 4NN5C 2B1HH 2W92A 2IBZY 1AR2A 1OF2B 4MD5A 3L95A 4TN9A 4PJ9C 4NM4L 4XI5C 5E5MB 5T5NF 4MJID 5CD3B 1N4XH 3WUZA 5DGQA 2GY7B 1JFQL 1NAMB 3IU4H 3TP4A 4PJ5E 1LNUA 3LIZL 1XMWA 2DLHA 1RD6A 1X9QA 3LEVH 1KB9J 5C07D 5BS0E 2EXWC 1T04A 2W1NA 3MOQA 3WS6C 3JXAA 4UOW0 2VLME 5DJYA 4NRZB 1F45A 2B1HL 3BDXA 4HCRL 1NEZB 1NFIA 2ZP0T 3S35H 1S3KL 4OF6A 4BK5A 1NC4D 5BVJA 4LCIL 3UC0H 5I1DA 2NY2D 1B4JL 4MB3A 5F7EH 3TA3B 3KJ6H 2I9TA 4PRID 4L8SA 1I3UA 2QQKL 4CMMB 4FTVB 4I18A 3D9AL 5KTEL 4RGOH 3ARDD 3TBYB 4Q6YA 3GSRA 1F6FB 4DVBA 4Q9CA 1JK8B 2AJYH 2R29L 2NY1C 3BSZH 4ZFFA 5KAQG 2EH8L 1VB9A 3MV8A 2H6PB 2FD6L 5I2IB 2AP2A 2HJKA 5GGVL 4RDQG 3KPPA 2FLBT 2HT4C 3GJFB 5INDB 4L8CA 4L8BA 5GRZA 4MVBC 1K8IA 1JI1A 3ARWA 1ZKAA 4DZBA 3RVUC 5I15L 3TWCL 1YEGH 1XT5A 1IEBB 4ZO7A 4PGEA 1OB1A 4UINH 1MFAH 5H94B 1HQ4A 2E7LA 3QIWB 4X6DF 2EIZA 1QRNB 3SDCD 3DVGA 3K3QA 1QG3A 1JP5A 2X1QA 1DBAH 4Y16D 5ENWA 2YA0A 2F5BL 1E4XH 2PXYD 2ZUQC 2P5EA 1S5IH 1HH9B 1KCLA 4QWWD 2CRIA 1FQ9C 3PWVA 5GIRA 3PV6A 1UWXK 3C2SA 1ADQL 4HBCH 4KUZL 5HYJB 2Z8SA 2X4QB 4YAQB 5CEYA 1OGAB 2CDFB 2IQAB 3CX5J 5F7WC 1KPVA 4PJXF 2DQCH 2V5TA 4LGSB 1UM5H 3BHBA 5KSVA 4RX4A 4LLDA 1YY8B 3FO9B 5EPMB 2VRAA 1JZ8A 4KI5E 2IGFL 2CLRB 4JY4A 1MSPA 3D3VA 25C8L 1YMMA 1BZ9A 3TVMB 1HH9A 2RJMA 4ODTH 1UA6H 3BO8B 1NCCL 2FJFB 2OX5A 2VDML 3P40A 2P5WA 5C2BH 5LGJB 5GSVA 2NW3B 3ULVH 5GXBB 1BJMA 3OWEA 3C9NB 2BHUA 3QIBA 1QSEE 4N0FB 4XP5L 3TBYA 4R4FL 2FECL 3ALXA 4XNQB 3VA6A 3K2UH 4MD5B 2PYFA 4S1SH 4DFHA 4MB5A 2R2HA 2N7BA 3LB6C 5HPOA 1PSKL 1UXSA 5T3ZE 2XI9A 3SN6N 5FUCE 1V3KA 1AH1A 3QCVH 5K9QI 3RGVC 4UIMA 4NQEB 4UDTA 4S1DD 4PJCB 2CR3A 5C09B 3D18A 4KGLA 3BP7A 1RURH 2B0SH 3LEXB 3DV4A 2JB6A 4LIQL 4JM4H 1UACL 2AK4E 2LAAA 2AQ2A 3S4SG 1OSPH 4XAWL 1FYTB 4Z7QF 5EUOF 3RDTD 5LGKA 1NH6A 1FG2B 4IMKA 3SGKC 4XP1H 4LOUC 3MJ9L 4OUUA 3E6HB 5IR1B 1E4XI 5IB5B 1NBVH 3KPOA 2HVJB 5IOPB 2OL3L 4MGXA 5DI8B 2HFGH 2BVOB 1A7OH 4XH2B 1WBZB 4XWOC 4LHUB 4WHYG 5GGVY 1KCRH 4LASL 3GBLA 4BSVA 1SJXA 3R8QA 5F44A 1N8ZB 2YN5A 1H3XA 1GGUA 4X6DB 4Q6IC 3G08B 1GZQB 4KK8D 3MV11 3T0XA 1G7LB 3DXAD 1QR4A 2BNUA 2ZOKA 1JBJA 5EFIB 1I9IH 5E5MA 4PJEE 1Z9LA 3Q3GA 3ZLQC 3MRJB 1I3GL 2R29H 2ZCLH 4KTDH 1GJIA 2MKLC 4G9FB 4HMEA 1LDSA 1G6RH 4YGVA 1DN0A 4EOWL 1K85A 1MI5A 2FR4A 2VKWA 3ZL4H 4ODXB 5IFAH 1J1PL 5F1IB 4L29A 5EU4A 1ZE3C 3EKCA 3GMOA 4FQLH 3VWJD 4M9PA 3QFDB 1TMCB 3TV3L 1UJTA 1NKRA 2VL4A 3BD4A 4P5TB 5GISH 5D72L 4GAGL 5GJSH 3WNOA 1F11A 4AEFA 4KJPC 2ZUSA 3VFMB 3S96B 2GKIA 1X5JA 1LEKA 5FOBA 1XF5A 5E6YA 4N8PA 5L2KE 5D5MF 5D7IA 3B5HA 2D7TL 5J12C 4NT6B 4UIMB 2XACC 1MWAB 4POZC 4XXCC 1TPXC 3FRPA 2RFXA 4TUOA 1QQDB 1AI1H 1NLDL 4WW2C 2P7TB 1JWMA 2F5AH 5CZVL 5DC4B 2HG5B 3EYQC 3IXAB 3IF1A 1XF4B 5J06A 1AY1H 3NIDE 4NCDA 3WUWB 1JTPA 3TA3C 2AABL 2R9HD 3BPLC 4PGDA 1PVHA 1UH4A 3IFLL 1XCTA 2F9BT 3FQUA 3RIFK 4NQDA 3X12B 4RRPA 3V0VB 5IHZB 4JHBA 5AD0B 3SDCB 3QUZC 3QEGL 1KULA 5LBSL 3WN5C 4GRLB 3STLB 2YD7A 1OSZA 2ITDB 3P77A 1FNGB 4HIJB 4F7MA 3SGEH 1U8OA 5KBNC 1CXIA 3HG1B 4LLWA 3AU1B 2E6QA 2R1XB 3FONB 1I1YA 3C08H 4QXUH 1HEZA 1DCLA 4EEEA 4P2QA 1G7MA 1AQDB 3QDGB 3W11D 2B8OT 5HYJA 4JRXE 2FYYB 2B4CC 3C6LA 4NQDB 4BK4A 3GMPB 4E5XA 4V2CB 3KLAB 1JHTA 3VXUD 2VDRH 2XN9A 2MCPH 3VFWB 4I3GA 2Y4SA 5IMLB 3QQ9D 4QHLB 1ZMYA 5SWSA 4M4PA 1YPZE 5BV7B 2V7NA 3EUUA 4PRPD 4LIQH 1YEDB 1T83A 3X3GL 4I0KA 1INDH 1QBML 2XY1A 3FO2B 4YHKH 2AXGB 1RUMH 1KN4L 5FF6B 3S3PA 2Q20A 4HMDA 3CSYB 3O6LH 3SGKA 1JMXA 2I5YH 4ZODA 1XR8A 1FVCA 2NLJB 3TNNA 4ZUSB 4MYWB 3D87B 2RB8A 5BOZG 4GW5A 5DC9B 4NO3A 4P57B 1JZ5A 1R5WB 4QXUL 1ZWIB 4JM2F 4TRPH 4LLMA 4X6DE 2X09A 3PWNB 4OF7A 5IJKA 3JV4A 5GRWA 4OD2B 5CEXA 2OR9H 2XZAL 3OZ9H 2GTWA 4MNGB 1RUPL 2X70B 4H0GA 3F7YB 2R1WB 5C70A 5SX5H 1T20A 2EC9U 1YY9C 3MRCB 3PXHA 4AIXA 1D5IL 1GAFL 1UJ3C 3MZTA 5DHYB 5LQBL 3NFSH 4QRTA 