1UEYA

Solution structure of the first fibronectin type iii domain of human kiaa0343 protein
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
127
structure length
127
Chain Sequence
GSSGSSGPTPAPVYDVPNPPFDLELTDQLDKSVQLSWTPGDDNNSPITKFIIEYEDAMHKPGLWHHQTEVSGTQTTAQLNLSPYVNYSFRVMAVNSIGKSLPSEASEQYLTKASEPDKNPTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA0343 protein
publication title Solution Structure of The First Fibronectin Type III Domain of Human KIAA0343 protein
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 8
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2003-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ueyA00
4K3DH 1ZWIA 5DJDB 3TH3T 4G9FE 2C4XA 4MA3B 2W65B 4HGWA 1NCNA 3QJFA 1M7DB 1A47A 2RR3A 1OPGL 1NC4D 4DGYH 2FH8A 1RUKH 3ZKXC 4D9QE 1SJEA 3P0VH 1FP5A 4DVRL 4IS6B 3Q3GB 4Z78A 5HHOB 2E3VA 4YH6A 1CR9H 3PNWA 3QH3A 4TOYL 1ZGLB 2AJXL 2UWEA 3ARZA 4NKMB 4OZIA 1DBJL 4NQVB 3ULUC 3NN8A 3QDMA 5C6PB 4OZGB 4XCEB 4C4KO 3AXLA 2WBJB 3L3OA 5CIPH 1NBYA 4FP8H 4OT1H 3UTPE 4LVHB 2APFA 1LHZA 4X9HA 3WUZA 4LQFH 5EZJB 1VGEH 3KPSD 2ORBH 1T03H 1H8OA 4EVNB 1R6VA 2YPKB 3P0GB 2VLLB 5LWYL 3O3EB 3S5LA 3ZKNC 2YRLA 4DOHE 5E2VL 5ICXA 2G75B 5EZLA 1QBMH 2NXZD 1G9MC 4ONFH 4IDJH 4HMCA 4JM2C 5JNYA 1WIOA 2FEDC 4KJYB 1GZPB 5JOPE 4EDXB 2C1OA 1A6ZA 4Z0BL 2XQBL 3D3VA 1JPGB 2CK0L 2VLRD 4NZTL 5KW9L 2J8OA 4YDKH 1MJ7L 4MB4A 3RL2A 4YE4L 5FM8A 3U0PB 4MD4A 2AS5M 3V6OE 4Q97A 3OKOB 1CGVA 3RA7L 3FB6A 2ITDB 4XWGH 4M3JA 2QTEA 1T2JA 3MRLA 2YD9A 5D8JH 4K7PL 2ED8A 8FABA 4ZUVA 1FNEA 4NCC2 1UG9A 2B5IC 4PRIB 1BAFH 1MPAL 3N50A 4YHYC 2D4DA 1IT9H 1KJ3H 3VFSB 5E2TH 5BV7B 5L6YH 1HE7A 1HYSD 1TETL 3KS0J 1A3QA 4NQUA 1NUDA 4M6ML 5FYLD 1CFQA 2KDGA 3IDIB 4AK1A 3ARPA 4BYHA 5DRXB 4P23C 4F15B 5IMMB 4JG1L 5E6ID 2MPAL 3OWEA 1DDHB 5BJTB 4QLRA 3U1SL 1NFDF 12E8H 4YX2L 1MCEA 2DKUA 5DSCB 3NOIA 4O5LL 4UTAH 4JFYB 4ZPVA 4E41B 2VAAB 3HG1A 5GGUB 1RFDH 4NWUH 4ZQKB 4M5YL 4JKLA 3KPNB 5F7WC 4OLZH 1C5CH 5ALBL 5C0RL 4FQ2L 3NIFE 3DX6B 1WTGT 5FHBL 4GG6F 1QFUH 2FL5B 3ZT5A 2VAJA 3QFJD 4LVOB 4DN3H 1NCAL 1WSST 1YEFL 3BT2L 2WBJC 4TSCL 2P24B 1OP3K 1IRAY 3GI8L 1BQHA 3HAEH 1DBMH 1CD9B 2GKIA 4MD0A 4DTGL 1FVEB 3BZEB 2CRYA 4LVHC 1MCSA 1SBSH 4KTEL 4OGZA 3GUTB 2E8ZA 2VE6B 4XWOC 4HUNB 3BZ4B 2UVFA 1NJ9A 2F5AL 2GSGB 3CDYA 4XP6L 1S5HA 3KYKL 5KSAA 2L7UA 3L5WB 1ND0B 3A6BL 2VDKH 5D1XD 3AS0A 4WUUD 5T3XE 2GIYA 3CSGA 1D5ZA 2FJFA 5K33A 5DJ6B 4OJFL 4UUJB 3O6FB 4RMUA 1XGQA 3MJGX 5E1AA 1I7UA 2W9EL 1OP3H 1S9VB 1MFEL 5JW3L 5KVEH 2RFXA 2ZOLB 4ZS7H 1A7PH 1JGLH 1F45A 2XI9A 4FFVC 2CDEB 2GCYA 3O6MH 4H1LH 2NX5B 3EYVA 4U1JA 5DDHB 1LQSR 2VZUA 2P5WB 4PJIB 5ANME 4I2XA 3THML 1VFAA 1UXSB 2NY3C 3RX8A 2HTLC 2IG2L 2YRZA 3CFCH 1H0DA 1A7BA 1FFNA 3FQRB 4NCDA 2F19L 2ARWA 1U3HB 3EJYD 2BX5A 5F96L 1QSED 3S3PA 3SBWC 1FFQA 2NYYC 4NQDD 1DBBL 2X4UB 3EZJB 1HXMA 3UDWC 4JLRB 4KQ3L 4WFED 1JPTH 4NCC1 1H3GA 4PB9L 4UOW0 1F6AA 3VWKA 2QADD 4XC1L 3D2UD 1DLFL 2FGZA 1M71A 5EOCJ 3H9SA 1RU9L 4MZ2A 5BW7A 4HC1H 1SHMA 3L1OH 2HJKA 4G80B 1VFBA 3TBWB 5L88H 1O5DT 4F15C 4ZYKA 5DI8A 1JGDB 4HJJL 1BVKB 3L7EB 4M43L 2NR6C 1UCTA 4HQQL 1NCCL 3TBSB 1NCDH 3VXMB 1N26A 1KLGB 1WQVT 3TJHC 3VJ6B 4NWTH 4WY7H 1JUFA 4XPAL 4ZDHA 1AD9A 1AXIB 5A2IH 1RZFL 5D70H 3VU2A 3O0RH 4JJHA 4LPWA 1AC6A 4ORGA 4NM4H 2QQLL 1E28B 3BAEL 3KPSE 2IADB 3SDAB 4NP4H 1CD1B 3BVNA 4YO0A 3WFZA 4CVWA 1HXYB 5I1DB 6FABL 3WNNA 3QT2A 4IEFB 2DLFL 1ADQH 2EDOA 3V5HA 1DFBH 3ARDA 2AABL 4RMQA 5E8EB 2W0PA 1TTFA 4TN9A 5IB5A 5GSRA 4NNYB 2HKHL 3O8XB 4KK9D 1NFDA 1MHHA 2VLRE 5C0AA 2YN5A 4L8CB 3DGGA 1R24A 1NLBH 2YMXH 1YEJH 2DIJA 3PJSA 5F89A 1Z9MA 3PGCA 3G5ZB 4ELME 3F5WA 3O2WL 3UTSB 2HWZH 3HI1B 2X4RA 4BH8A 3IXAB 3JVGC 3ZSSA 1TJIL 3STZB 4JQIL 4JM4H 1CGXA 4GG6A 1MHCA 5GRUL 2DDQH 1BBDH 4JB9H 1KCVH 4JFZH 4TVPH 3FFCB 3FJTA 3LQZB 3O6FC 3QA3B 4KK6C 3VXSB 4MA8L 2MKWA 3ZKSD 5I19L 1X4YA 5I1JH 1C5BL 5JXEA 3VMNA 3MXVH 1OAZH 5FYLE 5L2JA 1JNLL 1ZTXH 2D03L 2RCSH 4EZMA 5K9QI 3AB0B 1LE9B 4Z95L 3MMEA 4X98B 4PD4J 3PXJA 5DJ0B 1RZ7L 1WEJH 1DQQB 2KZWA 1AI1H 3O2DA 2BVOB 3AFLA 5CIPB 1FZMA 1U3HC 5C0JB 4Z0XB 4KY1H 1ZT1A 2Q1EA 4OD2A 2G60H 4XPTL 3VFWB 1XF2A 5CD5D 3GBML 1JHLL 1KPVA 3RBGA 1HHJA 4ERSH 5CGMA 3CFEB 5CSZB 3GO1L 1INEL 1VENA 2K7QA 1I8KB 5IFHL 1ACYH 4NYLB 4JR9H 5FCSH 2XT1B 5C0IA 3GDBA 4Z77B 1U58B 1XIWA 2KBGA 2R0ZL 3C60A 3DVIA 2DJUA 1MY5A 3QFJE 3T0ED 2GSIA 2GJZA 1WISA 1FPTL 3IDGA 2P44B 1XR8A 1C08A 2PR4H 3KNBA 3BD5A 1MRDL 1YEIH 5FUZL 4LRIC 4HIXL 1Y6NR 3MOBL 1UYWL 3EYSL 4HFUL 3VD9A 2P8MA 5CEYA 2W0KA 5DRZA 1OAUH 1RVFL 2R2HA 2SEBB 1UJ3B 1TJGH 3MJ7B 1UJTA 4WUUE 3O2DL 3TO4A 1I1FB 1D6VH 5A16A 5SWZB 1P4BH 1ZHKA 5ETUA 4K9EC 1OTTD 4MQ7B 4S2SA 1KLFA 3O8XC 1FIGH 2JELL 4HKJB 1JCKA 4ZFOB 1KT2B 1EZVY 3QIWA 4LDLB 4UNTA 1X5JA 4AZ8A 4ZO6A 3VGDA 4UDUB 1T3FA 1DL7L 1ZLSL 2B0SL 1QFHA 3MCLH 4Q2ZB 3TT3L 4L8SB 4U6VL 2Y36H 4KFZC 2PXYA 3Q48A 3TPUA 3Q6GH 1FNAA 1A6VH 1Q8MA 4K3JL 4J3TA 2J12B 2X9YA 4JG0L 1QSEE 3IU4L 4QGTA 4LPYA 4N0FA 4NQDE 1P4IH 3MRJB 5F7KC 5LQBH 1ZVSB 4WFEE 3QEHA 5J1SC 1TMCB 2F74A 1CFNB 1I8MA 1U93B 1OPGH 3DRQB 4DVRH 3WIIL 1A6AA 2FO4A 2P8LB 1U9KA 2VABB 5K93A 2X4TA 3GBNL 1OGTB 1K2DA 2CDFA 4TOYH 1FL3B 5F1KC 1HWHB 2AJXH 1XH3A 3AAZA 1DBJH 2N7AA 2XZZA 2BZDA 5HI4C 1YC7A 2BSTA 4G6ML 1J86A 4JRXB 4JY4B 3HAEB 5MEPB 4AQ1B 5ALCL 5F9JB 1TENA 3SKMB 1ITCA 1B6DA 1P6AB 1QPXA 2IPTL 1I8IA 2YD2A 2XQYK 1OP5K 2NNAB 2R0KL 4L1HA 1BF8A 4PRBA 3KYOB 3ARSA 4AIZA 4S1RH 5LWYH 1X6NA 5EU7C 1G7JA 2YN3A 5E2VH 4MQXD 2EO1A 4JREB 1H3VA 4NSKA 4ZNCD 1V5JA 4NC1C 5IWLA 3BXNB 2ICWB 4C83A 4EQ3A 1RI8A 3ZYIA 4Z0BH 2XQBH 2CK0H 4H1LB 4LCWB 4NZTH 5KW9H 4M7KL 2P45B 3L9RB 2JCCF 3D69A 1MJ7H 1ZSDA 4YE4H 1WZMA 1NAKL 3JWNC 3TO2B 4RGND 1CQKA 1LEIA 2GJJA 1U8JA 3RA7H 2VOTA 4PGCB 4Z7VB 3Q5OA 2LU4A 3QWQB 1UJ3C 1RUPL 1FL5B 3FN0L 1H8NA 5JIHA 2GJ6B 5I1CL 4R7DA 5CP7B 1E4WL 4XGZA 2Q8AH 3HCVA 4KI5C 4OZ4B 4XB7A 3SDCD 5JZ7C 2FEEI 5DC0A 1MPAH 3SKNA 1NANI 4D9LL 2LVEA 3O4LA 4EXPX 4XNQB 1F11B 2ARJB 3MRMA 3KYMA 2FZ3A 4PBXA 1TETH 1SM3L 1PKQA 1AGCB 2M1KA 5MERA 4M6MH 3ZYZA 1BFOB 2E7CA 3JZ7A 2EKSA 1MQ8A 3HZMA 3T0AA 4HIIA 3ARFA 4DFHA 4L8SC 4JG1H 2X9WA 1E4KA 2MPAH 2PW1A 3U1SH 1MLBB 1L4IA 2HFFA 1AQDA 4YX2H 2YK1H 4JQVA 5IB1B 1FLRL 4FQXD 1EUUA 5I16B 2O93L 4RIRA 4ZOCA 3IVKA 1EXUA 4P4KC 3LD8B 4M5YH 5IR1B 5E24E 3LN5B 3B9AA 4POYA 3VGBA 5DF0A 4MNGE 5ALBH 5C0RH 2PKDA 4FQ2H 1WBXA 4F7EB 4RSVA 1MH5B 3T0EE 3JSSA 5DJYA 5FHBH 2HH0L 3OXRB 3MLWL 1GVIA 3NA4A 1ZMYA 2P1YA 2KQNA 3P9LA 1T7ZA 4G6KL 3CFJB 1NCAH 3BMWA 1IGYB 1OW0C 3MRIA 1IGJB 3BT2H 3EO0B 1JVKA 4G7VL 2R56L 3M1BA 5DJ8B 4GOSA 3HAEG 1A14L 3FN3A 4U6YB 5BZWB 4DTGH 5GS2D 1D5BB 4KTEH 1MCDA 3G5XA 1VFUA 4PRNB 4Z7UE 4G8EA 3ARBB 2F5AH 3U36B 1C16B 5C0ND 4XP6H 4Y5VA 3KYKH 1ZHLB 4RFEB 1IC1A 3VFVB 1V7ML 3VXRB 3MV11 4O4YH 4JREC 2EKJA 3BP6A 4NN7B 2HT2D 1DEEA 2PTUA 2W9EH 1FJ1A 4QHLB 1MFEH 2H41A 5JW3H 5IHBA 3RWHA 4TUOA 2P49B 4NQTA 2RB8A 1EHXA 5HYSB 3R0NA 2FIKA 3EYUL 3KPQB 1U8KA 5EC1A 5I1AB 1U91A 5DRWA 2MCG1 1LVEA 2WQRA 3IU3B 3JV6A 1I8LC 1TJHL 2IG2H 1KLUA 1NDMA 3RGVA 3DURA 1HDMA 3I85A 4JFPA 1K8DA 4PJGF 1QHPA 2F19H 4X7DC 1IAII 4N0UA 1A7OL 5F96H 2M8XA 4QTHB 3SJVA 1DBBH 3U0TA 4YHKL 3U7AA 5DQJB 4XMPH 2GYSA 3ME0A 4PB9H 2JCCA 5I8OL 2C3VB 2VXSL 4XC1H 2VQ1A 1DLFH 1RU9H 2Y1VA 4M1CD 1E6JL 3VGAB 4HHAA 4IOIA 3U4EB 4AT6B 4AH2B 2EDLA 1UB5A 4H26A 1RULH 5B39A 1PX3A 2R9HC 4PJ7F 1OAKL 4HJJH 4M43H 5D5ME 5IHZA 1NCCH 2DL9A 4YDLB 2A6IB 4P2YA 5F7EL 1YMMB 4R7NB 5GGRY 2QQQA 5FIEA 1WC7B 4XPAH 4LCYB 1RZFH 5DRNA 1JHTA 5GRVK 4KKAD 4GLRI 2HT4C 2QQLH 2VZ3A 4IRJD 3BAEH 3V8CA 3LD8C 6FABH 4J3SA 1IM3A 4NO2B 3UTTA 1ZLVK 1HINL 2DLFH 3CUPA 1CIUA 3O45B 2AABH 1XF3B 3QIUC 3NABL 3LH2L 3G04A 4M61A 2C5DC 2HKHH 3FAWA 1QRNA 3X12A 3SE9L 1AR1D 3BD3A 4QRRD 4X0KA 1GPOL 1PW3A 1IGCL 4HK0B 3GZKA 4JDZA 5IP4A 4NQXB 4ISVA 4RGNE 5GZOC 4KKLD 3O2WH 1OVZA 3SKUD 1I75A 2XA3A 2ESVA 4MAYB 4XAKD 3UEZA 2I60L 4X7EC 2YD3A 3ARBC 1ZS8A 1A4KA 1TJIH 4JQIH 1NFIB 4YFLI 3BW9A 4I3GA 5GRUH 4GRWB 4OLYL 1UVQB 1LP9B 3I3EA 2XICA 3T65B 4NN7C 3D39A 3IKCA 5I17B 4YPGB 1EEZA 1ZA6B 4MA8H 5I19H 3VXTB 3BH8B 1K8IB 2CK2A 1C5BH 5M95B 3FB5B 3Q5YA 2UY7A 1N59B 3FO9B 1JNLH 5CEXB 5HYSG 3OQ3B 1INDL 3B8SA 5GSVA 3R1GL 1LEKA 4R4ND 3PGFH 5HVWA 4Z95H 1S9WA 4G6FB 2XTJB 1HQ4B 2FEEL 1RZ7H 5DHYB 5BVPL 3RTQA 3IAPA 4OFDA 1CICB 1P2CA 4KJPC 5FECA 4YAQA 1QP1A 2HYMA 4XPTH 3GBMH 5EUOF 1JHLH 4W4NA 3F62A 5DMYA 3GIVB 4HF5L 5IEHA 3BRFA 2QEJA 3PWPD 3V95A 3EYQC 3VGHA 1BD2B 4XP4L 4KZEL 4M8QA 3T3PF 3WFCL 4KRNA 4CADB 4LHUA 5IFHH 4N9GB 2Y07L 3C6LB 3MLVL 2BNQD 5E00A 5I1GL 4XRCB 4K7FB 5CLWA 1VACA 4PG9A 4GW1A 2ILLA 1ZWIB 1F8TL 5KSBF 3RUGF 4PJGA 3L3KA 1FYHB 1FPTH 1Q9OA 3QJFB 4S1QL 4QRPA 5B4MD 3GMNA 4MDJA 4WO4B 1SJEB 4WHDA 1BZ7A 1MRDH 4Z78B 4QHKJ 4OKDA 2EDXA 5FUZH 3BOVA 3PNWB 4Q6IA 3QH3B 4HIXH 5I74B 2UWEB 3MOBH 1UYWH 5CBEB 3PV6A 3EYSH 4HFUH 4I0CC 4OZIB 3G6JF 1T1YA 5CSGA 2VXVL 2AAVA 1RVFH 3NN8B 3QDMB 4Z76A 4OM1L 2AQ1A 4KJWC 3AXLB 3O2DH 5I9QC 3L3OB 2Y72A 4DKFL 1NBYB 1Z0NA 4PJ7A 3I75A 4Y1AA 4YBHA 3VFOA 5B38A 3BWUC 3DRTA 4ZXBB 4OLVL 4K8RL 3O3DA 1MSPA 1JK8A 1RPQA 2WBKA 5A3ID 1CVRA 3RZCA 1WUNT 3S5LB 3RDTD 4DZ8A 3FB8B 1KTRL 5EZLB 5ICXB 1DL7H 1WAAF 1BX2A 1ZLSH 4DW2L 1A1OA 3TT3H 5JNYB 4U6VH 3IRZA 3QNZB 2C1OB 2HP4A 1A6ZB 1MI5A 4K3JH 4AL8L 4PJ8D 4JG0H 4U1HB 1KTKE 1CCZA 2YPLD 2EYRA 2FR4A 2PTTA 3MFGB 3RL2B 2HG5A 2FX9L 4K55A 4MD4B 1T5WA 5IG7B 5CZKA 5EBLB 5F93C 3FB6B 3SCMB 2FRGP 2PYEA 1T1WA 4QXUL 3MRLB 2VLKA 5T1KA 3WIIH 8FABB 5D1QC 3DVNA 4ZUVB 1Q72L 2XWTA 5GGVH 1DVFA 5CEZD 2ERJB 5DJCA 4XI5D 1PDKA 1AO7A 1FNEB 1IAIL 3F7RA 2XTJC 3MA7A 3MQIA 5DVKA 2P5ED 4NQCA 1CICC 1OL0A 2Q7YA 4G8FA 3QEQA 4X7CC 1TQCB 5ALCH 3HB3D 1CFQB 3STLA 2E7HA 3DXAD 4HLZH 5FXCH 1JWSA 4IRSB 4FQQA 4JVPA 3MV9A 4Q9BA 4ZAKD 2IPTH 3S88L 3SPVB 2R0KH 1GXEA 2X4PA 1YEKL 2GTWB 3C6LC 1IKNC 3HE6C 4JEGB 4LOUC 5C09D 3BDYL 3LVEA 4YBLB 2WLYA 3HG1B 1MF2H 4U7SA 5T5NG 4QRRE 3LEXA 1AKJA 1G6VK 3QRFM 1EHAA 5GGTL 5H37H 5EUOA 1LK3L 4WO4C 3BKML 1IKFH 3UPAA 4RAUA 2XQYG 5CS7A 4WU5A 4ELKA 1NAKH 1YNLL 5KS9E 3PWLA 5F7LB 4XAKE 4M03A 5I74C 1QBBA 3QUZA 1Z3GL 4YXLL 5HI3D 3E3QC 4TTDD 1RUPH 4JZOA 2EICA 3FN0H 2IANA 1QA9A 5I1CH 5KSBA 1EEUA 3RUGA 1D3CA 1E4WH 1KPUA 4Y0GA 4LVEA 1X5KA 4MD0B 5CD3A 4URTB 4M93B 4D9LH 4ZXBC 3X11A 2W07A 5IUSA 2VZOA 1KUMA 3X3GL 1L9NA 1S5HB 5KSAB 5K9KA 1SM3H 