2L0DA 4G80B 1W0YT 3QWQB 1CXFA 4P2YA 2XA3A 2VZVA 4RAVB 3IDJA 5IOPA 3W5MA 3LRSA 1MFDH 1DANT 2OTUB 3ARFA 1ZSDB 5H37H 2D4DA 2D9QB 4X4YB 1W72B 5H37G 1JF1A 1YJDL 4IHOA 4JFXB 1JYWA 5IMMB 3BN3B 4U7MA 3ZTNH 3QUMA 5DLMH 3SY0A 1RU9H 2QSQA 4K3JH 4Y4KD 4ZS7H 4KKAD 5LQBH 5L2KB 3IU4L 3LEXA 4PJHF 5D1ZB 5DZLA 5CGYC 1U3HD 2C1OA 5KS9F 4J3XA 3VXRA 3ZKNC 4PS4H 1H5BB 1I7TB 2OP4H 1U3JA 3I2CL 1AC0A 3RWJB 3PIQB 3GSWA 1FNFA 5EUOE 4PY8J 3NH7H 5EU6E 1CGUA 1WZ1L 4GAGH 5FUOH 3ES6A 2I24N 4N8CL 5F7NC 3WE6A 4QTHA 2DQFB 4JB9H 3TV3H 5JA9A 5AWNL 3D0VA 3TPUA 5C0FB 2P46B 5AZ2L 5DS8A 3DX7A 2P44B 4WU7A 2DQJL 1EGJL 1ORSB 3W39B 3RWJA 5E2JA 3BOVA 4KXZH 2CLZA 3U4BL 2A6KA 4HHAB 4H1LH 2AJXH 3BJLA 1VFBA 1P84J 4C83A 1IGFL 5DRWB 3QNYB 2Q86B 4DTGH 5IHUL 5GGUB 2C7UB 3MNVA 1KCRL 1CD0A 4N0UA 5JDJA 5MEOA 1G84A 3V5HB 1UM4H 1P1ZA 3FFCD 3L5JA 2ZOLB 4FZEH 5TDOA 3DO7B 4OLXL 3VFOA 2NMSA 1MJUH 4N5EC 6FABH 3O3BA 2UV3A 5M7QA 2HN7B 4HZLA 4V1DB 3CSBA 1RZJC 4L4JA 4WFFE 4G43A 3HC3L 2DM2A 1BD2A 4X9GA 3S4SA 2F54D 3H9SE 4JFDB 1T7ZA 2I9LA 5HI4D 2P8MB 1KEGL 3GM0A 4R97C 4A2MA 3UAJC 1G7QA 1MJ8H 1DR9A 1OAKH 4KMTL 1YEKL 3QIUB 3IDGB 3B9KA 3GSNB 5IB2B 1NGZA 1ZA6A 2FX7H 4RWYH 5C6TL 3V0AC 4G6KL 2YKLL 1ZHBA 4WENB 3EYSL 4FFWD 4PGEB 4XXDA 3UJJL 1FVDA 2NY3B 3MBXL 4F8TA 1S8DA 1LK2A 5DD1H 1D6VH 3MFGB 1DQTA 3PDOA 2FCBA 5D5MA 1E27A 4YHZH 4KRPC 3X11B 1M7DB 2FX9H 5C08D 4ZG1A 4OAWB 1UM5L 1T83C 2VQTA 3LEYL 1J9CT 3ORJA 2P5ED 3WLWD 3QP3A 1J86A 2YSSB 4HJJL 1QFWI 1U2HA 2ADGA 4GRLA 3STLA 2DICA 2PUQT 2EDRA 2YD9A 2VIRA 4PJXB 4LFHG 4M7LL 1U91A 5F7FA 3FQRB 3KXFB 1FV1B 3NCJL 4EVNB 3MLRH 4XC1H 4NIKB 1UZ6E 3K1KC 5E2WL 2UWEE 1PEWA 5F88B 1PZUB 3TZVD 4XNUH 1FCGA 5KS9B 4HF5L 1E4KA 3HNVL 4HK3N 4UUJB 5DO2D 2IANB 5I18H 1CN4A 3FB7A 4QRPA 4Y1AD 4Z7UF 3BD5A 1RZ8B 2PW2B 3D1MC 5DUMH 1T1XB 4DGVL 5HYIA 3MV8D 5DA4A 5GZOD 5FEBA 3G5YB 4LQ1A 5JHDA 2XTJC 3SDXB 4CVXA 1Q8MA 1FZMA 4NO0D 5D7JD 4B5EA 7FABL 5L88H 5HGAA 2KPNA 3AS0A 5DHXB 3O6FD 2W0FA 1UYWL 1ES0B 1BOGA 3HC4H 4JAMA 1JF6A 4HLZG 1JPGA 3EAKA 1MFEL 3W39A 1QEWB 2H26B 4WDIA 2HTLC 3QUXD 4GW4B 1MREL 1K4CA 1CQKA 5B38A 1H3GA 2R2EB 3U7WL 2RFXB 3HB3C 4U1IA 1WIPA 2GK0A 1OTTD 1EAPA 4QRQB 4BQCA 1S7QA 1QFWM 4YXHH 4YQXL 4H5SB 4TSCL 1IGCH 5L9DH 1IMHC 4J3VA 1R0AL 4IIQB 4LCYB 4NGHL 3KLHC 3FHAA 2AABH 4TSAH 1S7SB 3T3PE 5E8PA 1BFVL 5FUZH 4P46A 4JFXA 1NANI 4EXPX 1GZQA 2IF7A 4QRSA 5E70A 3C60B 2VDKL 3ARFB 4PRDA 4R26L 1XGTA 5CCKL 3CMGA 4ZAKD 3JWOH 4XPGL 5DT1H 2VE6A 1WICA 2I9LB 4ODXA 4LKCA 1YN7A 2H3NA 4GAJL 2XZCH 1P4BH 4G3YL 1QA9A 5EWIL 2Y1VA 1MQ8A 3T3MF 4G9FA 2LQRA 3PWUA 1IM3B 4XVTH 4ZDHA 3RX7A 5JIPA 5GS1B 2QLVB 1Y0LB 1EBPA 2BFVL 4PLNC 4X7DC 2HVJA 1T5XA 3FFCB 3C8KB 4H1LA 3ZYOA 3BIKB 4M8QA 3C60A 3U1SH 3HTLX 1D5XB 4QKXB 1DZBA 2P42B 4LVOC 3B43A 3TBVB 3CU7A 4MQ7B 43C9A 4DOHE 3MV9E 1ED3A 2B1AH 2CK0L 3DXAE 3FQTB 3MROB 4JFFE 3RY4A 2BC4B 4JGJA 5J1AB 1JZ6A 4MJ4A 1MY7A 1A22B 1UFUA 1KBGL 5GGUA 1IGIH 3HNSL 3WL9A 1H3WM 1U3YA 1I9JL 2HFFA 4F9PA 4OZ4B 2DYPB 4PR5A 5DRWA 4HUVB 3IFNH 5CBAA 4L29B 4L4TE 4EN3A 1FC2D 4PY7B 1Q1JL 3G6AB 3VGHA 4JO1L 5FCSH 1S78C 4YEFA 5C7XH 1H8NA 1NBZA 2P8LB 3RWFA 3PWJA 1B4RA 4GO6B 2DQHH 5CIPA 3WJLC 4NO2B 1I1AC 4FFZH 3WE6B 5BVPH 1YMHA 5ANME 2ZCLL 4KTDL 4XNQA 1HYSD 3LKOB 2BY1A 2D03L 2DF3A 1CFTA 4G6AD 2XQBH 4UV4H 3VFNA 4NQCA 5HYEA 1W2KT 3VI3E 5D1QC 3S8WA 3MJ7A 1FNHA 5GSVB 4P2QE 2D31A 3GSUB 4J3UA 2Q87A 2GYSA 3S6CA 2FX8H 1U42A 3WD5H 4LLWB 2J2ZA 5C08E 4P3DB 3GKWL 3NABH 1FNGA 3H6JA 3ROOA 4NDMA 1IKFL 4K8RL 2WNGA 4ZSOA 1F90H 4GG6B 2WP3T 4LCWD 4Y8AA 4FFVD 2ORBL 4N0YH 2GJ6A 2IFFH 5EOTA 3P11H 1KEMH 5I1IL 2YBRB 5GRUH 5GZNC 4LLVB 2P4AB 4N0FA 1N3NA 2VZ3A 3GZKA 4I4WA 2EDNA 3PHQB 4XP9H 3T09A 3JWDC 5KOVC 5HDBF 4G6AC 4M4RA 2ADFL 3VFUA 2VC2H 5DHYA 4P2QD 5E2VH 3RJQB 1OP3H 1YDPA 2JIXD 4UOW1 5TQ0L 4UQ3A 5C8JA 2UUDK 3HS0B 2X70A 4PJ8D 1F6AB 2G9HB 3NIGF 3K80A 4WV1C 3FB5B 1UB5A 4JFYB 3VXQA 4A6YL 2IPTH 2FH8A 1G7HB 4M7LT 4I2XA 1U8LA 4JB9L 1YEKH 1FFRA 3UTOA 4KAQH 1CE1L 3GB7A 4CW1B 1G0YR 2F19H 2WUBL 4Q6IB 3RVWC 3HZMA 1OW0C 3OJ2C 3CLEH 3BZFB 3HZKA 1N5YH 2L7UA 4OCSH 1QR1B 5FF6A 4KXZI 4IOFD 4CL7A 1FLRH 3D39D 4JJ5A 4XMKL 2W9LA 3CCHA 1X4XA 5I1GH 5I30L 3GMQB 2Y5TB 1ONQA 3QZWA 5BOPA 3M45A 1KXVC 2PXYB 3T0BA 4NO0B 1HINL 5D7JB 2GUOB 4JDZB 1UQSA 3G6AA 3CCHB 3T0ED 3O6FB 1T5WB 5FECB 3DYOA 1X5YA 2DQCL 1CLOL 1P7QB 1TZGH 3MXWL 1G7MB 2EKSA 4M6OH 2OTWA 3NCCB 4WHCA 4RFOH 1VGEH 2BNRD 3BP6B 3L3DB 5C08B 5K9JL 4XPHH 3ZO0A 3B9KB 1WEJL 2YEZB 2FBOJ 3PDDA 2Z31C 1MIML 2MMXA 3HAEG 4JM2C 2EDEA 2ITDA 3VWJA 1BAFL 4ZFOL 5MEPA 1DL7H 3H9ZA 1T5XB 3RX8A 4XNXL 4ZS6D 1II4E 4X9IA 5D2NE 3LKQA 4JLRB 1T4KA 4AEEA 5AD0A 2ICWA 3BAEL 4NUGL 4LPTA 4F7CB 3W2DL 4QRPD 4KDTA 4R6UA 5ANMB 3VD7A 5C0CE 5HYJE 5I15H 2DQIL 5CILH 3ULSA 3QEGH 3EYFB 1ORSA 1B0WA 4HAFA 4QO1A 3VW3H 3BPOB 3QA3A 3FT2A 4HJGA 1MRDH 1XEDA 2BXYA 2DKSA 4NWTL 4UILL 4MNQB 1LWRA 3ZHLA 5HHNB 2IAND 1BVKB 2XIDA 5AAWA 2PCPA 1IBGH 4NM8H 2W65A 2M1KA 4HIEA 4NZRL 3LKRA 2MQCA 4NP4H 4XP4L 5BRZA 1HWGB 3I75B 1KIQB 2AI0L 4X98A 2YN3A 3AAZB 4WUUA 5M95B 3O6FC 3I6KB 1BBJB 3CZJA 4ERSH 3ARUA 4GBXD 1H0DA 3QCTL 4NWUH 2HJKB 1VGKB 2V9TA 1Z5LA 5D7JC 3K4AA 3PJSB 4Y1AE 1G7JA 4BQ8A 4PLKD 2VXTH 1SYSA 2EYRB 1ZVHA 3O2DL 1UM6H 2GHWB 5CEZE 4HHAA 3ARGA 1A2YA 3U6RA 1ND0A 4PB0L 2ZWLT 2YK1L 1R24B 3FB8A 4FZEL 1Z2KA 2YWZA 1QP1A 3CJJA 4FQHB 5D7KE 3LKRB 5C92A 4KK6C 1U6AL 3L95B 2OTUA 1M7XA 1OF2A 3IKCA 4HXAL 4XPBL 1A5FH 4QOKD 1AXTH 5FHAL 2V2TA 4WI4A 4Q9QL 1DN2A 3PGCB 3GSXA 4PS4L 4ODHL 1RIUL 5E5RB 4Z7OF 2FECI 2GUOA 3EFFB 4JDZA 1BLNA 4KQ3L 5EU5A 3KNBB 1T89C 1NGXB 4KJQD 4LSQL 5GSRB 3TO2A 3REWB 4DK6A 4Z7WF 1FC1A 3IYLW 3L3IB 1ZEAH 3DNKA 2HFFB 5D5ME 5DEGA 5DJCA 1G7IA 2WWKT 5HVWA 2JJWA 3S3SA 3RIAF 2DM4A 4KZDH 1RZ7H 3CDGA 1N4XL 1FYTE 1KIQA 1KEGH 4PV8B 5GS2H 3RL2A 1T7XA 1R6VA 4MXVF 4PP2B 2CO6B 1CK0L 3MR9A 5EO9A 5CJBA 4NNXA 2OJZH 3MC0A 4CUCA 1G9MC 5C2UB 1FBIH 4RBPH 1KCVL 3IDJB 4KFZC 3OGOE 4IOIA 4B53A 3FAXA 4OFVA 1N7MH 4X5XB 4I2XB 1DVFD 4WWKC 1CICC 2E5EA 2VQ1B 3RUGA 3E0GA 4PB9H 4LHUA 1HK6A 1EH9A 1W72L 1S7WB 1U3ZA 3UAJD 4YUEH 2F54E 3WCYA 2R23A 3D39E 1A9BB 4R2GC 1BJ1J 5JPNB 5D72H 4CN4A 2V17H 1C7SA 2FWOA 4QHUA 3GJEA 5DD3H 3LZFL 2V2WA 3D85A 4PLOB 4KKBD 5HI5C 2R0ZH 5KVDH 2GT9B 3R1GL 1P9MC 4OQ1A 4M00A 5I8OL 3S5LG 1HSBB 1IAIH 3VXOB 5D7IF 1OM3H 4K3EH 5E94A 3PXJA 3IDGA 5DZOA 1ZLWK 3CC5B 3MRHB 4KJYA 1T2XA 4JFZL 3TBSB 1XCQA 3RHWK 2JJUA 3FB5A 3BH8A 4GUPA 3I02B 3SDCA 2HKFH 1D9KC 2ZSWA 1XGUB 3ZHDA 1X4ZA 3DSFL 4JN2B 4KKCC 2UWEB 4RAUA 2PR4H 2R0ZL 5J0BA 5I0ZA 2XN9E 3DWTA 4J23A 5F6HI 3ARFD 5J3HD 1M05B 4YFLF 1DUZB 1HHHB 3DMMC 3DUUB 2OSLA 1BD2E 3PWJB 4I0CC 2R0KL 2HH0L 2GJ6B 5EOTB 1FL3A 3O8XD 5FKAA 2NZIA 1QSFD 2XFXA 3SDDC 3H2WA 2YRPA 4LBEB 3H9HB 3P4MA 1CDYA 4PJAA 4PJ8B 4TSBL 1NCTA 4U1MA 2MTPA 3QJFB 1U8JB 1J12A 2FL5B 2D4FA 4UUJA 2HYMA 3ARDA 5H2BA 2HWZL 1BQHB 2QHLA 3IFOA 3RX5A 2W0LA 2HA1A 3BPOC 2O5XH 5F7HA 5B3JE 2W9EL 3DX8B 4DCQB 1D9KD 5JXEC 2ZCKL 4P5TA 2LVEA 4PJ5D 1F4YL 5CBEB 4F9LC 4P3WA 4I18C 5TE7H 3NFNA 3NGBC 3E2HC 1BWMA 1FFOA 3HRZA 4HV8B 1KB5B 1MCEA 2NY6C 5CIPB 1XIWA 4U33A 4K3JL 3ZDXE 1KLGA 2DMCA 4JFOB 3ROOB 2EEBA 5F1IA 2R0LL 2VDPL 4ONGH 1JFQH 1YN7B 2H3NB 4PJDA 4S1SL 1DEDA 5KG9A 5I74C 4GBXB 2PW1B 1O7SA 3QFJA 2ATPA 2PTTA 1NAMH 3PL6A 4DQOH 1IM9B 5HI5D 5IESL 4LMQE 4KKBC 4JREB 3QHFH 3HZVB 4M93B 4G42B 2XQYK 5F1NB 4FQCL 5HVGB 4TUJB 4M6ML 3G6JB 2EH7L 3ZDXF 3I85A 3GRWA 5D7KD 4R2GD 1S7VB 3VCLA 43CAB 4ZUTB 3GRWL 4KH2A 5F9JB 4KK5D 1FFPB 3Q6GL 1IAMA 3O45B 4P4RB 1A9BA 4H88L 5EUOA 4QRQA 5IEHB 1W8NA 3AMLA 3K81A 1J8HA 5C0GB 3CVIL 4UDUB 3OKEA 3W2DH 2AS5M 1P4IL 3IS0X 4XAWH 5GGRA 3P4NA 3GUTB 4WW2A 