5AD0A 3FHQA 1ZV5A 2FJFB 3S5LG 5EBGA 4JE4B 1UB6A 3G6JA 4JQXC 2QV2A 1BREA 4G6JL 1XGQB 5E1AB 1I7UB 4AEEA 1O7VA 3HC0A 2RFXB 4IMLA 3QYCA 4U05A 4U3XA 1JNHA 5JOFA 4I0PB 1FLRH 3EYVB 4U1JB 3PWPE 5HVFB 4I2XB 4OZHB 1VFAB 3SCMC 4M1DL 4LMQI 5TQ0L 5CZXD 1FFNB 2BNQE 4GRLA 4RNRA 1JGEA 1WAAA 1PD6A 5TDNA 2HH0H 3MLWH 1OT2A 1HXMB 4OQTA 1X5XA 4G6KH 1M1SA 1IAKA 1JNJA 2CUHA 1F6AB 1CT8A 3E1F1 3F8UB 3VWKB 1OCWL 1P84K 3H9SB 1TQCC 5KSVA 2R56H 1I1YA 4KWUA 2HJKB 1VFBB 4IRSC 1EFQA 4N1EA 3AY4A 3TBVA 4ZYKB 5DI8B 1J8HA 5HHVL 4I13B 1QFWM 4RA0C 4APQD 3PWJA 4JFDA 3D3VD 4P4RA 4X99A 1XFPA 5FYJU 1JUFB 3BQUC 4ZDHB 3QDGD 1I1CA 5L8KB 1U8OA 1EJ6A 4YBLC 4ORGB 3QUKA 1VPOL 1YNKL 3SGKC 4TYUA 4NUGL 4EDWL 4YO0B 3BVNB 2DBLL 3GSWA 3GMPA 5SV4A 5EU3A 1N0XL 3ARED 4FOMA 3PF2A 4Y4HD 1FVDA 2FECI 2OR8A 3ARDB 4HUWA 3SDXF 3NVQA 5IB5B 1G9NL 5GSRB 3U7WL 1TJHH 5D7JD 1L0QA 4GXVL 4G9DA 1NFDB 1MHHB 4J6RL 4B5EA 4HUXA 5D2LE 4X4XA 4ODBD 3VWJA 5I8KL 2YPLE 1P9MA 1R24B 1A7OH 4LLYA 3PJSB 5F89B 5F7YC 2HAZA 3PGCB 1LD9A 1ZVYA 3F5WB 4YHKH 5DZLA 4U1MA 1BQHG 5MI0C 4M93C 3OMZA 2X4RB 4BH8B 5I8OH 1WBZA 5GGSA 4C59B 2FGWL 2VXSH 2NW2A 2VXQL 3V4PH 5CEZE 1E6JH 1MHCB 3HMXA 2OS7A 1BF2A 3QNYA 1NL0H 1W8OA 3MRRA 1D9KA 1A0QL 1OAKH 2P5EE 3T04D 1I1AA 5F7EH 5GJTL 1W72L 1TFHA 5L2JB 3DXAE 4I0PC 3KGRA 3DBXA 3HKFA 4PG2A 2H3NA 2MNUA 3BO8A 5D6CA 5GS3A 3MMEB 3EO1A 4CN1A 4JFED 4PJFF 2R15A 4BFEA 4Y88A 1LP9E 1HINH 3GSNA 1FZMB 4N0CD 5C09E 1ZT1B 4F7PB 5A40E 3NABH 4U6TA 3LH2H 1KJMA 1KPVB 3QDJA 1HHJB 4MJIA 1Y0LA 2YS4A 4M62L 3SE9H 4OCRL 1FG2B 3ZHLA 1PEZA 3VWKC 3KYAA 3E8UL 1GPOH 1ZEAL 1IGCH 5BW7C 3C9NB 1X44A 5M7QA 1VCAA 5H8DA 5DQ9A 4MS8D 1XIWB 3MR9A 3C60B 3RX7A 4FFWC 3LKSB 3HMXL 2GSIB 2I60H 2OK0L 3X3FL 5E6ZA 1U2HA 2YD1A 3IDGB 5KN5B 3ZT6A 5I6XB 5ICZB 3BX7C 3WYRA 3QXVA 2HMIC 4OLYH 4CBPA 5F71A 1QQDA 1JPSL 1CDJA 2AW2A 4FXGA 1FQ9C 4KDTA 2P8MB 5CEYB 5DRZB 3O3AA 2A6KA 4EEEA 3MLUL 3PHSA 1B4JL 4ALAL 5FEBA 3TO4B 5A16B 1R5IB 3ARDC 4JFFB 5DURB 2Z0BA 1FDLH 5LAXA 1INDH 5CINL 1KBGL 5ETUB 5E8DL 5ISZA 2AJYL 4S2SB 5FOBA 3RRQA 5BVPH 3V5KA 1NANH 3ECBA 2LFGA 3QIWB 4FTVD 2X89A 1QSFA 1V05A 3F7VB 1S7VA 1YPZF 4PP2A 2VYRE 2B1HH 4K3GA 2QHLA 1ULVA 1KB5A 1T3FB 3WNKA 1H3WM 4HF5H 1EFXD 2P7TA 5DD0L 2PXYB 4HD9A 1PLGL 4XP4H 4KZEH 3WFCH 1KB9K 2Y07H 4HWZA 2VLJD 2C4FU 3D18A 3MLVH 5I1GH 4N0FB 5F3BB 1EEYA 3C6SA 3FT2A 3MA9L 3R0MA 3QEHB 2DLHA 1MJ8L 3OKDA 2F74B 1I8MB 4RMSA 5TDPB 2XN9A 3SDDA 3ULVL 5JXEC 4S1QH 2YPVL 2YUWA 4C57C 3VXNB 3U4AA 1AFVL 4MXVF 3QXWA 1A6AB 2FO4B 3WLWD 1CIDA 1NMBL 2X4TB 1K2DB 1XH3B 4KJQC 1NBZB 3AAZB 1F5WA 3D3VE 3V5DA 1T80A 5LJYH 3IDUA 4LFHG 2VXVH 2AJUL 5C0AD 5JXAL 1NEUA 3LS5H 4OM1H 2AQ2A 3ARTA 2HA1A 3QDGE 1I4FA 1FVCA 5I0ZA 1EBAA 3VH8A 5K59E 3A6CL 5DZNA 5DFWH 5GRYA 1UC6A 1CXEA 1KB5L 3ZKQD 3QDAA 4OLVH 4K8RH 5IB2A 3DV4A 4LSVL 2W38A 4AIZB 5DMGD 4NOBA 1G7JB 3VA2C 4DGVL 2NY3D 5J3HC 3EHBD 2HTLD 4DKEL 2E7LC 1XIWC 3C60C 3MLSL 4DW2H 1QHOA 4NSKB 4PJFA 1YYLL 4H8WL 3MBEA 5FO8B 4C83B 1U8QA 3BN9D 5D1ZD 3EFFA 5E8PA 4AL8H 4G42A 5I6XC 2FHBA 5HHQA 4MHHI 4S10A 1I9IL 4R97B 4OV6F 1QYGL 4F9PC 1ZSDB 4ZPTA 2FX9H 5IB4A 2FECL 4Q9CA 1LEIB 1U8JB 1YMHA 3B8YA 1CLCA 2A0LD 2CLRB 3AC0A 5I1KL 1I1RA 4QXUH 1F13A 2DWEA 5FB8A 1JYNA 3HI5L 1Q72H 3TO4C 1T89A 2AJZA 5SX4H 4R7DB 4XGZB 1IAIH 2C1PA 3QG7L 3BSZL 3U46A 1PX4A 4TUJA 3TVMD 5CCKL 1MCOH 1AQKL 1MIEL 1T7WA 2DMBA 3O4LB 4PP1D 3MRMB 2F53D 2F8VA 3KYMB 2FZ3B 3QIWC 4JDVA 5FAAA 3RVUD 3OJMB 1UWXK 1PKQB 4G8GD 4LNRB 1S9YB 2GI7A 4P9HL 5F6HJ 5MERB 1E27A 4ZFGL 3NIGF 3OKNA 4HIIB 5L7XL 3CC5A 2H26B 3QBTB 2J1KA 1CFSA 4F57H 4JFEE 3S88H 3RKPA 4B7IA 4G43B 1A6UL 1AJ7L 2X10A 1YEKH 3K8LA 2X9XA 2PW1B 1KENL 5F7DA 2ZJSL 2HFFB 3BGFB 5I0DA 1AQDB 3EO9L 4L29A 3BDYH 2H6PA 5C08D 1LWRA 5TH2A 5DHXB 3LRHA 1HQRA 4KKNA 4RIRB 2AXFA 3TZVC 1EXUB 5FGCE 3CFDA 5GGTH 1YPZA 5H37G 4EIZC 4PGDB 1LK3H 2P43B 3RPKA 3BKMH 3KPRA 3RWDB 5HHXL 2NY5L 1WBXB 1KFAL 1CE1L 2F8OA 1YNLH 5DTFA 5ABDE 3ZTNL 4WNQA 3B43A 3P9LB 4HKZA 4YXLH 4PY8J 3K1DA 4ODWA 1UXWA 2Z92A 3MRIB 1NKRA 5HI5C 1N64L 1FE8L 5INCB 3M1BB 2AJ3A 1J5OL 4W68A 4V1DA 1P7HL 2NXYB 3G5XB 3NIFF 4G8EB 3FHAA 1F42A 1RUAL 3X3GH 4Y5VB 1IQWL 4M4PA 3Q6FA 4ODTL 3GKWL 2VB5A 3IYLW 2DYPD 1UEYA 4TPRL 3R8QA 1CK0L 4CL7A 4Y5XA 3BP6B 4G6JH 5T1LD 2XY1A 1DEEB 5IWLC 1A02N 3C5JB 4G9FA 1FJ1B 2Z35A 2YA1A 3EFDL 4FTVE 5ITFA 2Z31A 3RWHB 4TUOB 4CMMA 3K46A 2ICES 2FIKB 1H3UA 4R97C 1CWVA 1U8KB 3DJ9A 5EC1B 1U91B 5FUCE 4JRYA 5DRWB 3REWA 2VITA 3OF6A 1V3JA 4QOKD 1A7QL 5K9QG 1J1XL 3DO7A 2DTML 3JV6B 2R4RH 1KLUB 1NDMB 3DTXB 1FH5L 3RGVB 3DURB 2VLJE 5TQ0H 4JFPB 1K8DB 2AK4A 4OZFH 2CDGB 1I9JL 1VEPA 1OSZA 4N0UB 4ZTPL 4CN6A 1R3IH 2O5ZL 2FLBT 5DJ2A 4X7TA 3SJVB 1P53A 3U0TB 1OWRM 4PJEE 2KZ1B 4BFBD 3B9VA 3P77B 2JCCB 1OCWH 2VQ1B 3TBTA 4WHCA 4IOIB 1QFPA 1BQSA 5A2KH 3C09B 1UB5B 4KRLB 4H26B 5B39B 4JGJA 1NFDE 1P7QA 2I27N 5HHVH 3VA6A 5C0AE 4PV8A 4OTXL 1E4KC 5B8CA 2BY0A 2BRRL 3GSUA 3BGFC 3DECA 5KOVC 2A6JA 1M7IA 5DRNB 1JHTB 2JJUA 1U3ZA 1JTPA 2Z4QA 1YNKH 1H5BC 3U48A 1A9BA 2EDQA 4NUGH 4EDWH 4GG6E 3FQNA 2DBLH 4Y19B 1IM3B 3MRCA 3UTTB 4N5ED 3CUPB 1N0XH 4AJ0A 5GZND 4S1DC 1IBGL 3RQ3A 4M61B 1G9NH 3U7WH 5FF6A 4GXVH 1QRNB 4Q0XL 3X12B 5GGQL 2Q7NA 1G6RA 2ZNWA 3O3BA 2R2EA 1F4WL 4HAGA 4JDZB 2GY7B 3ZSTA 5F3HB 5J57B 4ISVB 4W6YB 4EUPA 3ARFD 1KIRA 4NQSA 2ESVB 4RAVA 4NUJA 2NXYC 3RWFA 1KN2H 1UZ6E 1ZS8B 2X2YA 3RY6A 4FG6D 1A4KB 1T0MA 2F9BT 4Y5VC 2FGWH 2VXQH 3QNXA 4HFWB 3BW9B 5CKGA 5IMLA 2IF7A 2DM3A 5DHVH 1F3JB 1WFNA 3GBLA 5F8QC 1OM3H 1A0QH 3D39B 3IKCB 3V4VL 1EEZB 1JF1A 1AGBA 1U8LA 1YECH 3C2SA 4WW2F 4ELMF 4GW5A 5GJTH 1W72H 2HVJA 1NBVL 2ATKA 4LLUA 2EECA 4BELD 4OLUL 4PRHD 2A38A 5GSVB 4XZUA 1LEKB 1S9WB 3RTQB 3RWJA 5FV1L 1P2CB 5FECB 4YAQB 2HT3C 4JY6A 4OIIL 5C08E 4MZ3A 3UP1A 1MOEA 1RHFA 2X4NA 2CIIB 1GJIA 1SYSA 4I48B 4FQ1L 3WKMH 5IEHB 2QR0A 4M62H 2QHRL 5HYJA 3NA9L 4OCRH 4HUUA 4M8QB 2BVQB 5SWQA 5FGRA 3B83A 5JQHC 1ZEAH 4LHUB 1S3KH 4NM8L 3IDJA 5E00B 1TZHA 2X4OA 3C09C 1CDYA 1VACB 4PG9B 4GW1B 2YBRB 1I3UA 4XAWL 1BQUA 2VZTA 3HMXH 1EA9C 4CVZA 5B39G 2OK0H 4PJGB 3X3FH 3MPCA 3L3KB 4PBVC 1Q9OB 1MUJA 4QRPB 3EDDA 3GMNB 4MDJB 3CFIC 4PGZA 4QRQA 3V0WL 1BZ7B 5IEKA 4XXCA 1KCUL 1JPSH 3KJ6L 4Q6IB 2BY2A 3PV6B 5ANMA 1FHGA 3RGVD 2NPLX 3T4YA 3UZQA 3CLEL 2H2SD 1T1YB 4ZUWA 4BJLA 1ORSA 3MLUH 1B4JH 5H2BA 3GJFH 4L3CA 4ALAH 1MAML 4U3HA 5CINH 3I75B 4Y1AB 2VDQL 3VFOB 4YJZL 4JO2L 1BWWA 5J11B 3DRTB 2KUTA 5E8DH 2AJYH 3Q2CA 1T1ZA 3HLAA 2ZOKA 5FKPA 5BRZD 1MCHA 3PWNA 3GHBL 1JK8B 4XB8A 3ULSA 1T0NA 1A7RL 4KKBD 1UADC 4QOKE 4P4KD 3HZVA 1U36A 2MQ0A 1BX2B 5DMKA 5LCVL 5IV2B 2LABA 1PLGH 4LP4A 4GW4A 4CN4A 1SEBA 1I9RL 1J87A 2EYRB 2FR4B 2PTTB 1HKFA 4WFFD 3MA9H 2CUMA 2HG5B 2C7UB 1T5WB 1MJ8H 2WBWB 3DROA 1F58L 2PYEB 3ULVH 2YPVH 1WWAX 1T1WB 3KPSA 1AFVH 5T1KB 4NJAL 3DVNB 2XWTB 1DVFB 4KXZH 1GGTA 5DJCB 5C07D 1AO7B 2DQIL 4LIQE 2AGJH 3OXSA 2GFBB 1J12A 5DVOA 3MA7B 5IKCA 3G6DL 3I50L 3RTQC 2AJUH 5JXAH 4NQCB 4MA7L 4NO3A 4R2GB 3WO4C 2Q7YB 3QEQB 2VLRA 4TNWF 4CJ1A 3STLB 3P4MA 3LKPA 1JWSB 3CX2A 3MV9B 4K8RC 3T4AA 1ZHBA 4WW2A 4ELMA 1KB5H 1G7PA 1JF5A 1S7TB 3QUMA 2X4PB 2Q87A 4LSVH 3GSXA 3TIDA 4CVXA 1U8MB 4JY5L 5AZ2L 4X6CE 4OD3L 4DGVH 4LHUG 5ECJE 3MLSH 4QTIL 4Z7OF 5I8CB 1YYLH 4RGMB 4H8WH 4RGOL 3LEXB 4K94L 1UWEH 1AKJB 1PKQE 4J3XA 3NCMA 1ZGLM 4DK3A 3NIDE 3QSKB 4ORZC 1MJJA 1FAIL 3V6ZA 1I9IH 3E6HA 4RAUB 2ED9A 5EIVA 4WU5B 4ELKB 3C5ZC 4Q6IC 1EX0A 4FN0A 3PL6D 6CGTA 3PWLB 1X4XA 3PABA 3QUZB 1JWUA 1MIMH 4OZFB 5T5FL 3EJJX 4XPBL 3TT1L 4HW6A 4XHQA 2PUQT 1EEQA 5I1KH 5GS0D 3HS0A 3HI5H 4JZOB 3E0GA 4IM8A 3S37X 4EN3B 2PYFA 1QA9B 3TGXA 5KSBB 3RUGB 1B9ZA 1KPUB 1D5XA 3QIBC 5J11C 3HNTL 1A64A 1MJUL 3BSZH 5CD3B 4CRPA 1FNGA 5CCKH 3HZYA 3X11B 5B38G 1MIEH 3KJ4B 5EB9A 2W92A 3QUML 1T4KA 5K9KB 4PRHE 3PDDA 5IVOA 4P9HH 5AD0B 5JIPA 3F7QA 4F7CA 4ZFGH 5L7XH 1W8NA 1UB6B 2DD8L 3G6JB 5H35B 3AS1A 5FYKU 3QFJA 3NCJH 3D0LA 2DI8A 1A6UH 1AJ7H 1Y6MR 3HC0B 1BHGA 3HA0A 2EO9A 4UQ3A 1KENH 1MLCA 3LMJL 4A2MA 3EO9H 5TPWL 1JNHB 2HN7A 4I18A 1S7WA 3NCYS 5C9JB 1OQXA 2C4FT 4UZGA 5FYLL 1RK1A 2V9RA 4UT7H 1SY6A 1EK3A 2JJSA 1AXSA 4JPIA 5IK3A 1NMAL 5FCUH 3V52L 3JV5A 2FSEA 1XCQA 2D3VA 2K1MA 5HHXH 2NY5H 2DM2A 4RNRB 1KFAH 1CE1H 1DVFC 5D1XA 4X5XA 3VG0L 2JIXD 1H3XA 3LQAL 4NQED 3ROLB 3ZTNH 3V0AC 4OUUB 5AUMB 3PV7A 1R3JA 5CGYD 1RV6X 4OI7A 1NKOA 4WWKD 1RSFA 3MCG1 1HKLL 2HLFD 1CT8B 4CU7A 4R2GC 2R39A 5TF1L 3BP7A 4OI8A 5DO2C 3VRLE 3I6KA 3RZCD 1N64H 1IFHL 1FE8H 5KZCD 2Q3AA 5KSVB 4PJ5D 4BKLB 1I1YB 1YY9C 3HFML 3LRSA 1YJDL 1J5OH 1J9CT 4OM0L 3TBVB 3DSFL 1XGTA 1RUAH 1X5ZA 1MI5D 3PWJB 4JFDB 3GM0A 1YEGL 4P4RB 2J8HA 1KTLA 4ODTH 3GKWH 4XBGB 3ZTJG 1OAXL 4HCRA 1QSEA 4TPRH 5F7NC 4NQDA 4LK4A 5IFJA 3IS1X 4RGMC 5BRZE 4X4ME 3QUKB 3GGWA 1DN2A 3VI4E 1XF1A 1CLYL 1NFKA 1W72B 3EFDH 3GNML 1SY6L 4KQ4L 1LNUA 2VLKD 3GMPB 3D2UA 1N7ML 1AR2A 1ED3A 1X3DA 4Z7UF 1FVDB 5KBNC 2YD8A 2D7TL 4HUWB 1A7QH 1J1XH 3L3GA 4WHTA 2DTMH 4I3RL 4G9DB 1FH5H 1GZQA 1CQYA 3VWJB 5D96B 4HIHB 1AD0A 1I9JH 2ZZUT 3FZUC 4WFFE 3WFEL 2EE3A 4EN3C 3R8BB 4ZTPH 4LLYB 2P42B 1DQML 2O5ZH 1LD9B 1AXTL 5HYEA 4U1MB 2XY2A 3KJ4C 1BFVL 1WBZB 5DVLA 5GGSB 3S4SA 3WLBA 3DARA 2NW2B 3NACL 2VQUA 5C07E 4U1GB 3CH1A 3QNYB 4LF3A 1UM6L 2X09A 3K2MC 3MRRB 3DI2B 3LN4A 5AYUL 2ICWJ 3CIQA 4OTXH 2V6HA 5E2UL 4WV1A 1I1AB 5F9OL 2E9IA 5C0DA 4ODHL 2VDOL 4JZNA 2HFGL 1G7HA 4FFYL 3RVXC 2H3NB 3O41A 3BO8B 2R2BA 4MLIA 4PREB 5D6CB 3EO1B 3QPQC 1K5NA 3PP4L 3GSNB 3JUYA 2IAND 3OG6B 5D5MF 2XACC 5TE7L 1G9NC 2VDML 1KJMB 4CJ0A 4XTRC 1IBGH 3ESUF 3O6LL 3QDJB 4YZFF 1TDQA 4MJIB 1ERNA 1Y0LB 2LU7A 4Q0XH 5GGQH 1A5FL 3ELAT 1RZ8B 1F4WH 2COQA 4DUVA 2ZUXA 1MVUB 1OB1A 3MR9B 3S37L 2B4CL 2UYLB 3AY4C 2UZIL 1HK6A 5DQDH 3H3KA 5D1QD 3AS3A 1QRKA 1XGYH 2DQHL 1PY9A 4U1LA 5BV7L 1T6WA 3B9KD 4O9HL 1QQDB 3QDHA 3FFDA 5JA8B 2ICCA 3G9AB 4LEOA 2Q76A 3V4VH 3RVTD 4HV8A 1KIPA 5IBTH 2AV1B 1YEEL 3O3AB 3DX9B 4GRLD 3UYOD 3MNWA 1NBVH 3REVA 3HPLA 4IBLT 4OLUH 4MNGA 5LAXB 1NCWL 3QULA 5LVEA 1J0KA 4BZ1L 3AGVA 4TSBL 5ISZB 5FOBB 3MV8A 5JA9A 2V7HA 3RWEA 3SE3A 3VWJC 3P4NA 3ECBB 1FYTD 5D96C 4OIIH 1QSFB 1EAPB 2EC9U 1S7VB 4PP2B 1T2XA 1NQBA 3RFZC 4QXGL 1KB5B 5DMIL 5DJZA 4IRZL 2P7TB 3VXUD 1J8HD 2QHRH 1T04B 3D0VA 4Z7UA 5T1MB 4HWZB 4NM8H 4PJ7E 3PWVA 3VXQA 4NQEE 3SDXB 4RA3A 4JJ5A 4U1GC 2DI9A 4OFIA 3C6SB 4XAWH 1QNZL 3P11L 2XNAA 1DANU 4ODUB 3OKDB 3KPLA 1AHWC 2EDHA 2PN5A 3BPOB 1I1AC 3G5YA 4P2CG 