4H26B 3NFNB 5D9SA 3BSZL 1DBBL 4P9MH 2HKHL 4HBCL 3G6DH 2VDOH 4QHMB 1V3LA 4LVHC 1NEZG 4HC1A 1K3IA 1HKFA 5CJ8A 5E8EA 4JFFB 2XZZA 4OCYL 3QSKB 3M17B 3G08A 3U48A 3TIDA 4F37K 3DGGA 5DHVA 2FB4L 4EIZC 5I71B 5IWLA 1XR9A 3G5ZB 4U1MB 5FM5O 1CGSH 1EAJA 3WFDH 4C59B 3IDXH 4LLQB 5IBUB 1FVEA 2Z92B 1MFAL 3G5VB 4KJQC 3U0WL 4PJAB 1C8PA 4JZOA 2EDKA 4ODUB 3FB7B 4YUEL 5FGRA 1CL7I 4LHQB 4JRYE 2A6KB 3DROA 4FQ1L 1MCRA 3H3BC 1PD6A 1DJSA 3G5XB 5EZLB 3DRQB 4YHNB 3U0PA 3LQZB 1KIRB 2LABA 4NFCA 1I3RB 4K07A 1F4AA 3LZFH 1QD0A 1HOCA 1RMFL 2R9HC 3K2UL 5D2NC 3VRLF 2HLAB 1ND0B 5D70H 4Q9RH 4ZYKA 1GYAA 4Z7OE 2WAHA 4JM4L 1H5BA 1I7TA 1L7TL 4M03A 4PLKC 3P4LA 5DMGD 3T4YA 2EE3A 2QQLH 4G9FE 5JW5A 4GBXC 4PBWD 2V6HA 5CINH 1A6ZB 3I3EA 3BP5B 1MI5D 5EIIB 2CRZA 3LV3A 4UDTB 4ZSOE 3L1OL 4ZNEA 3O4OC 2YD1A 2VLRE 2XPGB 3O6MH 5I1JL 1UXWA 1I8LA 1KCUH 1IEAA 3KHOA 1N5YL 2FATH 3O3AB 3UTSD 4D0BA 2WBJB 1N5AB 3DXAA 1OAYH 4MA1B 4OFYA 5J13B 3SE8H 4OLUL 4YK4B 4JQVC 4PRBA 1KJ2H 2XWTB 4MB4A 1C5BL 3QZWB 1UWGH 5FB8A 1AGFA 1GXEA 3QUKA 2F74A 3MRCA 1PG7H 4X7CC 4YXLL 4NQDE 4OFKA 1GIGH 2VWEE 4F80A 4PJGB 1AGCB 2Z31D 5HXMA 1NBQA 2C3HA 5C0RL 1QR1A 4ZFZA 1NC2B 3KPMA 3IDIB 2DB8A 1YQ2A 3GGWB 4U1LB 3O9WD 1XF3A 4KDTC 4ZAKA 5HHOE 5DF0A 4FQPA 2G5RA 2YA1A 3X11A 1MFEH 4W4OC 3BWAA 2VZUA 1LO4H 2O5YH 1FYHB 3O4OB 2NY5L 1JGVL 1HSBA 1INQB 3DHMA 5EZJB 1KLFA 2E9WA 3VXQB 4OQTA 4AZ8A 3MV01 4M61B 4Z7WA 2ZUQB 3GNML 1LP9A 2HVKB 2NX5E 2VNCA 5HVHB 1BX2A 1DBJH 3E8UH 3VGAC 2Q86A 4JFZH 5EC2A 3MODL 3EO0B 3MRPA 3WLBA 4CDHA 3KLDA 4IOFC 2MWCA 2YD8A 5J1TC 2V9QA 2VDRL 4BKLA 4NNYA 4DWHA 4UILH 3AY4C 5C0FA 2V2XA 3MNZA 4XWGH 4N9OB 3QG7H 3GHEL 4X5XA 4RRPG 4BQ9A 2MHAB 5KW9H 4HZLB 4FOMA 4LGRB 1KG0A 3ETBF 3MRIA 3DRTA 4OT1L 3C6SA 3MO1A 5E6IA 4LCWE 3VXRB 5C6WH 3HLAA 3TC9A 4DN4L 4D9LL 2R1YB 1Y6KR 3LY6A 4DAGH 1FNSH 5CUSH 4JHWH 5JHDD 1FDLH 3I6KA 2J7LA 1IAOA 3HS0A 4ESKA 4E41D 2HRPH 4IBLT 4NJ9L 5FHBL 1MAMH 3AMKA 1QSFE 4S1DC 1F8TL 4M8VA 3GJFK 3L3JB 3GMLB 4RZCB 1ZK9A 5FYKL 5HHOD 2PCPB 3I6LE 3LB6D 3DX9B 4I4WB 3FT4B 1X7QB 3PGCA 3QPQC 3TA3A 3KPOB 3ARPA 3AGVA 3NCMA 5DD5L 4OCXL 3CH8A 3H8NA 1ZLUH 4QCIB 1HDMA 2F19L 2WUBH 5GJSL 4UDUA 4PRNA 3WFCH 3VXSA 4B7IA 4WTWA 3VMOA 3WKMH 3LKQB 4C4KO 4GSDL 2NY4B 2APTA 4LNVA 2PETA 3MV7B 4YDLB 3P3YA 3JV4B 5CEXB 3M8OH 1D5MB 4NZTH 2D7TH 4AMKL 1G9NH 4JHAH 4RIRA 5CKAA 4L1HA 5EO1A 1LEGB 4MAUH 3ZMRA 1CF8H 3I75A 1CLZL 4JFFD 1AXSB 1TZHA 1H5BC 4OLWL 5D70L 3VFRA 5IK3A 4PBXA 4OBSA 4XT1C 5E2UH 5E8NB 4APQA 2R39A 4NN5B 5EWIH 3QJHA 4LL9A 1MELA 2KZWA 3GO1H 5EIQA 2IADB 3X3FH 1IGJB 4LEOB 2X40A 5L7XL 1NFDE 1MUJB 2MQ0A 4MJ5B 5T3ZL 2CIKB 2QEJA 3GKWH 4P2OC 3RZCB 1PX3A 4OZGB 2Z92A 5BZWB 4Y16C 2VDLL 2NY0B 4FQQB 4H8WL 2BCKA 2CDEB 4X4ZA 4XX1G 3SDCC 4CJ1A 1TZHB 2BNRE 4MD4A 1P53A 3FRUB 3EHBC 4UT9H 3NA9L 2OI9B 1NFKA 5CP3H 3X13A 1RZIB 3ZT7A 1DUYA 3UTSB 3RVUD 3UPCA 5IHUH 4QHMA 1CLZH 3TN0D 3MMEB 4DEPB 2AV7A 4PJIB 5EUKB 1XF3B 5FYKE 2N7AA 2OTPA 2IPKB 4X9HA 5LG1A 4LP4A 1N0XH 2FO4B 3DETD 4NN7B 3TBWB 1WWAX 3V4VL 3BE1H 4XBGA 1NDMB 2X4PA 3F7QA 4KPHL 2XG4A 4W4OA 3GHBL 3B3IB 4FQJH 3THMH 3TN0A 4Z7QE 1KJ2A 4R7NA 1K5NA 3ARDC 4JR9L 2VDLH 4H8WH 4QEGA 3T1FB 1MHCA 1ZANH 4G3YH 4RAUB 3IXTB 3DXAB 1AKJB 4HUWB 5DT1L 4DOHB 3KLHD 5I8KH 1FLRL 4HUXB 3ZT5A 1KOAA 4XBEL 3SGJC 2PF6A 1E6OL 4YDLC 3LHPH 2ESVA 5D4QA 2ZUWA 1FL5B 1GOGA 1OTTC 3TLRA 3HB3D 4NQEA 2FEEI 4F9PC 5ICYA 3PP4H 4M43H 5C9JA 2EXWD 1F5WA 2W59A 1MVFA 1F6AA 2G9HA 2BHYA 4GW4A 1KB5H 3QDJA 4EUPA 1S7UB 3SDYL 3EYUL 1Q9WB 1QLEH 4I48A 3B9VA 3BQUA 3DVFA 1MH5B 2XXMB 5D93B 5DJ8A 4DGYL 1JIBA 3QUML 4HEPG 4PJEB 4AEIL 3UZEA 2XTJD 1UEYA 4FFYH 2G5BA 4HWZA 3ZTJH 4UV7H 5FYKD 3FCTB 3IJHA 4RGNC 5INCA 2BXZA 4FQLL 4OD3H 1SJHA 1QHOA 4OZ4A 1RZ8A 3BPLB 2RIKA 1RJYB 3WNPA 4NYLB 1KB5L 1MWAA 5DO2C 5F7LB 5DDHB 4ZTOH 3CLEL 4EIGB 3TZVC 5EO0A 4Y5XC 1IVLA 2YD5A 4NRXA 1CDUA 1T66C 4YWGL 1BFOA 3TBVA 4DGVH 4OKVA 3R0MA 5CJXC 4RBPK 3STZA 2A83A 3CFIC 4LLUB 4MWFA 3GK8L 5JO5B 2ADIB 1F02I 1DP0A 1GRWA 4GKNA 1A14L 4UB0H 3QFDA 3MRKB 1NMCB 3ARRA 3MREA 4JREC 1S7WA 1UZ8A 2CRYA 2CIKA 3RZCA 1T03L 3WLWC 3REWA 4P5KA 2YOCA 3MGAA 1FE8L 4DGIH 5IGXL 5DI8A 3X17A 3OGCB 5IFHH 4NZTL 2CO7B 1FFPA 3SJVD 5GRUL 3GJFH 3VRJA 1OAZH 1A1MB 3O2VL 4Z8FL 4DJMA 1CGXA 4IRSA 5T3ZD 5T1LD 5E7FA 3GI9L 3CU1A 4HPYH 4LHUG 1DDHB 4MQ7A 43C9B 5J4MA 4ONFL 4ZUUB 5EIIA 3IETB 2AAVA 4FQQA 5IMKB 3QDME 5FYKU 1HKLL 3SO3C 5HI4C 1HYRC 2PW1A 3BP7B 3KDMB 1N8ZA 4MNQE 2DLGA 4I0PC 4S0SD 3KYOA 4X6CB 3X3FL 2EDWA 3VGBA 1LDPH 1QFWH 3BP4A 3TJHD 1BWWA 3VXSB 3FQXA 4NUJA 1K4DB 2FGWL 4JFHE 4HXBL 1MJ7L 4M7JL 4PY8I 5I75C 2VQ1A 3RWGB 2BVOA 4FQIH 4PGCA 3OG6B 4ZNEE 3MRFA 1NLDH 1SJEA 1QUNA 5TH2B 3SKJH 1G0DA 5ESVB 3BW9B 5DFVD 3RGVA 5JA8B 5C0JA 1IC1A 5F7DA 1DE4B 3DO7A 3PJSA 1S9VA 5T33L 1U3HB 1ZHLB 1LE5A 3C2AL 2J88L 1EGJA 3NPSC 4PJ8A 3WHXB 3QUZB 1TJGH 5MEND 4KPHH 4U49A 5D6CA 1AJ7H 4Y2OA 1CGWA 4EDXB 1U6AH 5E8OA 2QSCL 2R0WH 4C56B 3O3EB 1Z3GL 4JGMA 1YPZB 4G6JH 1KPVB 1QLFA 5DUBB 5CLWA 5DK3A 1WISA 5AYUH 1XGRB 1QACA 5IHBA 5IBUG 4OZIE 2LU4A 4NQCE 2GW5A 2NR6C 5EUOB 1U3HC 3VXME 3MV8E 1RJZB 4ORZC 4KKAC 1OQXA 2PTUA 4Y4KC 2C1OB 2RR3A 3LHPL 1BJ8A 5D7IE 3BZDA 3AREC 2UVEA 3VWJB 1VACB 3LN5B 4JANA 5BJTA 4LNRA 1GGYA 5FYKH 5DYOA 4U0RB 4J6RH 5FDWB 3MLZH 3U0TA 3WIIL 4HPOH 4Z95H 1INQA 2AI0H 3L3HA 4OFPA 5TE6L 1S8DB 1F3DJ 1QBMH 3QFJB 3WO4B 2FSEB 3V52L 3BKYH 5I73C 1REIA 1WCBA 4A6YB 3O2WL 3B6SB 4QF1A 4XTRD 2JJSA 4Z6AT 4KTEL 2EDBA 1KB5A 3QEHB 1CWVA 1L7IH 3B8YA 3F65A 4MMXC 5ESAB 4X0KB 5DJXA 1JGLL 3ZDYF 3SJVB 2COQA 3MRMA 3SBWA 4J3TA 4BH7B 4HK0A 4HG4K 2YZ1A 4FS0A 4LCIH 3UC0L 1TVHA 4RISL 1AE6L 3ZHKA 1HWHB 4CW1A 4F2MB 4P59H 2ZCKH 2WQ8A 5B39G 4J4PD 1N64H 2B1AL 2CK0H 2H1PL 2ZUYA 1NFIB 4HK0B 4JKPH 1MCDA 3N06B 4U1GB 4ZPTB 4ZFZB 4MXWL 2EIEA 3BVNA 4CRPA 2BY0A 2A6DA 2R0LH 1QLRB 3WXVL 4JE4B 4HWZB 3UO1H 5I73B 5F72S 1NLBH 2VO5A 1KPRA 1V3MA 1GH7A 3JTTB 3TJEL 4WO4A 3VH8A 4HFUL 3N1MC 1A6TB 4NQVB 3B6SA 4HT1L 1FDLL 1FLTX 3RZWA 3VXSE 1IFHH 5DVNA 1U8IA 4N8VA 3QBTB 3VFNB 4GMSH 1J10A 2QADD 3GMNB 1S7RA 1ERNA 3HC3H 4NO2A 4FG6D 5TF1H 1LD9A 4PD4K 1RUKH 1XCQB 1CQYA 3G04A 4JFDD 3V5DB 3SE4C 3GSNH 4D8PB 1ITBB 5E08L 1HKLH 4U1SA 4O58H 4WVRA 4K94L 1UJ3A 5EBGA 3GHBH 4FQJL 5D71H 5LXGL 5DMKB 1Z5LB 5DK2B 2Y36H 4FXLA 3IDYB 3DV6B 5EU3B 5BV7C 2C7UA 3MNVB 3CFCL 2K9UA 5IB1B 2A9NL 5F7DB 1UZ6F 3LSOB 4OGXH 4K3EL 3PHOB 3QDHA 3GI8H 5C0CA 1IAIL 4DW2L 3EYQD 4NC1E 2D9CA 5MI0B 3UMTA 1N26A 1OAXL 3WIFB 3FT2B 2JJTC 5T1DL 2YUXA 4JDVB 2HLFC 4WFGD 1MCPH 4ZDHB 1MLCB 2OR9L 4QTHB 1FNAA 2B39A 3L5HA 2P43B 5CZKA 4EDXA 4POZD 2IPKA 5L9DL 1UCTA 5FO7B 3UTQA 4DVRL 3TCLB 4N9GA 4Y2DA 3BRGC 1NEUA 5IGXH 1JNNL 1A7RL 5FYJH 1U2CA 4K94H 2HMIC 3O8XA 4KJPD 1KT2A 2VXVH 4LPYA 1AI1L 2L4OA 2AK4D 3TZVA 3JUZA 3MLWH 4DW2H 4YDKH 3VG0H 4MJIB 3RTQD 4JKLA 5KSUA 4P46B 4G6JL 4O02H 1DLFL 5D1XD 2FD6H 3NCEB 3WMSA 5D9SB 3Q0HA 1ZSDA 4Y88A 3HE7B 4POYA 1SJHB 2BNQE 5L88L 3NBNA 1PKQB 1G9EA 3H0TB 4DEPC 4OLZH 5B22A 1ZLSH 1KXTB 2RCSL 1J0KA 5CEZL 2ZUVA 5DVMA 3U7YL 5HHPA 3DVIA 5E00A 3RAJH 2DQJH 4HWUA 2BNQB 1DFBH 3MRKA 4P23C 4LF3A 5HI3C 4JZNA 3INUH 4BZ1H 5I76B 3I9GH 3OBAA 4WI2A 3AS3A 1IGIL 4NKDA 3N85H 4ODHH 1FYTA 1N6UA 4KK8C 3PQYB 1OAYL 3G6JE 5FHAH 2DLIA 1BJ1H 2AEQH 3H7LA 4LRNL 1G7PA 1KPUB 1RZ7L 2EDDA 4JO2L 5SX4I 2GJJA 1BGXH 1P69B 3FFCE 4LCCA 1PG7L 1X5IA 1KELL 2CUIA 4TNWK 3AM8A 4G8EB 1CGVA 1D7FA 3MUGA 3FO1A 1K4CB 3I6LD 4OCRL 4HUXA 1QA9B 1GC1L 5F7KC 3LD8B 4CJ0A 2KZ1B 2WANA 1E4JA 4LOUD 1AXIB 3K4DA 3DTXB 4OLEA 1EHLH 2DMKA 3OR6A 1MH5A 5CGMA 1YECL 2DD8H 1A6TA 3BKML 1J0HA 4EDWL 3RL1B 1QVOA 1JYNA 3P9MB 4YDVB 2EDQA 1NCCH 4HG4J 1NMAH 3IF1B 4XVJH 2J6EA 3MGTA 4RGNB 