4PJ5E 3V0WH 4NO5A 1KCUH 3KJ6H 2G2RA 2V17H 2XXMB 4PG2C 4AENA 1U6AL 3TWCL 4XP5L 32C2A 1ZLWH 1MI5E 2VZSA 2E8YA 3V5DB 3CLEH 1MCLA 2RAMA 1QOKA 1MAMH 3JTSA 4K71C 1I4FB 2WW8A 1FVCB 1BLNA 1S8DA 4P3WA 3VH8B 1ACZA 1MQKL 4XH2A 4JO2H 1T22B 4KK8D 2Y23A 4MVBC 2NY1D 1WGOA 2VLKE 1T1XA 5DK0A 3DV4B 4KRPC 1BIHA 5IB2B 3GHBH 2FO1A 1PQZA 2J6EA 4YK4B 4Y2OA 1A7RH 3H9YA 5C1MB 1D9KD 3IB4A 3RL1A 3C5SA 4PJFB 1MWAA 3DMMD 2N1KA 1QR4A 5EOTA 3MBEB 5LCVH 1U8QB 5D5MA 2CXKA 5E8PB 3Q5TA 4G42B 3SDYL 4N8PA 5HHQB 3VMPA 4L9LA 1P69B 2DKSA 1I9RH 2OI9B 3OB8A 4UT6L 1RQ5A 2QKIA 1GSMA 2DN7A 4PJ9D 4ZPTB 3EDJA 3GSOA 3ULVC 5ACLA 1YMHB 3MLZL 3P30L 2C3GA 4KDTC 1F58H 4D0BA 3Q0HA 1N6UA 4AG4L 2DWEB 1F02I 5FB8B 2UVEA 3ARXA 1NGPL 2IQ9L 4NJAH 1N0LA 1T7YA 3QO0B 5JTWA 2AJZB 3G08A 1UEMA 2DQIH 4CAGA 3PGDA 2C1PB 3CDGA 2EDYA 3U46B 3FL7A 4TUJB 2EDRA 5KAQF 1BVLA 3G6DH 5EUOE 2NY2B 3BQUD 2E9BA 2FCBA 4JDVB 3VW3L 2NQCA 3HUJE 4J2XA 3VFTA 1E27B 3CC5B 4BSVB 4TNVF 5JW4M 1CFSB 2FLRT 4KROD 5C0CD 4UBDD 4N1HB 3TH2T 3LKOA 5AG9A 2IANE 2C3XA 5AZ2H 5F7DB 3IXTA 4OD3H 1KYOJ 4L29B 2H6PB 2ZKHL 4H8WC 3IAGC 5TH2B 2AXGA 4WFHD 4QTIH 3MGOA 5I71B 1G7IA 4RGOH 3BI9X 3LV3A 2XWJA 2W91A 4K94H 3BPOC 2IBZY 3CFDB 4U31A 3F65A 4P2RB 4GBXD 1YPZB 1PYWA 1UQSB 3H7BA 4E5XA 1FAIH 3KPRB 2OXHA 5HY9A 3EKCA 4PJXB 4U1KA 5DTFB 3UYPA 4WNQB 1YN7A 5D4QA 4P5TA 4KU1A 4HKZB 5T5FH 4XPBH 3TT1H 1ROWA 1UXWB 3QUXD 2VR5A 1J11A 2OTUA 1RZJL 5L2KD 2DQUL 4ZOBA 2AJ3B 5IB3A 3HNTH 1MJUH 2UZYB 2VL5B 2BHUA 3VH8G 3HE7D 5A2FA 3OR6A 5KS9F 4P9HC 3QUMH 3OGOE 3Q6FB 4YK4C 4TULL 5DD3L 2VQTA 5EN2A 2IMMA 4JKKA 1OTSC 3WNOA 3H42L 3LKNA 4MNQD 2DD8H 4Y5XB 4XHJD 5IJVA 3MBEC 2XN9D 3SDDD 1RIVL 4G9FB 1FYTE 3W11C 2Z35B 4ZOAA 3OAZH 4CDGC 4NBYB 2Z31B 5ITFB 2QSCL 4PD4K 4CMMB 3LMJH 1EJOL 2OI9C 5TPWH 2IALA 5DS8A 4YEEA 5D7KD 4X5WA 1QFWL 3REWB 3VXUE 1J8HE 2VITB 4YFDB 3CDFA 5FYLH 3N1GC 5CAYB 2D0GA 1Q0YH 3DO7B 1IEAA 2VDNH 4RZCA 1NMAH 3IF1A 2MHAB 1JZ6A 1G0XA 2NY5C 1WT5A 4ETYA 4X9GA 3V52H 3FMGL 2X1WL 3BWAA 5E5MB 1XGRA 4UOJA 5C7XL 5DJXB 1D6EA 1OSZB 3VG0H 3LQAH 5DJ2B 1OGAD 4X7TB 1FZKA 4POZD 4L8BA 2P47B 2CGRL 4R8WH 1HKLH 2NY2C 3RWIA 4B0MM 5TF1H 3MGTA 4RMVA 1IFHH 3CSYA 5C6WH 1U3YA 3BKJL 4PPTA 3HFMH 1SJXA 1YJDH 1DP0A 3P9WB 3MV7D 3RY4A 4OM0H 4OGAC 1P7QB 4DOHB 3DSFH 2A83B 4I77L 4PV8B 5B8CB 1YEGH 5IVZB 4FABH 2EXYC 4Z7WE 1RAMA 3GSUB 1JFQL 3L7FA 1HSBA 1OAXH 2A6JB 1M7IB 5ESVA 5I71C 4A6YL 3DETD 4PLNC 2Z4QB 2VDRL 2L4OA 1HHIA 2AKRA 3UJJL 3NCCB 3ZHDA 5JMRA 1CLYH 4BQ9A 1ZVHA 3GNMH 1SY6H 4KQ4H 2A73A 3FQNB 4M6NH 1GOHA 1SYVA 4GRMA 5BS0D 5IJKA 1IAMA 4N8CH 1N7MH 4GSDL 4Y4FD 4NZJA 2PO6D 1FFOA 2MSPA 4JANA 2D7TH 4CKVX 3K74B 2HTKD 5FF6B 4I3RH 4YQXH 3GHEL 1L6ZA 3O3BB 2R2EB 3WFEH 2W59A 1DQMH 4ONGL 1AXTH 1CL7H 3SKJL 1MAKA 2XIDA 1WIPA 2XFXB 4TNWK 1KIRB 4NQSB 1NGQL 4RAVB 4NUJB 4ONHA 3RWFB 4IRJA 4PRDA 3KPOA 1BFVH 5D6DA 3LDBB 1BPVA 3QNXB 3NACH 4ENEC 5IMLB 2H8PB 4JVUA 1ZAGA 1YQVL 5GRZA 5D2LF 5TFSL 4YHPA 2X4SA 1UM6H 4RBPH 4ZTOL 4QT5A 4Y5XC 5DEZA 5AYUH 5ICYA 1FNHA 1JF1B 1AGBB 4NN5B 1U8LB 5E2UH 2EIBA 2XWBA 5INDA 3GI9L 5F9OH 2ADFH 2Z31C 4Y2DB 4GW5B 2D31A 2HVJB 4XVUC 5TF0A 4OFVA 4ODHH 4LLUB 2VDOH 4H25A 2HFGH 3C2AL 3RIFF 4FFYH 1RZKL 2WWKT 4X6FA 4YWGL 2D7MA 5C0CE 4J4PA 4XZUB 4J1UA 5KS9A 2BNRD 3RHWF 3S36X 5IIEA 3KLHC 4PJHE 3PP4H 3RWJB 4H5SA 3ZE0F 3VDAA 1NCBL 4JN2A 15C8L 1PG7X 4JY6B 3IFPA 1R0AL 2O5YL 4WFHE 1GGBH 5TE7H 2X4NB 2VDMH 4V1DD 1SYSB 3O6LH 1XF5A 2QR0B 5HGAA 5L8JB 4HKXB 4LL9A 4JFQA 5HD8D 1A5FH 4HUUB 5SWQB 4QYOB 3MO1A 5BZDA 3IDJB 3SKOA 3TNNA 2RBLA 4R0LA 1TZHB 2X4OB 5IQ9A 3S37H 2B4CH 2UZIH 3ZHKA 4CVZB 2AJVL 3H0TB 2OJZL 5B8CC 4WJ5A 4P3CL 1MUJB 4GMTL 5L2KE 2DQHH 3SGEH 3WS3A 3WFHB 2EXWC 4QRQB 3L1OL 4XVJL 5HXMA 2H1PL 5IBLD 3UBXI 4JRYD 5IEKB 1TTGA 3OF6D 3O9WD 1CZ8L 3NCBB 2JTDA 4JKPL 4PR5A 5FYKE 3V6OC 3PWPA 5ANMB 1CDGA 3T4YB 3WS6A 4KV5F 2AK4D 1CU4L 4ZUWB 1DBAL 1T20A 4PJCF 4EI5D 4HIJA 5H2BB 1IZJA 4L3CB 4NWTL 2BNQA 1W0YT 2MJWA 4ZG1A 4PLKC 1NCWH 5DMJB 4BZ1H 2XN9E 4PJAE 1EO7A 4TSBH 4NM4L 4HJGA 3ZO0A 1OTUC 1T1ZB 2PCPA 2ZOKB 3HLAB 5FKPB 1NC4B 3DYPA 3ULSB 1KXQE 4L9DA 1T0NB 5D7KE 5ADOL 3TZVD 4QXGH 5DMIH 1Q9WA 4EUPG 2X1OA 3MLTA 1RK0A 5DMKB 3OG4B 3NGBB 3RY6C 4UV4L 4GW4B 3OZ9L 3WE6A 3LDBC 5IT2L 1SEBB 2IPUK 5I76B 1OGAE 3QXUA 4DQOL 4M02A 4O2FA 3MUZ1 5F9WC 1QNZH 3P11H 2EIEA 2APXA 2WQ8A 4C56A 1GC1L 4NN5C 3DROB 4OCNC 5BOZG 4Y2DC 3KPSB 4Y16A 3UTOA 3FTGA 4JB9L 1ZKAA 2YZ1A 3MV7E 3RDTA 3R4DA 4WU7B 1U6AH 3OXSB 1O7SA 3MUHL 2NXZB 3TWCH 3WJJC 3EGSA 1RJCA 5E99L 5I2IA 2WP3T 3E2HB 5IKCB 3OAYK 4P0DA 1VHPA 4NO3B 1IGIL 4PJ8A 5D2LA 2VLRB 1C1EH 5JQ6H 3PIQA 2YPLA 2L0DA 3QXAA 3MOAL 2CR3A 1A6PA 2H32A 3KXFA 1MQKH 3P4MB 3LKPB 3WO3B 1JL8A 4Q7DA 3T4AB 2CLZA 4WW2B 4ELMB 1G7PB 1WEJL 3LB6C 3QUMB 5BS0E 1CVSC 3KVQA 3GSXB 4GKOA 1WJ3A 4CVXB 3G5VA 4PRAA 3KPMA 1K4CA 3OAYH 5GGVY 2EH7L 1T66D 3HRPA 2W60A 2J4WL 2E7MA 3HMWH 4L4TD 3HHRB 3S98A 3MXWL 2VLMD 4E42A 5K59F 1J0YA 2P5EA 3SDYH 1KC5L 4X7SL 1MJJB 3WJLA 4UT6H 3V6ZB 1U8NB 3DXAA 4QRTA 4Z8FL 1MY7A 2PW2A 3PABB 4ZAKA 1JWUB 3P30H 1D5IL 4P2OD 5E6IB 2VZVA 5FM5M 4AG4H 5D2NE 1NGPH 3WKNA 2IQ9H 2HJLA 4FQHA 2JF1A 5IVNA 5DR5L 4YBQC 3N0PB 1D5XB 1HILA 1EIBA 2A6DA 