3MRRA 4ENED 4X80L 2VOTA 1QSED 5B38G 2ENYA 5I1HH 2VKXA 2I60H 3W9EB 4HK3J 4OGYH 2B4CL 1MOEA 3G6DL 2EE2A 4MAYC 1AIFB 5DD3L 5ACLA 4P3DA 2PYED 3BXNA 2H32H 4AQ1B 2AJVH 2OTWB 4GMTH 2R2EA 3FN0L 2AXFB 3WFEH 4QOKA 1OM3L 2PYFB 1YN6A 2H9GB 2P24A 4WWKA 1P2CB 5FIEA 5IFAL 4MD4B 1NL0H 1S9WB 1RULH 2UWEA 2G75A 4X6EB 4XCEB 5DTFB 1BVLB 4QHUB 2WLYA 4DZ8A 1T7VA 2VXSH 3HCVA 4EDWH 3VXRD 4HUKB 2VLLA 3C09B 1ZHNA 4OIIL 3GK8H 1ZGLM 3TBWA 4PRIE 4N68A 5I1KH 5FK9A 5LKNA 3QUYC 3RBGA 3DSFH 3PDOB 5B8CA 1TCRB 4NKQB 3DUSB 4K8RC 1FAIL 4C4KT 4Q6IA 1GZPA 1EX0A 2DBLL 4MLSA 4HH9A 5C0BD 3RL2B 3B83A 4BH7A 4D9QE 4QWWC 3QWOA 1XGQA 4CADB 35C8L 3TIEB 3Q1SL 1T1YA 5C09D 5SV3A 3JWDL 1CZ8H 2NY5C 5D7LD 3W0WE 4M1GL 3VXMB 1J0ZA 1PKQE 3EFFA 1GGIL 4XMLH 5K9OA 2BERA 3BWUC 3UYOD 1NCWL 3LKNB 2FSEA 3GIVB 1KIUA 3ME0A 1E27B 1JN6B 1G6RL 4MVBD 1EK3A 1I1AB 2ILLA 2XG5A 2AK4A 3IJSA 5C0DA 2HT4D 4BZ2L 3IKKA 4JGUA 4TUJA 2HT2D 3ULUH 4E9LA 4GG6E 1P7KA 4MXQD 4ZOAA 4R4BA 5FYJU 1T04B 5MENA 1DE4A 2CXKA 2PR4L 3HE7D 4KKNA 4YK4C 1U8HB 1FPTH 3QUMB 4J2XA 1PY9A 4KI5C 4PJXE 3ZE2E 4QRUB 3TH4T 1MRCH 3BUYB 5FO9A 1H15A 4ODBD 2NY2C 4NZRH 3A6OA 3HZYB 4FA8A 4Y4HB 3QA3B 3SDXF 1NCDL 4OF5A 5DRXB 2P8PA 5DJAA 3DMMA 4NQVA 5FDYA 4MA8H 5HHXH 2VXTL 4KQ4H 3MLSH 3VXNA 4YZFF 4K9EH 2VDOL 5IG7A 5A43C 1F6LL 1K8DB 4KVCL 1DBBH 1MQKH 2IEPA 3LOWA 4XP9L 3ARBC 2BX5A 4QXTB 1QRKA 1JPSL 4YDJA 1KCSH 4PJFF 1KXQE 4L4TA 1MCBA 4LAQH 2PN5A 2MQ3A 4WEMB 4PB0H 3VD4A 1PQZA 3VG9C 3NAAL 4HH9B 5CSGA 4JRYA 3T2NH 4YDKL 3HNSH 4NKMB 4XPHL 1MHEB 5T1LA 3GSNL 4Q74A 3KPSA 5ABDE 3QDMA 1P6AB 1JI2A 3HI5H 4F57H 3IJYA 4W6YB 4M7LH 3FO2A 2DIAA 1FO0H 1QKZL 3ILQD 3QIBB 4X5WB 4M48H 4O4YL 3BKYL 3BP4B 1AR1C 4Z9KB 4ZQKA 1XIWD 2HFGL 5CP7B 1EXUB 4OZIB 4JVWA 4MWFB 4NFDA 3NIFE 2X4UA 1CD1A 1NUDA 1IGMH 5D6DC 4XCFL 3MO1B 5E6IB 5H35A 4NC0B 1QFPA 4XPFL 2WIIB 3VGGA 4ELMA 5EU6D 1DSFH 5D7SL 1KCVH 2NXYC 4FQCH 5HBBA 4F15C 2XPGA 1IM9A 1JZ3A 2EICA 5F9OH 4JKPL 4TTGA 1YY8A 3L1OH 2BDNH 1WAAE 4JG0L 4HIIA 2DQEH 4U2YA 4EKXA 3SGEI 2Z9TA 3HG1A 1OL0A 4PPTA 5I19L 1CFSA 1AE6H 3GEWB 2PO6A 5EA0H 1G7HA 3HNTL 2FJGA 2X6MA 1IAIM 4YBQD 4GXVL 4EN3D 3F6IA 2ERJC 1CU4H 4RFOL 5JR1H 1FO0L 1QKZH 1ZTXH 3RGHA 2FEDD 2BNQD 2R23B 3SQBA 3MLXL 4YQXH 2IH1B 5DURB 3MCG1 2ADIA 5BXFA 1MLBB 2R4RL 2VH5H 1T21B 2WBWB 3I6GB 4WI6A 4R96A 4N8VG 3RVTD 3TF7C 3TT3H 1IM9D 4GLRH 3QAZC 1CFNA 5HY9B 5I74B 3JVGA 4YEEA 2H2PD 5HGAB 4NKOA 5J57B 1IEAB 5TJWK 4OF3A 1FL5A 1U8KA 1IC4H 4OIBA 5JNYB 4ONHB 3BUTA 4KROB 4J1UB 4R26H 1UB5B 4JFYA 3OR7A 3L3KB 4U6XA 1Z6JT 3AM8C 1YQVL 4YGAB 4XVUD 5DYOB 3G5ZA 1G1YA 2Z91A 5EC1B 1EVTC 4AG4L 2A6JB 1CFVL 4H20L 4JY6A 1RIVL 2HH0H 1NGXA 1OARL 1Z9SA 2Q8AL 5EU7C 1IC5H 4RMTA 5T1DH 3L7FB 3VRIA 4U3XA 5DD6B 1WSST 1AGDA 3GUTA 4MCYB 1MCWW 4JRYD 3GMOB 3E8UL 3ULUD 2J6EL 4G7VH 4K2UH 4WFHE 4QXWA 1BBDH 3RQ3A 4OAWA 1QRNE 5JPMA 3S3JA 4TQEL 4NCC2 1CG9B 3MBEC 4NSKA 5FKPA 5IF0B 5I71C 2KQNA 1BZ7A 2GTZB 1PKOA 4LPWA 4P2RA 1FIEA 4LKXA 3RIFF 1RV6X 2CH8A 4NKDB 1I8LC 4GH7B 3ARQA 1F4XH 1WV7T 4TVSa 3V8CA 3M07A 3BX7C 1ODAA 5F93C 2APBA 1S9YA 2Y7QA 1Y0LA 3MJ8A 4JQVA 2DI8A 3IXAA 4W6XB 4JKWA 2X05A 5T1KB 2P5WE 1EFXA 4K71C 4DQOL 1F8TH 1XIWB 2UUDH 1YEFL 2N1KA 1KGCE 4Z0XA 2X4RA 1YMMD 4R9HA 1EIBA 3D3VD 2AJSL 2R1WA 1OWRM 4Y1AA 1A7QH 4NT6A 4YHYC 5I30H 1T4KB 5B4MD 3EYVA 3N85L 3A67L 3TT1L 4PRDB 3DGGB 3V0WL 1EHNA 5DRNA 2YPLB 4IRSD 4JVUA 4PGBB 5C0BB 5JIIA 3X13B 3GFUA 4JFFA 3RP1A 4XMPL 5DZNA 2FL5A 2H1PH 4ODWB 1IQDB 3WFBH 4Y5YC 4FFYL 1EO5A 3HRPA 2GTZA 4YFLI 1NQBA 4IJ3B 1G7IB 4WFHD 2Z35B 2O61A 1ETZB 1M7IA 3FHQA 5JW3H 5KOMC 5FM8A 3LIZH 3UTTE 2A2QT 5IEHA 4TSCH 3KPLB 1U8NB 3CAFA 5JORA 4PG9A 1DQMH 4FP8L 4MAYB 3V0WH 2Y7QB 15C8H 5TQ0H 4WEBL 4WI3A 3CFDB 1F58L 1U0QA 4BFEA 2AK1H 3AS2A 4PRHE 1U93B 4FXGA 1EO7A 1H9VA 4EZMA 4Z7VA 1GVIA 3HPLB 4YBLB 4NQTA 