3L3DA 5HYJD 1FNGB 2CKNA 3HZYB 5T3ZD 1T21A 3LS4H 3QZWA 1H15B 3MRKA 4MXWL 2Z9TA 3GJEA 3VW3H 1T4KB 4WIQA 3LKRA 5CFHA 5JHLL 3TN0A 1PG7L 2BNRE 2NLJA 5CEZL 1KG0A 5EC2A 5IW3A 3QFJB 3NGBC 4PJCA 3BKCL 3D0LB 3GMQA 3TIEA 4HZAA 3T2QA 3KLDA 4UQ3B 2CIKA 3GSQA 1A3LL 1MLCB 1P4LA 4L8DB 3UBXA 4V1DE 2HN7B 4I18B 2ZKHH 1S7WB 1YQ2A 5EBMA 4K94C 3MCLL 4MXVE 5JW4Q 5E1HB 4JPIB 1AXSB 1G7QA 2Y4SA 4M7LT 4POUB 1F3RB 3ZDZE 5HSFA 1MFBL 1CE6A 2FSEB 5HPMB 1XCQB 1U95A 1MHEB 1P4IL 5D1XB 5LQBL 4X5XB 2J5LB 4WUUB 2NXZC 1MCKA 3QI9C 1R3JB 1XEDA 2RQ8A 5E7BA 3CZFA 3LZFL 4L3AA 4OCYL 1VDGA 5FO9A 4BUGA 5E2JA 3EOAA 3BP7B 2DJ4A 4JRYE 5AEAA 1RZJH 1WBYA 2DQUH 2DL2A 5FHAL 3BZFA 1J05A 3LRSB 3WXWL 2CJUL 2ATPA 4WW2C 4KDVA 4ETQA 5C0BA 4F7TA 2AK4E 4LLQA 2VSDA 3MRGA 4TULH 1KTLB 5DD3H 2R0WL 3DV6A 5FDWB 4XPHH 1QSEB 1IGML 4X6BB 1KACB 2NTSP 4F8QA 3H42H 1GYAA 4NQDB 2UUDK 5IFJB 2M2DA 4KUZL 1CXIA 3CMOL 3GGWB 3WN5A 3F7YA 1KGCD 1RIVH 4HGKC 3TV3L 3TA3D 4XBPA 2QSCH 3BZDA 1LNUB 1NAMA 2QADB 3D2UB 4S1RL 1IGFH 1HYSC 1EJOH 1WF5A 1ED3B 1MCWW 2D7OA 1QFWH 4FS0A 1I7ZA 1U8HA 3L3GB 3K3QA 4WHTB 3MNZA 5E6IC 4ZD3L 4APQA 1GZQB 1JI2A 1FFPA 2JJVA 2UUDH 3FMGH 4F3FA 1AD0B 3LQAC 1KPRA 5C7XH 1I7RA 1IM9D 1Y6KR 3KPPA 3D48R 1HH9A 3GSVA 3QDGA 3QUYD 2I25N 2W0LA 1IQDA 3EAKA 1RY7B 4X4YA 1Z6JT 1UT9A 2CGRH 2IMNA 2E6PA 3B9DA 3ZYOA 3NIGE 3S4SB 1YZZA 3WLBB 5FA3A 2NY4D 2E27L 1YJDC 3AREA 1T7XA 5CLTA 2RIKA 4Y4HA 5J6HB 3BKJH 2AJSL 2Q8AL 3CH1B 4LF3B 5HDOA 3K4DA 1NMCB 3LN4B 4LCUA 3GMMA 4I77H 5D7JA 4LSPL 2LAAA 4WV1B 5DA0B 4PJEF 5C0DB 1JFQH 4JZNB 1NAML 4I18C 4QXWA 5DEFA 3O41B 3SGDI 2LAGB 2FJGA 3B6SA 4A6YH 2VDRH 2JJSC 3UJJH 2R2BB 3CXDH 3BPCA 5GS2H 1U8IA 4TSAH 5B3NA 4GSDH 1DQDL 4QHMA 2YK1L 5D1XC 4GXUM 2J5LC 3IJYB 5I1EL 4U6HA 5JW5A 4RQQA 4L4TE 2VLME 3TNMA 3IJSA 43CAA 1F6LL 3GHEH 2WWMC 4AM0A 4UV7L 4QEGA 2X42A 5IROC 4ONGH 3SKJH 1OB1B 2BXYA 2NY0D 4HUVA 3PG2A 1TIUA 1NGQH 5TGBA 4ZMAT 2GUOA 4U1NB 1J88A 3KYNA 1XT5A 4JFEA 4YHOL 4TNVK 4U1LB 1DE4B 3EJYC 1TLKA 1YQVH 3NCEB 5TFSH 4R9HA 3FFDB 4ZTOH 5HYJE 4DFIA 5T3ZE 1QSVA 3EW3B 1D5MA 2Q76B 3TPKA 4HV8B 4PFEA 1KIPB 1CDHA 1E0OB 4M00A 3VFRA 3GI9H 1J1OH 3O3UN 1S7UA 1N3NA 2QADC 4N0RA 3MNWB 3MROA 3REVB 4MQSB 3HPLB 1UZ6F 2NMSA 3C2AH 4O4YL 4MNGB 1RZKH 2A9NL 3QULB 4YWGH 1OWWA 5CP3A 3T0EB 2X7LA 3BN3B 5DD1L 5IGXL 2IQAB 3MV8B 3WNMA 1F4AA 2V7HB 3RWEB 1NGXA 1NCBH 15C8H 1ZHNA 1J10A 1R0AH 2O5YH 4RWYL 1W0WA 3T2OA 1SVCP 3F6LA 2HFTA 5CJ5A 4LLMA 3SOBL 2OSLA 2AEPL 3RU8L 3NPZB 3L5HA 3D0VB 4Z7UB 3C5ZD 2DKMA 5J12B 4P23A 3PWVB 3S4SG 2B4CC 3VI3E 3M17A 3SO3B 4Z5RB 3CFKA 1PG7W 4G3YL 1NMCC 2IFFL 1X5IA 2N56A 4LSTL 5JO5B 4R6UA 2AJVH 4XMPL 2OJZH 4KK9C 2G5BA 5BV7C 4WV1C 4P3CH 3G5YB 4GMTH 4NPYA 4G8IA 1JN6A 3QIBD 4FTVA 4XVJH 5DJDA 5C2BL 2H1PH 5E4IA 4FZEL 1A1MB 3NTCL 4LSSL 1RULL 4AENB 1M7DA 1CZ8H 4JKPH 1EFXA 2NY6D 5EUKB 4KKCD 2BOBA 4X8JA 32C2B 1UCBL 2V7NA 1MCNA 1CGUA 1CU4H 1HEZA 1DBAH 2VLJA 1CXHA 3JTSB 3NFSL 1S8DB 1BLNB 4MMXC 4NKMA 4N68A 2FWOA 4BQBA 1KGCE 5F9AC 3BPLB 5ILTL 4PJEA 4W6WB 2H2PD 5DK0B 3W39A 2Y9RT 1PQZB 2QJDA 5ADOH 3UJIL 2AQ3A 3A0OA 1OAYL 4PJIF 4PRPD 4XCYA 2WZPD 2X1XR 3RL1B 3C5SB 2EDNA 4LVOC 4OIAA 4PJDF 4EVNA 5EOTB 3S3SA 4UV4H 1XZ0B 4P5KA 3OZ9H 4LPXA 5IT2H 5D5MB 3U9PL 5BCAA 2FX7L 5GRVL 4AQOA 3PUCA 4L9LB 4J3WA 3WD5H 4DQOH 3OL2A 2QKIB 5CD5C 5JHDD 4XNYL 1MVFA 3N9GH 1GC1H 3WXVL 4KMQA 3PHQA 4TRPL 5I1IL 4G5ZL 3OKOA 5ESQA 3G08B 1W0VA 3PGDB 3CDGB 3T0EC 3ES6A 3RKDD 2IPUG 2YHGA 1BVLB 4WEUD 5E99H 1Q0XL 3SE3C 5D1ZA 4U4BA 3SBWA 1IGIH 2WUCL 3MLPA 4HBQA 1V3KA 4HUKB 3MOAH 3VFTB 5E9DD 1DBKH 2V9QA 1I7TB 1VGKA 3PGFL 4RGNB 5I18L 2GAZB 4MCZB 3LKOB 3S9DB 4JCLA 5J12C 5DRXA 3IXTB 1H3TA 4YPJA 2OTWA 2V2TA 3SO3C 1R3KA 4GQ9L 2EH7H 5HDBE 1DDHA 5D71L 2AXGB 4MJ5B 4ODSL 3SDCB 3MGOB 1ONQA 2J4WH 1OTTC 3TVMA 1G7IB 2ZNXA 3QWRD 3MXWH 2XWJB 3BEWA 3LV3B 5IFAH 5AZEL 2E9JA 2F53A 4NHCL 3BP4A 1KC5H 1PYWB 4X7SH 3H7BB 1FZOA 4E5XB 4JFYA 1NUGA 4G8GA 1A6TA 5E4EB 4RCAA 5HY9B 4YNYB 1VERA 3U0WL 4U1KB 4Z8FH 4ZQKA 4MB5A 1YN7B 5DGRA 4P5TB 4X6CF 3MV8D 1D5IH 4N8VA 3RIFK 2WANA 3BYYA 5HVGB 2ENYA 5KVGL 5GS1A 2OTUB 4LU5L 3RHWK 2FL5A 4IOFD 5DR5H 5C08A 3NIDF 4MCYA 5IB3B 3BIAX 4FQXB 4ZUSB 5L8LB 3BPLC 3KPTA 3SDAC 3TCLA 1U3JA 3OR6B 2P24A 4O58L 4MXWH 1TPXB 3P9MA 3S36H 5EN2B 1KNOA 3MLYL 5JHLH 2VE6A 5IHLB 3BFOA 1RURL 1PG7H 3OAUL 2GSGA 3LKNB 4B50A 4WENB 3D85D 2GK0A 2X41A 5CEZH 5KVFL 5IJVB 1ND0A 3BKCH 2GQHA 2DMKA 1G1CA 2FJHA 1A3LH 3TYGL 5E08L 2EDJA 5DS8B 4HH9A 4A6YB 1KEML 4X5WB 2HJFA 1N2RB 3U82B 5FGSA 4P59H 1IEAB 4QNPF 4RZCB 3NH7H 3IF1B 5C70A 3CVHA 3M8OL 2NX5A 2YSSA 1CTOA 1MFBH 2J2ZA 3BWAB 4HPOL 3NMEA 4PJIA 5CZVH 2MFNA 1WZ1H 1J1PL 1XGRB 3QB7C 2DYPA 3QR2A 3V2AR 4GRWH 4PJDA 4MQXC 4YFEA 3BHBA 1CD0A 4M8VA 4OFPA 2EDFA 5T1LA 2OX5A 4L8BB 1U3HA 3HC3L 3LZFH 4LKXA 1RZJC 4OCYH 3RWIB 3T2PA 2FDBP 2V5MA 4UILH 4X80L 5E03A 3MGTB 1UKQA 5KSUA 4UAOB 2AI0L 2FATH 5GGVL 3CSYB 4WEBH 5FHAH 1O0VA 3WXWH 2CJUH 3K4ZA 3N06B 3AB0C 4WTXA 4M4RA 1BQLL 4RGNC 4QOKA 4U49A 1YN6A 4I3SL 5E94A 4Z7OE 3PP3K 4KK5D 2R0WH 1HSBB 1WIUA 1OAQL 3I84A 4L5FL 1IGMH 1XCTA 4KI5F 4JN1L 5CILH 5ESVB 3SDCC 2EE6A 3B9EA 3VRLF 4KUZH 3CMOH 1HHIB 2AKRB 4JKWA 5DD6A 3MRPB 