5IB1A 1Q38A 4NGHH 3QDGA 1GHFH 5GGSA 3P9LA 4TULL 1IGTA 4GQPH 5FKPB 4Q97A 3CLFH 2YZ8A 1J0IA 3CNKA 1R3KA 4Y16B 1GPOH 2YD2A 1ACYL 5J89A 4RDQF 2EO1A 3SDDB 4ELMF 2B4CH 4LU5L 5E6ID 3VA2C 2X4OA 3W9EA 3RA7L 1ZLVH 4ZMAT 1YEHH 4M62L 1BVKA 5H8DA 1PY4A 3VWKB 4M6AA 2J12B 1NGPH 4HEME 4OM1L 5F9WB 1N0XL 5EBMB 3BGMA 5CD5C 1MFNA 3NH7L 4RZCA 2GAZA 3DOSA 1OY3B 5DD5H 1F97A 2YBRA 2EZ0C 1BX2B 4RFEA 5ENWB 3EJYD 4LSTH 4U2ZA 1EV2E 2MNUA 2ADGB 1A4JA 2DIBA 3MUZ1 3IFNL 2AJZB 2H41A 4KRMB 4Z0BL 1DL7L 3BH9B 1A1NA 3PGDA 3B9EA 2NYYC 4HLJA 1ZWIA 1TQBB 4AIZA 4G8GD 1KBGH 4M1CD 4CU8A 5HDBE 2MHAA 3FOMB 4FFZL 5CFHA 3MLYH 4AH2A 2VZTA 1YJDC 5BV7L 1SYVB 4Z78A 4KVNL 5F6HJ 1XGPA 4RQQB 5E5UB 3GSQB 1CICA 2MPAL 2WIIA 5FECA 1A64A 2VUYA 5DJ6B 5KSBF 1FFNB 5ACMA 3RWDA 1AGBA 2DQTH 3O9WA 5EN2A 4PJ7F 1AJ7L 2GJ6E 3EO1A 4Y4FC 3H9SA 3CZFB 5GQBA 2Z31A 3QXDB 2P8MA 3VFWA 5IMLA 1OLLA 4WIQA 3EJZC 5J11C 4JZJC 1BQHG 3ROLA 2VAAB 4I0PA 4PJAE 5M94B 4KTYA 3X3GH 5F89A 3VFTA 3S88L 4K55A 3IRPX 2DYPA 4PR5B 4KJWC 1NGWA 1X3DA 2XKSA 2OLDA 4POUB 1OGAD 4KMLB 5KSBE 3HI5L 1LK2B 1OTUC 5DA0B 5SWZE 2SEBA 4LP5A 2JCCB 4PJ7E 1PBYA 3UTSA 3PF2A 2OZ4L 2AV1A 4JN1H 3R4DA 2KH2B 3ZYIA 1JRHI 4MD0B 1P6FA 4MJ2A 2ORBH 4YHZL 4P4KB 5GPRA 5DD1L 1KTLB 4HIXH 3QUKB 3MUHL 1CFVH 3PL6C 4H20H 3FTGA 3CPLA 3VFUB 2WINB 3JV6B 3SJVE 3WUWA 3P0YH 3KYNB 4APQD 4OKDA 2NY0D 2P5EE 1HQ4B 4NQCD 1HHJB 5D1XA 4KKLC 4LK4A 4OV5A 3VWKA 1L6XA 1Y6NR 1GGTA 4XVJL 4NNPL 5FO9B 4K23H 3JVGC 3RKPA 3OX8A 5T1MA 5CMAA 4DN4H 4S10A 4NKIH 5I66A 2YA2A 1FZJB 4XNUL 5ALCH 2Y36L 4O5LH 4Z5RA 3DV6A 5EU3A 4HBQA 2QQNL 4HKJB 3TYGH 5BJTB 4G8FA 3L6FB 2R4RH 4PIRF 1CG9A 1ZLUK 5C0AE 1CS6A 4Y5XA 4G6ML 6FABL 1SEBA 1UKQA 4R90H 5CS7A 3MV7D 1BLNB 4PJBA 3LH2L 3DHJA 1YC7A 1MCSA 1HHGA 1LE9A 1NJ9A 4D2NA 1CFTB 4JRWA 5CINL 4DKAA 4L3AA 5J13C 5KVMC 4YBLC 5DSCB 3RWGA 1JN6A 3AS1A 5C0CD 3TYFB 4C54A 3T0VA 5F3BB 1J11A 3OKEB 4FABL 1HI6B 4XNYH 1IC7H 1NAKH 1U92B 3ROLB 2APVA 5I1JH 3O4LB 5I0DA 4HC1H 4L5FL 3NCYP 3N9GH 3SE4A 5C1MB 3OHXB 5IIEB 5F9JA 1F3JA 4XZUB 3IETA 3E6FA 3TVMC 2AJSH 3S37H 4JLRA 2VITA 1ZHLA 4G7YH 4XNZC 3EW3B 5IV2A 1DTUA 3FT3B 4LLUA 4FQ2H 5E4IA 4NQDD 3ULVC 1CF8L 2ZJSH 3V9FA 3FZUD 1I1AA 1QFUL 5EPMA 1VFAB 1CE6B 3OAZH 1KTRL 2W65B 5F9DC 3X14B 4P46D 4KZEH 1CXKA 4YDIL 2ZG2A 2JB5L 5CJOH 3F5WA 1VPOL 2XWJB 3C6LC 4LVNB 3ZE0F 3GGWA 4U1LA 1QSEB 5J9PB 3L3GB 1LK3H 3FTGB 3CK0H 25C8H 4IJ3C 1T5WA 1FV1A 5I1LA 3QDAA 3QHTC 3MA7B 4KI1A 2AGJL 3UP1A 3G6JF 3SDAA 2ZUXA 4PJXA 5F6IC 2XZCL 1S9YB 4NO5B 1AGFB 32C2B 3BEVB 5IMKA 4PJ5A 4P5TD 3MACL 3EYOB 4TSBH 4K3DL 3A6CH 1U95A 5F70A 5K9QG 1AQDA 1UADC 1A1MA 5JHLH 1JNLL 4NSKB 3SDXE 2Y6SD 4L8CB 4V2BA 4PRHD 2AERT 1T3FB 5AWNH 4DVRH 1UEMA 2CSPA 4ZFGL 1UQSB 2V17L 4MDJB 1PYWB 3VJ6A 2YPKB 4MHHG 3V8OA 5JW5B 3N1QC 4ZFFB 1EERB 1TJHH 3MLWL 3CX5K 1MVUB 4M02A 4HKXB 5SWQB 2X7LB 2VJXA 1UH2A 3BKJL 4NHUA 5F3HB 4OFYD 3GMMB 1A7PL 3P9MA 4YDVA 1CICB 3BMVA 3D0LA 3C6LB 1NCDH 1X5KA 1BFTA 2DQHL 3VG9B 5DMIH 3HZKB 4AH2B 1C1EL 3PABB 1OARH 2HJFB 3HPJA 5DJDA 5I1EL 4MA3A 4HF5H 1ZT1A 3U0PB 3HUJE 2XQBL 5A2IH 5E8OB 5BVPL 1P4LA 3L3KA 4JPIA 2GEEA 1FZOA 3NCFB 1A4JB 2QHRH 4UI2A 4IRJC 1X6LA 1DBMH 1ZLVK 4PJIA 3SQOL 3LMJH 2XICA 1CDHA 3RY5A 4RFEB 5IHZA 3D85B 1T80A 4XHJC 2AKRA 4R96B 4UAOC 3PWVB 5GIRB 3BGFC 5HGBB 3C5ZA 3TN0B 4NQCB 1SY6A 3B9KD 3DX7B 4CNIB 2HT3C 2J8UB 2BCKB 2CDEA 1KCUL 5I75B 3H3PL 4Y5YA 4X7SL 4AMKH 3U1SL 4JFQA 3Q48A 4Z77B 4PP1C 5GHWL 3WXVH 3DVGB 4PJDE 3BYYA 4GT7A 4G6MH 5IBTL 4LCCB 1QBLH 3EDFA 3IDMA 5E6ZA 1PW3A 4ZOEA 1MIEL 3LDBB 1T2QH 3ALPA 3WYRA 5KVFL 5EO9B 4IMLB 3IVKB 5I1CH 3OKNA 5JZ7D 4L1DA 3QQ3B 4WI9A 4XBEH 3FRUA 3UZVB 2EDOA 1T0MB 2Q3ZA 3JUYA 2YPLA 1YMHB 1CTOA 4H0IA 2IMNA 2DLFL 5JW4R 1NBVL 3LKNA 4WFED 5E00B 1RZJL 5JIKA 3IDMB 5JOPD 1A7NH 3SDAB 1MCOL 1NFDF 1L7TH 5D96B 3GSRB 4F3FB 4Z7UE 