3TV3H 4OF3A 2A73B 1SYVB 4GRMB 1EMTL 2CXGA 4LRIA 4MXQC 4PRPE 5E4EC 1E28A 4LKCB 2XXCB 4UIKL 1FFOB 4JANB 1RUML 3QP3A 2AK1L 1MF2L 1JIBA 3PP3H 4X6DE 3ZE2E 1A4JA 3RWGA 1EO8L 4XX1E 3ARWA 4ZD3H 3IETB 1ZLUK 4LNVA 4JPKH 1IKFL 5HHNA 5JHDE 1OP5H 1VADA 2X70B 3VI4F 4YEFA 5ELIA 2WLZA 1G0DA 2BSRA 4FQXC 3VFGL 4Y7MA 4ONHB 1ZGLP 4IRJB 1J0HA 5CJ8A 4PRDB 5LKNA 2FX8L 3KPOB 1TPXC 3N1FC 4H88L 5F8RC 2FH6A 5F1NA 2E27H 3G6AA 3SO5A 2AJSH 2ZG2A 4X6CA 3MRFB 4YHPB 3IFLL 2X4SB 3MODH 4QT5B 4I0KA 4MNHB 4LSPH 4I4WA 2XWBB 5INDB 4QRRB 2EZ0D 3H2WA 4YIQA 2D31B 5E9DE 2C9AA 1JP5A 3ZYJA 1NAMH 4H25B 2PTVA 2VH5L 1EH9A 1BJ8A 4X6FB 4P5TD 4WEMB 4KRPD 1TNNA 5FYJL 4J1UB 3DI3B 5KS9B 3K8MA 5IIEB 4YHIB 2OR9L 4LIQL 1KJVA 5F97E 5DD5L 1YNTA 2BDNL 1DQDH 4JN2B 4U3CA 3IFPB 5ADPL 1KV3A 3QEGL 5I1EH 4P3DA 5EORL 1A7NL 3O11A 5AWNL 3EOTL 1XF5B 2HT2C 5AAMA 3VXOB 2I9LA 4JAMA 5HGAB 1KN4H 1NH6A 3CMGA 4JFQB 4UV7H 3OKEB 4UAOC 3MO1B 3UAJD 5BZDB 3SKOB 5F72S 3TNNB 3U9UA 4R0LB 2YXMA 4PRHA 4B7LA 3ILQD 5IQ9B 2APWA 4JO4L 1T7VA 3B2VL 3MV8E 2IBBA 2K7PA 4UQ2A 1I8KA 3DUUA 3MNVB 1LO3L 2QQKH 4WJ5B 4YHOH 3GFUA 2V2XB 4LARL 3WS3B 1C12A 5EA0L 5CMAA 5DGQA 1R3HA 3IDMA 3EJZD 3PE9A 2VXTH 5FDYA 3OSKA 4PR5B 5KAQG 3P40A 2ZCKL 3PWPB 5D9SB 2IC2A 5FO7A 3VRJA 3N85H 4ZSOE 5IJKC 1HHKA 1OF2A 1T20B 3SHSA 4HIJB 1RZKC 4M1CC 4OLEA 1DQJB 2BNQB 4XCCL 5GGSY 5HHMD 4NO0D 2A9NH 4KVCL 3AU1A 2AVGA 1UJ3A 2SEBA 4HJGB 5DD1H 3WBDA 5IGXH 2PCPB 3OJDA 4A2LA 2FHFA 4JDTL 3CU7A 3MJ9A 1S78D 3WFDL 1CS6A 2V2WA 4RWYH 3VD5A 4N0YL 1Q9WB 1WV7T 7FABL 4KKAC 3DX7B 1RK0B 3SOBH 4IRJC 2AEPH 3RU8H 5D6DC 3WE6B 1Y18A 2BC4A 5SX4I 1F6FB 4PLJD 4K3EL 3CVIL 5M94B 4O2FB 4XMLL 4R4BA 1I3VA 4G3YH 1KCSL 1UA6L 2JE8A 2IFFH 4LSTH 2EYTA 5ERWB 4QRUA 5BRZA 1X5LA 3B2UD 4X4MA 1AR1C 4WDIA 1QZ1A 3MRJA 1TCRB 3E6FA 5FKAA 4Y16B 3V4PL 3GEWB 5C2BH 3ARYA 4FZEH 4LSSH 3NTCH 3RDTB 1NL0L 1XR9A 4KKLC 4P4KA 2BVTA 2CR6A 5FM4A 3RJQB 2B8OT 3EGSB 1UCBH 2O61B 3MBXL 5I2IB 5AYQA 5DWUL 4F9LC 4NRXA 4K2UL 3BH9B 3P4OA 3W9EA 4PJ8B 5D2LB 4YZFE 4FQJL 3PIQB 3NFSH 2YPLB 4WI6A 5F88A 3QXAB 3MJ9L 4KVNL 2VKWA 4TQEL 1LILA 2CLZB 3MFFB 5IMKA 3UZVB 5ILTH 3BYTA 2UV3A 3BESR 4NFDA 4K3HA 2RGSA 2JB6B 3G5VB 3T77A 3OKKA 4X5LA 3LIZL 3UJIH 3KPMB 4R0LC 3RJDA 1K4CB 2NNAA 1OAYH 5C07A 4HSQA 4HG4J 1JWMA 3KYOA 2W60B 4R4NC 3W0WD 1JMXA 4E42B 2P5EB 3U9PH 3ARGD 2FX7H 3PHOA 2G9HB 2HKFH 5KVDL 3DXAB 4QRTB 1GC1C 4J4PD 4XNYH 1URLA 1IAIM 1ZLVH 4IMKA 4H1LA 4ZAKB 1NUFA 3WXVH 3UROR 5IF0B 4TRPH 5I1IH 2QL1A 2HJLB 4FQHB 4G5ZH 1B6UA 5C09B 4PTUA 3IDNA 3DUHA 2JKXA 2A6DB 1B0WA 1C5DA 2EEBA 3L3DB 3O2VL 1EERB 2ZUWA 5IW1B 4YHNB 1UACL 1T21B 1Q0XH 2EDDA 3QZWB 5TJWK 3MRKB 1NCUA 5CP7A 2WUCH 2Z8WC 5B4MC 4P2QD 1FDLL 4LCCA 3PL6A 1UKSA 4HC1A 4F2MA 2XRAL 1J0IA 1EV2E 1KG0B 5I18H 5EC2B 35C8L 3GMQB 4GS7B 3TIEB 2YUZA 3GSQB 1P4LB 3BUTA 3UBXB 2B1HL 5JDJA 4NKQB 4GQ9H 4NKDA 5D71H 3HN3A 4ODSH 5EBMB 2R69L 1AH1A 3HUJF 1V7NL 3SGDH 3WIFA 1G7QB 5AZEH 3H9ZA 4NHCH 4OF8A 5EU4A 5A3IC 1CE6B 3VGAC 4LAJH 3FO1A 3U0WH 3VD3A 2P8PA 4OFYD 3CZFB 4HGWB 4YDLC 4JHBA 4RMWA 5KVGH 3QIUA 4HIEA 5LGKA 3EOAB 2QSTA 3I6LD 4PJ8C 4LU5H 5D7IE 2CKBA 4P46D 3EYFA 4UNUA 3OPZH 2ATPB 4B53A 3L95A 4Z9KB 2A77L 1NSNL 2XOTA 4ETQB 1IGJA 3EO0A 4F7TB 4LLQB 5EDXA 4O58H 3PQYD 3DO3A 4GH7B 5DJ8A 4FZ8L 3LS5L 3EDEA 4LQ1A 3MRGB 3WDIA 5I1LA 3BIBX 1HYRC 1VKXA 5HHME 2NZ9D 2IAMD 3DV6B 3MX0A 3MLYH 5GS0L 2JIXA 2YEZA 1RURH 3OAUH 4NQEA 3KWWA 2BMKA 3ZDYE 4C56D 5D7SL 5KVFH 3WN5B 3F7YB 4WWKA 3UPCA 3VXRA 5GXBB 2P46B 1QO3A 4XBPB 4Y16D 2OQJA 1GGIH 1NAMB 3VD7A 3WJLC 2G5RA 3TYGH 5E08H 3TBYA 3HB3C 4PJ5A 4D0DA 1KEMH 2OR7A 5B3JF 1DEDA 3C08L 1I7ZB 5KTEL 4MAYC 1U8HB 5LGJA 4U1SA 3MNZB 1KULA 2PETA 3KPQA 1A21A 2MQ3A 4APQB 3NFNA 1RHHA 3D3VB 2VSCA 1B3JA 3M8OH 4HPOH 1TVBA 4F3FB 2Q86A 1J1PH 1KPRB 1I7RB 3KXFD 5TE6L 3KPPB 4M6OL 4BSJA 3QDGB 1NCTA 1IQDB 1MCCA 1NC2D 4X4YB 3HC3H 3WHE1 1K9TA 1YY8A 4NGHL 4XNMA 5CUSL 4X80H 4QTHA 3QZWG 2AI0H 4PY7A 5FA3B 5C92A 4H20L 3AREB 5DQJA 1FNFA 1TQBB 4Y4HB 4BSWA 3EOBA 1H3PL 1BQLH 4HWNA 1TITA 3LEVH 1MCOL 4LCUB 3GMMB 4GS7C 5D7JB 3EIFA 4I3SH 5HI3C 4HMDA 2J8UE 4TTDC 1JYWA 5GISL 3C8DA 1OAQH 2VO5A 4L5FH 4JN1H 4K7PX 3UBXG 5DEFB 2ZUTA 3SQBA 2FJGB 3B4NA 1INQA 3B6SB 4F57L 4GMSL 1RJLA 5J7CC 3ZKXB 1CLOL 5EULV 2AERT 3GMLA 2WINA 4BH7A 1U8IB 1EMTH 4MAUL 4QHMB 2K3TA 3DIFA 3CGTA 4UIKH 5JW5B 3VCLA 4RQQB 3W0WE 1RUMH 4ZPVB 4Z7WF 2AK1H 3L3HA 5HBBA 3QQ9D 3TNMB 3IJSB 43CAB 2QBWA 1EO8H 1DSFL 1VFMA 4AM0B 1U92A 3QXDA 4R4FL 1N6QL 1TVHA 1T6VN 4Z6AT 3TN0D 3HUJA 4NNPH 1HI6A 3QQ3A 3VFGH 4HUVB 5TGBB 2WMPA 4N1CA 1CN4A 4HK0A 1F3DH 4NFCA 2FX8H 3QG6A 4JFEB 4NQXA 4PJBF 3P3YA 4Y4KD 4H88H 3GB7A 4OSUL 3AMKA 4J8RA 1M6OA 3JWOL 3GK8L 2AV7A 1BQHB 2R8SL 5GIRA 4ACPA 3IFLH 1E4XI 3MGAA 4DN4L 1D5MB 1F4XL 3GRWA 1GHFL 1LEGA 1XGUA 3UCRA 1NJ9B 4OKVA 4X8XA 2W9DH 5D7LD 5DJAA 4ZFFA 4P2QE 1N3NB 5FGCB 4JFHD 5EZIL 3MROB 2ADIA 1RUQH 2R2CA 2VH5H 2X05A 3VXTA 1CTNA 1D5ZB 3BH8A 4NNXA 5FYJH 2X7LB 5JLZA 5D1QA 5F70A 2OR9H 4LIQH 3JWDH 1MRFL 5DC9B 3U30B 3NZHH 5DD5H 2BDNH 2GCYB 1ZHNB 5A43C 3B9KA 5ADPH 3QEGH 4YHYB 3IT8D 3MREA 5EORH 1A7NH 5ACZA 1W0WB 5AWNH 2VWEE 3EOTH 3HPJA 2WUBL 5C0BD 1FRGL 3QCUL 4LLMB 3ZE1E 