3MRNA 4P4KD 5D2NB 2MFNA 1RMFH 4KY1L 1CLCA 1KTKE 4LQFL 4OV6F 1OAZL 1QLFB 5DUBA 1AO7E 2JF1A 1U8QA 1R3LB 3T0EE 5L8JB 1I8IB 3R06B 2DJ4A 3FT4A 4DCQA 5IB5A 4PLJC 2HT3D 4NNXB 4HKZA 3B9KC 3B4NA 1OAXH 5DR5H 3O6LL 2W0KA 3IFOB 2FZ3B 2Q7YB 1FO0B 1OOAA 3QWRD 3DBXA 4K3GA 1D5MA 3QI9A 3QJFA 5AZ2H 1HXMB 2ZKHH 3G5YA 3E6FB 4Y1AB 1U3HA 4EQ2A 4GKZA 1R3HB 3V52H 3L3IA 4KHXH 5CMAB 4GBXA 5I6XB 3HE6D 3NFPA 1H3VA 5FA3B 3VG0L 2C4XA 1A7NL 2F58H 3A6BH 2BSED 3F8UB 1CT8B 1Q94A 5L2JB 4NJAL 4Y4HA 3WIFA 3BGAA 2J8UE 4LSUH 3WNKA 1NC4B 2H8PB 3ES6B 5IK3B 1B4JH 1JGUL 3QG6B 3VRIB 2G2RB 1JV5A 1MWAL 1U8IB 1Q9WA 3C5ZB 4IRZH 3SKNA 1JPGB 3JWNC 3BZEB 1QRND 5B39A 4AT6A 5HDOA 4QHKJ 3CFKB 1JNLH 1VESA 5BMFL 1RFDL 3RKDC 4KJYB 2FJFA 5IW1B 3SGDH 4Y4FB 2P45B 1P4BL 3I3DA 4UT7H 1S9KC 1AIFA 1VFUA 1HHIA 2JCCF 4R7DA 3PP3K 1FJ1A 8FABB 3RBSA 5ITBL 1FZOB 5D5MB 3SE3A 4F7TA 3CFCH 3WFCL 4Y89A 1MCCA 1U8KB 1JGDA 4J3WA 1RK0A 4M6NH 4E42B 3ALWA 5FCUL 2Q76B 4HULB 4YR6B 5IB2A 4OCWH 5E0QA 1LEIB 2IAMD 2GFBB 2QADB 1A02N 1OPGL 4PGJA 5LGHH 5C0NC 3BE1L 1B0RA 5CP7A 1KELH 2F54B 5ICXB 1GL4B 3IFPB 2VISB 1XGUA 3TFKC 1BP3B 1IGML 4OT1H 5SWSD 4NQED 2VXQH 4S1RH 3V6OC 4MS8C 1QNZL 1X5XA 3L3GA 3PG2A 4Q9QH 4Y2DC 4CVWA 2IG2L 4GRLC 3QO0A 4JY4B 1YEJL 2FBJH 3C5ZC 1JUFA 2XNAB 4OZFA 3C6LD 4QYOB 4GW5B 2NY3D 1JF5A 4KDWA 3GB7B 1MF2L 3MFFA 3D85D 1J5OH 1OTSC 1CR9L 3VFOB 3VI4E 3QO0B 3S96A 5F7MC 3ZSTA 3F7PC 2NXZC 5KVEL 3RUGE 1LP9E 1WITA 1F58H 1AD0B 2DDQH 3P0GB 2X9WA 1WFTA 1DQJA 3LDBC 1UVQA 4HIXL 4P5MB 5IVOA 4HDIB 1VADB 1HCVA 3BQUB 4PD4J 4JFDA 1R3IH 3MRDB 4LLVA 5J12B 4P2OA 4EI5D 2HFTA 2VDNL 4H88H 3CUPB 3V6ZB 4PJ7A 3HFML 1YNKL 5LCVL 5FXCH 3RWHB 1NCAL 4NZUH 1C5CL 3U6RB 4PJBE 1ZHBB 2HKHH 1G9NL 1MF2H 3CSGA 1IAKB 2WSKA 4WO4D 1EEZA 3SE9L 4ODUA 4XC3L 5DVKA 5F1OB 5TDOB 4YE4H 4JM2B 4Q0XH 3SPVA 1KSRA 2V5YA 2UVFA 4JRXA 2D0FA 3UJTL 3S34H 2ICEA 3WBDA 3S5LA 3DBXB 5E03A 3NACH 5FGCB 1QOKA 5C0JB 4QCIA 2K7PA 1D3CA 1MLCA 3PHQA 4LSTL 4MZ3A 3BKMH 3WDIA 5IROC 5ICZB 5DS8B 2Q76A 1CFQA 3QIWD 3S36H 1CU4L 4YHIA 4APQC 3QNXA 1HIML 4EBQL 3G5VA 1HHGB 2NXZB 1KENL 3SGJA 2NNAB 2OL3A 1I85A 2HTKC 1U36A 5DD0H 4XMKH 4S0TD 3ZKMD 2E27L 1KJMA 2ARWA 3MRGA 2BOBA 1EEZB 3BIAX 1SJEB 5TH2A 3L3DA 2Z4QB 4X7TA 2DQDL 2E9IA 1R5VB 4X8JA 2WWMC 1FG9C 4LRIA 4UNTA 2FRGP 3U2SA 5ID0A 5K59E 1F4HA 1U8QB 1UXSB 3W9DA 4HAGA 3KYKH 1NGWB 2HWZH 4YHKL 3U4AA 3VGEA 3EDJA 5HGHB 2YUVA 3V4VH 3GSWB 3T08A 4BKLB 4O2EB 3DRQA 4O9HH 5GRYA 5JQ6H 1ORQA 3ZL4L 1A6AA 4G9FD 4AY0A 2R4SL 2YWYA 5ISZD 2PYEE 5FYJL 3EJZD 1H3TA 4I1NB 5HHVH 3U30B 1A47A 2VC2L 4X7EC 2F53D 4E0RA 4LCWB 1WIUA 4OTXH 1IC5L 2AXHA 4ODWA 1CDIA 2H2SC 3EDDA 3NVQA 4LRIC 3QPXL 1HEZB 5C86A 3GMRB 4MA1C 5CJXA 4KVCH 2CGRH 5CILL 1BBDL 4RAVA 5L6YH 1L0QA 3V7AE 2CK2A 4QXGL 2WUCH 5K9OB 3SDAD 3RIAK 1WBZA 3F12A 1WFUA 1I3VA 1LO4L 2O5YL 3G9VA 3ULVE 5MERA 4NM8L 5JOFA 3UDWA 1J0JA 3DUUA 5IVZA 3AXLA 1ZA3A 3LPGA 1J18A 2XWTA 5CLTA 1NFDA 2ZCHH 3EO1B 3QUMH 3UBXI 4AIOA 2AKRB 2WWMD 4TVPL 1WCBB 4A6YA 5ILTH 3KHQA 4LLMB 3MOBL 3KS0H 1L0XA 4MJ6B 3MLPA 3IFLH 3NZHH 1OB1B 1BEYL 2DRUA 3QRGH 1JZ4A 1TQCC 3ZKMC 2E8ZA 2X4OB 2JLLA 3JWOC 3ARXA 3DUSA 2P5WD 4P9HL 3F62A 5BS0A 2HTKD 4N90E 3GBNH 2E7CA 4Y4KB 2J5LC 1GAFH 2X89A 3H9HA 2OS7A 3EO9H 3KYMB 4OZFH 3HE6B 3HAEA 3QB7C 3FCTA 3G9AB 3IJHB 4OCRH 3MRQA 1CE1H 3FN3A 3PE9A 1S9XA 2DOCA 2VXUL 4AQOA 2FHFA 3VXOA 2D31B 4MCZB 5EORL 4NPYA 4D9LH 5F9OL 3KJ6L 4M5ZL 4IMKC 3MNZB 5CIPH 1DQLH 4CNIA 4JO1H 3DI2B 1BEYH 1QEWA 1UENA 3QRGL 4S11A 2P49B 4LF3B 4GXVH 1OCWH 4NPYB 2Z93B 5ALBL 5FV2A 2RCSH 2HRPL 2YPKA 1FIGL 4TPRH 3GI9H 5LJYH 4XPAH 1I1YB 1CIUA 1Q9LB 1UCBL 1PG7W 2FO4A 1JWMB 4GAJH 1LHZA 2BMKB 1M71B 1T0PB 5IBLD 3MRJA 3U46B 1FP5A 4Q9BA 2CLRA 3NGBB 2VUOA 3WS3A 3P2TA 5FV1L 4EUPH 1OGTB 1WUNT 4U1GC 4ZXBA 5TE4L 5EBLB 2GT9A 1A6PA 1B0GB 1ZT1B 3L5X