2R4RL 3S8WA 1H0DB 1Q1JL 1X9QA 3ZKMD 1S5IL 3D9AH 4KXZI 3GIVA 3AREC 1TQBC 4Y4HC 2ERJC 1OARH 1R3IL 3BKYL 1FV1A 4HUMB 4NC0B 4Q74A 3M17B 4PJHF 1KSRA 3CFKB 1IAOA 4JO4H 1BD2A 3B2VH 3MLXL 1JZ2A 3ZMRA 4P57A 4N9GA 3HE6A 1LO3H 4YXHL 2G5BB 3I6LE 4LARH 2DQFA 3GRWL 3IKKA 4NZUL 1FIEA 4CW1A 1FNSL 1FYTA 1M71B 4G8IB 1JN6B 3VRIA 4FTVB 5EA0H 5ITBL 5DK3A 1BGXL 1LE5A 1EFXB 3VXUA 4HULB 3PQYE 4NBZB 2BOBB 4PTTA 4X8JB 2ZCKH 4WO4A 5F6IB 7CGTA 3V79C 1CLZL 2ADGA 2V7NB 1HEZB 2VLJB 1EAJA 3OKYA 1LO5A 3DX8A 4HX1A 2A9MH 1AD9B 1UENA 4XCCH 5CBEA 3W9DA 4C56E 4KVCH 4RX4D 4EQ2A 2FWOB 4ZNEE 1JTTA 3T3ME 3T8XA 4PJEB 5A2JH 4HJ0D 5H94A 5C8JA 4JDTH 3W39B 3V5HB 3WFDH 2VUOA 4I8DA 1KCKA 2F5BL 4ZXBA 5MEND 1B2WL 2VN7A 4XCYB 4OZHF 4N0YH 5J1TC 1DTUA 7FABH 3RIAF 3C87A 1WCBA 4OQTL 3UPRA 4P5KB 5C0AB 3FB8A 3DGGB 4PJAF 3KXFE 4MDIA 1IEBA 4N0CC 2IBGA 3QI9D 4JQXA 4Z7WA 4K3EH 3CVIH 5KJRH 4XMLH 2B7DT 3I02A 4BZ2L 1KCSH 1UA6H 2X6MA 3QNZA 1B0RA 5GRJL 1E6OL 5GQBA 1IZKA 4KHTL 4U2YA 1KN2L 3FO0L 4U1HA 2HVKA 5KSAC 5EIIA 3R06A 3FKUS 2BVEA 3PHQB 4GG6B 5HHPA 4O51A 3STBA 5EU6D 4D8PA 2EDWA 5IG7A 1SMOA 4YGVA 2NY3B 5EBLA 4MS8C 3SCMA 5ESQB 3ZE0E 3ULUD 1W0VB 1OM3L 1FL6A 3ES6B 4PJBA 3DMMA 5DUBA 3MBXH 1YECL 3T08A 5DWUH 5D1ZB 4K2UH 3U30C 4FQJH 4LDEB 2FB4L 3MJ9H 4M7ZB 2OP4L 4KVNH 1VGKB 4PJ9A 4QHNA 2AEQL 5SWSD 4TQEH 5HPOA 3ZKND 5E95B 5IBUB 1Z5LA 4HLJA 4IRSA 4LSQH 4I5BA 3LIZH 4JM2D 4OD2B 4J23A 2FEDD 2OTWB 3I9GL 1XF2B 1J7VR 4QCIA 3SPVA 3QHZH 2V2TB 1R3KB 3O4OB 3WKML 3FRUA 4OCWH 1ONQB 2GTWA 3TVMB 3BEWB 4ESKA 2F53B 3BQUA 1NLDL 3BP4B 2ZCLH 4DZBA 5KG9A 1S3KL 4WUKL 4NOFA 4XXDA 1FZOB 4PV9A 4WI4A 3N1MC 4OF0A 1NEZA 4FFZL 4G8GB 1A6TB 3ARRA 5C0IB 5KVDH 4KV5E 2R1XA 3SGKA 1MAJA 4PJCE 4KMTL 5FUCC 2GJZB 2DQEL 5F6IC 5C0CA 4N8VB 2R29L 2D4FA 2GEEA 4M5ZL 5GS1B 1XR8B 1C08B 3KNBB 4PJHA 4K07A 2BVUA 5E56A 1A22B 2HRPH 5IVXE 1IJ9A 1ORQA 3CXHJ 5C08B 3EUUA 1CDUA 4GJTB 4MCYB 4DVBA 3O2VH 1VESA 1OQOA 4GO6B 5D7LE 4WI5A 2OMBA 1UACH 3T2NL 1FCCA 3TCLB 3GSRA 1FO0A 4JFHE 5D72L 2R2HB 4XNZB 1NBQA 4OV5A 3P9MB 4GBXA 3I6GA 1N5YL 4P23D 3F12A 3V6FA 3IJHA 3FQTA 2FNBA 3WLWC 1KNOB 3GSNL 1EVTC 1L0XA 3AM8A 3MJ8A 1ZHKB 2XRAH 4L4VD 2F54A 2CLVA 2GK0B 35C8H 2DICA 1E4XL 2XPGA 3L3IA 1BJ1J 2FJHB 2BCKA 3QUXA 5L2KA 3D5OF 4HH9B 4E0RA 4LGRB 2WWMD 2HJFB 5C0BE 3OBAA 4V2CB 1S7QA 2R69H 3HE7A 2Y5TA 1CFTA 1V7NH 5D93B 4NHUA 4O2EA 1MCQA 5CSBA 5HHOD 3TPUB 1AE6L 4I0PA 43C9A 3CVHB 3WFBL 5CHNA 1UWGL 2DQCL 2W0FA 2YSSB 1Q94A 5DMGC 4OGYL 2E9WA 4OZHA 2DYPB 3EHBC 4PJDB 1AGFA 3JTTA 4OAWA 1DLHA 2GITA 2ADJA 3BHBB 4MNQA 4C58B 5T1LB 2WBJD 2VDPL 4PJAA 4LKXB 3BN9C 5D1ZC 4CU6A 5KSUB 1FO0L 1SEQL 3LCYA 2R1WA 4XWOD 4M7ZC 4XC3L 2AGJL 2CDFB 3ZDZF 4Y5YA 2FHCA 2A77H 1NSNH 2YOCA 4QOKB 1YA5A 3QFDA 1K3ZA 2A0LC 4TVSa 4LHJB 1YN6B 2D0FA 4FZ8H 2BSTB 5E94B 5IBUG 3OX8A 5GS0H 3O4OC 1XCTB 1OGAA 5D7SH 2BY3A 1I8IB 4FFVD 3TVMC 1JZ8A 1QUNA 1AGDA 5DD6B 1JE6A 4RDQF 4PP1C 4PRBB 1K85A 2B39A 2Q8BL 1EGJA 5FYKL 3RVUC 1DR9A 5MENE 4QY8A 3FN9A 3CDCA 2DQJL 2OCFD 4Q9RL 1AGEA 3C08H 2NW3A 5KTEH 3MC0A 3MV7A 3FB7A 1CD8A 3J7HA 1A4JB 3RWGB 1UWEL 3MRNA 4N8VG 1J0ZA 2NYYD 4KTYA 4PRID 3WCYA 5GS1C 1LDSA 4WTZA 5HHNB 3D69B 1ZK9A 4JO3L 2I9TA 1VADB 4HDIA 5TE6H 4M6OH 2Y06L 2BSRB 2CKBH 4F37K 1RZIA 1JYXA 3OB0K 1MIML 3OV6A 2CRIA 3X17A 4P99A 4XNZC 4NGHH 5CUSH 1CGYA 5EU6E 5BS0A 5F1NB 4Y4FA 3G6AB 4H20H 2PO6A 3ULUE 4NT6A 2NR6D 4X6CB 1H3PH 3HCVB 1NDGA 3SKNB 1S9XA 3QRGL 3TJHD 4I4WB 3ARUA 4OLWL 3ROOA 1RJYA 1OLZA 1HH6A 2WK2A 1R5WA 5GISH 4E41D 4YIQB 3UTZA 3OB0H 1EGJL 1TNMA 3IFOA 5SWSE 2EKSB 3HZMB 5CJQL 4QWWC 3ARFB 2PF6A 4GMSH 3NCJL 3S3JA 5D93C 2PXYC 1CLOH 2OL3A 3T1WA 1CXKA 1KCRL 1KJVB 1YNTB 3W82A 4MAUH 3OGCA 5D2NA 4UNVA 4P3DB 5JUEL 2DB8A 3O11B 2O26U 4UT7L 2APBA 3TP4A 4P5MA 1UWXH 4W70A 3V0VA 3IVKB 2I9LB 1P1ZA 4JAMB 4F7PA 3IS0X 1DSFH 1QD0A 5FCUL 1X5FA 3GKZA 4R4FH 2DQTL 1N6QH 1S7SA 3CSBA 3U9UB 5DJYB 4PRHB 1DQLL 1FG2A 1H8SA 4UQ2B 2R0LL 2BNRA 3UO1L 3C9NA 3WUWA 3DUUB 4XCNA 2E7LA 4OSUH 4HZLA 3O6FD 4PUBL 3JWOH 3LKSA 4KK6D 3GK8H 1C12B 5CMAB 4MSWA 1R3HB 3IDMB 2R8SH 5KN5A 4DN4H 1F4XH 2WNGA 5ICZA 1GHFH 4KDWA 5FO7B 1QLRA 4M6AA 4MMZC 3VRJB 4C55A 3QO1A 2NX5D 4MB3A 4F9PA 5ID0A 2CD0A 1HHKB 1OF2B 2P5WD 5EZIH 2OL3L 3ZTJH 5J9PA 4Q9QH 4L4VE 4PIRF 5E8NA 5KOMC 3AU1B 2F8XC 1U3HD 3JWDC 3OJDB 5TE4L 1R5IA 4JFFA 1OY3B 1G9EA 1MRFH 3K8KA 3TYFA 4H0GA 2V2WB 4LLWA 1GAFL 5BMFH 3O9WA 4NKIL 1KYOK 5HHOE 2WUBH 3JXAA 1FRGH 4LAQL 1BBJA 3QCUH 5C3LD 2ZP0T 4YR6A 3F7VA 1HDMB 2VJXA 1Q1JH 1S5IH 1Y18B 2NY7L 4EI5A 4N5EC 2BC4B 5GZNC 3BKYH 4OZGE 4R4BB 3MLXH 3VXMD 2EYTB 3SGJA 1SQ2N 4QRUB 5BRZB 4YXHH 5JR1L 4NRZA 5HTSA 5F3BA 4EI6A 2VIRA 4WDIB 3GRWH 4NZUH 1FNSH 3E6FB 5FKAB 4AEIL 1UH3A 2EDKA 5ITBH 4HHAB 1BGXH 2XTLA 3SDAD 5TDPA 3TZVA 1XR9B 5DUML 3ARFC 4FQLL 4P4KB 4QO1A 3VXNA 2IWGA 1RZGA 3VI3F 5IHZB 3VXPA 1CLZH 4FG6C 5IMOA 1I3GL 4NRXB 2IPKA 3P4OB 3W9EB 1NGYA 2D2OA 4Z18A 1QKZL 4JQVC 3O8XD 5F88B 1NBZA 4RFNB 4M3KB 3MRBA 4GAFB 5A1AA 3F6IA 4KMLB 4J3OC 5IMKB 4JPVL 2Q20A 1QSZA 5I15L 3T77B 3UTSD 3OKKB 4YC2B 3TFKC 2F5BH 4XBEL 1B2WH 4NIKB 5C07B 3G04B 1JWMB 4ZO7A 2DQDL 3L6FA 5MEQA 5DYOA 1BZQK 4OQTH 4PRIE 4XT1C 1UH2A 4X0KB 3FFCD 2JJTA